BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002F12

Length=542
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

sp|Q53UH5.1|DUSKY_IPOPU  RecName: Full=Anthocyanidin 3-O-glucosid...    350   1e-116   Ipomoea purpurea
sp|Q53UH4.1|DUSKY_IPONI  RecName: Full=Anthocyanidin 3-O-glucosid...    350   1e-116   Ipomoea nil [qian niu]
dbj|BAD95885.1|  glucosyltransferase                                    350   2e-116   Ipomoea nil [qian niu]
dbj|BAD95884.1|  glucosyltransferase                                    350   2e-116   Ipomoea nil [qian niu]
gb|AHJ60266.1|  anthocyanidin 3-O-glucoside-2''-O-glucosyltransfe...    349   6e-116   Ipomoea purpurea
gb|ABL74480.1|  glucosyltransferase                                     325   2e-106   Ipomoea batatas [batate]
ref|XP_006449435.1|  hypothetical protein CICLE_v10015186mg             212   8e-63    Citrus clementina [clementine]
ref|XP_006467704.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    210   5e-62    
ref|XP_002522508.1|  UDP-glucosyltransferase, putative                  207   4e-61    Ricinus communis
ref|XP_006449434.1|  hypothetical protein CICLE_v10017784mg             206   2e-60    Citrus clementina [clementine]
ref|XP_008245371.1|  PREDICTED: LOW QUALITY PROTEIN: anthocyanidi...    203   2e-59    Prunus mume [ume]
ref|XP_004499897.1|  PREDICTED: UDP-glycosyltransferase 79B3-like       201   8e-59    Cicer arietinum [garbanzo]
gb|KHN11172.1|  UDP-glycosyltransferase 79B3                            199   9e-59    Glycine soja [wild soybean]
ref|XP_004485850.1|  PREDICTED: UDP-glycosyltransferase 79B3-like       201   1e-58    Cicer arietinum [garbanzo]
gb|KJB68176.1|  hypothetical protein B456_010G2301002                   199   1e-58    Gossypium raimondii
ref|XP_003593675.1|  Anthocyanidin 3-O-glucosyltransferase              200   3e-58    Medicago truncatula
ref|XP_003530810.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    199   7e-58    
ref|XP_010111152.1|  UDP-glycosyltransferase                            197   3e-57    Morus notabilis
gb|KJB68177.1|  hypothetical protein B456_010G230200                    196   6e-57    Gossypium raimondii
ref|XP_007025500.1|  UDP-Glycosyltransferase superfamily protein        196   7e-57    
ref|XP_003543300.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    196   1e-56    Glycine max [soybeans]
ref|XP_007213494.1|  hypothetical protein PRUPE_ppa022356mg             196   1e-56    
ref|XP_007132682.1|  hypothetical protein PHAVU_011G115700g             196   1e-56    Phaseolus vulgaris [French bean]
gb|KJB62832.1|  hypothetical protein B456_009G439200                    195   2e-56    Gossypium raimondii
gb|KDP21029.1|  hypothetical protein JCGZ_21500                         195   2e-56    Jatropha curcas
ref|XP_004304716.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    195   3e-56    Fragaria vesca subsp. vesca
ref|XP_010035826.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    194   4e-56    Eucalyptus grandis [rose gum]
ref|XP_010035825.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    194   6e-56    Eucalyptus grandis [rose gum]
gb|KDO77743.1|  hypothetical protein CISIN_1g039043mg                   194   7e-56    Citrus sinensis [apfelsine]
ref|XP_007025501.1|  UDP-Glycosyltransferase superfamily protein        193   1e-55    
ref|XP_003607531.1|  Glucosyltransferase                                193   1e-55    Medicago truncatula
gb|ACU24192.1|  unknown                                                 193   1e-55    Glycine max [soybeans]
gb|KHN36711.1|  UDP-glycosyltransferase 79B6                            193   2e-55    Glycine soja [wild soybean]
gb|KJB68179.1|  hypothetical protein B456_010G230400                    193   2e-55    Gossypium raimondii
gb|KHN27959.1|  UDP-glycosyltransferase 79B3                            192   2e-55    Glycine soja [wild soybean]
ref|XP_003540412.2|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    193   2e-55    Glycine max [soybeans]
ref|XP_011045872.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    192   2e-55    Populus euphratica
gb|AES89730.2|  UDP-glucosyltransferase family protein                  191   8e-55    Medicago truncatula
ref|XP_010262362.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    191   8e-55    Nelumbo nucifera [Indian lotus]
gb|KJB68394.1|  hypothetical protein B456_010G242800                    191   1e-54    Gossypium raimondii
ref|XP_010277785.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    190   2e-54    Nelumbo nucifera [Indian lotus]
gb|ADV71366.1|  glycosyltransferase GT10J15                             190   2e-54    Pueraria montana var. lobata [kudzu]
ref|XP_003539949.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    190   2e-54    Glycine max [soybeans]
gb|KHN07772.1|  UDP-glycosyltransferase 79B6                            190   2e-54    Glycine soja [wild soybean]
ref|XP_003526249.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    190   2e-54    
ref|XP_008465522.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    190   3e-54    Cucumis melo [Oriental melon]
ref|XP_004487585.1|  PREDICTED: UDP-glycosyltransferase 79B9-like       189   3e-54    Cicer arietinum [garbanzo]
ref|XP_007149718.1|  hypothetical protein PHAVU_005G0935001g            182   3e-54    Phaseolus vulgaris [French bean]
ref|XP_003607533.1|  Glucosyltransferase                                191   5e-54    
ref|XP_007132838.1|  hypothetical protein PHAVU_011G128700g             188   8e-54    Phaseolus vulgaris [French bean]
ref|XP_004487586.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       187   2e-53    Cicer arietinum [garbanzo]
ref|XP_004144610.1|  PREDICTED: UDP-glycosyltransferase 79B1-like       187   2e-53    
ref|XP_006377437.1|  hypothetical protein POPTR_0011s05910g             186   3e-53    
ref|XP_004487588.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       187   4e-53    Cicer arietinum [garbanzo]
gb|KJB68397.1|  hypothetical protein B456_010G243100                    185   6e-53    Gossypium raimondii
gb|KHN41619.1|  UDP-glycosyltransferase 79B6                            186   7e-53    Glycine soja [wild soybean]
ref|XP_004169305.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    186   1e-52    
ref|XP_007213460.1|  hypothetical protein PRUPE_ppa024453mg             185   1e-52    
gb|AFK39154.1|  unknown                                                 185   2e-52    Lotus japonicus
ref|XP_010093489.1|  UDP-glycosyltransferase                            185   2e-52    Morus notabilis
ref|XP_008371703.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    184   2e-52    
ref|XP_007132927.1|  hypothetical protein PHAVU_011G136700g             184   4e-52    Phaseolus vulgaris [French bean]
ref|XP_008349217.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    184   4e-52    
ref|XP_004487587.1|  PREDICTED: UDP-glycosyltransferase 79B1-like       183   5e-52    Cicer arietinum [garbanzo]
ref|XP_007149722.1|  hypothetical protein PHAVU_005G093600g             183   8e-52    Phaseolus vulgaris [French bean]
ref|XP_008383670.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    182   1e-51    Malus domestica [apple tree]
ref|XP_003596667.1|  Anthocyanidin 3-O-glucosyltransferase              182   2e-51    
gb|AES66918.2|  UDP-glucosyltransferase family protein                  182   2e-51    Medicago truncatula
ref|XP_003540019.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    182   3e-51    Glycine max [soybeans]
ref|XP_010093983.1|  UDP-glycosyltransferase                            181   3e-51    
ref|XP_004505528.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       181   4e-51    Cicer arietinum [garbanzo]
ref|XP_004487584.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       180   9e-51    Cicer arietinum [garbanzo]
ref|XP_006593292.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    179   1e-50    
ref|XP_003596676.1|  Anthocyanidin 3-O-glucosyltransferase              178   2e-50    
ref|XP_010666234.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    179   2e-50    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009352834.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    180   2e-50    Pyrus x bretschneideri [bai li]
ref|XP_009353146.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    179   2e-50    Pyrus x bretschneideri [bai li]
ref|XP_004307624.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    179   3e-50    Fragaria vesca subsp. vesca
ref|XP_008455548.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    173   3e-50    
gb|AES66927.2|  UDP-glucosyltransferase family protein                  178   5e-50    Medicago truncatula
ref|XP_003596675.1|  Anthocyanidin 3-O-glucosyltransferase              178   7e-50    Medicago truncatula
gb|AFK34819.1|  unknown                                                 178   7e-50    Medicago truncatula
gb|KHN27960.1|  UDP-glycosyltransferase 79B3                            178   1e-49    Glycine soja [wild soybean]
ref|XP_004487589.1|  PREDICTED: UDP-glycosyltransferase 79B1-like       177   2e-49    Cicer arietinum [garbanzo]
ref|XP_003543299.2|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    177   2e-49    Glycine max [soybeans]
ref|XP_008371430.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    176   3e-49    Malus domestica [apple tree]
ref|XP_007132948.1|  hypothetical protein PHAVU_011G138500g             176   4e-49    Phaseolus vulgaris [French bean]
gb|AES66921.2|  UDP-glucosyltransferase family protein                  175   6e-49    Medicago truncatula
ref|XP_011087015.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    175   8e-49    Sesamum indicum [beniseed]
ref|XP_003596670.1|  Anthocyanidin 3-O-glucosyltransferase              175   9e-49    
gb|KHN36713.1|  UDP-glycosyltransferase 79B6                            174   1e-48    Glycine soja [wild soybean]
gb|AES66919.2|  UDP-glucosyltransferase family protein                  173   3e-48    Medicago truncatula
ref|XP_007132923.1|  hypothetical protein PHAVU_011G136400g             174   3e-48    Phaseolus vulgaris [French bean]
emb|CDO96715.1|  unnamed protein product                                173   3e-48    Coffea canephora [robusta coffee]
ref|XP_010245594.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    174   3e-48    
ref|XP_003596668.1|  Anthocyanidin 3-O-glucosyltransferase              174   3e-48    
ref|XP_008455479.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    173   5e-48    Cucumis melo [Oriental melon]
ref|XP_003596666.1|  UDP rhamnose-anthocyanidin-3-glucoside rhamn...    171   5e-48    
gb|EYU28028.1|  hypothetical protein MIMGU_mgv1a006231mg                172   1e-47    Erythranthe guttata [common monkey flower]
ref|XP_003596671.1|  Anthocyanidin 3-O-glucosyltransferase              172   1e-47    Medicago truncatula
ref|XP_007149716.1|  hypothetical protein PHAVU_005G093300g             172   2e-47    Phaseolus vulgaris [French bean]
ref|XP_007132949.1|  hypothetical protein PHAVU_011G138600g             171   2e-47    Phaseolus vulgaris [French bean]
ref|XP_004144602.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       169   1e-46    Cucumis sativus [cucumbers]
emb|CBI20243.3|  unnamed protein product                                167   2e-46    Vitis vinifera
ref|XP_008455481.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    169   2e-46    Cucumis melo [Oriental melon]
ref|XP_010686377.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    169   2e-46    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007212397.1|  hypothetical protein PRUPE_ppa016365mg             164   6e-46    
ref|XP_009352835.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    168   6e-46    
emb|CDY14339.1|  BnaA10g07160D                                          160   1e-45    Brassica napus [oilseed rape]
ref|XP_002285222.1|  PREDICTED: UDP-glycosyltransferase 79B9-like       166   2e-45    Vitis vinifera
emb|CBI20245.3|  unnamed protein product                                165   3e-45    Vitis vinifera
emb|CDY20207.1|  BnaC09g30320D                                          159   3e-45    Brassica napus [oilseed rape]
ref|XP_004144600.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       166   3e-45    Cucumis sativus [cucumbers]
ref|XP_010695817.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    166   3e-45    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002866015.1|  UDP-glucose:flavonoid 3-O-glucosyltransferase      166   4e-45    
gb|AFJ52975.1|  UDP-glycosyltransferase 1                               166   4e-45    Linum usitatissimum
ref|XP_009123330.1|  PREDICTED: anthocyanidin 3-O-glucoside 2'''-...    159   4e-45    
ref|XP_010041982.1|  PREDICTED: anthocyanidin 3-O-glucoside 2'''-...    165   5e-45    Eucalyptus grandis [rose gum]
ref|NP_200217.1|  anthocyanidin 3-O-glucoside 2'''-O-xylosyltrans...    165   8e-45    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011465114.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    164   8e-45    Fragaria vesca subsp. vesca
ref|XP_008226430.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       164   2e-44    Prunus mume [ume]
ref|XP_009121268.1|  PREDICTED: anthocyanidin 3-O-glucoside 2'''-...    157   3e-44    
ref|XP_007021620.1|  UDP-Glycosyltransferase superfamily protein        161   4e-44    
ref|XP_009340538.1|  PREDICTED: UDP-glycosyltransferase 79B9-like       163   4e-44    Pyrus x bretschneideri [bai li]
ref|XP_010062848.1|  PREDICTED: anthocyanidin 3-O-glucoside 2'''-...    162   4e-44    Eucalyptus grandis [rose gum]
ref|XP_008226432.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       163   5e-44    Prunus mume [ume]
ref|XP_006281777.1|  hypothetical protein CARUB_v10027945mg             162   9e-44    Capsella rubella
gb|KCW69983.1|  hypothetical protein EUGRSUZ_F03293                     161   1e-43    Eucalyptus grandis [rose gum]
ref|XP_010062847.1|  PREDICTED: anthocyanidin 3-O-glucoside 2'''-...    161   1e-43    Eucalyptus grandis [rose gum]
ref|XP_008455478.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    161   2e-43    Cucumis melo [Oriental melon]
ref|XP_006373006.1|  hypothetical protein POPTR_0017s06940g             160   2e-43    
ref|XP_007021619.1|  UDP-Glycosyltransferase superfamily protein        161   3e-43    
ref|XP_009767952.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    160   4e-43    Nicotiana sylvestris
ref|XP_008386212.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    160   5e-43    
emb|CAN63557.1|  hypothetical protein VITISV_034121                     159   5e-43    Vitis vinifera
ref|XP_004248461.2|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    159   7e-43    Solanum lycopersicum
ref|XP_002282825.3|  PREDICTED: UDP-glycosyltransferase 79B6-like       159   7e-43    Vitis vinifera
ref|XP_007021598.1|  UDP-Glycosyltransferase superfamily protein        159   7e-43    
ref|XP_008350006.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    159   8e-43    
ref|XP_002282717.1|  PREDICTED: UDP-glycosyltransferase 79B9-like       159   9e-43    Vitis vinifera
emb|CDP05961.1|  unnamed protein product                                159   9e-43    Coffea canephora [robusta coffee]
gb|KJB13265.1|  hypothetical protein B456_002G065500                    159   1e-42    Gossypium raimondii
gb|AEM37037.1|  UDP-glucose:flavonoid 3-O-glucosyltransferase 2         159   1e-42    Brassica rapa subsp. oleifera [biennial turnip rape]
ref|XP_007021621.1|  UDP-Glycosyltransferase superfamily protein        159   2e-42    
gb|AEM37036.1|  UDP-glucose:flavonoid 3-O-glucosyltransferase 1         158   3e-42    Brassica rapa subsp. oleifera [biennial turnip rape]
ref|XP_003634640.2|  PREDICTED: UDP-glycosyltransferase 79B9-like       157   3e-42    Vitis vinifera
ref|XP_011464322.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    155   4e-42    Fragaria vesca subsp. vesca
ref|XP_002285228.1|  PREDICTED: UDP-glycosyltransferase 79B9-like       157   6e-42    Vitis vinifera
ref|XP_008386210.1|  PREDICTED: UDP-glycosyltransferase 79B9-like       157   6e-42    Malus domestica [apple tree]
gb|EYU43362.1|  hypothetical protein MIMGU_mgv1a019428mg                156   7e-42    Erythranthe guttata [common monkey flower]
ref|XP_006361070.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    156   9e-42    Solanum tuberosum [potatoes]
emb|CAN63799.1|  hypothetical protein VITISV_026416                     151   1e-41    Vitis vinifera
gb|KJB13261.1|  hypothetical protein B456_002G0654002                   155   1e-41    Gossypium raimondii
ref|XP_009610402.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    156   1e-41    Nicotiana tomentosiformis
ref|XP_006401632.1|  hypothetical protein EUTSA_v10013471mg             156   1e-41    Eutrema salsugineum [saltwater cress]
ref|XP_002316802.1|  glycosyltransferase family protein                 156   1e-41    Populus trichocarpa [western balsam poplar]
ref|XP_010644165.1|  PREDICTED: UDP-glycosyltransferase 79B9-like       155   1e-41    
emb|CAN63555.1|  hypothetical protein VITISV_034119                     155   2e-41    Vitis vinifera
ref|XP_004144601.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       155   2e-41    
gb|KGN43487.1|  hypothetical protein Csa_7G041320                       155   3e-41    Cucumis sativus [cucumbers]
emb|CAN63797.1|  hypothetical protein VITISV_026414                     154   3e-41    Vitis vinifera
ref|XP_004164964.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       155   3e-41    
gb|KCW69984.1|  hypothetical protein EUGRSUZ_F03295                     154   3e-41    Eucalyptus grandis [rose gum]
ref|XP_010260356.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    155   4e-41    Nelumbo nucifera [Indian lotus]
ref|XP_006401633.1|  hypothetical protein EUTSA_v10013535mg             154   6e-41    Eutrema salsugineum [saltwater cress]
ref|XP_006281795.1|  hypothetical protein CARUB_v10027966mg             153   9e-41    Capsella rubella
ref|XP_010520927.1|  PREDICTED: anthocyanidin 3-O-glucoside 2'''-...    154   1e-40    Tarenaya hassleriana [spider flower]
gb|KJB11800.1|  hypothetical protein B456_002G0654001                   153   1e-40    Gossypium raimondii
ref|XP_009340549.1|  PREDICTED: UDP-glycosyltransferase 79B3-like       153   1e-40    
ref|XP_011008292.1|  PREDICTED: anthocyanidin 3-O-glucoside 2'''-...    153   2e-40    Populus euphratica
ref|XP_002866013.1|  glycosyltransferase family protein                 152   2e-40    Arabidopsis lyrata subsp. lyrata
ref|XP_010482811.1|  PREDICTED: anthocyanidin 3-O-glucoside 2'''-...    152   3e-40    Camelina sativa [gold-of-pleasure]
ref|XP_010260530.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    152   3e-40    
gb|KFK30258.1|  hypothetical protein AALP_AA7G237800                    152   4e-40    Arabis alpina [alpine rockcress]
ref|XP_010442978.1|  PREDICTED: UDP-glycosyltransferase 79B6 isof...    151   5e-40    
ref|XP_010442976.1|  PREDICTED: UDP-glycosyltransferase 79B6 isof...    151   7e-40    Camelina sativa [gold-of-pleasure]
ref|NP_194487.1|  UDP-glycosyltransferase 79B3                          151   8e-40    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002867497.1|  glycosyltransferase family protein                 151   8e-40    
ref|XP_010474328.1|  PREDICTED: anthocyanidin 3-O-glucoside 2'''-...    151   8e-40    
emb|CBI20242.3|  unnamed protein product                                149   1e-39    Vitis vinifera
ref|XP_011460590.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    150   2e-39    Fragaria vesca subsp. vesca
ref|XP_010537036.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       149   3e-39    Tarenaya hassleriana [spider flower]
gb|AAL09791.1|  AT4g27560/T29A15_50                                     149   4e-39    Arabidopsis thaliana [mouse-ear cress]
ref|NP_200212.1|  UDP-glycosyltransferase 79B6                          149   4e-39    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011460764.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       149   6e-39    Fragaria vesca subsp. vesca
ref|XP_008355387.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       148   8e-39    
ref|XP_009339314.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       148   9e-39    Pyrus x bretschneideri [bai li]
gb|KDO58530.1|  hypothetical protein CISIN_1g012080mg                   148   1e-38    Citrus sinensis [apfelsine]
ref|XP_006451768.1|  hypothetical protein CICLE_v10008184mg             148   1e-38    Citrus clementina [clementine]
ref|NP_194486.1|  UDP-glycosyltransferase 79B2                          147   1e-38    Arabidopsis thaliana [mouse-ear cress]
emb|CBI20246.3|  unnamed protein product                                147   2e-38    Vitis vinifera
ref|XP_009132454.1|  PREDICTED: UDP-glycosyltransferase 79B6            147   2e-38    Brassica rapa
ref|NP_189604.1|  UDP-glycosyltransferase 79B4                          147   3e-38    Arabidopsis thaliana [mouse-ear cress]
gb|KDP36254.1|  hypothetical protein JCGZ_09819                         147   3e-38    Jatropha curcas
gb|KFK27016.1|  hypothetical protein AALP_AA8G323600                    147   3e-38    Arabis alpina [alpine rockcress]
dbj|BAE99810.1|  putative flavonol 3-O-glucosyltransferase              147   3e-38    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010098447.1|  UDP-glycosyltransferase                            147   3e-38    Morus notabilis
ref|XP_002523261.1|  UDP-glucosyltransferase, putative                  146   4e-38    Ricinus communis
ref|XP_006361401.1|  PREDICTED: anthocyanidin 3-O-glucoside 2'''-...    146   4e-38    
emb|CAN71740.1|  hypothetical protein VITISV_005149                     149   5e-38    Vitis vinifera
ref|NP_179877.1|  UDP-glycosyltransferase 79B8                          145   6e-38    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010448113.1|  PREDICTED: UDP-glycosyltransferase 79B3-like...    146   6e-38    
ref|XP_010442979.1|  PREDICTED: anthocyanidin 3-O-glucoside 2'''-...    145   6e-38    
ref|XP_003527222.1|  PREDICTED: UDP-glycosyltransferase 79B3-like       145   1e-37    Glycine max [soybeans]
ref|XP_010421894.1|  PREDICTED: UDP-glycosyltransferase 79B8-like       145   1e-37    Camelina sativa [gold-of-pleasure]
ref|XP_006289802.1|  hypothetical protein CARUB_v10003406mg             145   1e-37    
gb|KHN13063.1|  UDP-glycosyltransferase 79B3                            145   1e-37    Glycine soja [wild soybean]
ref|XP_010438412.1|  PREDICTED: UDP-glycosyltransferase 79B8            145   1e-37    Camelina sativa [gold-of-pleasure]
ref|XP_010496152.1|  PREDICTED: UDP-glycosyltransferase 79B8-like       145   1e-37    Camelina sativa [gold-of-pleasure]
ref|XP_007213912.1|  hypothetical protein PRUPE_ppa005654mg             144   2e-37    
ref|XP_009132456.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       144   2e-37    Brassica rapa
ref|XP_010433351.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    144   2e-37    Camelina sativa [gold-of-pleasure]
ref|XP_006286630.1|  hypothetical protein CARUB_v10002468mg             144   2e-37    
ref|XP_010446347.1|  PREDICTED: UDP-glycosyltransferase 79B6-like...    144   3e-37    
gb|AAM65481.1|  UDP rhamnose-anthocyanidin-3-glucoside rhamnosylt...    144   3e-37    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010446338.1|  PREDICTED: UDP-glycosyltransferase 79B6-like...    144   4e-37    Camelina sativa [gold-of-pleasure]
ref|XP_002866011.1|  glycosyltransferase family protein                 143   4e-37    Arabidopsis lyrata subsp. lyrata
ref|XP_006397072.1|  hypothetical protein EUTSA_v10028656mg             143   5e-37    Eutrema salsugineum [saltwater cress]
gb|EPS58858.1|  glucosyltransferase                                     142   9e-37    Genlisea aurea
gb|EYU44977.1|  hypothetical protein MIMGU_mgv1a006277mg                142   9e-37    Erythranthe guttata [common monkey flower]
ref|XP_010064901.1|  PREDICTED: anthocyanidin 3-O-glucoside 2'''-...    139   1e-36    Eucalyptus grandis [rose gum]
ref|XP_004166346.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    142   2e-36    
dbj|BAF75891.1|  glucosyltransferase                                    142   2e-36    Dianthus caryophyllus [carnation]
gb|AFJ52978.1|  UDP-glycosyltransferase 1                               142   2e-36    Linum usitatissimum
ref|XP_004146274.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       142   2e-36    Cucumis sativus [cucumbers]
ref|XP_010455340.1|  PREDICTED: UDP-glycosyltransferase 79B8-like       142   2e-36    Camelina sativa [gold-of-pleasure]
gb|KGN57635.1|  hypothetical protein Csa_3G236030                       142   2e-36    Cucumis sativus [cucumbers]
ref|NP_175473.1|  UDP-glycosyltransferase 79B5                          141   3e-36    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010496151.1|  PREDICTED: UDP-glycosyltransferase 79B8-like       141   3e-36    Camelina sativa [gold-of-pleasure]
emb|CDY59372.1|  BnaA08g29640D                                          141   4e-36    Brassica napus [oilseed rape]
ref|XP_006393137.1|  hypothetical protein EUTSA_v10012257mg             141   4e-36    Eutrema salsugineum [saltwater cress]
ref|XP_009107252.1|  PREDICTED: UDP-glycosyltransferase 79B5-like       141   4e-36    Brassica rapa
gb|EYU19000.1|  hypothetical protein MIMGU_mgv1a021196mg                141   4e-36    Erythranthe guttata [common monkey flower]
ref|XP_010430891.1|  PREDICTED: UDP-glycosyltransferase 79B4            137   5e-36    
ref|XP_006287748.1|  hypothetical protein CARUB_v10000959mg             140   5e-36    Capsella rubella
ref|NP_192688.2|  UDP-glycosyltransferase 79B7                          140   6e-36    Arabidopsis thaliana [mouse-ear cress]
gb|AAO42032.1|  unknown protein                                         140   6e-36    Arabidopsis thaliana [mouse-ear cress]
emb|CDY03578.1|  BnaC03g68370D                                          140   7e-36    
ref|XP_008456016.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    140   8e-36    Cucumis melo [Oriental melon]
ref|NP_974524.1|  UDP-glycosyltransferase 79B7                          140   9e-36    Arabidopsis thaliana [mouse-ear cress]
gb|KEH38979.1|  UDP-glucose:flavonoid 3-O-glucosyltransferase, pu...    138   1e-35    Medicago truncatula
ref|XP_010479520.1|  PREDICTED: UDP-glycosyltransferase 79B5            140   1e-35    Camelina sativa [gold-of-pleasure]
ref|XP_009628388.1|  PREDICTED: LOW QUALITY PROTEIN: anthocyanidi...    140   1e-35    
gb|KCW69986.1|  hypothetical protein EUGRSUZ_F03297                     139   1e-35    Eucalyptus grandis [rose gum]
ref|XP_006286772.1|  hypothetical protein CARUB_v10003323mg             139   1e-35    
ref|XP_011082713.1|  PREDICTED: anthocyanidin 3-O-glucoside 2'''-...    139   2e-35    
ref|XP_011082711.1|  PREDICTED: anthocyanidin 3-O-glucoside 2'''-...    139   2e-35    Sesamum indicum [beniseed]
ref|XP_010437932.1|  PREDICTED: UDP-glycosyltransferase 79B8-like       139   2e-35    Camelina sativa [gold-of-pleasure]
ref|XP_002872446.1|  glycosyltransferase family protein                 138   3e-35    
ref|XP_010455377.1|  PREDICTED: UDP-glycosyltransferase 79B8-like       138   3e-35    Camelina sativa [gold-of-pleasure]
emb|CAN73297.1|  hypothetical protein VITISV_028314                     137   3e-35    Vitis vinifera
ref|NP_176672.1|  UDP-glycosyltransferase 79B11                         138   4e-35    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003596801.1|  Pentatricopeptide repeat-containing protein        141   4e-35    
ref|XP_010421892.1|  PREDICTED: UDP-glycosyltransferase 79B8-like       138   4e-35    Camelina sativa [gold-of-pleasure]
ref|XP_006282036.1|  hypothetical protein CARUB_v10028277mg             137   5e-35    
ref|XP_004236775.1|  PREDICTED: anthocyanidin 3-O-glucoside 2'''-...    138   5e-35    Solanum lycopersicum
ref|XP_004236774.1|  PREDICTED: UDP-glycosyltransferase 79B6 isof...    138   5e-35    Solanum lycopersicum
gb|KJB13288.1|  hypothetical protein B456_002G066600                    138   6e-35    Gossypium raimondii
ref|XP_010319271.1|  PREDICTED: UDP-glycosyltransferase 79B8 isof...    138   6e-35    Solanum lycopersicum
ref|XP_004238163.1|  PREDICTED: anthocyanidin 3-O-glucoside 2'''-...    137   7e-35    Solanum lycopersicum
ref|XP_010442973.1|  PREDICTED: UDP-glycosyltransferase 79B9-like       137   8e-35    Camelina sativa [gold-of-pleasure]
ref|XP_006289841.1|  hypothetical protein CARUB_v10003451mg             137   9e-35    
ref|XP_010446317.1|  PREDICTED: UDP-glycosyltransferase 79B9-like       137   9e-35    Camelina sativa [gold-of-pleasure]
ref|XP_010501682.1|  PREDICTED: UDP-glycosyltransferase 79B9-like       134   1e-34    
ref|XP_010437944.1|  PREDICTED: UDP-glycosyltransferase 79B8-like       137   1e-34    Camelina sativa [gold-of-pleasure]
ref|XP_006401636.1|  hypothetical protein EUTSA_v10013536mg             136   1e-34    Eutrema salsugineum [saltwater cress]
ref|XP_006393133.1|  hypothetical protein EUTSA_v10012012mg             136   1e-34    
ref|XP_010455375.1|  PREDICTED: UDP-glycosyltransferase 79B8-like       136   2e-34    Camelina sativa [gold-of-pleasure]
ref|XP_009127123.1|  PREDICTED: UDP-glycosyltransferase 79B10-like      135   4e-34    Brassica rapa
ref|XP_008226433.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       135   4e-34    
ref|XP_010482808.1|  PREDICTED: UDP-glycosyltransferase 79B9            135   4e-34    Camelina sativa [gold-of-pleasure]
ref|NP_200210.1|  UDP-glycosyltransferase 79B9                          135   5e-34    Arabidopsis thaliana [mouse-ear cress]
emb|CDY28802.1|  BnaA02g09940D                                          135   5e-34    Brassica napus [oilseed rape]
ref|XP_004238162.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       135   5e-34    Solanum lycopersicum
ref|XP_010485115.1|  PREDICTED: UDP-glycosyltransferase 79B9-like       131   6e-34    Camelina sativa [gold-of-pleasure]
ref|XP_010502980.1|  PREDICTED: UDP-glycosyltransferase 79B4-like       134   7e-34    
ref|XP_006354894.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       131   7e-34    
gb|EYU28029.1|  hypothetical protein MIMGU_mgv1a006905mg                134   8e-34    Erythranthe guttata [common monkey flower]
ref|XP_006354934.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       134   9e-34    
ref|XP_008226434.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       134   9e-34    
ref|XP_010446327.1|  PREDICTED: UDP-glycosyltransferase 79B9-like       134   1e-33    
ref|XP_009147894.1|  PREDICTED: UDP-glycosyltransferase 79B5-like...    134   1e-33    
gb|KCW69985.1|  hypothetical protein EUGRSUZ_F03296                     132   2e-33    
ref|XP_002891582.1|  glycosyltransferase family protein                 133   3e-33    
ref|XP_011096374.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    133   3e-33    
emb|CDY70505.1|  BnaAnng33940D                                          132   4e-33    
emb|CDY36163.1|  BnaC04g37310D                                          129   5e-33    
emb|CDY43062.1|  BnaA03g12090D                                          131   7e-33    
gb|KFK35925.1|  hypothetical protein AALP_AA4G054400                    132   8e-33    
ref|XP_002888294.1|  glycosyltransferase family protein                 132   8e-33    
ref|XP_009132457.1|  PREDICTED: UDP-glycosyltransferase 79B9-like       131   9e-33    
ref|XP_010674067.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       132   9e-33    
ref|XP_006354953.1|  PREDICTED: anthocyanidin 3-O-glucoside 2'''-...    131   1e-32    
ref|NP_176671.1|  UDP-glycosyltransferase 79B10                         131   1e-32    
ref|XP_006401634.1|  hypothetical protein EUTSA_v10016070mg             129   6e-32    
ref|XP_006393134.1|  hypothetical protein EUTSA_v10011473mg             128   1e-31    
ref|XP_010675464.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       127   2e-31    
emb|CDY65923.1|  BnaCnng49110D                                          127   4e-31    
gb|AFJ52976.1|  UDP-glycosyltransferase 1                               124   3e-30    
ref|XP_009353133.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    120   3e-30    
ref|XP_002888295.1|  predicted protein                                  124   3e-30    
dbj|BAE98680.1|  UDP rhamnose-anthocyanidin-3-glucoside rhamnosyl...    123   7e-30    
emb|CDY65922.1|  BnaCnng49100D                                          123   7e-30    
gb|EPS58859.1|  hypothetical protein M569_15954                         123   9e-30    
emb|CDP05960.1|  unnamed protein product                                123   1e-29    
gb|KJB13260.1|  hypothetical protein B456_002G065300                    122   2e-29    
ref|XP_003593678.1|  Anthocyanidin 3-O-glucosyltransferase              119   2e-29    
emb|CDY36161.1|  BnaC04g37330D                                          118   3e-29    
gb|EPS67374.1|  hypothetical protein M569_07398                         120   6e-29    
gb|AFJ52977.1|  UDP-glycosyltransferase 1                               120   1e-28    
ref|XP_003607534.1|  Anthocyanidin 3-O-glucosyltransferase              115   2e-28    
emb|CBI20248.3|  unnamed protein product                                121   3e-28    
ref|XP_010442975.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       117   1e-27    
gb|KDO40622.1|  hypothetical protein CISIN_1g037721mg                   115   4e-27    
ref|XP_006421028.1|  hypothetical protein CICLE_v10004868mg             115   5e-27    
gb|EYU41034.1|  hypothetical protein MIMGU_mgv1a006102mg                115   6e-27    
ref|NP_001275829.1|  1,6-rhamnosyltransferase                           115   7e-27    
emb|CDY36159.1|  BnaC04g37350D                                          110   8e-27    
gb|KHN28417.1|  UDP-glycosyltransferase 79B3                            114   9e-27    
emb|CAN63798.1|  hypothetical protein VITISV_026415                     112   4e-26    
emb|CDY68468.1|  BnaC03g71890D                                          112   6e-26    
emb|CDY43057.1|  BnaA03g12040D                                          110   2e-25    
emb|CDY43058.1|  BnaA03g12050D                                          110   2e-25    
emb|CDY43844.1|  BnaC03g14770D                                          110   2e-25    
emb|CDY43059.1|  BnaA03g12060D                                          105   3e-25    
ref|XP_010683332.1|  PREDICTED: anthocyanidin 3-O-glucoside 2'''-...    110   4e-25    
ref|XP_007146549.1|  hypothetical protein PHAVU_006G050000g             108   9e-25    
gb|KFK27014.1|  hypothetical protein AALP_AA8G323200                    108   9e-25    
ref|XP_006848503.1|  hypothetical protein AMTR_s00013p00259270          109   1e-24    
ref|XP_007021622.1|  UDP-Glycosyltransferase superfamily protein,...    108   1e-24    
gb|ABO21805.1|  UDP rhamnose:anthocyanidin-3-glucoside rhamnosylt...    108   1e-24    
gb|ABO21830.1|  UDP rhamnose:anthocyanidin-3-glucoside rhamnosylt...    108   1e-24    
gb|ABO21818.1|  UDP rhamnose:anthocyanidin-3-glucoside rhamnosylt...    108   1e-24    
gb|ABO21820.1|  UDP rhamnose:anthocyanidin-3-glucoside rhamnosylt...    108   1e-24    
ref|XP_006367560.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    108   1e-24    
emb|CAA81057.1|  UDP rhamnose: anthocyanidin-3-glucoside rhamnosy...    108   1e-24    
ref|XP_002527371.1|  UDP-glucosyltransferase, putative                  108   2e-24    
gb|ABO21828.1|  UDP rhamnose:anthocyanidin-3-glucoside rhamnosylt...    108   2e-24    
ref|XP_009416585.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    108   2e-24    
sp|Q43716.1|UFOG_PETHY  RecName: Full=Anthocyanidin 3-O-glucosylt...    108   2e-24    
gb|ABO21810.1|  UDP rhamnose:anthocyanidin-3-glucoside rhamnosylt...    108   2e-24    
emb|CAA50376.1|  anthocyanin 3 glucoside: rhamnosyltransferase          108   2e-24    
gb|ABO21809.1|  UDP rhamnose:anthocyanidin-3-glucoside rhamnosylt...    108   2e-24    
ref|XP_004247056.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    107   4e-24    
ref|XP_010683409.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       107   6e-24    
dbj|BAC10994.1|  rhamnosyl transferase                                  107   6e-24    
gb|EPS70335.1|  hypothetical protein M569_04423                         106   1e-23    
ref|XP_009587143.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    106   1e-23    
gb|AAS48512.1|  glucosyl-transferase                                    103   1e-23    
gb|KCW82042.1|  hypothetical protein EUGRSUZ_C03411                     105   2e-23    
ref|XP_010051440.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       105   2e-23    
ref|XP_008778568.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    105   4e-23    
ref|XP_010049449.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       104   4e-23    
gb|AFJ52973.1|  UDP-glycosyltransferase 1                               104   4e-23    
emb|CAN68180.1|  hypothetical protein VITISV_013392                     102   1e-22    
ref|XP_011089649.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    102   2e-22    
ref|XP_010060107.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    102   2e-22    
ref|XP_007156464.1|  hypothetical protein PHAVU_003G288200g             102   3e-22    
ref|XP_010461910.1|  PREDICTED: UDP-glycosyltransferase 79B5-like     99.8    3e-22    
ref|XP_010683331.1|  PREDICTED: UDP-glycosyltransferase 79B9-like       102   3e-22    
ref|XP_010909163.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    102   3e-22    
emb|CBI20247.3|  unnamed protein product                                101   4e-22    
ref|XP_010696239.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    102   5e-22    
gb|KCW59686.1|  hypothetical protein EUGRSUZ_H02446                     101   5e-22    
ref|XP_002309370.1|  hypothetical protein POPTR_0006s19340g             101   8e-22    
ref|XP_010023432.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       101   1e-21    
ref|XP_011017699.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       100   1e-21    
ref|XP_010909266.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    100   1e-21    
ref|XP_010023429.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       100   2e-21    
ref|XP_010061561.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       100   2e-21    
ref|XP_006371492.1|  hypothetical protein POPTR_0019s12250g           97.8    2e-21    
ref|XP_004287583.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       100   2e-21    
ref|NP_199780.1|  UDP-glycosyltransferase 91C1                        99.8    3e-21    
gb|KCW59683.1|  hypothetical protein EUGRSUZ_H02441                   99.8    3e-21    
ref|XP_010535333.1|  PREDICTED: UDP-glycosyltransferase 91C1          99.4    4e-21    
ref|XP_010696238.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...  99.4    4e-21    
ref|XP_009761380.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...  99.8    4e-21    
ref|XP_007156463.1|  hypothetical protein PHAVU_003G288100g           99.0    5e-21    
ref|XP_007204467.1|  hypothetical protein PRUPE_ppa023177mg           97.8    6e-21    
gb|ABR18123.1|  unknown                                               99.0    6e-21    
gb|EYU37211.1|  hypothetical protein MIMGU_mgv1a018729mg              98.6    8e-21    
ref|XP_002865752.1|  UDP-glucoronosyl/UDP-glucosyl transferase fa...  98.6    1e-20    
ref|XP_010049450.1|  PREDICTED: UDP-glycosyltransferase 91C1-like     98.2    1e-20    
ref|XP_009801322.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...  97.8    1e-20    
gb|AHL38585.1|  glycosyltransferase                                   99.8    1e-20    
gb|KDO54147.1|  hypothetical protein CISIN_1g019759mg                 96.7    2e-20    
emb|CDP03925.1|  unnamed protein product                              97.8    2e-20    
gb|KDP41496.1|  hypothetical protein JCGZ_15903                       97.8    2e-20    
ref|XP_010091274.1|  Anthocyanidin 3-O-glucosyltransferase            97.8    2e-20    
gb|KCW82044.1|  hypothetical protein EUGRSUZ_C03414                   97.4    2e-20    
ref|XP_010111557.1|  Anthocyanidin 3-O-glucosyltransferase            97.8    2e-20    
ref|XP_010051441.1|  PREDICTED: UDP-glycosyltransferase 91C1-like     97.4    2e-20    
gb|KHG23094.1|  hypothetical protein F383_29773                       96.7    2e-20    
gb|KDO77744.1|  hypothetical protein CISIN_1g017557mg                 96.3    2e-20    
gb|ABR16053.1|  unknown                                               97.4    2e-20    
gb|AFN53693.1|  pectinacetylesterase                                  98.2    3e-20    
ref|XP_009376199.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...  96.7    4e-20    
gb|KJB42544.1|  hypothetical protein B456_007G157200                  96.7    4e-20    
gb|KHN06911.1|  UDP-glycosyltransferase 91A1                          96.3    5e-20    
gb|AAN40684.1|  UDP-glucosyltransferase                               96.3    5e-20    
ref|XP_003551309.1|  PREDICTED: UDP-glycosyltransferase 91A1-like     96.3    5e-20    
gb|AAR06923.1|  UDP-glycosyltransferase 79A2                          96.3    5e-20    
ref|XP_006451091.1|  hypothetical protein CICLE_v10010307mg           96.3    6e-20    
gb|KJB78823.1|  hypothetical protein B456_013G021100                  95.9    7e-20    
ref|XP_007012764.1|  UDP-Glycosyltransferase superfamily protein      95.9    7e-20    
gb|AFJ53033.1|  UDP-glycosyltransferase 1                             95.9    7e-20    
ref|XP_006836292.1|  hypothetical protein AMTR_s00092p00015830        95.9    9e-20    
ref|XP_010023433.1|  PREDICTED: UDP-glycosyltransferase 91A1-like     95.9    9e-20    
ref|XP_009623232.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...  95.5    9e-20    
gb|KJB78822.1|  hypothetical protein B456_013G021000                  95.5    1e-19    
ref|XP_011084237.1|  PREDICTED: UDP-glycosyltransferase 91C1-like     95.5    1e-19    
ref|XP_003560486.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...  95.5    1e-19    
ref|XP_008242383.1|  PREDICTED: UDP-glycosyltransferase 91C1-like     95.1    1e-19    
ref|XP_007217920.1|  hypothetical protein PRUPE_ppa022969mg           93.6    2e-19    
ref|XP_003552084.1|  PREDICTED: UDP-glycosyltransferase 91A1-like     94.7    2e-19    
gb|KCW59684.1|  hypothetical protein EUGRSUZ_H02443                   94.7    2e-19    
ref|XP_008242170.1|  PREDICTED: UDP-glycosyltransferase 91C1-like     94.7    2e-19    
ref|XP_010023430.1|  PREDICTED: UDP-glycosyltransferase 91A1-like     94.7    2e-19    
ref|XP_004161742.1|  PREDICTED: UDP-glycosyltransferase 91C1-like     94.4    2e-19    
ref|XP_008378603.1|  PREDICTED: UDP-glycosyltransferase 91C1          94.4    3e-19    
ref|XP_009623238.1|  PREDICTED: UDP-glycosyltransferase 91A1-like     94.0    3e-19    
ref|XP_002325254.2|  hypothetical protein POPTR_0018s13720g           93.6    4e-19    
ref|XP_007012761.1|  UDP-Glycosyltransferase superfamily protein      94.7    4e-19    
gb|KJB64112.1|  hypothetical protein B456_010G033600                  94.0    4e-19    
ref|XP_003619079.1|  Anthocyanidin 3-O-glucosyltransferase            94.0    4e-19    
gb|EEE52059.1|  hypothetical protein OsJ_33813                        93.6    5e-19    
gb|AES79436.2|  UDP-glucosyltransferase family protein                93.2    6e-19    
ref|NP_001067852.2|  Os11g0457300                                     93.6    6e-19    
gb|EAY80827.1|  hypothetical protein OsI_36007                        93.6    6e-19    
ref|XP_008807755.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...  93.2    7e-19    
ref|XP_002318358.2|  hypothetical protein POPTR_0012s01130g           93.2    8e-19    
ref|XP_004287416.1|  PREDICTED: UDP-glycosyltransferase 91C1          92.8    8e-19    
ref|XP_010047531.1|  PREDICTED: UDP-glycosyltransferase 91C1-like     92.8    1e-18    
gb|KCW79469.1|  hypothetical protein EUGRSUZ_C00854                   92.4    1e-18    
gb|KFK29804.1|  hypothetical protein AALP_AA7G181400                  92.4    1e-18    
ref|XP_006415140.1|  hypothetical protein EUTSA_v10007607mg           92.0    1e-18    
ref|XP_002533517.1|  UDP-glucosyltransferase, putative                91.7    1e-18    
gb|AAM53963.1|AF515727_1  UDP-glucosyltransferase                     92.4    1e-18    
gb|AAR06918.1|  UDP-glycosyltransferase 91D1                          92.4    2e-18    
ref|XP_004173968.1|  PREDICTED: UDP-glycosyltransferase 91C1-like     89.4    2e-18    
ref|XP_003623218.1|  Anthocyanidin 3-O-glucosyltransferase            92.8    2e-18    
ref|XP_010047532.1|  PREDICTED: UDP-glycosyltransferase 91C1-like     92.0    2e-18    
ref|XP_010091273.1|  Anthocyanidin 3-O-glucosyltransferase            92.0    2e-18    
gb|KCW79477.1|  hypothetical protein EUGRSUZ_C00864                   91.7    2e-18    
emb|CDX73276.1|  BnaC05g28300D                                        91.7    2e-18    
ref|XP_010683330.1|  PREDICTED: UDP-glycosyltransferase 79B6-like...  91.7    2e-18    
ref|XP_007012766.1|  UDP-Glycosyltransferase superfamily protein      92.0    2e-18    
ref|XP_010683329.1|  PREDICTED: UDP-glycosyltransferase 79B6-like...  91.7    2e-18    
gb|KJB54416.1|  hypothetical protein B456_009G033300                  91.3    2e-18    
ref|XP_010047534.1|  PREDICTED: UDP-glycosyltransferase 91C1-like     91.7    2e-18    
ref|XP_002509496.1|  UDP-glucosyltransferase, putative                91.7    3e-18    
ref|XP_007144190.1|  hypothetical protein PHAVU_007G135800g           91.3    3e-18    
ref|XP_004288528.1|  PREDICTED: UDP-glycosyltransferase 91A1-like     91.3    4e-18    
gb|KEH20104.1|  UDP-glucosyltransferase family protein                91.3    4e-18    
ref|XP_008440526.1|  PREDICTED: UDP-glycosyltransferase 91A1-like     91.3    4e-18    
ref|XP_006846035.1|  hypothetical protein AMTR_s00155p00094050        90.9    5e-18    
gb|KEH23150.1|  UDP-glucosyltransferase family protein                90.5    5e-18    
gb|KHN22341.1|  UDP-glycosyltransferase 91A1                          87.4    5e-18    
ref|XP_008440527.1|  PREDICTED: UDP-glycosyltransferase 91A1-like     90.5    5e-18    
dbj|BAN91400.1|  flavonol 3-O-glucoside (1->6) rhamnosyltransferase   89.0    6e-18    
ref|XP_006353157.1|  PREDICTED: UDP-glycosyltransferase 91A1-like     90.5    6e-18    
gb|AFK37289.1|  unknown                                               90.5    6e-18    
gb|ABC47323.1|  UDP-glucosyltransferase                               87.4    7e-18    
ref|XP_010440988.1|  PREDICTED: UDP-glycosyltransferase 91C1-like     90.5    7e-18    
ref|XP_003593144.1|  Glucosyltransferase                              90.5    7e-18    
ref|XP_004496085.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...  90.1    8e-18    
ref|XP_003556320.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...  90.1    8e-18    
ref|XP_002533518.1|  UDP-glucosyltransferase, putative                90.1    9e-18    
emb|CDY67347.1|  BnaC03g71870D                                        87.8    9e-18    
ref|XP_004250158.1|  PREDICTED: UDP-glycosyltransferase 91A1-like     90.1    9e-18    
ref|XP_009151459.1|  PREDICTED: UDP-glycosyltransferase 91C1-like     89.7    1e-17    
ref|XP_004143545.1|  PREDICTED: UDP-glycosyltransferase 91A1-like     89.7    1e-17    
ref|XP_009361645.1|  PREDICTED: UDP-glycosyltransferase 91C1-like     89.7    1e-17    
gb|ABA93458.1|  Flavonol 3-O-glucosyltransferase, putative, expre...  89.7    1e-17    
ref|XP_002315125.2|  hypothetical protein POPTR_0010s18980g           89.7    1e-17    
ref|XP_010442438.1|  PREDICTED: UDP-glycosyltransferase 91C1          89.7    1e-17    
dbj|BAJ85176.1|  predicted protein                                    89.4    1e-17    
ref|XP_010277529.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...  89.7    1e-17    
gb|KDP29778.1|  hypothetical protein JCGZ_18713                       89.4    2e-17    
ref|XP_007047762.1|  UDP-Glycosyltransferase superfamily protein,...  89.7    2e-17    
ref|XP_006282295.1|  hypothetical protein CARUB_v10028581mg           89.4    2e-17    
ref|XP_003593142.1|  Glucosyltransferase                              89.4    2e-17    
ref|XP_010938322.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...  89.4    2e-17    
ref|XP_009361641.1|  PREDICTED: UDP-glycosyltransferase 91C1-like     89.0    2e-17    
ref|XP_009615005.1|  PREDICTED: UDP-glycosyltransferase 91A1-like     89.4    2e-17    
ref|XP_009768273.1|  PREDICTED: UDP-glycosyltransferase 91A1-like     89.0    2e-17    
gb|KCW79472.1|  hypothetical protein EUGRSUZ_C00857                   89.0    2e-17    
ref|XP_010095306.1|  UDP-glycosyltransferase 91C1                     88.2    2e-17    
gb|KJB54425.1|  hypothetical protein B456_009G033400                  90.1    2e-17    
ref|XP_008354446.1|  PREDICTED: UDP-glycosyltransferase 91C1-like     89.0    2e-17    
ref|XP_010482257.1|  PREDICTED: UDP-glycosyltransferase 91C1-like...  89.0    2e-17    
ref|XP_010938324.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...  89.0    2e-17    
ref|XP_011015214.1|  PREDICTED: LOW QUALITY PROTEIN: putative UDP...  89.0    2e-17    
ref|XP_006586521.1|  PREDICTED: UDP-glycosyltransferase 91A1-like     85.5    2e-17    
ref|XP_010050451.1|  PREDICTED: UDP-glycosyltransferase 91C1-like     89.4    2e-17    
emb|CDP00929.1|  unnamed protein product                              89.0    2e-17    
ref|XP_010680364.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...  89.0    2e-17    
ref|XP_006836294.1|  hypothetical protein AMTR_s00092p00017910        89.0    3e-17    
ref|XP_009351087.1|  PREDICTED: UDP-glycosyltransferase 91C1-like     89.0    3e-17    
ref|NP_001275524.1|  anthocyanidin 3-O-glucosyltransferase-like       88.6    3e-17    



>sp|Q53UH5.1|DUSKY_IPOPU RecName: Full=Anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase; 
AltName: Full=3-O-glucoside-2''-O-glucosyltransferase; 
Short=Ip3GGT; AltName: Full=Protein dusky; Short=Dy [Ipomoea 
purpurea]
 dbj|BAD95882.1| glucosyltransferase [Ipomoea purpurea]
Length=459

 Score =   350 bits (899),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 168/168 (100%), Positives = 168/168 (100%), Gaps = 0/168 (0%)
 Frame = +2

Query  38   MGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLI  217
            MGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLI
Sbjct  1    MGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLI  60

Query  218  SFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTH  397
            SFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTH
Sbjct  61   SFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTH  120

Query  398  WLPSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
            WLPSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP
Sbjct  121  WLPSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  168



>sp|Q53UH4.1|DUSKY_IPONI RecName: Full=Anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase; 
AltName: Full=3-O-glucoside-2''-O-glucosyltransferase; 
Short=In3GGT; AltName: Full=Protein dusky; Short=Dy [Ipomoea 
nil]
 dbj|BAD95881.1| glucosyltransferase [Ipomoea nil]
 dbj|BAD95883.1| glucosyltransferase [Ipomoea nil]
Length=459

 Score =   350 bits (899),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 168/168 (100%), Positives = 168/168 (100%), Gaps = 0/168 (0%)
 Frame = +2

Query  38   MGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLI  217
            MGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLI
Sbjct  1    MGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLI  60

Query  218  SFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTH  397
            SFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTH
Sbjct  61   SFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTH  120

Query  398  WLPSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
            WLPSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP
Sbjct  121  WLPSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  168



>dbj|BAD95885.1| glucosyltransferase [Ipomoea nil]
Length=464

 Score =   350 bits (899),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 168/168 (100%), Positives = 168/168 (100%), Gaps = 0/168 (0%)
 Frame = +2

Query  38   MGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLI  217
            MGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLI
Sbjct  1    MGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLI  60

Query  218  SFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTH  397
            SFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTH
Sbjct  61   SFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTH  120

Query  398  WLPSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
            WLPSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP
Sbjct  121  WLPSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  168



>dbj|BAD95884.1| glucosyltransferase [Ipomoea nil]
Length=464

 Score =   350 bits (898),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 168/168 (100%), Positives = 168/168 (100%), Gaps = 0/168 (0%)
 Frame = +2

Query  38   MGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLI  217
            MGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLI
Sbjct  1    MGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLI  60

Query  218  SFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTH  397
            SFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTH
Sbjct  61   SFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTH  120

Query  398  WLPSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
            WLPSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP
Sbjct  121  WLPSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  168



>gb|AHJ60266.1| anthocyanidin 3-O-glucoside-2''-O-glucosyltransferase [Ipomoea 
purpurea]
Length=459

 Score =   349 bits (895),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 167/168 (99%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = +2

Query  38   MGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLI  217
            MGSQA TYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLI
Sbjct  1    MGSQAATYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLI  60

Query  218  SFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTH  397
            SFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTH
Sbjct  61   SFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTH  120

Query  398  WLPSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
            WLPSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP
Sbjct  121  WLPSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  168



>gb|ABL74480.1| glucosyltransferase [Ipomoea batatas]
Length=459

 Score =   325 bits (832),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 154/168 (92%), Positives = 160/168 (95%), Gaps = 0/168 (0%)
 Frame = +2

Query  38   MGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLI  217
            MGSQATT+HMAMYPWFGVGHLT FFRLANKLA KGHRISFLIPKNTQSKL SFNLHPHL+
Sbjct  1    MGSQATTHHMAMYPWFGVGHLTAFFRLANKLASKGHRISFLIPKNTQSKLASFNLHPHLV  60

Query  218  SFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTH  397
            SFVPI VPSIPGLPPGAETTSDVPF STHLLMEAMDKTQ DIEIILK+L+VDVVF+DFTH
Sbjct  61   SFVPITVPSIPGLPPGAETTSDVPFSSTHLLMEAMDKTQTDIEIILKNLEVDVVFFDFTH  120

Query  398  WLPSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
            WLP LARKIGIKSVFYSTISPLMHG+ALSPERRV GKQLTEADMMKAP
Sbjct  121  WLPGLARKIGIKSVFYSTISPLMHGFALSPERRVAGKQLTEADMMKAP  168



>ref|XP_006449435.1| hypothetical protein CICLE_v10015186mg [Citrus clementina]
 gb|ESR62675.1| hypothetical protein CICLE_v10015186mg [Citrus clementina]
Length=458

 Score =   212 bits (539),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 97/160 (61%), Positives = 126/160 (79%), Gaps = 0/160 (0%)
 Frame = +2

Query  62   HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVP  241
            H+AMYPWF +GHLT +  ++NKLA +GH+ISF++P NTQ+K E FNLH HLI+F+PI VP
Sbjct  7    HIAMYPWFAMGHLTSYLHISNKLAERGHKISFILPTNTQTKFEPFNLHKHLITFIPITVP  66

Query  242  SIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARK  421
             + GLP G ETT+DVPFP   LLM AMD T+  IE I++D+K ++VF+DFT+WLPSLARK
Sbjct  67   CVDGLPSGTETTTDVPFPLHPLLMTAMDLTEPAIEAIVRDIKPNIVFFDFTYWLPSLARK  126

Query  422  IGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
            +GIKS+ + TISP   GY LSPER+   K LTEAD+++ P
Sbjct  127  LGIKSIAFVTISPATVGYLLSPERKFPDKVLTEADLLQPP  166



>ref|XP_006467704.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Citrus sinensis]
Length=458

 Score =   210 bits (534),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 95/160 (59%), Positives = 126/160 (79%), Gaps = 0/160 (0%)
 Frame = +2

Query  62   HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVP  241
            H+AMYPWF +GHLT +  ++NKLA +GH+ISF++P NT +K E FNLH HL++F+PI VP
Sbjct  7    HIAMYPWFAMGHLTSYLHISNKLAERGHKISFILPTNTHTKFEPFNLHKHLVTFIPITVP  66

Query  242  SIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARK  421
             + GLP G ETT+DVPFP   LLM AMD T+  IE I++D+K ++VF+DFT+WLPSLARK
Sbjct  67   CVDGLPSGTETTTDVPFPLHPLLMTAMDLTEPAIEAIVRDIKPNIVFFDFTYWLPSLARK  126

Query  422  IGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
            +GIKS+ + TISP   GY LSPER++  K LTEAD+++ P
Sbjct  127  LGIKSIAFVTISPATVGYLLSPERKLRDKVLTEADLLQPP  166



>ref|XP_002522508.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF39808.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=457

 Score =   207 bits (528),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 98/168 (58%), Positives = 125/168 (74%), Gaps = 2/168 (1%)
 Frame = +2

Query  38   MGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLI  217
            MG +  T+H+ MYPWF +GHLT F  L+NKLA +GH+ISFL+P  T  K + FNLHP LI
Sbjct  1    MGEE--TFHIVMYPWFALGHLTSFLHLSNKLAERGHKISFLLPSKTIKKFQPFNLHPDLI  58

Query  218  SFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTH  397
             F+P+ VP + GLPPG+ETT+DVPF    LLM AMD T++ IE  L +LK + VF+DFTH
Sbjct  59   IFIPVTVPHVDGLPPGSETTTDVPFSLHSLLMTAMDLTESVIEFHLTNLKPNFVFFDFTH  118

Query  398  WLPSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
            WLP+L RK+G+KSV Y TISP   GY +SPER+++ K LT AD+MK P
Sbjct  119  WLPALCRKLGVKSVHYCTISPATVGYLISPERKLLEKSLTAADLMKPP  166



>ref|XP_006449434.1| hypothetical protein CICLE_v10017784mg [Citrus clementina]
 gb|ESR62674.1| hypothetical protein CICLE_v10017784mg [Citrus clementina]
Length=458

 Score =   206 bits (523),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 100/168 (60%), Positives = 124/168 (74%), Gaps = 2/168 (1%)
 Frame = +2

Query  38   MGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLI  217
            MGS+  T+H+AMYPWF +GHLT F  +ANKLA +GHRISFL+P    +K E  NLH  LI
Sbjct  1    MGSE--TFHIAMYPWFAMGHLTPFLHIANKLAERGHRISFLLPAKAITKFEPSNLHRDLI  58

Query  218  SFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTH  397
            +F+P+ VP + GLPPGAETT+DVPFP   LLM AMD T+  IE +L+ LK D VF+DFTH
Sbjct  59   TFIPVSVPRVDGLPPGAETTNDVPFPLHPLLMTAMDLTEPAIESVLRRLKPDFVFFDFTH  118

Query  398  WLPSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
            WLP LARK GIKSV Y  ISP   GY LSPER++  + LT+ D+++ P
Sbjct  119  WLPPLARKFGIKSVLYCIISPATIGYLLSPERKLRERTLTDNDLLRPP  166



>ref|XP_008245371.1| PREDICTED: LOW QUALITY PROTEIN: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Prunus mume]
Length=456

 Score =   203 bits (517),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 99/164 (60%), Positives = 122/164 (74%), Gaps = 2/164 (1%)
 Frame = +2

Query  56   TYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIV  235
            T H+AMYPWFG+GHLT F  ++NKLA +GHRISF  P   Q KLE+FNLH H ISF+PI 
Sbjct  5    TLHIAMYPWFGMGHLTSFLHISNKLAERGHRISFFSPSKVQQKLEAFNLHSHRISFIPID  64

Query  236  VPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLA  415
            VP + GLPPG ETT+DVPFP   LL+ AMD T+  IE  L +L+ + VF+DFTHWLP+L 
Sbjct  65   VPHVDGLPPGTETTADVPFPLHSLLVTAMDLTRPAIEQALCELRPNFVFFDFTHWLPALL  124

Query  416  RK--IGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
             K  IGIKSV Y TISP   G+ +SPER+++ K LTEAD+M+ P
Sbjct  125  HKLDIGIKSVHYCTISPATVGFLISPERKLLEKSLTEADLMEPP  168



>ref|XP_004499897.1| PREDICTED: UDP-glycosyltransferase 79B3-like [Cicer arietinum]
 gb|AGU14119.1| UDP-glycosyltransferase [Cicer arietinum]
Length=458

 Score =   201 bits (512),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 94/164 (57%), Positives = 126/164 (77%), Gaps = 0/164 (0%)
 Frame = +2

Query  50   ATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVP  229
            A  +H+AMYPWF +GHLT +  ++NKLA +GH+ISF IPKNT SKLE FNLHP+LISF+P
Sbjct  3    ANIFHVAMYPWFALGHLTSYLHISNKLAERGHKISFFIPKNTISKLEHFNLHPNLISFIP  62

Query  230  IVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPS  409
            I +P + GLP G+ETT+D+PF    LLM AMD T+  IE  L++L+  +VF+DFT+WLP+
Sbjct  63   ITIPHVDGLPLGSETTADLPFSLHSLLMTAMDLTEPIIEDSLRELRPHMVFFDFTYWLPA  122

Query  410  LARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
            LA ++GIK++ Y TISP   GY +SPER++  K LTEAD++  P
Sbjct  123  LACQLGIKALHYCTISPATVGYLISPERKLHEKSLTEADLINPP  166



>gb|KHN11172.1| UDP-glycosyltransferase 79B3 [Glycine soja]
Length=383

 Score =   199 bits (507),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 99/169 (59%), Positives = 127/169 (75%), Gaps = 3/169 (2%)
 Frame = +2

Query  38   MGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLI  217
            M S  + +H+AMYPWF +GHLT F  ++NKLA +GH+ISFL+PKNT  +L  FNLHPHLI
Sbjct  3    MSSNTSLFHVAMYPWFALGHLTSFLHISNKLAERGHKISFLMPKNTIPRLSHFNLHPHLI  62

Query  218  SFVPIVVPSIPGLPPGAETTSDVPFPSTH-LLMEAMDKTQNDIEIILKDLKVDVVFYDFT  394
             FVPI VP + GLP G+ETTSD+P  S H LLM AMD T+  IE  LK LK  +VF+DFT
Sbjct  63   FFVPITVPHVDGLPLGSETTSDLPNYSKHSLLMTAMDLTEPVIETCLKHLKPHMVFFDFT  122

Query  395  HWLPSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQ--LTEADMMK  535
            HWLP+LA K+GIK++ Y TISP   GY +SPER+++ ++  LTEAD++ 
Sbjct  123  HWLPALACKLGIKALHYCTISPATVGYLISPERKLLLEKNSLTEADLIN  171



>ref|XP_004485850.1| PREDICTED: UDP-glycosyltransferase 79B3-like [Cicer arietinum]
 gb|AGU14087.1| UDP-glycosyltransferase [Cicer arietinum]
Length=458

 Score =   201 bits (512),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 94/164 (57%), Positives = 127/164 (77%), Gaps = 0/164 (0%)
 Frame = +2

Query  50   ATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVP  229
            A  +H+AMYPWF +GHLT +  ++NKLA +GH+ISFL+PKNT SKLE FNLHP+LISF+P
Sbjct  3    ANIFHVAMYPWFALGHLTSYLHISNKLAERGHKISFLMPKNTISKLEHFNLHPNLISFIP  62

Query  230  IVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPS  409
            I +P + GLP G+ETT+D+PF    LLM AMD T+  IE  L++L+  +VF+DFT+WLP+
Sbjct  63   ITIPHVHGLPLGSETTADLPFSLHSLLMTAMDLTEPIIEDSLRELRPHMVFFDFTYWLPA  122

Query  410  LARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
            LA ++GIK++ Y TISP   GY +SPER++  K LTEAD++  P
Sbjct  123  LACQLGIKALHYCTISPATVGYLISPERKLHEKSLTEADLINPP  166



>gb|KJB68176.1| hypothetical protein B456_010G2301002, partial [Gossypium raimondii]
Length=371

 Score =   199 bits (505),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 92/162 (57%), Positives = 121/162 (75%), Gaps = 0/162 (0%)
 Frame = +2

Query  56   TYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIV  235
            ++H+AMYPWF +GH+T +  +ANKLA +GH+ISF +P  TQ K+E+FNLHPHLI+F+PIV
Sbjct  5    SFHIAMYPWFALGHITPYVHMANKLAERGHKISFFLPAKTQHKVEAFNLHPHLITFIPIV  64

Query  236  VPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLA  415
            VP + GLP GAETT+DVPFP   L+M AMD T+ DIE  L+ LK    FYDFT WLP+L 
Sbjct  65   VPHVEGLPLGAETTNDVPFPLHPLIMTAMDLTEPDIEAYLRQLKPHFAFYDFTCWLPALT  124

Query  416  RKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
            R++GIKSV Y  IS    GY LSP R+ + K +T +D+++ P
Sbjct  125  RRLGIKSVVYCIISSATIGYLLSPARKTLEKGMTGSDLLEPP  166



>ref|XP_003593675.1| Anthocyanidin 3-O-glucosyltransferase [Medicago truncatula]
 gb|AES63926.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=458

 Score =   200 bits (508),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 93/164 (57%), Positives = 125/164 (76%), Gaps = 0/164 (0%)
 Frame = +2

Query  50   ATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVP  229
            A  +H+AMYPWF +GHLT +  ++NKLA +GH+ISFL+P+NT SKLE FNLHP LISFVP
Sbjct  3    ANIFHVAMYPWFALGHLTSYLHISNKLAERGHKISFLMPRNTISKLEHFNLHPDLISFVP  62

Query  230  IVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPS  409
            I +P + GLP G+ETT+D+PF    LLM AMD T+  IE  L++L+  +VF+DFT+WLP+
Sbjct  63   ITIPHVDGLPLGSETTADIPFSLHSLLMTAMDLTEPIIEDTLRELRPHMVFFDFTYWLPA  122

Query  410  LARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
            LA ++GIK++ Y TISP   GY +SPER++  K LTE D++  P
Sbjct  123  LACRLGIKALHYCTISPATVGYLISPERKLHEKSLTEEDLIDPP  166



>ref|XP_003530810.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Glycine max]
Length=466

 Score =   199 bits (506),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 99/169 (59%), Positives = 127/169 (75%), Gaps = 3/169 (2%)
 Frame = +2

Query  38   MGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLI  217
            M S  + +H+AMYPWF +GHLT F  ++NKLA +GH+ISFL+PKNT  +L  FNLHPHLI
Sbjct  2    MSSNTSLFHVAMYPWFALGHLTSFLHISNKLAERGHKISFLMPKNTIPRLSHFNLHPHLI  61

Query  218  SFVPIVVPSIPGLPPGAETTSDVPFPSTH-LLMEAMDKTQNDIEIILKDLKVDVVFYDFT  394
             FVPI VP + GLP G+ETTSD+P  S H LLM AMD T+  IE  LK LK  +VF+DFT
Sbjct  62   FFVPITVPHVDGLPLGSETTSDLPNYSKHSLLMTAMDLTEPVIETCLKHLKPHMVFFDFT  121

Query  395  HWLPSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQ--LTEADMMK  535
            HWLP+LA K+GIK++ Y TISP   GY +SPER+++ ++  LTEAD++ 
Sbjct  122  HWLPALACKLGIKALHYCTISPATVGYLISPERKLLLEKNSLTEADLIN  170



>ref|XP_010111152.1| UDP-glycosyltransferase [Morus notabilis]
 gb|EXC30543.1| UDP-glycosyltransferase [Morus notabilis]
Length=460

 Score =   197 bits (501),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 97/161 (60%), Positives = 117/161 (73%), Gaps = 1/161 (1%)
 Frame = +2

Query  62   HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVP  241
            H+AMYPWF +GHLT F  ++NKLA +GHRISF IP  TQ KL SFNLHPHLISF+PI VP
Sbjct  6    HIAMYPWFAMGHLTSFLHISNKLAERGHRISFFIPTETQPKLSSFNLHPHLISFLPIDVP  65

Query  242  SIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARK  421
             +PGLPP AETT+D+P+    LLM AMD T+  IE  L  LK   VF+DFTHWLP  AR+
Sbjct  66   HVPGLPPTAETTNDIPYALFSLLMTAMDLTRPAIEASLVQLKPHFVFFDFTHWLPQSARR  125

Query  422  IG-IKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
            IG IK++ Y TISP   GY +SPER +  K L E+D++  P
Sbjct  126  IGNIKTLLYCTISPAAVGYLISPERELNEKSLKESDLLVPP  166



>gb|KJB68177.1| hypothetical protein B456_010G230200 [Gossypium raimondii]
Length=456

 Score =   196 bits (499),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 91/162 (56%), Positives = 120/162 (74%), Gaps = 0/162 (0%)
 Frame = +2

Query  56   TYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIV  235
            ++H+AMYPWF +GH+T +  +ANKLA +GH+ISF +P  TQ K+E+FNLHPHLI+F+PI 
Sbjct  5    SFHIAMYPWFALGHITPYVHMANKLAERGHKISFFLPAKTQHKVEAFNLHPHLITFIPIE  64

Query  236  VPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLA  415
            VP + GLP GAETT+DVPFP   L+M AMD T+ DIE  L+ LK    FYDFT WLP+L 
Sbjct  65   VPHVEGLPLGAETTNDVPFPLHPLIMTAMDLTEPDIEAYLRQLKPHFAFYDFTCWLPALT  124

Query  416  RKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
            R++GIKSV Y  IS    GY LSP R+ + K +T +D+++ P
Sbjct  125  RRLGIKSVVYCIISSATIGYLLSPARKTLEKGMTGSDLLEPP  166



>ref|XP_007025500.1| UDP-Glycosyltransferase superfamily protein [Theobroma cacao]
 gb|EOY28122.1| UDP-Glycosyltransferase superfamily protein [Theobroma cacao]
Length=456

 Score =   196 bits (499),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 91/162 (56%), Positives = 121/162 (75%), Gaps = 0/162 (0%)
 Frame = +2

Query  56   TYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIV  235
            T+H+A+YPWF +GH+T F  +ANKLA +GH+ISF +P  TQ K+E+FNLHP LI+F+PI 
Sbjct  5    TFHIALYPWFALGHITAFVHIANKLAERGHKISFFLPAKTQRKVEAFNLHPDLITFIPIT  64

Query  236  VPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLA  415
            VP + GLP GAETT+DVPFP   L+M AMD T+ DIE  L +LK   VF+DFT WLP+L+
Sbjct  65   VPHVEGLPHGAETTNDVPFPLHPLIMTAMDLTEPDIEASLLELKPHFVFFDFTCWLPALS  124

Query  416  RKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
            R++GIKSV Y  +S    GY LSP R+++ K LT  D+++ P
Sbjct  125  RRLGIKSVLYCIVSSATIGYLLSPARKILEKGLTGHDLLEPP  166



>ref|XP_003543300.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Glycine max]
 gb|KHN36712.1| UDP-glycosyltransferase 79B6 [Glycine soja]
Length=468

 Score =   196 bits (499),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 93/166 (56%), Positives = 122/166 (73%), Gaps = 0/166 (0%)
 Frame = +2

Query  44   SQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISF  223
            + A   H+A++PWF +GHLT    L+NKLA +GHRISF+ PK TQ+KL+  NLHPHLI+F
Sbjct  4    ANAAPLHIAIFPWFAMGHLTPSLHLSNKLAQRGHRISFIGPKKTQTKLQHLNLHPHLITF  63

Query  224  VPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWL  403
            VPI VP + GLP  AETTSDVPF    L+ EAMD+T+ DIEI+L++LK  +VF+DF HWL
Sbjct  64   VPIKVPHVNGLPHDAETTSDVPFSLFPLIAEAMDRTEKDIEILLRELKPQIVFFDFQHWL  123

Query  404  PSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
            P+L R++GIKSV Y  I+PL   Y  +  R+  G++LTE D+M  P
Sbjct  124  PNLTRRLGIKSVMYVIINPLSTAYFANGPRKSKGRELTELDLMVPP  169



>ref|XP_007213494.1| hypothetical protein PRUPE_ppa022356mg [Prunus persica]
 gb|EMJ14693.1| hypothetical protein PRUPE_ppa022356mg [Prunus persica]
Length=450

 Score =   196 bits (497),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 116/159 (73%), Gaps = 2/159 (1%)
 Frame = +2

Query  71   MYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVPSIP  250
            MYPWFG+GHLT F  ++NKLA +GHRISF  P   Q KLE+FNLH H ISF+PI VP + 
Sbjct  1    MYPWFGMGHLTSFLHISNKLAERGHRISFFSPSKVQQKLEAFNLHSHRISFIPIDVPHVD  60

Query  251  GLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARK--I  424
            GLPPG ETT+DVPFP   LL+ AMD T+  IE  L +L+ + VF+DFTHWLP L  K  I
Sbjct  61   GLPPGTETTADVPFPLHSLLVTAMDLTRPAIEQALCELRPNFVFFDFTHWLPELLHKLDI  120

Query  425  GIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
            GIKSV Y TISP   G+ +SPER++  K LTEAD+M+ P
Sbjct  121  GIKSVHYCTISPATVGFLISPERKLFEKSLTEADLMEPP  159



>ref|XP_007132682.1| hypothetical protein PHAVU_011G115700g [Phaseolus vulgaris]
 gb|ESW04676.1| hypothetical protein PHAVU_011G115700g [Phaseolus vulgaris]
Length=457

 Score =   196 bits (497),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 91/160 (57%), Positives = 116/160 (73%), Gaps = 0/160 (0%)
 Frame = +2

Query  62   HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVP  241
            H+AMYPW  +GH T F  L NKLA +GHRISF+ P   Q+KLE FNLHP LI+FV I VP
Sbjct  7    HIAMYPWLAMGHQTAFLHLCNKLAIRGHRISFITPPKAQAKLEPFNLHPELITFVTITVP  66

Query  242  SIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARK  421
             + GLPP A+TT+DV +P    +M AMD T++DIE +L DLK D+VFYDFTHW+P+L +K
Sbjct  67   HVEGLPPDAQTTADVTYPLQPNIMTAMDLTKDDIETLLTDLKPDLVFYDFTHWMPTLTKK  126

Query  422  IGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
            +GIK+V Y T S +M GY L P R   G  L+E+D+M+ P
Sbjct  127  LGIKAVHYCTASSVMVGYTLPPARYYQGIDLSESDLMEPP  166



>gb|KJB62832.1| hypothetical protein B456_009G439200 [Gossypium raimondii]
Length=456

 Score =   195 bits (496),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/162 (56%), Positives = 120/162 (74%), Gaps = 0/162 (0%)
 Frame = +2

Query  56   TYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIV  235
            ++H+AMYPWF +GH+T +  +ANKLA +GH+ISF +P  TQ K+E+FNLHPHLI+F+PI 
Sbjct  5    SFHIAMYPWFALGHITPYVHMANKLAERGHKISFFLPPKTQHKVEAFNLHPHLITFIPIT  64

Query  236  VPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLA  415
            VP + GLP GAETT+DVPFP   L+M AMD T+ DIE  L+ LK   VFYDFT WLP+L 
Sbjct  65   VPHVEGLPLGAETTNDVPFPLHPLIMTAMDLTKPDIEAYLRQLKPQFVFYDFTCWLPALT  124

Query  416  RKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
            R++GIKSV Y  IS    GY LSP R+ + K +  +D+++ P
Sbjct  125  RRLGIKSVVYCIISSGTIGYLLSPARKTLEKGMIGSDLLEPP  166



>gb|KDP21029.1| hypothetical protein JCGZ_21500 [Jatropha curcas]
Length=458

 Score =   195 bits (495),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 93/164 (57%), Positives = 121/164 (74%), Gaps = 1/164 (1%)
 Frame = +2

Query  53   TTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPI  232
             T+H+AMYPWF +GHLT F  L+NKLA +GH+ISFL+P  T+S  E FNL+P+LI+ +PI
Sbjct  4    NTFHIAMYPWFALGHLTSFLHLSNKLAERGHKISFLLPPKTKSNFEPFNLYPNLITLIPI  63

Query  233  VVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSL  412
             +P + GLPPG+ETT+DVPFP   L+M AMD TQ  IE  L++LK   VF+DFTHWLP+L
Sbjct  64   DIPHVDGLPPGSETTADVPFPLHPLIMTAMDLTQPTIEFHLRNLKPHFVFFDFTHWLPAL  123

Query  413  ARKIGIKSVFYSTISPLMHGYALSPERRVVGKQL-TEADMMKAP  541
            +RK+ IKSV Y TISP   GY L PE ++   ++ TE D+M  P
Sbjct  124  SRKLNIKSVHYYTISPATVGYLLRPEIKIADNKIRTEVDLMNPP  167



>ref|XP_004304716.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Fragaria vesca subsp. vesca]
 ref|XP_011465894.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Fragaria vesca subsp. vesca]
Length=463

 Score =   195 bits (495),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/164 (55%), Positives = 122/164 (74%), Gaps = 2/164 (1%)
 Frame = +2

Query  56   TYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIV  235
            T H+AMYPWF +GHL+ F  ++NKLA +GHRISF +P+ TQ+KL+ +NLHP LI+F P+ 
Sbjct  8    TLHIAMYPWFAMGHLSPFLHISNKLAERGHRISFFLPQKTQAKLQYYNLHPDLITFYPLT  67

Query  236  VPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLA  415
            +P + GLP GAETT+DVPFP   L++ AMD T+  IE  L++LK D+VFYDF+HWLP L 
Sbjct  68   IPHVEGLPQGAETTADVPFPLHTLVVTAMDLTRPQIEKFLRELKPDLVFYDFSHWLPQLL  127

Query  416  RKI--GIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
            R++   IKSV Y  ISP+  GY LSPER++  K L   D+++AP
Sbjct  128  RELDGNIKSVLYCIISPVTIGYLLSPERKLTEKPLVATDLLEAP  171



>ref|XP_010035826.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Eucalyptus grandis]
 gb|KCW47284.1| hypothetical protein EUGRSUZ_K01076 [Eucalyptus grandis]
Length=457

 Score =   194 bits (494),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 94/160 (59%), Positives = 115/160 (72%), Gaps = 0/160 (0%)
 Frame = +2

Query  62   HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVP  241
            H+AMYPW  +GHLT F  LANKLA KGH+ISFL+P  TQ+KLE FN HP LI+FVPI +P
Sbjct  7    HIAMYPWLAMGHLTPFLHLANKLAKKGHKISFLVPPRTQAKLEHFNRHPDLITFVPIAIP  66

Query  242  SIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARK  421
             + GLPP AETTSDVP+P   L+M AMD T+  +  +L+ LK   V +DFTHWLP++AR 
Sbjct  67   HVEGLPPDAETTSDVPYPLHPLIMTAMDHTEPTVHQLLQTLKPHCVLHDFTHWLPAIARD  126

Query  422  IGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
            +GIKSV Y  ISP+   Y LSP R +   +LTEAD M  P
Sbjct  127  LGIKSVHYCIISPVTVSYTLSPVRHLSAHKLTEADYMVPP  166



>ref|XP_010035825.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Eucalyptus grandis]
 gb|KCW47287.1| hypothetical protein EUGRSUZ_K01079 [Eucalyptus grandis]
Length=457

 Score =   194 bits (492),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 94/160 (59%), Positives = 115/160 (72%), Gaps = 0/160 (0%)
 Frame = +2

Query  62   HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVP  241
            H+AMYPW  +GHLT F  LANKLA KGH+ISFLIP  T++KLE FN HP LI+FVPI +P
Sbjct  7    HIAMYPWLAMGHLTPFLHLANKLAKKGHKISFLIPPRTRAKLEHFNRHPDLITFVPIAIP  66

Query  242  SIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARK  421
             + GLPP AETTSDVP+P   L+M AMD T+  +  +L+ LK   VF+DFTHWLP++A  
Sbjct  67   HVEGLPPDAETTSDVPYPLHPLIMTAMDHTEPTVRQLLQTLKPHCVFHDFTHWLPAIAHD  126

Query  422  IGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
            +GIKSV Y  ISP+   Y LSP R +   +LTEAD M  P
Sbjct  127  LGIKSVHYCIISPVTVSYTLSPARHLSAHKLTEADYMVPP  166



>gb|KDO77743.1| hypothetical protein CISIN_1g039043mg, partial [Citrus sinensis]
Length=449

 Score =   194 bits (492),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 93/157 (59%), Positives = 116/157 (74%), Gaps = 0/157 (0%)
 Frame = +2

Query  71   MYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVPSIP  250
            +YPWF +GHLT F  +ANKLA +GHRISFL+P    +K E  NLH +LI+F+P+ VP + 
Sbjct  1    IYPWFAMGHLTPFLHIANKLAERGHRISFLLPAKAITKFEPSNLHRNLITFIPVSVPRVD  60

Query  251  GLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARKIGI  430
            GLPPGAETT+DVPFP   LLM AMD T+  IE +L+ LK D VF+DFTHWLP LARK GI
Sbjct  61   GLPPGAETTNDVPFPLHPLLMTAMDLTEPAIESVLRHLKPDFVFFDFTHWLPPLARKFGI  120

Query  431  KSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
            KSV Y  ISP   GY LSPER++  + LT+ D+++ P
Sbjct  121  KSVLYCIISPATIGYLLSPERKLRERTLTDNDLLRPP  157



>ref|XP_007025501.1| UDP-Glycosyltransferase superfamily protein [Theobroma cacao]
 gb|EOY28123.1| UDP-Glycosyltransferase superfamily protein [Theobroma cacao]
Length=456

 Score =   193 bits (491),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/160 (56%), Positives = 118/160 (74%), Gaps = 0/160 (0%)
 Frame = +2

Query  62   HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVP  241
            HMAMYPWF VGH+T F  ++NKLA +GH+ISF +P  TQSK E FNLHP +I+F+PI VP
Sbjct  7    HMAMYPWFAVGHITSFLHISNKLAERGHKISFFLPTKTQSKFEPFNLHPDVITFIPIKVP  66

Query  242  SIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARK  421
             I GLP G ETT+D+PF    LLM AMD T+  IE  L++LK   +F+DFT W+P+L  +
Sbjct  67   HIDGLPLGTETTTDIPFSLQPLLMAAMDLTEPAIEASLRELKPHFLFFDFTFWMPALCHR  126

Query  422  IGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
            +GIKS++Y TISP   GY +SP R+++ K LT +D+M+ P
Sbjct  127  LGIKSMYYCTISPATVGYLISPTRKILEKGLTGSDLMEPP  166



>ref|XP_003607531.1| Glucosyltransferase [Medicago truncatula]
 gb|AES89728.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=462

 Score =   193 bits (491),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/160 (58%), Positives = 116/160 (73%), Gaps = 0/160 (0%)
 Frame = +2

Query  62   HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVP  241
            H+AMYPWF +GH T F  LANKLA KGH+I+F  PK+ QSKLE FNL+P LI+F+ I VP
Sbjct  8    HIAMYPWFAMGHQTPFLHLANKLAKKGHKITFFTPKSAQSKLEPFNLYPQLITFITIKVP  67

Query  242  SIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARK  421
             + GLP  AETT+DVP+P    +M AMD TQ DIE  L +LK  +VFYDFTHW+PSL ++
Sbjct  68   HVEGLPLNAETTADVPYPLHPHIMTAMDLTQPDIETHLTNLKPQIVFYDFTHWIPSLTKR  127

Query  422  IGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
            +GIK+  Y  IS +M GY+L+P R   G  LTE D+M+ P
Sbjct  128  LGIKAFHYCIISSIMVGYSLTPARYSQGNNLTEFDLMQPP  167



>gb|ACU24192.1| unknown [Glycine max]
Length=458

 Score =   193 bits (490),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 93/164 (57%), Positives = 118/164 (72%), Gaps = 0/164 (0%)
 Frame = +2

Query  50   ATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVP  229
            A++ H+AM+PWF +GHLT +  L+NKLA +GHRISF IPK TQ KLE FNL PHLI+F P
Sbjct  3    ASSMHIAMFPWFAMGHLTPYLHLSNKLAKRGHRISFFIPKRTQHKLEQFNLFPHLITFYP  62

Query  230  IVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPS  409
            I VP + GLP GAETTSDV F    L+M AMD+T+ DIE++L +LK  +VF+DFT+WLP+
Sbjct  63   INVPHVEGLPHGAETTSDVSFSLGPLIMTAMDRTEKDIELLLIELKPQIVFFDFTYWLPN  122

Query  410  LARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
            L R++GIKS  Y  +SP    Y  SP R      LTE D+M+ P
Sbjct  123  LTRRLGIKSFQYMIVSPATVAYNASPPRMQNSVNLTEVDLMQPP  166



>gb|KHN36711.1| UDP-glycosyltransferase 79B6 [Glycine soja]
Length=458

 Score =   193 bits (490),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 93/164 (57%), Positives = 118/164 (72%), Gaps = 0/164 (0%)
 Frame = +2

Query  50   ATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVP  229
            A++ H+AM+PWF +GHLT +  L+NKLA +GHRISF IPK TQ KLE FNL PHLI+F P
Sbjct  3    ASSMHIAMFPWFAMGHLTPYLHLSNKLAKRGHRISFFIPKRTQHKLEQFNLFPHLITFYP  62

Query  230  IVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPS  409
            I VP + GLP GAETTSDV F    L+M AMD+T+ DIE++L +LK  +VF+DFT+WLP+
Sbjct  63   INVPHVEGLPHGAETTSDVSFSLGPLIMTAMDRTEKDIELLLIELKPQIVFFDFTYWLPN  122

Query  410  LARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
            L R++GIKS  Y  +SP    Y  SP R      LTE D+M+ P
Sbjct  123  LTRRLGIKSFQYMIVSPATVAYNASPPRMQNSVNLTEVDLMQPP  166



>gb|KJB68179.1| hypothetical protein B456_010G230400 [Gossypium raimondii]
Length=456

 Score =   193 bits (490),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/162 (56%), Positives = 119/162 (73%), Gaps = 0/162 (0%)
 Frame = +2

Query  56   TYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIV  235
            ++H+AMY WF +GH+T +  +ANKLA +GH+ISF +P  TQ K+E+FNLHPHLI+F+PI 
Sbjct  5    SFHIAMYLWFALGHITPYVHMANKLAERGHKISFFLPAKTQHKVEAFNLHPHLITFIPIE  64

Query  236  VPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLA  415
            VP + GLP GAETT+DVPFP   L+M AMD T+ DIE  L+ LK    FYDFT WLP+L 
Sbjct  65   VPHVEGLPLGAETTNDVPFPLHPLIMTAMDLTEPDIEAYLRQLKPHFAFYDFTCWLPALT  124

Query  416  RKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
            R++GIKSV Y  IS    GY LSP R+ + K +T +D+++ P
Sbjct  125  RRLGIKSVVYCIISSATIGYLLSPARKTLEKGMTGSDLLEPP  166



>gb|KHN27959.1| UDP-glycosyltransferase 79B3 [Glycine soja]
Length=461

 Score =   192 bits (489),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/166 (54%), Positives = 120/166 (72%), Gaps = 0/166 (0%)
 Frame = +2

Query  44   SQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISF  223
            + A   H+A++PWF +GHLT    L+NKLA +GHRISF++PK TQ+KL+  NLHPHLI+F
Sbjct  4    ASAAPLHVAIFPWFAMGHLTPILHLSNKLAQRGHRISFIVPKRTQTKLQHLNLHPHLITF  63

Query  224  VPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWL  403
            VPI VP + GLP  AETTSD+PF    LL  A+D+T+ DIE++L++LK   VF+DF HWL
Sbjct  64   VPITVPRVDGLPQDAETTSDIPFSLFPLLATALDRTEKDIELLLRELKPQFVFFDFQHWL  123

Query  404  PSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
            P+L R +GIKSV Y  ++PL   Y  +  R+  G++LTE D M+ P
Sbjct  124  PNLTRSLGIKSVAYFIVNPLSIAYLGNGPRQSQGRELTEVDFMEPP  169



>ref|XP_003540412.2| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Glycine max]
Length=478

 Score =   193 bits (490),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/166 (54%), Positives = 120/166 (72%), Gaps = 0/166 (0%)
 Frame = +2

Query  44   SQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISF  223
            + A   H+A++PWF +GHLT    L+NKLA +GHRISF++PK TQ+KL+  NLHPHLI+F
Sbjct  21   TSAAPLHVAIFPWFAMGHLTPILHLSNKLAQRGHRISFIVPKRTQTKLQHLNLHPHLITF  80

Query  224  VPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWL  403
            VPI VP + GLP  AETTSD+PF    LL  A+D+T+ DIE++L++LK   VF+DF HWL
Sbjct  81   VPITVPRVDGLPQDAETTSDIPFSLFPLLATALDRTEKDIELLLRELKPQFVFFDFQHWL  140

Query  404  PSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
            P+L R +GIKSV Y  ++PL   Y  +  R+  G++LTE D M+ P
Sbjct  141  PNLTRSLGIKSVAYFIVNPLSIAYLGNGPRQSQGRELTEVDFMEPP  186



>ref|XP_011045872.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Populus euphratica]
Length=462

 Score =   192 bits (489),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 98/171 (57%), Positives = 122/171 (71%), Gaps = 4/171 (2%)
 Frame = +2

Query  29   IGSMGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHP  208
            I +  S+A   H+AMYPWF +GHLT F   +NKLA +GHR+SF +PK TQSK E FNLHP
Sbjct  5    IAARSSKA--LHIAMYPWFALGHLTAFVHFSNKLAERGHRVSFFLPKKTQSKFEPFNLHP  62

Query  209  HLISFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYD  388
             LI+F+PI VP + GLP G ETT++VPFP   LLM AMD T++ IE  L+ L    VF+D
Sbjct  63   DLITFIPITVPHVDGLPTGTETTTNVPFPLHPLLMTAMDLTEHVIEDHLRILNPHFVFFD  122

Query  389  FTHWLPSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
            FTHWLP L+RK GIKSV +  ISP   GY LSPER++  + LT AD+M+ P
Sbjct  123  FTHWLPVLSRKHGIKSVHFCIISPATIGYLLSPERKL--ESLTAADLMQPP  171



>gb|AES89730.2| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=462

 Score =   191 bits (485),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 92/160 (58%), Positives = 115/160 (72%), Gaps = 0/160 (0%)
 Frame = +2

Query  62   HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVP  241
            H+AMYPWF +GH T F  LANKLA KGH+I+F  PK+ QSKLE FNL+P LI+F+ I VP
Sbjct  8    HIAMYPWFAMGHQTPFLHLANKLAKKGHKITFFTPKSAQSKLEPFNLYPQLITFITIKVP  67

Query  242  SIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARK  421
             + GLP  AETT+DVP+P    +M AMD TQ DIE  L +LK  +VFYDFTHW+PSL ++
Sbjct  68   HVEGLPLNAETTADVPYPLHPHIMTAMDLTQPDIETHLTNLKPQIVFYDFTHWIPSLTKR  127

Query  422  IGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
            + IK+  Y  IS +M GY L+P R   GK LTE D+M+ P
Sbjct  128  LDIKAFHYCIISSIMIGYTLAPSRYSKGKDLTEFDLMQPP  167



>ref|XP_010262362.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Nelumbo nucifera]
Length=475

 Score =   191 bits (486),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 91/172 (53%), Positives = 121/172 (70%), Gaps = 1/172 (1%)
 Frame = +2

Query  29   IGSMGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHP  208
            +G   +   T H+AMYPW+ +GHLT F  ++NKLA +GHR+SF +P  TQSKL S NLHP
Sbjct  1    MGGAVADVDTLHIAMYPWYAMGHLTPFLHISNKLAERGHRVSFFLPTKTQSKLNSNNLHP  60

Query  209  HLISFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYD  388
            +LI+F+P+VVP + GLPPGAETT+DVP     L+M AMD TQ +IE  L+ LK  +VF+D
Sbjct  61   NLITFIPVVVPHVDGLPPGAETTADVPHSLHSLIMTAMDLTQPEIEASLRQLKPHIVFFD  120

Query  389  FTHWLPSLARKIGIKSVFYSTISPLMHGYALSPERRVVGK-QLTEADMMKAP  541
            F +W+P+LAR +GIKS+ Y  ISP+  GY LSP R  +    L E+ +M  P
Sbjct  121  FAYWVPALARSLGIKSIHYCIISPVTIGYLLSPSRNNISDVDLYESSLMHPP  172



>gb|KJB68394.1| hypothetical protein B456_010G242800 [Gossypium raimondii]
Length=456

 Score =   191 bits (484),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 119/162 (73%), Gaps = 0/162 (0%)
 Frame = +2

Query  56   TYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIV  235
            T+H+AMYPWF +GH+T F  LANKLA  GH+ISF +P  T  ++E+FNLHP+L++F+PI+
Sbjct  5    TFHIAMYPWFALGHITPFVHLANKLAENGHKISFFLPAKTLRRVEAFNLHPNLVTFIPII  64

Query  236  VPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLA  415
            VP + GLP GAETT+DVPFP   L+M AMD T+ DIE  L++LK   VF+DF  WLP+L 
Sbjct  65   VPHVEGLPLGAETTNDVPFPLHPLIMTAMDCTEPDIEAYLRELKPHFVFFDFACWLPTLT  124

Query  416  RKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
             ++GIKSV Y  IS    GY LSP R+++ + LT  D+++ P
Sbjct  125  HELGIKSVVYCVISSGTIGYLLSPARKIIERGLTGLDLLEPP  166



>ref|XP_010277785.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Nelumbo nucifera]
Length=462

 Score =   190 bits (483),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 94/170 (55%), Positives = 120/170 (71%), Gaps = 3/170 (2%)
 Frame = +2

Query  38   MGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLI  217
            MG+  +T+H+ MYPWF  GHLT F  L+NKLA +GHRISFL+P   ++KLE+FNLHP LI
Sbjct  1    MGTD-STFHVVMYPWFAFGHLTPFLHLSNKLAERGHRISFLLPTKARAKLEAFNLHPDLI  59

Query  218  SFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTH  397
             FVP+VVP + GLP GAETT+DVP     L+M AMD+TQ D+E  LKDLK D +F+DFTH
Sbjct  60   RFVPLVVPHVDGLPAGAETTNDVPLHLQPLIMSAMDRTQPDVEAALKDLKPDFIFFDFTH  119

Query  398  WLPSLARKIGIKSVFYSTISPLMHGYALSPE--RRVVGKQLTEADMMKAP  541
             +P LAR++GIKS+ Y   S     Y L+P   +   G QL+E D+M  P
Sbjct  120  CIPPLARRLGIKSIQYCITSAATIAYLLAPASIKLEEGAQLSEDDLMHQP  169



>gb|ADV71366.1| glycosyltransferase GT10J15 [Pueraria montana var. lobata]
Length=460

 Score =   190 bits (483),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/166 (54%), Positives = 120/166 (72%), Gaps = 0/166 (0%)
 Frame = +2

Query  44   SQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISF  223
            + AT  H+A++PWF +GHLT    L+NKLA +GH+ISF+IPK TQ+KL+  NLHPHLI+F
Sbjct  4    TSATPLHIAIFPWFAMGHLTPTLHLSNKLAQRGHKISFIIPKTTQTKLQHLNLHPHLITF  63

Query  224  VPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWL  403
            VPI VP + GLP  AETTSD+PF    LL  A+D+T+ DIE++L+ LK  +VF+DF HWL
Sbjct  64   VPIKVPHVDGLPHDAETTSDLPFSLFPLLATALDRTEKDIELLLRKLKPQIVFFDFQHWL  123

Query  404  PSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
            P+L R +GIKSV Y    PL   Y  +  R+  G++LTE D+M+ P
Sbjct  124  PNLTRSLGIKSVMYFITHPLSAAYLGNGPRKSQGRELTELDLMEPP  169



>ref|XP_003539949.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Glycine max]
Length=461

 Score =   190 bits (482),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 115/160 (72%), Gaps = 0/160 (0%)
 Frame = +2

Query  62   HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVP  241
            H+AMYPW  +GH T F  L NKLA +GH+ISF+ P   Q+KLE+FNLHP+ I+FV I VP
Sbjct  7    HIAMYPWLAMGHQTAFLHLCNKLAIRGHKISFITPPKAQAKLEAFNLHPNSITFVTITVP  66

Query  242  SIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARK  421
             + GLPP A+TT+DV +P    +M AMD T++DIE +L  LK D+VFYDFTHW+P+LA+ 
Sbjct  67   HVEGLPPDAQTTADVTYPLQPQIMTAMDLTKDDIETLLSGLKPDLVFYDFTHWMPALAKS  126

Query  422  IGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
            +GIK+V Y T S +M GY L P R   G  L E+D+M+ P
Sbjct  127  LGIKAVHYCTASSVMVGYTLPPARYHQGTNLIESDLMEPP  166



>gb|KHN07772.1| UDP-glycosyltransferase 79B6 [Glycine soja]
Length=459

 Score =   190 bits (482),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/160 (56%), Positives = 116/160 (73%), Gaps = 0/160 (0%)
 Frame = +2

Query  62   HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVP  241
            H+AMYPW  +GH T F  L NKLA +GH+ISF+ P   Q+KLE FNLHP+ I+FV I VP
Sbjct  7    HIAMYPWLAMGHQTAFLHLCNKLAIRGHKISFITPPKAQAKLEPFNLHPNSITFVTINVP  66

Query  242  SIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARK  421
             + GLPP A+TT+DV +P    +M AMD T++DIE +L  LK D+VFYDFTHW+P+LA++
Sbjct  67   HVEGLPPDAQTTADVTYPLQPQIMTAMDLTKDDIETLLTGLKPDLVFYDFTHWMPALAKR  126

Query  422  IGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
            +GIK+V Y T S +M GY LSP R   G  L E+D+M+ P
Sbjct  127  LGIKAVHYCTASSVMVGYTLSPVRFHQGTDLMESDLMEPP  166



>ref|XP_003526249.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Glycine max]
Length=459

 Score =   190 bits (482),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 116/160 (73%), Gaps = 0/160 (0%)
 Frame = +2

Query  62   HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVP  241
            H+AMYPW  +GH T F  L NKLA +GH+ISF+ P   Q+KLE FNLHP+ I+FV I VP
Sbjct  7    HIAMYPWLAMGHQTAFLHLCNKLAIRGHKISFITPPKAQAKLEPFNLHPNSITFVTINVP  66

Query  242  SIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARK  421
             + GLPP A+TT+DV +P    +M AMD T++DIE +L  LK D+VFYDFTHW+P+LA++
Sbjct  67   HVEGLPPDAQTTADVTYPLQPQIMTAMDLTKDDIETLLTGLKPDLVFYDFTHWMPALAKR  126

Query  422  IGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
            +GIK+V Y T S +M GY L+P R   G  L E+D+M+ P
Sbjct  127  LGIKAVHYCTASSVMVGYTLTPSRFHQGTDLMESDLMEPP  166



>ref|XP_008465522.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Cucumis melo]
Length=479

 Score =   190 bits (482),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 89/166 (54%), Positives = 115/166 (69%), Gaps = 0/166 (0%)
 Frame = +2

Query  44   SQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISF  223
            S  T  H+AMYPWF +GHLT F  L+NKLA KGH+ISF IP  T  K E  NL P+LI+F
Sbjct  13   SSHTCLHIAMYPWFALGHLTPFLHLSNKLAKKGHKISFFIPTKTLPKFEPLNLFPNLITF  72

Query  224  VPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWL  403
            +PI+VP + GLP GAETT DVP+P  +L+M +MD TQ  I ++L+ LK  ++ +DFTHWL
Sbjct  73   IPIIVPHVDGLPRGAETTCDVPYPLHNLIMTSMDLTQPQITLLLQSLKPHLILFDFTHWL  132

Query  404  PSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
            P LA ++GIKS+ Y   S  M  Y L+P R+    +LTE D+MK P
Sbjct  133  PKLASQLGIKSIHYCVTSAAMIAYTLTPSRQFSKNELTEEDLMKPP  178



>ref|XP_004487585.1| PREDICTED: UDP-glycosyltransferase 79B9-like [Cicer arietinum]
 gb|AGU14140.1| UDP-glycosyltransferase [Cicer arietinum]
Length=457

 Score =   189 bits (481),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 90/165 (55%), Positives = 120/165 (73%), Gaps = 0/165 (0%)
 Frame = +2

Query  47   QATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFV  226
            +A   H+AM+PWF +GH T F  L+NKLA +GH+ISF IPK T +KL+  NLHPHLI+F 
Sbjct  2    EAPPLHLAMFPWFAMGHFTPFLHLSNKLAQRGHKISFFIPKKTLNKLQHLNLHPHLITFF  61

Query  227  PIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLP  406
             I VP + GLP GAETTSDVPF    L+  AMD+T  +IE++LK+LK  +VF+DF +WLP
Sbjct  62   TINVPHVDGLPYGAETTSDVPFSLFPLIATAMDQTDKEIELLLKELKPQIVFFDFQYWLP  121

Query  407  SLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
            +L +K+GIKSV Y  I+P+   Y  +  R+  G++LTEAD+MK P
Sbjct  122  NLTKKLGIKSVQYMIINPMTTAYLGTGPRQSQGRELTEADLMKPP  166



>ref|XP_007149718.1| hypothetical protein PHAVU_005G0935001g, partial [Phaseolus vulgaris]
 ref|XP_007149719.1| hypothetical protein PHAVU_005G0935001g, partial [Phaseolus vulgaris]
 gb|ESW21712.1| hypothetical protein PHAVU_005G0935001g, partial [Phaseolus vulgaris]
 gb|ESW21713.1| hypothetical protein PHAVU_005G0935001g, partial [Phaseolus vulgaris]
Length=204

 Score =   182 bits (462),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 87/165 (53%), Positives = 117/165 (71%), Gaps = 0/165 (0%)
 Frame = +2

Query  47   QATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFV  226
             +++ H+AM+PWF +GHLT +  L+NKLA +GH+ISF IP+ TQSKLE FNL P LI+F 
Sbjct  2    DSSSLHIAMFPWFAMGHLTPYLHLSNKLAKRGHKISFFIPRRTQSKLEQFNLFPDLITFF  61

Query  227  PIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLP  406
            PI VP + GLP GAETTSDV F    L+M AMD+T+ DIE++L DLK  +VF++FT+WLP
Sbjct  62   PINVPHVEGLPHGAETTSDVSFSLGPLIMTAMDRTERDIELLLLDLKPQIVFFNFTYWLP  121

Query  407  SLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
            ++  ++GIKS  Y  +SP    Y  +P R      LTE D+M+ P
Sbjct  122  NITSRLGIKSFQYFILSPATVSYTTAPPRMNHKGSLTELDLMQPP  166



>ref|XP_003607533.1| Glucosyltransferase [Medicago truncatula]
Length=552

 Score =   191 bits (484),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 92/160 (58%), Positives = 115/160 (72%), Gaps = 0/160 (0%)
 Frame = +2

Query  62   HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVP  241
            H+AMYPWF +GH T F  LANKLA KGH+I+F  PK+ QSKLE FNL+P LI+F+ I VP
Sbjct  8    HIAMYPWFAMGHQTPFLHLANKLAKKGHKITFFTPKSAQSKLEPFNLYPQLITFITIKVP  67

Query  242  SIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARK  421
             + GLP  AETT+DVP+P    +M AMD TQ DIE  L +LK  +VFYDFTHW+PSL ++
Sbjct  68   HVEGLPLNAETTADVPYPLHPHIMTAMDLTQPDIETHLTNLKPQIVFYDFTHWIPSLTKR  127

Query  422  IGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
            + IK+  Y  IS +M GY L+P R   GK LTE D+M+ P
Sbjct  128  LDIKAFHYCIISSIMIGYTLAPSRYSKGKDLTEFDLMQPP  167



>ref|XP_007132838.1| hypothetical protein PHAVU_011G128700g [Phaseolus vulgaris]
 gb|ESW04832.1| hypothetical protein PHAVU_011G128700g [Phaseolus vulgaris]
Length=457

 Score =   188 bits (478),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 88/165 (53%), Positives = 116/165 (70%), Gaps = 0/165 (0%)
 Frame = +2

Query  47   QATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFV  226
            +A   H+AMYPW  +GH   F  L NKLA  GHRISF+ P   Q+KLE FNLHP LI+FV
Sbjct  2    EARPLHIAMYPWLAMGHQIPFLHLCNKLAIGGHRISFITPPKAQAKLEPFNLHPELITFV  61

Query  227  PIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLP  406
             I VP + GLPP A+TT+DV +P    +M AMD T++DI+ +L  LK D+VFYDFTHW+P
Sbjct  62   TITVPHVEGLPPDAQTTADVTYPLQPNIMTAMDLTKDDIQTLLTHLKPDLVFYDFTHWMP  121

Query  407  SLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
            +L +K+GIK+V Y  +S +M GY L+P R   G  L+E+D+M+ P
Sbjct  122  TLTKKLGIKAVHYCIVSSVMVGYTLTPARYYQGVDLSESDLMEPP  166



>ref|XP_004487586.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Cicer arietinum]
Length=459

 Score =   187 bits (476),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 86/163 (53%), Positives = 117/163 (72%), Gaps = 0/163 (0%)
 Frame = +2

Query  53   TTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPI  232
            ++ H+AM+PWF +GHLT +  L+NKLA +GH+ISF IPK TQ+KLE FNL+P+LI+F P+
Sbjct  5    SSLHIAMFPWFAMGHLTPYLHLSNKLAKRGHKISFFIPKKTQTKLEQFNLYPNLITFFPL  64

Query  233  VVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSL  412
             VP + GLP GAETTSDV F    L+M AMD+TQN IE++L  L   ++F+DFT WLP +
Sbjct  65   NVPHVDGLPLGAETTSDVSFSLGPLIMTAMDQTQNQIELLLTQLNPQIIFFDFTFWLPKI  124

Query  413  ARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
            ++ +GIKS  Y  ++P    Y  SP R    ++LTE D+MK P
Sbjct  125  SQSLGIKSFLYLIVNPATTSYTTSPLRMCEAEKLTEVDLMKPP  167



>ref|XP_004144610.1| PREDICTED: UDP-glycosyltransferase 79B1-like [Cucumis sativus]
 gb|KGN43443.1| hypothetical protein Csa_7G037470 [Cucumis sativus]
Length=477

 Score =   187 bits (476),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/163 (53%), Positives = 115/163 (71%), Gaps = 0/163 (0%)
 Frame = +2

Query  53   TTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPI  232
            T+ H+AMYPWF +GHLT F  L+NKLA KGH+ISF IP  T  K E  NL P+LI+F+P+
Sbjct  14   TSLHIAMYPWFALGHLTPFLHLSNKLAKKGHKISFFIPTKTLPKFEPLNLFPNLITFIPV  73

Query  233  VVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSL  412
            +VP + GLP GAETT DVP+P  +L+M +MD TQ  I ++L+ LK  ++ +DFTHWLP L
Sbjct  74   IVPHVHGLPHGAETTCDVPYPLHNLIMTSMDLTQPQITLLLQTLKPHLILFDFTHWLPKL  133

Query  413  ARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
            A ++GIKS+ Y   S  M  Y L+P R+    +LTE D+MK P
Sbjct  134  ASQLGIKSIHYCVTSAAMIAYTLTPSRQFYKNELTEEDLMKPP  176



>ref|XP_006377437.1| hypothetical protein POPTR_0011s05910g [Populus trichocarpa]
 gb|ERP55234.1| hypothetical protein POPTR_0011s05910g [Populus trichocarpa]
Length=446

 Score =   186 bits (473),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 91/155 (59%), Positives = 113/155 (73%), Gaps = 2/155 (1%)
 Frame = +2

Query  71   MYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVPSIP  250
            MYPWF +GHLT F   +NKLA +GHR+SF +PK TQSK E FNLHP LI+F+PI VP + 
Sbjct  1    MYPWFALGHLTAFVHFSNKLAERGHRVSFFLPKKTQSKFEPFNLHPDLITFIPITVPHVD  60

Query  251  GLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARKIGI  430
            GLP G ETT+DVPFP   LLM AMD T++ I+  L+ L    +F+DFTHWLP L+RK GI
Sbjct  61   GLPTGTETTTDVPFPLHPLLMTAMDLTEHVIKDHLRILNPHFIFFDFTHWLPELSRKHGI  120

Query  431  KSVFYSTISPLMHGYALSPERRVVGKQLTEADMMK  535
            KSV +  ISP   GY LSPER++  + LT AD+M+
Sbjct  121  KSVHFCIISPATIGYMLSPERKL--ESLTAADLMQ  153



>ref|XP_004487588.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Cicer arietinum]
 gb|AGU14137.1| UDP-glycosyltransferase [Cicer arietinum]
Length=457

 Score =   187 bits (474),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 89/160 (56%), Positives = 116/160 (73%), Gaps = 0/160 (0%)
 Frame = +2

Query  62   HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVP  241
            H+AM+PWF +GHLT F  L+NKLA +GH+ISF IPK TQ+KL+  NLHPHLI+F  I VP
Sbjct  7    HIAMFPWFAMGHLTPFLHLSNKLAQRGHKISFFIPKKTQTKLQHLNLHPHLITFFTINVP  66

Query  242  SIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARK  421
             + GLP GAETTSDVPF    L+  AMD+T  DIE++LK+LK  +VF+DF HWLP+L +K
Sbjct  67   HVDGLPYGAETTSDVPFSLFPLIATAMDQTDKDIELLLKELKPQIVFFDFQHWLPNLTKK  126

Query  422  IGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
             GIKS+ Y   +P+   Y  +  R+  G++L E D+MK P
Sbjct  127  HGIKSLQYLIWNPISTAYLGTGPRQSQGRELNEVDLMKPP  166



>gb|KJB68397.1| hypothetical protein B456_010G243100 [Gossypium raimondii]
Length=407

 Score =   185 bits (469),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 117/164 (71%), Gaps = 0/164 (0%)
 Frame = +2

Query  50   ATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVP  229
              T+ +AMYPW  +GH+T F  +ANKLA +GH+ISF +P     K+E+FNL+P LI+F+P
Sbjct  3    GKTFRIAMYPWVAIGHITPFIHMANKLAQRGHKISFFLPAKKLGKVEAFNLYPDLITFMP  62

Query  230  IVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPS  409
            I+VP + GL  GAETT+DVPFP   L+M AMD+T+ DIE  L++LK   VF+DFT W+P+
Sbjct  63   IIVPHVEGLLIGAETTNDVPFPFHPLIMSAMDRTEPDIEAYLRELKPHFVFFDFTCWMPA  122

Query  410  LARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
              RK+GIKSV Y  IS    GY LSP R+++ + LT  D++K P
Sbjct  123  FTRKLGIKSVLYCIISSGTIGYLLSPARKILERGLTGLDLLKPP  166



>gb|KHN41619.1| UDP-glycosyltransferase 79B6 [Glycine soja]
Length=460

 Score =   186 bits (472),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 115/160 (72%), Gaps = 1/160 (1%)
 Frame = +2

Query  62   HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVP  241
            H+AMYPW  +GH T F  L NKLA +GH+ISF+ P   Q+KLE+FNLHP+ I+FV I VP
Sbjct  7    HIAMYPWLAMGHQTAFLHLCNKLAIRGHKISFITPPKAQAKLEAFNLHPNSITFVTITVP  66

Query  242  SIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARK  421
             + GLPP A+TT+DV +P    +M AMD T++DIE  L+ LK D+VFYDFTHW+P+LA+ 
Sbjct  67   HVEGLPPDAQTTADVTYPLQPQIMTAMDLTKDDIE-TLRGLKPDLVFYDFTHWMPALAKS  125

Query  422  IGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
            +GIK+V Y T S +M GY L P R   G  L E+D+M+ P
Sbjct  126  LGIKAVHYCTASSVMVGYTLPPARYHQGTNLIESDLMEPP  165



>ref|XP_004169305.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyltransferase 79B1-like 
[Cucumis sativus]
Length=477

 Score =   186 bits (471),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/163 (53%), Positives = 114/163 (70%), Gaps = 0/163 (0%)
 Frame = +2

Query  53   TTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPI  232
            T+ H+AMYPWF +GHLT F  L+NKLA KGH+ISF IP  T  K E  NL P+LI+F+P+
Sbjct  14   TSLHIAMYPWFALGHLTPFLHLSNKLAKKGHKISFFIPTKTLPKFEPLNLFPNLITFIPV  73

Query  233  VVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSL  412
            +VP + GLP GAETT DVP+P  +L+M +MD TQ  I ++L+ L   ++ +DFTHWLP L
Sbjct  74   IVPHVHGLPHGAETTCDVPYPLHNLIMTSMDLTQPQITLLLQTLNPXLILFDFTHWLPKL  133

Query  413  ARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
            A ++GIKS+ Y   S  M  Y L+P R+    +LTE D+MK P
Sbjct  134  ASQLGIKSIHYCVTSAAMIAYTLTPSRQFYKNELTEEDLMKPP  176



>ref|XP_007213460.1| hypothetical protein PRUPE_ppa024453mg [Prunus persica]
 gb|EMJ14659.1| hypothetical protein PRUPE_ppa024453mg [Prunus persica]
Length=450

 Score =   185 bits (470),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 91/159 (57%), Positives = 113/159 (71%), Gaps = 2/159 (1%)
 Frame = +2

Query  71   MYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVPSIP  250
            MYPWF +GHLT F  ++NKLA +GHRISF  P   Q KLE+FNLH H ISF+PI VP + 
Sbjct  1    MYPWFAMGHLTSFLHISNKLAQRGHRISFFSPSKVQQKLEAFNLHSHRISFIPIDVPHVD  60

Query  251  GLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARK--I  424
            GLPPG ETT+DVP     LL+ AMD T+  IE  L +L+ + VF+DFTHWLP L  K  I
Sbjct  61   GLPPGTETTADVPSLLQPLLVTAMDLTRPAIEQALCELRPNFVFFDFTHWLPELLHKLDI  120

Query  425  GIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
            GIKSV+Y TISP   G+ + PER+++   LTEAD+M+ P
Sbjct  121  GIKSVYYCTISPATVGFLMCPERKLLEISLTEADLMEPP  159



>gb|AFK39154.1| unknown [Lotus japonicus]
Length=457

 Score =   185 bits (469),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 92/160 (58%), Positives = 114/160 (71%), Gaps = 1/160 (1%)
 Frame = +2

Query  62   HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVP  241
            H+AM+PWF +GHLT F  L+NKLA +GHRISFLIPK TQ+KLE  NLHP LI+FVPI VP
Sbjct  7    HIAMFPWFAMGHLTPFLHLSNKLARRGHRISFLIPKRTQAKLEHLNLHPQLITFVPITVP  66

Query  242  SIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARK  421
             + GLP  AETTSDVPF     L  A+D T+ DIE +L DLK  +VF+DF +WLP++AR 
Sbjct  67   HVDGLPHDAETTSDVPFSLFSNLATALDLTEKDIEPLLMDLKPQIVFFDFQYWLPNMARS  126

Query  422  IGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
            +GIKSV Y  ++P    Y  +P R   G ++TE D MK P
Sbjct  127  LGIKSVQYFIVNPATSAYFGTP-RPSQGSEITEVDCMKPP  165



>ref|XP_010093489.1| UDP-glycosyltransferase [Morus notabilis]
 gb|EXB54128.1| UDP-glycosyltransferase [Morus notabilis]
Length=458

 Score =   185 bits (469),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/161 (55%), Positives = 117/161 (73%), Gaps = 1/161 (1%)
 Frame = +2

Query  62   HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVP  241
            H+AM PWF +GH+T F  ++NKLA KGH+ISF IP  TQSK+  FNL PHLISFVPI +P
Sbjct  8    HIAMCPWFALGHITSFLHISNKLAKKGHKISFFIPTKTQSKVSHFNLFPHLISFVPITIP  67

Query  242  SIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARK  421
             + GLPPG+ETT+DVP P   L+M AMD+ + D EI+L DLK D+VF+D  HW+P LAR+
Sbjct  68   LVDGLPPGSETTNDVPRPLIPLIMTAMDRAEPDFEILLHDLKPDIVFFDSAHWIPKLARR  127

Query  422  IGIKSVFYSTISPLMHGYALSPERRVVGKQLTE-ADMMKAP  541
            + IKSVFY T+S +  G+ LS   ++   + T+ A+ M+ P
Sbjct  128  LSIKSVFYITVSAVAIGFNLSRNMKLGESKATDVAEAMQPP  168



>ref|XP_008371703.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Malus domestica]
Length=459

 Score =   184 bits (468),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 92/166 (55%), Positives = 115/166 (69%), Gaps = 2/166 (1%)
 Frame = +2

Query  50   ATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVP  229
            A   H AMYPWF +GHLT F  ++NKLA +GHRISF IP  T  KLE+FNL+P  I+F+P
Sbjct  3    AKKLHXAMYPWFAMGHLTSFLHISNKLAERGHRISFFIPVKTLQKLEAFNLYPDRIAFIP  62

Query  230  IVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPS  409
            I VP +PGLPPG ETT+DVPFP   LLM AMD T+ +I   L++LK D VF+DFT W+P 
Sbjct  63   INVPHVPGLPPGTETTADVPFPLHSLLMTAMDLTRPEIGQALRELKPDFVFFDFTQWMPE  122

Query  410  LARKI--GIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
            L  ++  G KS+ Y TISP    Y  +PER ++ KQ T AD+M  P
Sbjct  123  LLHELDMGTKSIHYCTISPATVLYLSTPERNLMEKQPTVADLMLPP  168



>ref|XP_007132927.1| hypothetical protein PHAVU_011G136700g [Phaseolus vulgaris]
 gb|ESW04921.1| hypothetical protein PHAVU_011G136700g [Phaseolus vulgaris]
Length=452

 Score =   184 bits (466),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 95/166 (57%), Positives = 116/166 (70%), Gaps = 7/166 (4%)
 Frame = +2

Query  47   QATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFV  226
             A + H+AMYPWF +GHLT F  LANKLA +GH+ISF IPK TQ+KLE+ NL P LI+FV
Sbjct  2    NAASLHIAMYPWFAMGHLTPFLHLANKLAKRGHKISFFIPKRTQAKLENLNLRPSLITFV  61

Query  227  PIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDF-THWL  403
            PI VP + GLP GAETTSDVP     L+  AMD T+ DIE++L +LK  +V +DF T+WL
Sbjct  62   PISVPHVDGLPCGAETTSDVPSSLFPLIASAMDLTEKDIELLLLELKPHIVLFDFATYWL  121

Query  404  PSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
            P+LAR+IGIKS+ Y  ISP   GY  SP R+       E DM K P
Sbjct  122  PNLARRIGIKSLQYWIISPATIGYMASPARK------REDDMRKPP  161



>ref|XP_008349217.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Malus domestica]
Length=456

 Score =   184 bits (466),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 91/158 (58%), Positives = 114/158 (72%), Gaps = 4/158 (3%)
 Frame = +2

Query  71   MYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVPSIP  250
            MYPWF +GHLT +  L+NKLA +GHRISF +P  TQ KL++ NLHPHLISF+PI VP + 
Sbjct  1    MYPWFAMGHLTSYLHLSNKLAERGHRISFFVPTKTQQKLQALNLHPHLISFIPITVPHVD  60

Query  251  GLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARKI--  424
            GLPPGAETT+DVP PS  L+M AMD TQ  I   + +L  D VF+DFT WLP L R++  
Sbjct  61   GLPPGAETTNDVPIPSYSLIMAAMDLTQPAILQAICELNPDFVFFDFTPWLPKLLRQLGT  120

Query  425  GIKSVFYSTISPLMHGYALSPERRVVGKQ--LTEADMM  532
            GIKS+ Y  ISP   GY  SPER+V+ ++  LTE D++
Sbjct  121  GIKSINYIIISPAFVGYVRSPERKVLMEKSVLTEDDLI  158



>ref|XP_004487587.1| PREDICTED: UDP-glycosyltransferase 79B1-like [Cicer arietinum]
 gb|AGU14138.1| UDP-glycosyltransferase [Cicer arietinum]
Length=455

 Score =   183 bits (465),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 89/165 (54%), Positives = 118/165 (72%), Gaps = 2/165 (1%)
 Frame = +2

Query  47   QATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFV  226
            +A   H+AM+PWF +GH T F  L+NKLA +GH+ISF IPK T +KL+  NLHPHLI+F 
Sbjct  2    EAPPLHIAMFPWFAMGHFTPFLHLSNKLAQRGHKISFFIPKKTLNKLQHLNLHPHLITFF  61

Query  227  PIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLP  406
             I VP + GLP GAETTSDVPFP   L+  AMD+T+ DIE++LK+LK  +VF+DF HWLP
Sbjct  62   TINVPHVDGLPHGAETTSDVPFPLFPLIATAMDQTEKDIELLLKELKPQIVFFDFQHWLP  121

Query  407  SLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
            +L +K+GIKSV    ++P+   Y     R   G++LTE D++K P
Sbjct  122  NLTKKLGIKSVQNWIMNPISTAYL--GNRPSQGRELTEVDLLKPP  164



>ref|XP_007149722.1| hypothetical protein PHAVU_005G093600g [Phaseolus vulgaris]
 gb|ESW21716.1| hypothetical protein PHAVU_005G093600g [Phaseolus vulgaris]
Length=458

 Score =   183 bits (465),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 116/164 (71%), Gaps = 0/164 (0%)
 Frame = +2

Query  50   ATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVP  229
             ++ H+AM+PWF +GHLT +  L+NKLA +GH+ISF +P+ TQSKLE FNL P LI+F P
Sbjct  3    GSSLHIAMFPWFAMGHLTPYLHLSNKLAKRGHKISFFVPRRTQSKLEQFNLFPDLITFFP  62

Query  230  IVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPS  409
            I VP + GLP GAETTSDV F    L+M AMD+T+ DIE++L DLK  +VF+DFT+WLP+
Sbjct  63   INVPHVEGLPHGAETTSDVSFSLGPLIMTAMDRTERDIELLLLDLKPQIVFFDFTYWLPN  122

Query  410  LARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
            +  ++GIKS  Y  +SP    Y  +P R      LTE D+M+ P
Sbjct  123  ITSRLGIKSFQYFIVSPATVSYTTAPPRMNHKGSLTELDLMQPP  166



>ref|XP_008383670.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Malus domestica]
Length=471

 Score =   182 bits (463),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 93/164 (57%), Positives = 119/164 (73%), Gaps = 5/164 (3%)
 Frame = +2

Query  56   TYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIV  235
            + H+AMYPWF +GHLT +  L+NKLA +GHRISF +P  TQ KL++ NLHPHLISF+PI 
Sbjct  9    SLHIAMYPWFAMGHLTPYLHLSNKLAERGHRISF-VPTKTQQKLQALNLHPHLISFIPIT  67

Query  236  VPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLA  415
            VP + GL PGAETT+DVPFPS  LLM AMD TQ  I   + +L  D VF+DFT WLP L 
Sbjct  68   VPHVDGLLPGAETTNDVPFPSYSLLMTAMDLTQPAILQAICELNPDFVFFDFTPWLPKLL  127

Query  416  RKI--GIKSVFYSTISPLMHGYALSPERRVVGKQ--LTEADMMK  535
            R++  GIKS+ Y  I+P + GY  SPER+V+ ++  LTE D++ 
Sbjct  128  RQLGTGIKSINYIIITPALVGYVRSPERKVLMEKSVLTEDDLIN  171



>ref|XP_003596667.1| Anthocyanidin 3-O-glucosyltransferase [Medicago truncatula]
Length=463

 Score =   182 bits (462),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/163 (54%), Positives = 115/163 (71%), Gaps = 0/163 (0%)
 Frame = +2

Query  53   TTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPI  232
            ++ H+AM+PWF +GHLT +  L+NKLA +GH+ISF IPK TQ+KLE FNL+P+LI+F P+
Sbjct  9    SSLHIAMFPWFAMGHLTPYLHLSNKLAKRGHKISFFIPKKTQTKLEQFNLYPNLITFYPL  68

Query  233  VVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSL  412
             VP I GLP GAETTSDV F    L+M AMD+TQ  +E++L  L  ++VF+DFT WLP +
Sbjct  69   NVPHIHGLPFGAETTSDVSFSLGPLIMTAMDQTQPQVELLLTQLNPEIVFFDFTFWLPKI  128

Query  413  ARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
            A  +GIKS+    +SP    Y  SP R   G  LTE D+MK P
Sbjct  129  AHNLGIKSLQCWIVSPATVSYNASPSRMCEGTNLTEFDLMKPP  171



>gb|AES66918.2| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=476

 Score =   182 bits (462),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/163 (54%), Positives = 115/163 (71%), Gaps = 0/163 (0%)
 Frame = +2

Query  53   TTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPI  232
            ++ H+AM+PWF +GHLT +  L+NKLA +GH+ISF IPK TQ+KLE FNL+P+LI+F P+
Sbjct  22   SSLHIAMFPWFAMGHLTPYLHLSNKLAKRGHKISFFIPKKTQTKLEQFNLYPNLITFYPL  81

Query  233  VVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSL  412
             VP I GLP GAETTSDV F    L+M AMD+TQ  +E++L  L  ++VF+DFT WLP +
Sbjct  82   NVPHIHGLPFGAETTSDVSFSLGPLIMTAMDQTQPQVELLLTQLNPEIVFFDFTFWLPKI  141

Query  413  ARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
            A  +GIKS+    +SP    Y  SP R   G  LTE D+MK P
Sbjct  142  AHNLGIKSLQCWIVSPATVSYNASPSRMCEGTNLTEFDLMKPP  184



>ref|XP_003540019.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Glycine max]
 gb|KHN27788.1| UDP-glycosyltransferase 79B6 [Glycine soja]
Length=455

 Score =   182 bits (461),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 95/169 (56%), Positives = 117/169 (69%), Gaps = 7/169 (4%)
 Frame = +2

Query  38   MGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLI  217
            M + A   H+AMYPWF +GHLT F  LANKLA +GH+ISF IP+ TQ+KLE  NLHP+LI
Sbjct  1    MDADAAPLHIAMYPWFAMGHLTPFLHLANKLAKRGHKISFFIPRRTQAKLEDLNLHPNLI  60

Query  218  SFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDF-T  394
            +FVPI VP + GLP  AETTSDVP     L+  AMD T+ +IE++L DLK  +V +DF T
Sbjct  61   TFVPINVPHVDGLPYDAETTSDVPSSLFPLIATAMDLTEKNIELLLLDLKPHIVLFDFST  120

Query  395  HWLPSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
            +WLP+LAR+IGIKS+ Y  ISP   GY  SP R+       E DM K P
Sbjct  121  YWLPNLARRIGIKSLQYWIISPATVGYMASPARQ------REDDMRKPP  163



>ref|XP_010093983.1| UDP-glycosyltransferase [Morus notabilis]
 gb|EXB54970.1| UDP-glycosyltransferase [Morus notabilis]
Length=453

 Score =   181 bits (460),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 86/152 (57%), Positives = 114/152 (75%), Gaps = 1/152 (1%)
 Frame = +2

Query  38   MGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLI  217
            M +  ++ H+AMYPWF  GH+T F  L+NKLA +GH+ISF +P  TQSK+E FN  PHLI
Sbjct  1    MEADDSSLHIAMYPWFAFGHITPFLHLSNKLAKRGHKISFFVPTRTQSKIEHFNHFPHLI  60

Query  218  SFVPIVVPSIPGLPPGAETTSDVPFPSTH-LLMEAMDKTQNDIEIILKDLKVDVVFYDFT  394
            +F PI VP I GLP GAETT DVP P    L++ AM+KT+  IE++L++LK D++F+DF 
Sbjct  61   TFAPITVPHIDGLPLGAETTYDVPNPLLFPLIIMAMEKTKLQIELLLRNLKPDIIFFDFA  120

Query  395  HWLPSLARKIGIKSVFYSTISPLMHGYALSPE  490
            HW+P+LAR +GIKSVFYS ISP+  GY ++ E
Sbjct  121  HWIPNLARPLGIKSVFYSIISPVSIGYGVARE  152



>ref|XP_004505528.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Cicer arietinum]
 gb|AGU14090.1| UDP-glycosyltransferase [Cicer arietinum]
Length=465

 Score =   181 bits (460),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 85/160 (53%), Positives = 113/160 (71%), Gaps = 0/160 (0%)
 Frame = +2

Query  62   HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVP  241
            H+AM+PWF +GH T F  L+NKLA KGH+I+F  P+  +SKL+ FNLHP  I+F+ I VP
Sbjct  8    HIAMFPWFAMGHQTAFLHLSNKLAKKGHKITFFTPQKAESKLKPFNLHPESITFITITVP  67

Query  242  SIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARK  421
             +  LPP ++TT+DVP+P    +M AMD T+ DIE  L +LK  +VFYDFTHW+PS+ + 
Sbjct  68   HVDPLPPNSQTTADVPYPLQPHIMTAMDLTRPDIESHLLNLKPHIVFYDFTHWIPSVTKA  127

Query  422  IGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
            +GIK + Y T S +M GY LSP R   GK LTE D+M+ P
Sbjct  128  LGIKCLHYCTASSVMVGYTLSPARYSKGKDLTEFDLMEPP  167



>ref|XP_004487584.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Cicer arietinum]
Length=458

 Score =   180 bits (457),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 84/163 (52%), Positives = 113/163 (69%), Gaps = 0/163 (0%)
 Frame = +2

Query  53   TTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPI  232
            ++ H+AM+PWF +GHL  +  L+NKLA +GH+ISF  PK TQ+KLE FNL+P+LI+F P+
Sbjct  5    SSLHIAMFPWFAMGHLIPYLHLSNKLAKRGHKISFFTPKKTQTKLEQFNLYPNLITFYPL  64

Query  233  VVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSL  412
             VP + GLP GAETTSDV      +LM AMD+TQN IE++L  LK  ++F+DF  WLP +
Sbjct  65   NVPHVDGLPFGAETTSDVAISLGPILMTAMDQTQNQIELLLTQLKPQIIFFDFVFWLPKI  124

Query  413  ARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
             +++GIKS  Y  I+P    Y  SP R    + LTE D+MK P
Sbjct  125  TQRLGIKSFLYFIINPATISYTTSPPRMFEAENLTEVDLMKPP  167



>ref|XP_006593292.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Glycine max]
Length=414

 Score =   179 bits (453),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 83/168 (49%), Positives = 115/168 (68%), Gaps = 0/168 (0%)
 Frame = +2

Query  38   MGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLI  217
            M + A + H+AM+PWF +GH   F  L+NKLA +GH+ISF  P+ TQ+KL+  NLHPH I
Sbjct  1    MDAHAPSMHIAMFPWFAMGHFIPFLHLSNKLAKRGHKISFFTPRRTQTKLQHLNLHPHHI  60

Query  218  SFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTH  397
            +FVPI VP + GLP  AETTSDVP     L+  AMD T+  IE++L++LK  +VF+DF H
Sbjct  61   TFVPINVPHVDGLPHDAETTSDVPSSLFPLIATAMDSTEKHIELLLRELKPQIVFFDFQH  120

Query  398  WLPSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
            WLP++ R +GIK + Y  ++P    Y  +  R++ G +LTE D+MK P
Sbjct  121  WLPNITRSLGIKCIQYWILNPSTIAYLWNGPRQIQGGELTEVDLMKPP  168



>ref|XP_003596676.1| Anthocyanidin 3-O-glucosyltransferase, partial [Medicago truncatula]
Length=389

 Score =   178 bits (452),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/163 (53%), Positives = 113/163 (69%), Gaps = 0/163 (0%)
 Frame = +2

Query  53   TTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPI  232
            ++ H+AM+PWF +GHLT +  L+NKLA +GH+ISF IP  TQ+KLE FNL+P+LI+F P+
Sbjct  5    SSLHIAMFPWFAMGHLTPYLHLSNKLAKRGHKISFFIPTKTQTKLEQFNLYPNLITFYPL  64

Query  233  VVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSL  412
             VP I GLP GAETTSDV F    L+M AMD+TQ  +E++L  L   +VF+DF  W+P +
Sbjct  65   NVPHIHGLPFGAETTSDVSFSLGPLIMTAMDQTQPQVELLLAQLNPKMVFFDFAFWIPKI  124

Query  413  ARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
            A+ +GIKS  Y  +SP    Y LSP R      LTE D+MK P
Sbjct  125  AQSLGIKSFQYWIVSPATISYTLSPSRMCESINLTEFDLMKPP  167



>ref|XP_010666234.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Beta vulgaris subsp. vulgaris]
Length=459

 Score =   179 bits (455),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 112/154 (73%), Gaps = 1/154 (1%)
 Frame = +2

Query  62   HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVP  241
            H+AMY WF  GHLT F +LANKLA +GH+ISF +P  TQ KL   N HPHLI+F+PI VP
Sbjct  10   HIAMYSWFAFGHLTSFLQLANKLAQRGHKISFFLPTKTQQKLTPHNHHPHLITFIPIAVP  69

Query  242  SIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARK  421
            ++ GLP GAETT+DVP+ +  L+M AMD TQ+ IE +L  LK D+VF+DFT WLP++ARK
Sbjct  70   AVEGLPSGAETTADVPYEARSLIMAAMDLTQDTIESLLSQLKPDLVFFDFTEWLPNVARK  129

Query  422  IGIKSVFYSTISPLMHGYALSPER-RVVGKQLTE  520
             G+KSV+Y+T+  +   Y L   R ++ G+ LT 
Sbjct  130  HGVKSVYYATLLAVSGAYFLPRARAQLGGRDLTR  163



>ref|XP_009352834.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Pyrus x bretschneideri]
Length=471

 Score =   180 bits (456),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 93/162 (57%), Positives = 121/162 (75%), Gaps = 4/162 (2%)
 Frame = +2

Query  62   HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVP  241
            H+AMYPWF +GHLT +  L+NKLA +GHRISF +P  TQ KL++ NLHPHLISF+PI VP
Sbjct  11   HIAMYPWFAMGHLTSYLHLSNKLAERGHRISFFVPTKTQQKLQALNLHPHLISFIPITVP  70

Query  242  SIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARK  421
             + GLPPGAETT+DVPFPS  LLM+AMD TQ  I  ++ +L  + VF+DFT WLP L R+
Sbjct  71   HVDGLPPGAETTNDVPFPSYSLLMDAMDLTQPAILQLICELNPNFVFFDFTPWLPKLLRQ  130

Query  422  IGI--KSVFYSTISPLMHGYALSPERRVVGKQ--LTEADMMK  535
            +G   KS++Y  ISP + GY  SPER+V+ ++  LTE D++ 
Sbjct  131  LGTGIKSIYYIIISPAIVGYVRSPERKVLMEKSVLTEDDLIN  172



>ref|XP_009353146.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Pyrus x bretschneideri]
Length=459

 Score =   179 bits (455),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 89/162 (55%), Positives = 113/162 (70%), Gaps = 2/162 (1%)
 Frame = +2

Query  62   HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVP  241
            H+AMYPWF +GHLT F  ++NKLA +GHRISF IP  T  KLE+FNL+P  I+F+PI VP
Sbjct  7    HVAMYPWFAMGHLTSFLHISNKLAERGHRISFFIPVKTLQKLEAFNLYPDRIAFIPINVP  66

Query  242  SIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARK  421
             +PGLPPG ETT+DVPFP   LLM  MD T+ +I   L++LK D VF+DFT W+P L  +
Sbjct  67   HVPGLPPGTETTADVPFPLHSLLMTTMDLTRPEIGQALRELKPDFVFFDFTQWMPELLHE  126

Query  422  I--GIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
            +  G KS+ Y TISP    Y  + ER ++ KQ T AD+M  P
Sbjct  127  LDMGTKSIHYCTISPATVLYLSTLERNLMEKQPTAADLMLPP  168



>ref|XP_004307624.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Fragaria vesca subsp. vesca]
Length=459

 Score =   179 bits (454),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 89/164 (54%), Positives = 115/164 (70%), Gaps = 2/164 (1%)
 Frame = +2

Query  56   TYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIV  235
            T H+AMYPWF +GHLT +  ++NKLA +GH+ISF IP  TQ K+  FNLHPHLISF+PI 
Sbjct  5    TMHIAMYPWFAMGHLTSYLHISNKLAERGHKISFFIPIKTQPKMVQFNLHPHLISFIPIN  64

Query  236  VPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLA  415
            VP I GLP G ETT+D+P      L  AMD T+  IE  L+++  + VFYDF++WLP+  
Sbjct  65   VPHIDGLPLGTETTADIPLHLHPHLATAMDLTRPQIEQSLREINPNFVFYDFSYWLPAFL  124

Query  416  RKIG--IKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
            R++G  IKSV Y TISP   GY +SPER++  K LTE +  +AP
Sbjct  125  RQLGKTIKSVHYCTISPATVGYLISPERKLSEKTLTEFEYREAP  168



>ref|XP_008455548.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Cucumis melo]
Length=240

 Score =   173 bits (439),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 83/170 (49%), Positives = 116/170 (68%), Gaps = 2/170 (1%)
 Frame = +2

Query  38   MGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLI  217
            M    ++ H+AMYPWF  G +  F ++ANKLA KGHRISF IP  TQ KL+ FN  P+LI
Sbjct  1    MEESPSSLHVAMYPWFAFGRMIPFLQIANKLANKGHRISFFIPSKTQPKLQHFNHFPNLI  60

Query  218  SFVPIVVPSIPGLPPGAETTSDVPFPST-HLLMEAMDKTQNDIEIILKDLKVDVVFYDFT  394
            +FVPI VP + GLPPGA+TT+D+  PS   L+M +MD+T+ +I   L+D+K +V+F+DF 
Sbjct  61   TFVPITVPHVDGLPPGAQTTADISHPSQLSLIMTSMDRTEPEIASCLQDIKPNVIFFDFA  120

Query  395  HWLPSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQ-LTEADMMKAP  541
            HW+  LA ++GI S++Y+ IS +  GY L   R + G   LT+ D M+ P
Sbjct  121  HWVIKLANQMGITSIYYNVISAVTTGYVLGKIRELSGHDTLTQDDFMQPP  170



>gb|AES66927.2| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=459

 Score =   178 bits (452),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 86/163 (53%), Positives = 113/163 (69%), Gaps = 0/163 (0%)
 Frame = +2

Query  53   TTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPI  232
            ++ H+AM+PWF +GHLT +  L+NKLA +GH+ISF IP  TQ+KLE FNL+P+LI+F P+
Sbjct  5    SSLHIAMFPWFAMGHLTPYLHLSNKLAKRGHKISFFIPTKTQTKLEQFNLYPNLITFYPL  64

Query  233  VVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSL  412
             VP I GLP GAETTSDV F    L+M AMD+TQ  +E++L  L   +VF+DF  W+P +
Sbjct  65   NVPHIHGLPFGAETTSDVSFSLGPLIMTAMDQTQPQVELLLAQLNPKMVFFDFAFWIPKI  124

Query  413  ARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
            A+ +GIKS  Y  +SP    Y LSP R      LTE D+MK P
Sbjct  125  AQSLGIKSFQYWIVSPATISYTLSPSRMCESINLTEFDLMKPP  167



>ref|XP_003596675.1| Anthocyanidin 3-O-glucosyltransferase [Medicago truncatula]
 gb|AES66926.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=458

 Score =   178 bits (451),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 83/160 (52%), Positives = 116/160 (73%), Gaps = 0/160 (0%)
 Frame = +2

Query  62   HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVP  241
            H+AM+PWF +GHLT +  L+NKLA +GH+ISF IPKNT +KL+  NL+P+LI+F PI VP
Sbjct  8    HIAMFPWFAMGHLTPYLHLSNKLALRGHKISFFIPKNTLNKLQYLNLYPNLITFFPITVP  67

Query  242  SIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARK  421
             + GLP  AETTSDVPF    L+  AMD+T+ DIEI+LK++K  +VF+DF +WLP L + 
Sbjct  68   HVNGLPLDAETTSDVPFSLVPLIATAMDQTEKDIEILLKEIKPQIVFFDFQYWLPKLTKN  127

Query  422  IGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
            + IKS+ Y  ++P+   Y    ++  +GK LT+ D+MK P
Sbjct  128  LDIKSLQYIILTPVSTAYLGCLQKLSLGKDLTDVDIMKPP  167



>gb|AFK34819.1| unknown [Medicago truncatula]
Length=458

 Score =   178 bits (451),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 83/160 (52%), Positives = 116/160 (73%), Gaps = 0/160 (0%)
 Frame = +2

Query  62   HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVP  241
            H+AM+PWF +GHLT +  L+NKLA +GH+ISF IPKNT +KL+  NL+P+LI+F PI VP
Sbjct  8    HIAMFPWFAMGHLTPYLHLSNKLALRGHKISFFIPKNTLNKLQYLNLYPNLITFFPITVP  67

Query  242  SIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARK  421
             + GLP  AETTSDVPF    L+  AMD+T+ DIEI+LK++K  +VF+DF +WLP L + 
Sbjct  68   HVNGLPLDAETTSDVPFSLVPLIATAMDQTEKDIEILLKEIKPQIVFFDFQYWLPKLTKN  127

Query  422  IGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
            + IKS+ Y  ++P+   Y    ++  +GK LT+ D+MK P
Sbjct  128  LDIKSLQYIILTPVSTAYLGCLQKLSLGKDLTDVDIMKPP  167



>gb|KHN27960.1| UDP-glycosyltransferase 79B3 [Glycine soja]
Length=519

 Score =   178 bits (452),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 83/168 (49%), Positives = 115/168 (68%), Gaps = 0/168 (0%)
 Frame = +2

Query  38   MGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLI  217
            M + A + H+AM+PWF +GH   F  L+NKLA +GH+ISF  P+ TQ+KL+  NLHPH I
Sbjct  1    MDAHAPSMHIAMFPWFAMGHFIPFLHLSNKLAKRGHKISFFTPRRTQTKLQHLNLHPHHI  60

Query  218  SFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTH  397
            +FVPI VP + GLP  AETTSDVP     L+  AMD T+  IE++L++LK  +VF+DF H
Sbjct  61   TFVPINVPHVDGLPHDAETTSDVPSSLFPLIATAMDSTEKHIELLLRELKPQIVFFDFQH  120

Query  398  WLPSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
            WLP++ R +GIK + Y  ++P    Y  +  R++ G +LTE D+MK P
Sbjct  121  WLPNITRSLGIKCIQYWILNPSTIAYLWNGPRQIQGGELTEVDLMKPP  168



>ref|XP_004487589.1| PREDICTED: UDP-glycosyltransferase 79B1-like [Cicer arietinum]
 gb|AGU14103.1| UDP-glycosyltransferase [Cicer arietinum]
Length=457

 Score =   177 bits (449),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 85/165 (52%), Positives = 116/165 (70%), Gaps = 0/165 (0%)
 Frame = +2

Query  47   QATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFV  226
            +A   H+AM+PW  +GH T +  L+NKLA +GH+ISF IPKNT +KL+  NL+PHLI+FV
Sbjct  2    EAPPLHLAMFPWLAMGHFTPYLHLSNKLAKRGHKISFFIPKNTLNKLQHLNLNPHLITFV  61

Query  227  PIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLP  406
            PI VP + GLP  AET SDVPF    L+  AMD+T+ +IE++LK+LK  +VF+DF +W+P
Sbjct  62   PITVPHVDGLPHDAETASDVPFSLLPLIATAMDETKKEIELLLKELKPQIVFFDFQYWVP  121

Query  407  SLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
            +L +K+GIKSV Y   SP    Y     R+ +GK+LT  D+ K P
Sbjct  122  NLTKKLGIKSVQYWIASPYSISYFFHGPRQSLGKELTVDDLKKPP  166



>ref|XP_003543299.2| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Glycine max]
Length=461

 Score =   177 bits (448),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/158 (53%), Positives = 112/158 (71%), Gaps = 0/158 (0%)
 Frame = +2

Query  62   HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVP  241
            H+AMYPWF +GH   F  L+NKLA +GH+ISF++PK TQ+K++  N HPHLI+ VPI VP
Sbjct  10   HIAMYPWFAMGHFIPFLHLSNKLAKRGHKISFIVPKRTQTKIQHLNQHPHLITLVPITVP  69

Query  242  SIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARK  421
             + GLP  AETTSDV F    LL  AMD+ + DIE++L++LK  +VF+DF+ WLP+LAR 
Sbjct  70   HVDGLPHDAETTSDVLFSFFPLLATAMDRIEKDIELLLRELKPQIVFFDFSFWLPNLARS  129

Query  422  IGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMK  535
            +GIKSV Y  ++ +   Y  SPER   G+ L+E D  K
Sbjct  130  LGIKSVQYFIVNAVSVAYFGSPERYHNGRDLSETDFTK  167



>ref|XP_008371430.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Malus domestica]
Length=459

 Score =   176 bits (447),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 87/162 (54%), Positives = 109/162 (67%), Gaps = 2/162 (1%)
 Frame = +2

Query  62   HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVP  241
            H+AMYPWF +GHL  F    NKLA +GHRISF +P  T  KL++FNL+P  I+F+PI VP
Sbjct  7    HVAMYPWFAMGHLIAFLHTCNKLAERGHRISFFVPVQTLQKLQAFNLYPDRIAFIPINVP  66

Query  242  SIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARK  421
             + GLPPG ETT+DVPFP   LLM AMD T+  +   L++LK D VF+DFTHW+P L  +
Sbjct  67   HVDGLPPGTETTTDVPFPLHSLLMTAMDLTRPAVGQALRELKPDFVFFDFTHWMPELLHE  126

Query  422  I--GIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
            +  GIKS+ Y  ISP   GY  +PER    K  T AD+M  P
Sbjct  127  LDMGIKSIHYCIISPATIGYLSTPERNPTEKLPTAADLMLPP  168



>ref|XP_007132948.1| hypothetical protein PHAVU_011G138500g [Phaseolus vulgaris]
 gb|ESW04942.1| hypothetical protein PHAVU_011G138500g [Phaseolus vulgaris]
Length=448

 Score =   176 bits (446),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 114/164 (70%), Gaps = 10/164 (6%)
 Frame = +2

Query  50   ATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVP  229
            +++ H+AM+PWF +GHLT F  L+NKLA +GH+ISF IP  TQSKLE FNL P LI+F P
Sbjct  3    SSSLHIAMFPWFAMGHLTPFLHLSNKLAKRGHKISFFIPTRTQSKLEQFNLFPDLITFFP  62

Query  230  IVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPS  409
            I VP + GLP GAETTSDV F    L+M AMD+T+ DIE++L DLK  +VF+DFT+WLP+
Sbjct  63   INVPHVEGLPHGAETTSDVSFSLGPLIMTAMDRTEKDIELLLLDLKPQIVFFDFTYWLPN  122

Query  410  LARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
            +  ++GIKS  Y  +SP    Y  SP          ++D+M+ P
Sbjct  123  ITSRLGIKSFQYFIVSPATVSYIRSP----------QSDLMQPP  156



>gb|AES66921.2| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=434

 Score =   175 bits (443),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 84/160 (53%), Positives = 114/160 (71%), Gaps = 0/160 (0%)
 Frame = +2

Query  62   HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVP  241
            H+AM+PWF +GHLT +   +NKLA +GH+ISF IPKNT +KL+  NLHP+LI+F PI VP
Sbjct  8    HIAMFPWFAMGHLTPYLHFSNKLAIRGHKISFFIPKNTLNKLQHLNLHPNLITFFPITVP  67

Query  242  SIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARK  421
             + GLP  AETTSDVPF    L+  AMD+T   IE++LK+LK  +VF+DF +WLP+L +K
Sbjct  68   HVNGLPHNAETTSDVPFSLFPLIATAMDQTDKQIELLLKELKPQIVFFDFQYWLPNLTQK  127

Query  422  IGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
            +GIKS+ Y   +P+   Y  +  R+  GK LT+ D+ K P
Sbjct  128  LGIKSLQYLIWNPISSAYLGNIPRKSQGKYLTKDDLKKPP  167



>ref|XP_011087015.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Sesamum indicum]
Length=452

 Score =   175 bits (443),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 82/146 (56%), Positives = 104/146 (71%), Gaps = 0/146 (0%)
 Frame = +2

Query  53   TTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPI  232
             +  + MYPWF +GHLT F  +++K A KGH+I F++P  TQSKL+ FNLHP+LI F+PI
Sbjct  4    NSLKIVMYPWFAMGHLTAFLHISDKFAEKGHKIFFILPTKTQSKLDQFNLHPNLIKFIPI  63

Query  233  VVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSL  412
             VP + GLP G+ETT+DVPFP   LL  AMD T+  IE  L++LK   VF+DFTHWLP+L
Sbjct  64   TVPQVDGLPDGSETTADVPFPMYSLLRHAMDLTEPVIEGFLRELKPHFVFFDFTHWLPAL  123

Query  413  ARKIGIKSVFYSTISPLMHGYALSPE  490
            AR++GIKSV Y TISP    Y    E
Sbjct  124  ARRLGIKSVHYCTISPASVAYLFRDE  149



>ref|XP_003596670.1| Anthocyanidin 3-O-glucosyltransferase [Medicago truncatula]
Length=458

 Score =   175 bits (443),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 84/160 (53%), Positives = 114/160 (71%), Gaps = 0/160 (0%)
 Frame = +2

Query  62   HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVP  241
            H+AM+PWF +GHLT +   +NKLA +GH+ISF IPKNT +KL+  NLHP+LI+F PI VP
Sbjct  8    HIAMFPWFAMGHLTPYLHFSNKLAIRGHKISFFIPKNTLNKLQHLNLHPNLITFFPITVP  67

Query  242  SIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARK  421
             + GLP  AETTSDVPF    L+  AMD+T   IE++LK+LK  +VF+DF +WLP+L +K
Sbjct  68   HVNGLPHNAETTSDVPFSLFPLIATAMDQTDKQIELLLKELKPQIVFFDFQYWLPNLTQK  127

Query  422  IGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
            +GIKS+ Y   +P+   Y  +  R+  GK LT+ D+ K P
Sbjct  128  LGIKSLQYLIWNPISSAYLGNIPRKSQGKYLTKDDLKKPP  167



>gb|KHN36713.1| UDP-glycosyltransferase 79B6 [Glycine soja]
Length=461

 Score =   174 bits (442),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 83/158 (53%), Positives = 111/158 (70%), Gaps = 0/158 (0%)
 Frame = +2

Query  62   HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVP  241
            H+AMYPWF +GH   F  L+NKLA +GH+ISF++PK TQ+K++  N HPHLI+ VPI VP
Sbjct  10   HIAMYPWFAMGHFIPFLHLSNKLAKRGHKISFIVPKRTQTKIQHLNQHPHLITLVPITVP  69

Query  242  SIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARK  421
             + GLP  AETT DV F    LL  AMD+ + DIE++L++LK  +VF+DF+ WLP+LAR 
Sbjct  70   HVDGLPHDAETTLDVLFSFFPLLATAMDRIEKDIELLLRELKPQIVFFDFSFWLPNLARS  129

Query  422  IGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMK  535
            +GIKSV Y  ++ +   Y  SPER   G+ L+E D  K
Sbjct  130  LGIKSVQYFIVNAVSVAYFGSPERYHNGRDLSETDFTK  167



>gb|AES66919.2| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=437

 Score =   173 bits (439),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 84/160 (53%), Positives = 112/160 (70%), Gaps = 0/160 (0%)
 Frame = +2

Query  62   HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVP  241
            H++M+PWF +GH T +   +NKLA +GH+ISF IPKNT +KL+  NLHP+LI+F PI VP
Sbjct  8    HISMFPWFAMGHFTPYLHFSNKLAIRGHKISFFIPKNTLNKLQHLNLHPNLITFFPITVP  67

Query  242  SIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARK  421
             + GLP  AETTSDVPF    L+  AMD+T   IE++LK+LK  +VF+DF +WLP+L +K
Sbjct  68   HVNGLPHNAETTSDVPFSLFPLIATAMDQTDKQIELLLKELKPQIVFFDFQYWLPNLTQK  127

Query  422  IGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
            +GIKS+ Y   SP+   Y  S  R+  G  LTE D+ K P
Sbjct  128  LGIKSLQYLIWSPISPAYLGSIPRKSQGTYLTEDDLKKPP  167



>ref|XP_007132923.1| hypothetical protein PHAVU_011G136400g [Phaseolus vulgaris]
 gb|ESW04917.1| hypothetical protein PHAVU_011G136400g [Phaseolus vulgaris]
Length=461

 Score =   174 bits (440),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 76/156 (49%), Positives = 113/156 (72%), Gaps = 0/156 (0%)
 Frame = +2

Query  62   HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVP  241
            H+AMYPWF +GH++ +  LANKLA +GH+ISF++PK T+SK+E FNL+P L++F+PI +P
Sbjct  9    HIAMYPWFAIGHISAYLHLANKLAKRGHKISFIVPKLTKSKVEHFNLYPQLVTFIPITMP  68

Query  242  SIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARK  421
             + GLPP AETT D       L+M  MD+T+ DIE++L +LK ++VF+D+T W+P+LAR 
Sbjct  69   LVDGLPPHAETTFDATISLGKLIMTGMDRTEKDIELLLLELKPNIVFFDYTCWMPNLARS  128

Query  422  IGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADM  529
            +GIKSV Y T+S +   Y    E++   K + E ++
Sbjct  129  LGIKSVHYITLSMIFESYMECMEKQFSEKNIAEHEL  164



>emb|CDO96715.1| unnamed protein product [Coffea canephora]
Length=437

 Score =   173 bits (439),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 82/151 (54%), Positives = 109/151 (72%), Gaps = 6/151 (4%)
 Frame = +2

Query  89   VGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVPSIPGLPPGA  268
            +GHLT F  ++NKLA  GH+I FL+P+ TQ++L+ FNL+P LI F+P+ VP + GLPPGA
Sbjct  1    MGHLTAFLHMSNKLADGGHKIFFLLPRKTQAQLKQFNLYPDLIDFIPLCVPQVEGLPPGA  60

Query  269  ETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARKIGIKSVFYS  448
            ETT+D+PF     L  AMD TQ  IE IL+++K  VVF+DFTHWLP LAR++GIKS+F+ 
Sbjct  61   ETTADIPFHLQPNLRLAMDSTQPQIESILQEIKPQVVFFDFTHWLPKLARRLGIKSIFFI  120

Query  449  TISPLMHGYALSPERRVVGKQLTEADMMKAP  541
            T+S    GY         G+Q T+AD+MKAP
Sbjct  121  TMSSATSGYTFR------GEQTTDADLMKAP  145



>ref|XP_010245594.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Nelumbo nucifera]
Length=461

 Score =   174 bits (440),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 81/156 (52%), Positives = 112/156 (72%), Gaps = 1/156 (1%)
 Frame = +2

Query  71   MYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVPSIP  250
            MYPWF +GH+  F  L+NKLA  GHR+SFL+P  TQSKL+  N +P LI F+PI +P + 
Sbjct  1    MYPWFAIGHIVPFLHLSNKLAENGHRVSFLLPPKTQSKLQHLNRYPDLIRFIPIAIPPVD  60

Query  251  GLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARKIGI  430
            GLPP AETT+DV  P   LL++AM+ T++ +E  L+++K D VF+DF++WLP LAR++GI
Sbjct  61   GLPPTAETTADVSRPIMPLLVDAMNLTKDQVEAALRNIKPDFVFFDFSYWLPPLARQLGI  120

Query  431  KSVFYSTISPLMHGYALSPERRVVG-KQLTEADMMK  535
            KS+ Y  ISP    Y L P R+  G +QLTE ++M+
Sbjct  121  KSILYCVISPASTSYLLVPARKPDGIEQLTEEELMQ  156



>ref|XP_003596668.1| Anthocyanidin 3-O-glucosyltransferase [Medicago truncatula]
Length=461

 Score =   174 bits (440),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 84/160 (53%), Positives = 112/160 (70%), Gaps = 0/160 (0%)
 Frame = +2

Query  62   HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVP  241
            H++M+PWF +GH T +   +NKLA +GH+ISF IPKNT +KL+  NLHP+LI+F PI VP
Sbjct  8    HISMFPWFAMGHFTPYLHFSNKLAIRGHKISFFIPKNTLNKLQHLNLHPNLITFFPITVP  67

Query  242  SIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARK  421
             + GLP  AETTSDVPF    L+  AMD+T   IE++LK+LK  +VF+DF +WLP+L +K
Sbjct  68   HVNGLPHNAETTSDVPFSLFPLIATAMDQTDKQIELLLKELKPQIVFFDFQYWLPNLTQK  127

Query  422  IGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
            +GIKS+ Y   SP+   Y  S  R+  G  LTE D+ K P
Sbjct  128  LGIKSLQYLIWSPISPAYLGSIPRKSQGTYLTEDDLKKPP  167



>ref|XP_008455479.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Cucumis melo]
Length=469

 Score =   173 bits (439),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 85/167 (51%), Positives = 111/167 (66%), Gaps = 1/167 (1%)
 Frame = +2

Query  44   SQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISF  223
            +  ++ H+AMYPWF  GHL  + ++ANKLA KGHRISFLIP NTQ KL+ FN  P+LI+F
Sbjct  2    AATSSLHIAMYPWFAFGHLIPYLQIANKLAKKGHRISFLIPSNTQPKLQPFNHFPNLITF  61

Query  224  VPIVVPSIPGLPPGAETTSDVP-FPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHW  400
            +PI+VP + GLP GAETT+DV       L+M AMD TQ  IE  L+ +K    F+DFT+W
Sbjct  62   LPIIVPHVNGLPQGAETTADVSNLQQFSLIMTAMDLTQPQIESFLQHVKPHFFFFDFTYW  121

Query  401  LPSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
            +P LA + GIKS+++S IS     Y   P R++ G   T  D MK P
Sbjct  122  MPKLASQFGIKSIYHSVISATTFAYVYPPSRQLCGHDFTVDDFMKPP  168



>ref|XP_003596666.1| UDP rhamnose-anthocyanidin-3-glucoside rhamnosyltransferase-like 
protein [Medicago truncatula]
 gb|AES66917.1| UDP-glycosyltransferase superfamily protein [Medicago truncatula]
Length=374

 Score =   171 bits (433),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 85/166 (51%), Positives = 114/166 (69%), Gaps = 0/166 (0%)
 Frame = +2

Query  44   SQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISF  223
            S     H+AM+PWF +GH T F RL+NKL  +GH+ISF+IPKNT +KL+  NLHP+LI+ 
Sbjct  23   SMVCPLHIAMFPWFAMGHSTPFIRLSNKLVIRGHKISFIIPKNTLNKLQHLNLHPNLITI  82

Query  224  VPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWL  403
            VPI VP +  LP  AETTSDVP     L+  AMD+T+  IE +LK+LK  +VF+DF +WL
Sbjct  83   VPITVPHVNCLPHDAETTSDVPSSLFPLIATAMDQTEKQIESLLKELKPQIVFFDFQYWL  142

Query  404  PSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
            P+L +K+GIKS+ Y   +P+   Y  +  R+  G  LTE D+MK P
Sbjct  143  PNLTQKLGIKSLQYLIWNPISSAYLGNIPRQSQGSFLTEFDLMKPP  188



>gb|EYU28028.1| hypothetical protein MIMGU_mgv1a006231mg [Erythranthe guttata]
Length=451

 Score =   172 bits (435),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 79/145 (54%), Positives = 103/145 (71%), Gaps = 0/145 (0%)
 Frame = +2

Query  56   TYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIV  235
            T+ + MYPW  +GHLT F  ++NKLA +GHRI  ++P NTQSKL+ FNLHP+LI+F PI 
Sbjct  5    TFRIVMYPWLAIGHLTSFLHISNKLAERGHRIFLILPLNTQSKLQQFNLHPNLITFNPIT  64

Query  236  VPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLA  415
            VP +  LP G ETTSDVPFP    L  AMD T+  I  +L++L+ D V +DF HWLP++A
Sbjct  65   VPQVENLPNGTETTSDVPFPLYKNLRHAMDLTKPAITHLLQELEPDFVLFDFAHWLPAVA  124

Query  416  RKIGIKSVFYSTISPLMHGYALSPE  490
            R +GIKS++Y TISP   GY +  E
Sbjct  125  RSLGIKSIYYCTISPAAVGYLVREE  149



>ref|XP_003596671.1| Anthocyanidin 3-O-glucosyltransferase [Medicago truncatula]
 gb|AES66922.1| UDP-glucosyltransferase family protein [Medicago truncatula]
 gb|AFK38670.1| unknown [Medicago truncatula]
Length=458

 Score =   172 bits (435),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/160 (53%), Positives = 111/160 (69%), Gaps = 0/160 (0%)
 Frame = +2

Query  62   HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVP  241
            H+AM+PWF +GH T +  L+NKLA KGH+ISF IPK TQ+KL+  NL+P+LI+F P+ VP
Sbjct  8    HIAMFPWFAMGHFTPYLHLSNKLAKKGHKISFFIPKKTQTKLQHLNLNPNLITFYPLNVP  67

Query  242  SIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARK  421
             I GLP GAET+SDVPF    L+  AMD+T+  IE +LK+L   +VF+DF +WLP+L +K
Sbjct  68   HIDGLPDGAETSSDVPFSLVPLIATAMDQTEKQIEHLLKELNPQIVFFDFQYWLPNLTQK  127

Query  422  IGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
            +GIKS+ Y   SP    Y  +  R   GK LT  D+ K P
Sbjct  128  LGIKSLQYWITSPFSISYFWNGPRHSQGKGLTVDDLKKPP  167



>ref|XP_007149716.1| hypothetical protein PHAVU_005G093300g [Phaseolus vulgaris]
 gb|ESW21710.1| hypothetical protein PHAVU_005G093300g [Phaseolus vulgaris]
Length=475

 Score =   172 bits (435),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 89/167 (53%), Positives = 119/167 (71%), Gaps = 0/167 (0%)
 Frame = +2

Query  41   GSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLIS  220
             + A   H+A++PWF +GHLT    L+NKLA +GHRISF++P+ TQ+KL   NLHPHLI+
Sbjct  3    AASAAPLHIAIFPWFAMGHLTPNLHLSNKLAERGHRISFIVPQRTQTKLHHLNLHPHLIT  62

Query  221  FVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHW  400
            F+PI +P + GLP  AETTSDVPF    LL  AMD+TQ DIE++L+DL   +VF+DF HW
Sbjct  63   FIPIKLPHVHGLPHHAETTSDVPFSLFPLLTTAMDRTQKDIELLLRDLNPQIVFFDFQHW  122

Query  401  LPSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
            LP+L+R + IKSV Y  + PL   Y +   RR  G++LTE D+M+ P
Sbjct  123  LPNLSRSLSIKSVMYLILHPLSSAYLVEDPRRSQGRELTELDLMEPP  169



>ref|XP_007132949.1| hypothetical protein PHAVU_011G138600g [Phaseolus vulgaris]
 gb|ESW04943.1| hypothetical protein PHAVU_011G138600g [Phaseolus vulgaris]
Length=466

 Score =   171 bits (434),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 88/167 (53%), Positives = 119/167 (71%), Gaps = 0/167 (0%)
 Frame = +2

Query  41   GSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLIS  220
             + A   H+A++PW  +GHLT    L+NKLA +GHRISF++P+ TQ+KL   NLHPHLI+
Sbjct  3    AASAAPLHIAIFPWLAMGHLTPNLLLSNKLAERGHRISFIVPQRTQTKLHHLNLHPHLIT  62

Query  221  FVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHW  400
            F+PI +P + GLP  AETTSD+PF    LL  AMD+TQ DIE++L+DL   +VF+DF HW
Sbjct  63   FIPIKLPHVHGLPHHAETTSDIPFSLFPLLATAMDRTQKDIELLLRDLNPQIVFFDFQHW  122

Query  401  LPSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
            LP+L+R +GIKSV Y  + PL   Y +   RR  G++LTE D+M+ P
Sbjct  123  LPNLSRSLGIKSVMYLMLHPLSSAYLVEEPRRSQGRELTELDLMEPP  169



>ref|XP_004144602.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Cucumis sativus]
 ref|XP_004164963.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Cucumis sativus]
 gb|KGN43484.1| hypothetical protein Csa_7G041300 [Cucumis sativus]
Length=460

 Score =   169 bits (429),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 81/167 (49%), Positives = 114/167 (68%), Gaps = 1/167 (1%)
 Frame = +2

Query  44   SQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISF  223
            +  ++ H+AM+PWF  GHL  + ++ANKLA KGH+ISFLIP  TQ KL+ FN  P+LI+F
Sbjct  2    AATSSLHIAMFPWFAFGHLAPYLQIANKLAKKGHKISFLIPSKTQVKLQPFNHFPNLITF  61

Query  224  VPIVVPSIPGLPPGAETTSDVP-FPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHW  400
            VPI+VP + GLP GAE T+DV      +L+M AMD TQ  I+ +L+ +K  V+F+DFT W
Sbjct  62   VPIIVPHVDGLPEGAEITADVSNLHEFNLIMTAMDLTQPQIKTLLQLIKPHVIFFDFTFW  121

Query  401  LPSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
            +P LA ++GIKS++YS IS     Y  +P R++ G   T  + M+ P
Sbjct  122  IPKLASQLGIKSIYYSVISATTFSYVFTPTRQLCGPDFTVDEFMQPP  168



>emb|CBI20243.3| unnamed protein product [Vitis vinifera]
Length=358

 Score =   167 bits (422),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 75/151 (50%), Positives = 106/151 (70%), Gaps = 0/151 (0%)
 Frame = +2

Query  44   SQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISF  223
            +++T  H+AMYPWF  GHLT +  L+N+LA +GH+I+F++PK  QS+L+  NLHP LI+F
Sbjct  4    ARSTKLHIAMYPWFAFGHLTPYLHLSNELAERGHKITFILPKKAQSQLQHLNLHPTLITF  63

Query  224  VPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWL  403
             P+ +P + GLPPGAET SDVPF   HLL+ AMD+T + +E  L+ LK D + +DF +W 
Sbjct  64   HPLTIPHVDGLPPGAETASDVPFFMHHLLVTAMDRTADQVEAALRALKPDFLLFDFPYWA  123

Query  404  PSLARKIGIKSVFYSTISPLMHGYALSPERR  496
            P+LA K+GIKS++YS +          PE R
Sbjct  124  PTLASKLGIKSIYYSAVCAAALARHPVPEDR  154



>ref|XP_008455481.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Cucumis melo]
 ref|XP_008455483.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Cucumis melo]
Length=463

 Score =   169 bits (428),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 81/170 (48%), Positives = 117/170 (69%), Gaps = 1/170 (1%)
 Frame = +2

Query  35   SMGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHL  214
            S  +  ++ H+AM+PWF  GHL+ + ++ANKLA KGH+ISFLIP   ++KL+ FN  P+L
Sbjct  2    STMAATSSLHIAMFPWFAFGHLSPYLQIANKLAKKGHKISFLIPSKIRAKLQPFNHFPNL  61

Query  215  ISFVPIVVPSIPGLPPGAETTSDVP-FPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDF  391
            I+FVPI+VP + GLP GAETT+DV      +L+M AMD TQ  I+ +L+ +K  V+F+DF
Sbjct  62   ITFVPIIVPHVDGLPEGAETTADVSNLHQFNLIMTAMDLTQPQIKSLLQHIKPHVIFFDF  121

Query  392  THWLPSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
            T W+P LA ++GIKS++YS IS     Y  +P R++ G   T  + +K P
Sbjct  122  TFWIPKLASQLGIKSIYYSVISATTFSYVFTPTRQLCGPDFTVDEFIKPP  171



>ref|XP_010686377.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Beta vulgaris subsp. vulgaris]
Length=466

 Score =   169 bits (428),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 84/160 (53%), Positives = 106/160 (66%), Gaps = 0/160 (0%)
 Frame = +2

Query  62   HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVP  241
            H+AM PWF  GH+T F  LANKLA KGH ISF IP  T+ K  S N HPHLI+ +PI +P
Sbjct  12   HIAMCPWFAFGHITSFLHLANKLAEKGHTISFFIPTKTKLKFVSHNHHPHLITLIPITLP  71

Query  242  SIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARK  421
            S+ GL  GAETT+DVP  S  L+M AMD+TQ+ IE  L  +K D +F+DFT W+P +ARK
Sbjct  72   SVHGLHVGAETTADVPASSRSLIMAAMDQTQDTIESHLAHIKPDFIFFDFTEWIPKVARK  131

Query  422  IGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
              IKSVFYST+  +   Y L   R++     +E DM + P
Sbjct  132  HQIKSVFYSTVYLVTVAYLLPQPRKLAINCFSEEDMKQPP  171



>ref|XP_007212397.1| hypothetical protein PRUPE_ppa016365mg [Prunus persica]
 gb|EMJ13596.1| hypothetical protein PRUPE_ppa016365mg [Prunus persica]
Length=290

 Score =   164 bits (414),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 75/172 (44%), Positives = 107/172 (62%), Gaps = 6/172 (3%)
 Frame = +2

Query  44   SQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISF  223
            + ++ +H+AM+PWF +GH   F  L+N+LA +GH+ISFL+PK  Q +++  NLHP LI+F
Sbjct  9    TSSSNFHIAMFPWFAIGHAIPFLHLSNELAARGHKISFLLPKKAQIQIQHLNLHPQLIAF  68

Query  224  VPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIIL-----KDLKVDVVFYD  388
              + VP I GLP G ET SD+P  ST LL  AMD+T+  IE  L      D K+D++FYD
Sbjct  69   CSVTVPHIEGLPEGTETASDIPTSSTALLATAMDRTRQQIEGFLVSCGANDRKIDMIFYD  128

Query  389  FTHWLPSLARKIGIKSVFYSTISPLMHGYALSPERRV-VGKQLTEADMMKAP  541
            F HW+P + R +GIK + Y  +       A+ P R V   + +TE D+   P
Sbjct  129  FAHWVPEITRGLGIKCINYGVLCAATTAMAIVPARNVPKDRPVTEEDLRDPP  180



>ref|XP_009352835.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Pyrus x bretschneideri]
Length=471

 Score =   168 bits (425),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 90/164 (55%), Positives = 118/164 (72%), Gaps = 4/164 (2%)
 Frame = +2

Query  56   TYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIV  235
            + H+AMYPWF +GHLT    L+NKLA +GHR SF +P  TQ KL++ N HPHLISF+PI 
Sbjct  9    SLHIAMYPWFAMGHLTPSPPLSNKLAERGHRTSFFVPTKTQQKLQALNFHPHLISFIPIT  68

Query  236  VPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLA  415
            VP + GL PGAETT+DVPFPS  LLM+AMD TQ  I  ++ +L  + VF+DFT WLP L 
Sbjct  69   VPHVDGLLPGAETTNDVPFPSNSLLMDAMDLTQPAILQLICELNPNFVFFDFTPWLPKLL  128

Query  416  RKIGI--KSVFYSTISPLMHGYALSPERRVVGKQ--LTEADMMK  535
            R++G   KS++Y  ISP + GY  SPER+V+ ++  LTE D++ 
Sbjct  129  RQLGTGIKSIYYIIISPAIVGYVRSPERKVLMEKSVLTEDDLIN  172



>emb|CDY14339.1| BnaA10g07160D [Brassica napus]
Length=211

 Score =   160 bits (406),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 79/175 (45%), Positives = 116/175 (66%), Gaps = 4/175 (2%)
 Frame = +2

Query  29   IGSMGSQ-ATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLH  205
            +G  GS+ +++  + MYPW   GH+T F  L+NKLA KGH I FL+PK    +++  NL+
Sbjct  1    MGDFGSEGSSSMSIVMYPWLAFGHMTAFLHLSNKLAEKGHEIVFLLPKKALDQVKPLNLY  60

Query  206  PHLISFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFY  385
            P+LI+F  I +P + GLPPGAET SDVPF  THLL  AM++T+ ++E IL+  K D+VFY
Sbjct  61   PNLITFHTISIPHVKGLPPGAETNSDVPFFLTHLLAVAMNQTRPEVETILRTNKPDLVFY  120

Query  386  DFTHWLPSLARKIGIKSVFYSTISPLMHGYALSP--ERRVV-GKQLTEADMMKAP  541
            D   W+P +AR +G K+V Y+T+S       L P  ER ++ GK+++  ++ K P
Sbjct  121  DSADWIPEIARPVGAKTVCYNTVSAASIALTLVPAAEREIIDGKEMSAEELAKPP  175



>ref|XP_002285222.1| PREDICTED: UDP-glycosyltransferase 79B9-like [Vitis vinifera]
Length=457

 Score =   166 bits (420),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 103/138 (75%), Gaps = 0/138 (0%)
 Frame = +2

Query  44   SQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISF  223
            +++T  H+AMYPWF  GHLT +  L+N+LA +GH+I+F++PK  QS+L+  NLHP LI+F
Sbjct  4    ARSTKLHIAMYPWFAFGHLTPYLHLSNELAERGHKITFILPKKAQSQLQHLNLHPTLITF  63

Query  224  VPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWL  403
             P+ +P + GLPPGAET SDVPF   HLL+ AMD+T + +E  L+ LK D + +DF +W 
Sbjct  64   HPLTIPHVDGLPPGAETASDVPFFMHHLLVTAMDRTADQVEAALRALKPDFLLFDFPYWA  123

Query  404  PSLARKIGIKSVFYSTIS  457
            P+LA K+GIKS++YS + 
Sbjct  124  PTLASKLGIKSIYYSAVC  141



>emb|CBI20245.3| unnamed protein product [Vitis vinifera]
Length=415

 Score =   165 bits (417),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 71/138 (51%), Positives = 103/138 (75%), Gaps = 0/138 (0%)
 Frame = +2

Query  44   SQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISF  223
            +++T  H+A+YPWF  GHLT +  L+N+LA +GH+I+F++PK  QS+L+  NLHP LI+F
Sbjct  4    ARSTKLHIALYPWFAFGHLTPYLHLSNELAERGHKITFILPKKAQSQLQHLNLHPTLITF  63

Query  224  VPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWL  403
             P+ +P + GLPPGAET SDVPF   HLL+ AMD+T + +E  L+ LK D + +DF +W 
Sbjct  64   HPLTIPHVDGLPPGAETASDVPFFMHHLLVTAMDRTADQVEAALRALKPDFLLFDFPYWA  123

Query  404  PSLARKIGIKSVFYSTIS  457
            P+LA K+GIKS++YS + 
Sbjct  124  PALASKLGIKSIYYSAVC  141



>emb|CDY20207.1| BnaC09g30320D [Brassica napus]
Length=211

 Score =   159 bits (403),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 79/175 (45%), Positives = 115/175 (66%), Gaps = 4/175 (2%)
 Frame = +2

Query  29   IGSMGSQ-ATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLH  205
            +G  GS  +++  + MYPW   GH+T F  L+NKLA KGH I FL+PK    +++  NL+
Sbjct  1    MGDFGSDGSSSMSVVMYPWLAFGHMTAFLHLSNKLAEKGHEIVFLLPKKALDQVKPLNLY  60

Query  206  PHLISFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFY  385
            P+LI+F  I +P + GLPPGAET SDVPF  THLL  AM++T+ ++E IL+  K D+VFY
Sbjct  61   PNLITFHTISIPHVKGLPPGAETNSDVPFFLTHLLAVAMNQTRPEVETILRTNKPDLVFY  120

Query  386  DFTHWLPSLARKIGIKSVFYSTISPLMHGYALSP--ERRVV-GKQLTEADMMKAP  541
            D   W+P +AR +G K+V Y+T+S       L P  ER ++ GK+++  ++ K P
Sbjct  121  DSADWIPEIARPVGAKTVCYNTVSAASIALTLVPAAEREIIDGKEMSAEELAKPP  175



>ref|XP_004144600.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Cucumis sativus]
 ref|XP_004164965.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Cucumis sativus]
 gb|KGN43488.1| hypothetical protein Csa_7G041330 [Cucumis sativus]
Length=461

 Score =   166 bits (419),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 82/170 (48%), Positives = 113/170 (66%), Gaps = 2/170 (1%)
 Frame = +2

Query  38   MGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLI  217
            M    ++ H+AMYPWF +GHL  F ++ NKLA KGHRISF IP  TQ KL+ FN  P+LI
Sbjct  1    MEEAPSSLHIAMYPWFALGHLIAFLQIGNKLASKGHRISFFIPSKTQPKLQPFNHFPNLI  60

Query  218  SFVPIVVPSIPGLPPGAETTSDVPFPST-HLLMEAMDKTQNDIEIILKDLKVDVVFYDFT  394
            +FVPI VP + GLP GAETT+DV  PS   L+M +MD+T+ +I   L+++K + +FYD  
Sbjct  61   TFVPITVPHVDGLPLGAETTADVSHPSQIPLIMTSMDRTEPEIASRLQEIKPEAIFYDLA  120

Query  395  HWLPSLARKIGIKSVFYSTISPLMHGYALSPERRVVGK-QLTEADMMKAP  541
             W+P LA  +GIKSV++S +SP+  GY      +  G   LT+ D++  P
Sbjct  121  CWVPKLAHPLGIKSVYFSAVSPVTMGYIQCKLWKFPGHYNLTQDDLLHPP  170



>ref|XP_010695817.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Beta vulgaris subsp. vulgaris]
Length=452

 Score =   166 bits (419),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 81/149 (54%), Positives = 104/149 (70%), Gaps = 2/149 (1%)
 Frame = +2

Query  47   QATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFV  226
            ++    +A YPWF +GHLT F RLANKLA +GH++S+ +PKNTQ KL S N  P  ++F+
Sbjct  6    ESQVLKVAFYPWFALGHLTSFLRLANKLAERGHQVSYFLPKNTQLKLASQNHFPDHLTFI  65

Query  227  PIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLP  406
            PI VPS+ GLPPGAETT+DV     HL+M AMD T++ I+  L  LK D VFYDF +W+P
Sbjct  66   PITVPSVDGLPPGAETTNDVSLSGAHLIMAAMDMTRDTIDAHLALLKPDFVFYDFAYWMP  125

Query  407  SLARKIGIKSVFYSTISPLMHGYALSPER  493
             LARK GIKSV Y  I+ L+  Y L+  R
Sbjct  126  QLARKHGIKSVHY--ITGLIARYTLAISR  152



>ref|XP_002866015.1| UDP-glucose:flavonoid 3-O-glucosyltransferase [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH42274.1| UDP-glucose:flavonoid 3-O-glucosyltransferase [Arabidopsis lyrata 
subsp. lyrata]
Length=468

 Score =   166 bits (419),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 82/173 (47%), Positives = 117/173 (68%), Gaps = 5/173 (3%)
 Frame = +2

Query  32   GSMGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPH  211
            GS GS + T  + MYPW   GH+T F  L+NKLA KGH+I FL+PK   ++LE  NL+P+
Sbjct  5    GSNGSSSMT--IVMYPWLAFGHMTPFLHLSNKLAEKGHKIVFLLPKKALNQLEPLNLYPN  62

Query  212  LISFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDF  391
            LI+F  I +P + GLPPGAET SDVPF  THLL  AMD+T+ ++E I + +K D+VFYD 
Sbjct  63   LITFRTISIPQVKGLPPGAETNSDVPFFLTHLLAIAMDQTRPEVETIFRTIKPDLVFYDS  122

Query  392  THWLPSLARKIGIKSVFYSTISPLMHGYALSP--ERRVV-GKQLTEADMMKAP  541
             HW+P +A+ +G K+V ++ +S      +L P  ER V+ GK+++  ++ K P
Sbjct  123  AHWIPEIAKPVGAKTVCFNIVSAASIALSLVPAAEREVIDGKEMSGEELAKTP  175



>gb|AFJ52975.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=468

 Score =   166 bits (419),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 82/166 (49%), Positives = 108/166 (65%), Gaps = 2/166 (1%)
 Frame = +2

Query  47   QATTY-HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISF  223
            +ATT  H+AM+PWF  GH+T +  LAN LA +GHR+SFLIPK TQSK    N HPHLI+F
Sbjct  7    RATTKPHVAMFPWFAFGHITPYLHLANHLASRGHRVSFLIPKRTQSKFTKLNRHPHLITF  66

Query  224  VPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWL  403
             PI VP + GLPPGAET+ D PFP    L  A D+TQ  +  IL +L   +V YD  HW+
Sbjct  67   HPITVPHVDGLPPGAETSYDAPFPLVMFLFTAFDRTQPQVREILTELNPSLVLYDLAHWI  126

Query  404  PSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
            PSL  ++G K V Y T S +     + P  ++V K +T+A++M+ P
Sbjct  127  PSLGLELGFKKVAYVTASAVSSALRILPSVKMV-KGMTDAELMRPP  171



>ref|XP_009123330.1| PREDICTED: anthocyanidin 3-O-glucoside 2'''-O-xylosyltransferase-like 
[Brassica rapa]
Length=211

 Score =   159 bits (402),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 78/175 (45%), Positives = 115/175 (66%), Gaps = 4/175 (2%)
 Frame = +2

Query  29   IGSMGSQ-ATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLH  205
            +G  GS  +++  + MYPW   GH+T F  L+NKLA KGH I FL+PK    +++  NL+
Sbjct  1    MGDFGSDGSSSMSIVMYPWLAFGHMTAFLHLSNKLAEKGHEIVFLLPKKALDQVKPLNLY  60

Query  206  PHLISFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFY  385
            P+LI+F  I +P + GLPPGAET SD+PF  THLL  AM++T+ ++E IL+  K D+VFY
Sbjct  61   PNLITFHTISIPHVKGLPPGAETNSDIPFFLTHLLAVAMNQTRPEVETILRTNKPDLVFY  120

Query  386  DFTHWLPSLARKIGIKSVFYSTISPLMHGYALSP--ERRVV-GKQLTEADMMKAP  541
            D   W+P +AR +G K+V Y+T+S       L P  ER ++ GK+++  ++ K P
Sbjct  121  DSADWIPEIARPVGAKTVCYNTVSAASIALTLVPAAEREIIDGKEMSAEELAKPP  175



>ref|XP_010041982.1| PREDICTED: anthocyanidin 3-O-glucoside 2'''-O-xylosyltransferase-like 
[Eucalyptus grandis]
Length=461

 Score =   165 bits (418),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 75/164 (46%), Positives = 109/164 (66%), Gaps = 1/164 (1%)
 Frame = +2

Query  53   TTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPI  232
            + +HMAM+PWF VGH+T +  L+N+LA +GH+ISF +P+     LE+ NLHP+LI+F P+
Sbjct  7    SKFHMAMFPWFAVGHITPYLHLSNELAKRGHKISFFLPRKALILLENLNLHPNLITFHPL  66

Query  233  VVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSL  412
             VPS+  LPPG ET SD+PF  +  L  AMD T+  +E+ L+ ++ D +FYD  HW+P +
Sbjct  67   TVPSVATLPPGTETASDIPFSDSPFLAAAMDLTRPQLEVSLQAMRPDFIFYDLAHWIPQV  126

Query  413  ARKIGIKSVFYSTISPLMHGYALSPERRVV-GKQLTEADMMKAP  541
            AR +GI++V Y+ +S       L P R V  GK  TE ++ K P
Sbjct  127  ARPLGIRTVCYNVVSAAAIAIVLVPAREVTQGKPCTEEELEKPP  170



>ref|NP_200217.1| anthocyanidin 3-O-glucoside 2'''-O-xylosyltransferase [Arabidopsis 
thaliana]
 sp|Q9LVW3.1|AXYLT_ARATH RecName: Full=Anthocyanidin 3-O-glucoside 2'''-O-xylosyltransferase; 
Short=A3G2''XylT [Arabidopsis thaliana]
 dbj|BAA97127.1| flavonol 3-O-glucosyltransferase-like [Arabidopsis thaliana]
 gb|ACE82596.1| At5g54060 [Arabidopsis thaliana]
 gb|AED96443.1| UDP-glucose:flavonoid 3-o-glucosyltransferase [Arabidopsis thaliana]
 gb|AHL38579.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=468

 Score =   165 bits (417),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 81/175 (46%), Positives = 119/175 (68%), Gaps = 4/175 (2%)
 Frame = +2

Query  29   IGSMGS-QATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLH  205
            +G  GS ++++  + MYPW   GH+T F  L+NKLA KGH+I FL+PK   ++LE  NL+
Sbjct  1    MGVFGSNESSSMSIVMYPWLAFGHMTPFLHLSNKLAEKGHKIVFLLPKKALNQLEPLNLY  60

Query  206  PHLISFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFY  385
            P+LI+F  I +P + GLPPGAET SDVPF  THLL  AMD+T+ ++E I + +K D+VFY
Sbjct  61   PNLITFHTISIPQVKGLPPGAETNSDVPFFLTHLLAVAMDQTRPEVETIFRTIKPDLVFY  120

Query  386  DFTHWLPSLARKIGIKSVFYSTISPLMHGYALSP--ERRVV-GKQLTEADMMKAP  541
            D  HW+P +A+ IG K+V ++ +S      +L P  ER V+ GK+++  ++ K P
Sbjct  121  DSAHWIPEIAKPIGAKTVCFNIVSAASIALSLVPSAEREVIDGKEMSGEELAKTP  175



>ref|XP_011465114.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Fragaria vesca subsp. vesca]
Length=456

 Score =   164 bits (416),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 80/143 (56%), Positives = 103/143 (72%), Gaps = 2/143 (1%)
 Frame = +2

Query  62   HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVP  241
            H+AMYPWF +GHLT F  ++NKLA +GH+ISF +P  TQSKL+ +NLHPHLI+F+P+ VP
Sbjct  2    HVAMYPWFAMGHLTAFLHISNKLAERGHKISFFLPIKTQSKLQHYNLHPHLITFIPLNVP  61

Query  242  SIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARK  421
             + GLPPG ETT+DVP     L+  AMD T+  IE  L  L+ D VF+DF+HWLP+L R+
Sbjct  62   HVDGLPPGTETTADVPLSLGSLVATAMDLTRPQIEQHLLKLRPDYVFFDFSHWLPALLRQ  121

Query  422  IG--IKSVFYSTISPLMHGYALS  484
            +G  IKSV Y  I+P    Y LS
Sbjct  122  LGSNIKSVCYWVINPASVWYLLS  144



>ref|XP_008226430.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Prunus mume]
Length=489

 Score =   164 bits (415),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 78/172 (45%), Positives = 107/172 (62%), Gaps = 6/172 (3%)
 Frame = +2

Query  44   SQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISF  223
            + ++ +H+AM+PWF +GH   F  L+N+LA +GHRISFL+PK  Q +L+  NLHPHLI+F
Sbjct  20   TSSSNFHIAMFPWFAMGHSIPFLHLSNELASRGHRISFLLPKKAQIQLQHLNLHPHLIAF  79

Query  224  VPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIIL-----KDLKVDVVFYD  388
              + VP I GLP G ET SD+P   T LL  AMD+T+  I+  L      D KVD++FYD
Sbjct  80   CSVTVPHIEGLPEGTETASDIPISLTPLLAAAMDRTRQQIQGFLVSCGVNDRKVDMIFYD  139

Query  389  FTHWLPSLARKIGIKSVFYSTISPLMHGYALSPERRV-VGKQLTEADMMKAP  541
            F HW+P + R +GIK V Y      +   A+ P R V   + +TE D+   P
Sbjct  140  FAHWVPEITRGLGIKCVNYGVACAAITAMAIVPARNVPKDRPVTEEDLRDPP  191



>ref|XP_009121268.1| PREDICTED: anthocyanidin 3-O-glucoside 2'''-O-xylosyltransferase-like 
[Brassica rapa]
Length=206

 Score =   157 bits (396),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 78/166 (47%), Positives = 111/166 (67%), Gaps = 4/166 (2%)
 Frame = +2

Query  29   IGSMGSQ-ATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLH  205
            +G  GS  +++  + MYPW   GH+T F  L+NKLA KGH+I FL+PK    +++  NL+
Sbjct  1    MGDFGSDGSSSMSIVMYPWLAFGHMTAFLHLSNKLAEKGHKIVFLLPKKALDQVKPLNLY  60

Query  206  PHLISFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFY  385
            P+LISF  I +P + GLPPGAET SDVPF  THLL  AM++T+ ++E IL+  K D+VFY
Sbjct  61   PNLISFHTISIPHVKGLPPGAETNSDVPFFLTHLLAVAMNQTRPEVETILRTNKPDLVFY  120

Query  386  DFTHWLPSLARKIGIKSVFYSTISPLMHGYALSP--ERRVV-GKQL  514
            D   W+P +AR +G K+V Y+T+S       L P  ER ++ GK++
Sbjct  121  DSADWIPEIARPVGAKTVCYNTVSAASIALTLVPAAEREIIDGKEM  166



>ref|XP_007021620.1| UDP-Glycosyltransferase superfamily protein [Theobroma cacao]
 gb|EOY13145.1| UDP-Glycosyltransferase superfamily protein [Theobroma cacao]
Length=386

 Score =   161 bits (408),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 74/167 (44%), Positives = 110/167 (66%), Gaps = 3/167 (2%)
 Frame = +2

Query  41   GSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLIS  220
             S  +   +AM+PWF  GH   F  L+NKLA K H +SFL+PK  Q KLE  N +P+LI 
Sbjct  3    NSNTSKLRVAMFPWFSFGHFVPFLHLSNKLAEKDHEVSFLLPKGAQPKLEQLNQYPNLIQ  62

Query  221  FVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHW  400
            F P+VV  + G+ PGA+TTSDVP P   L   A D+T++ +E IL+ +K D+VFYDF +W
Sbjct  63   FFPLVVSHVDGILPGAQTTSDVPLPLHSLFAIAFDQTRDQVEAILRSIKPDIVFYDFGYW  122

Query  401  LPSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
            +P+LA +I IKS++Y+ ++   H Y L+   + V K++T  ++++ P
Sbjct  123  IPALAHQIDIKSIYYAVVTAAAHAYFLT---KKVTKEMTVEELIEVP  166



>ref|XP_009340538.1| PREDICTED: UDP-glycosyltransferase 79B9-like [Pyrus x bretschneideri]
Length=467

 Score =   163 bits (412),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 74/165 (45%), Positives = 110/165 (67%), Gaps = 4/165 (2%)
 Frame = +2

Query  50   ATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVP  229
            ++++H+AM+PWF +GH+T F  L+N+LA +GH+I+FL+PK  Q +L+  NLHPHLI+F P
Sbjct  2    SSSFHIAMFPWFAMGHMTPFLHLSNELAARGHKITFLLPKKAQIQLQRLNLHPHLITFHP  61

Query  230  IVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILK----DLKVDVVFYDFTH  397
            + VP I GLP   E  S++P   +H L  A+D+T++ I+  LK    D KVD++F+D  H
Sbjct  62   VTVPHIEGLPDKTEFVSEIPLSLSHFLTLAIDRTRDQIQDFLKTSVADCKVDMIFFDSAH  121

Query  398  WLPSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMM  532
            W+P +AR +GIKS+FY  IS   +  +L P    V K    A M+
Sbjct  122  WIPEIARGLGIKSIFYGVISAAAYALSLVPICNYVTKDACMAPMI  166



>ref|XP_010062848.1| PREDICTED: anthocyanidin 3-O-glucoside 2'''-O-xylosyltransferase-like 
[Eucalyptus grandis]
Length=461

 Score =   162 bits (411),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 75/164 (46%), Positives = 109/164 (66%), Gaps = 1/164 (1%)
 Frame = +2

Query  53   TTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPI  232
            + +HMAM+PWF VGH+T +  L+N+LA +GH+ISF +P+     LE+ NLHP+LI+F P+
Sbjct  7    SKFHMAMFPWFAVGHITPYLHLSNELAKRGHKISFFLPRKALILLENLNLHPNLITFHPL  66

Query  233  VVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSL  412
             VPS+  LPPG ET SD+ F  +  L  AMD T+  +E+ L+ ++ D +FYD+ HW+P +
Sbjct  67   TVPSVATLPPGTETASDITFSDSPFLAAAMDLTRPQLEVSLQAMQPDFIFYDYAHWIPQV  126

Query  413  ARKIGIKSVFYSTISPLMHGYALSPERRVV-GKQLTEADMMKAP  541
            AR +GI++V Y+ IS       L P R V  GK  TE ++ K P
Sbjct  127  ARPLGIRTVCYNVISAAAIAMVLVPVREVTQGKPCTEEELEKPP  170



>ref|XP_008226432.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Prunus mume]
Length=489

 Score =   163 bits (412),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 78/172 (45%), Positives = 106/172 (62%), Gaps = 6/172 (3%)
 Frame = +2

Query  44   SQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISF  223
            + ++ +H+AM+PWF +GH   F  L+N+LA +GHRISFL+PK  Q  L+  NLHPHLI+F
Sbjct  20   TSSSNFHIAMFPWFAMGHSIPFLHLSNELAARGHRISFLLPKKAQIHLQHLNLHPHLIAF  79

Query  224  VPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIIL-----KDLKVDVVFYD  388
              + VP I GLP G ET SD+P   T LL  AMD+T+  I+  L      D KVD++FYD
Sbjct  80   CSVTVPHIEGLPEGTETASDIPISLTPLLAAAMDRTRQQIQGFLVSCGVNDRKVDMIFYD  139

Query  389  FTHWLPSLARKIGIKSVFYSTISPLMHGYALSPERRV-VGKQLTEADMMKAP  541
            F HW+P + R +GIK V Y      +   A+ P R V   + +TE D+   P
Sbjct  140  FAHWVPEITRGLGIKCVNYGVACAAITAMAIVPARNVPKDRPVTEEDLRDPP  191



>ref|XP_006281777.1| hypothetical protein CARUB_v10027945mg [Capsella rubella]
 gb|EOA14675.1| hypothetical protein CARUB_v10027945mg [Capsella rubella]
Length=469

 Score =   162 bits (409),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 80/175 (46%), Positives = 116/175 (66%), Gaps = 4/175 (2%)
 Frame = +2

Query  29   IGSMGSQ-ATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLH  205
            +G  GS  +++  + MYPW   GH+T F  L+NKLA KGH+I FL+PK   ++LE  NL+
Sbjct  1    MGDFGSNGSSSMSIVMYPWLAFGHMTPFLHLSNKLAEKGHKIVFLLPKKALNQLEPLNLY  60

Query  206  PHLISFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFY  385
            P LI+F  I +P + GLPPGAET SDVPF  THLL  AMD+T+ ++E I + +K D+VFY
Sbjct  61   PKLITFHTISIPQVKGLPPGAETNSDVPFFLTHLLAVAMDQTRPEVETIFRTIKPDLVFY  120

Query  386  DFTHWLPSLARKIGIKSVFYSTISPLMHGYALSP--ERRVV-GKQLTEADMMKAP  541
            D  HW+P +A+ +G K+V +  +S      +L P  ER V+ GK+++  ++ K P
Sbjct  121  DSAHWIPEIAKPMGAKTVCFHIVSAASIALSLVPAAEREVIDGKEMSGEELAKTP  175



>gb|KCW69983.1| hypothetical protein EUGRSUZ_F03293, partial [Eucalyptus grandis]
Length=448

 Score =   161 bits (408),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 75/164 (46%), Positives = 108/164 (66%), Gaps = 1/164 (1%)
 Frame = +2

Query  53   TTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPI  232
            + +H+AM+PWF VGH+T F  L+N+LA +GH+ISF +P+     LE+ NLHP+LI+F P+
Sbjct  7    SKFHIAMFPWFAVGHVTPFLHLSNELAKRGHKISFFLPRKALILLENLNLHPNLITFHPL  66

Query  233  VVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSL  412
             VPS+  LPPG ET SD+P      L  AMD T+  +E+ L+ ++ D +FYD  HW+P +
Sbjct  67   TVPSVATLPPGTETASDIPISDAPSLAVAMDLTRRQLEVSLQAMRPDFIFYDTAHWIPQV  126

Query  413  ARKIGIKSVFYSTISPLMHGYALSPERRVV-GKQLTEADMMKAP  541
            AR +GI++V Y+ +S       L P R V  GK LTE ++ K P
Sbjct  127  ARPLGIRTVCYNVVSAAAIAIVLVPAREVTPGKPLTEEELGKPP  170



>ref|XP_010062847.1| PREDICTED: anthocyanidin 3-O-glucoside 2'''-O-xylosyltransferase-like 
[Eucalyptus grandis]
Length=461

 Score =   161 bits (408),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 75/164 (46%), Positives = 108/164 (66%), Gaps = 1/164 (1%)
 Frame = +2

Query  53   TTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPI  232
            + +H+AM+PWF VGH+T F  L+N+LA +GH+ISF +P+     LE+ NLHP+LI+F P+
Sbjct  7    SKFHIAMFPWFAVGHVTPFLHLSNELAKRGHKISFFLPRKALILLENLNLHPNLITFHPL  66

Query  233  VVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSL  412
             VPS+  LPPG ET SD+P      L  AMD T+  +E+ L+ ++ D +FYD  HW+P +
Sbjct  67   TVPSVATLPPGTETASDIPISDAPSLAVAMDLTRRQLEVSLQAMRPDFIFYDTAHWIPQV  126

Query  413  ARKIGIKSVFYSTISPLMHGYALSPERRVV-GKQLTEADMMKAP  541
            AR +GI++V Y+ +S       L P R V  GK LTE ++ K P
Sbjct  127  ARPLGIRTVCYNVVSAAAIAIVLVPAREVTPGKPLTEEELGKPP  170



>ref|XP_008455478.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Cucumis melo]
Length=460

 Score =   161 bits (407),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 81/170 (48%), Positives = 111/170 (65%), Gaps = 2/170 (1%)
 Frame = +2

Query  38   MGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLI  217
            M    +  H+AMYPWF +GHL  F ++ NKLA KGHRISF IP  TQ KL+ FN  P+LI
Sbjct  1    MEEAPSGLHIAMYPWFALGHLIAFLQIGNKLANKGHRISFFIPSKTQPKLQPFNHFPNLI  60

Query  218  SFVPIVVPSIPGLPPGAETTSDVPFPST-HLLMEAMDKTQNDIEIILKDLKVDVVFYDFT  394
            +FVPI VP + GLP GAETT+DV  PS   L+M +MD+T+ +I   L+D+K +V+FYD  
Sbjct  61   TFVPITVPHVDGLPLGAETTADVSHPSQIPLIMTSMDRTEPEIASRLQDIKPEVIFYDLA  120

Query  395  HWLPSLARKIGIKSVFYSTISPLMHGYALSPERRVVGK-QLTEADMMKAP  541
            +W+P LA  +GIKSV+++ +S +   Y      +  G   LT  D++  P
Sbjct  121  YWVPKLAHPLGIKSVYFTAVSAVTMSYIQCKLWKFPGHYNLTRDDLLHPP  170



>ref|XP_006373006.1| hypothetical protein POPTR_0017s06940g [Populus trichocarpa]
 gb|ERP50803.1| hypothetical protein POPTR_0017s06940g [Populus trichocarpa]
Length=403

 Score =   160 bits (404),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 80/162 (49%), Positives = 100/162 (62%), Gaps = 33/162 (20%)
 Frame = +2

Query  56   TYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIV  235
             YH+AMYPWF  GHLT F  LANKLA  GH+ISFL+P  TQSKL+ FNLHP +I+F+PI 
Sbjct  6    AYHIAMYPWFAFGHLTPFLHLANKLAQAGHKISFLLPTRTQSKLQQFNLHPDIITFIPIT  65

Query  236  VPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLA  415
            VP + GLPPGAETTSDVPFPS   +M AMD+                             
Sbjct  66   VPHVDGLPPGAETTSDVPFPSFTHIMTAMDR-----------------------------  96

Query  416  RKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
                IKS++Y  +S +  GY +SP RR+ G +LT+AD+M+ P
Sbjct  97   ----IKSIYYCVVSSVTIGYIMSPARRLSGNKLTKADLMQPP  134



>ref|XP_007021619.1| UDP-Glycosyltransferase superfamily protein [Theobroma cacao]
 gb|EOY13144.1| UDP-Glycosyltransferase superfamily protein [Theobroma cacao]
Length=505

 Score =   161 bits (407),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 77/167 (46%), Positives = 116/167 (69%), Gaps = 4/167 (2%)
 Frame = +2

Query  41   GSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLIS  220
             S +++ H+AM+PWF  GH   +  L+NKLA KGH++SFL+PK  Q KLE  N +P+L+ 
Sbjct  54   NSNSSSLHVAMFPWFAFGHFIPYLHLSNKLAEKGHKVSFLLPKGAQPKLEQLNQYPNLLQ  113

Query  221  FVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHW  400
            F P+VV  + G+PPGAET SDVP P   LL  A D+T++ +E IL+ +K DVVF+D  HW
Sbjct  114  FFPLVVSHVDGMPPGAETASDVPQPLHSLLAIAFDQTRDQVEAILRAIKADVVFHDMGHW  173

Query  401  LPSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
            +P+LA +IGIKS++Y+ +S   + + L+ E   V K++T  ++++ P
Sbjct  174  IPALAHQIGIKSIYYAAVSAAANAH-LAKE---VSKEMTVEELIEVP  216



>ref|XP_009767952.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Nicotiana sylvestris]
Length=469

 Score =   160 bits (405),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 78/157 (50%), Positives = 106/157 (68%), Gaps = 5/157 (3%)
 Frame = +2

Query  71   MYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVPSIP  250
            MYPW+ +GHLT F  L+NKLA +GH I F+ P NT SKLE FNL+P LI+F+ I VP + 
Sbjct  10   MYPWYAMGHLTSFLHLSNKLADRGHTIFFIHPTNTLSKLEKFNLYPQLINFISITVPHVE  69

Query  251  GLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARKIGI  430
            GLP GAETTSD+P    +LL +A+D TQ  IE ++++LK   + YDF +W+P +ARK G+
Sbjct  70   GLPIGAETTSDIPIFKQNLLWQALDLTQQKIESLIQELKPHFILYDFAYWVPLVARKYGV  129

Query  431  KSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
            KS+ Y +I+P   GY +  E     K   E +MM+ P
Sbjct  130  KSIHYCSITPSSVGYLMRGE-----KPTPEDEMMEPP  161



>ref|XP_008386212.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyltransferase 79B3-like 
[Malus domestica]
Length=472

 Score =   160 bits (404),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 78/171 (46%), Positives = 110/171 (64%), Gaps = 8/171 (5%)
 Frame = +2

Query  53   TTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPI  232
            + +H+AM+PWF +GHLT F  L N+LA +GHRI+FL+PK  Q+KL+  N HPHLI+F  I
Sbjct  11   SNFHIAMFPWFAMGHLTPFLHLXNELAARGHRITFLLPKKAQTKLQHLNHHPHLITFHSI  70

Query  233  VVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILK----DLK--VDVVFYDFT  394
             VP + GLP GAET S++P  S H L  AMD+T++ I   LK    D K  +D++ +D  
Sbjct  71   TVPHVEGLPKGAETASEIPLSSIHFLTIAMDRTRDQIHDFLKASAADPKHIIDMIVFDLA  130

Query  395  HWLPSLARKIGIKSVFYSTISPLMHGYAL--SPERRVVGKQLTEADMMKAP  541
            HW+P +AR +GIKS++Y  I   ++  AL  +PE   V   +TE    + P
Sbjct  131  HWIPDIARGLGIKSIYYGVICAAVYAAALVPTPECNSVPMTVTEERQRRNP  181



>emb|CAN63557.1| hypothetical protein VITISV_034121 [Vitis vinifera]
Length=447

 Score =   159 bits (403),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 74/162 (46%), Positives = 107/162 (66%), Gaps = 1/162 (1%)
 Frame = +2

Query  59   YHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVV  238
            +H+AM+PWF  GH+T F  L+NKLA +GH+I+F++PK  QS+L++ N HP LISF P+ +
Sbjct  9    FHVAMFPWFAFGHMTAFLHLSNKLAERGHKITFMLPKKAQSQLQTLNFHPTLISFHPLSI  68

Query  239  PSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLAR  418
            P + GLPPGAET SD+P   THLL  AMD+  + +E  L+    D +FYD +H  P LA 
Sbjct  69   PHVDGLPPGAETASDIPIFLTHLLATAMDRATDQLEAALRASNPDFLFYDCSHLAPVLAS  128

Query  419  KIGIKSVFYSTISPLMHGYALSPERRVVGKQ-LTEADMMKAP  541
            ++GIK++ Y+ +       AL P R V   + +TEA++   P
Sbjct  129  RLGIKAICYNVVCAASIAIALVPARGVSKDRPVTEAELAVPP  170



>ref|XP_004248461.2| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Solanum lycopersicum]
Length=456

 Score =   159 bits (402),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 108/157 (69%), Gaps = 5/157 (3%)
 Frame = +2

Query  71   MYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVPSIP  250
            MYPW+ +GHLT F  L+NKLA +GH++ F+ P NT SKLE FN +P LI+F  + VP + 
Sbjct  10   MYPWYAMGHLTSFLHLSNKLAHRGHKVFFVHPTNTLSKLEKFNRYPELINFKSVTVPHVD  69

Query  251  GLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARKIGI  430
            GLP GAETTSDVP  + +LL +A+D T   IE +++++K   +FYDF +W+PS+ARK G+
Sbjct  70   GLPLGAETTSDVPIFNQNLLCQALDLTLPKIESLIQEIKPHFIFYDFAYWVPSVARKYGV  129

Query  431  KSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
            KSV Y +I+P   GY +  E        +EA+MM+ P
Sbjct  130  KSVHYCSITPSSVGYLMRGENPT-----SEAEMMQPP  161



>ref|XP_002282825.3| PREDICTED: UDP-glycosyltransferase 79B6-like [Vitis vinifera]
Length=463

 Score =   159 bits (403),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 74/162 (46%), Positives = 107/162 (66%), Gaps = 1/162 (1%)
 Frame = +2

Query  59   YHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVV  238
            +H+AM+PWF  GH+T F  L+NKLA +GH+I+F++PK  QS+L++ N HP LISF P+ +
Sbjct  11   FHVAMFPWFAFGHMTAFLHLSNKLAERGHKITFMLPKKAQSQLQTLNFHPTLISFHPLSI  70

Query  239  PSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLAR  418
            P + GLPPGAET SD+P   THLL  AMD+  + +E  L+    D +FYD +H  P LA 
Sbjct  71   PHVDGLPPGAETASDIPIFLTHLLATAMDRATDQLEAALRASNPDFLFYDCSHLAPVLAS  130

Query  419  KIGIKSVFYSTISPLMHGYALSPERRVVGKQ-LTEADMMKAP  541
            ++GIK++ Y+ +       AL P R V   + +TEA++   P
Sbjct  131  RLGIKAICYNVVCAASIAIALVPARGVSKDRPVTEAELAVPP  172



>ref|XP_007021598.1| UDP-Glycosyltransferase superfamily protein [Theobroma cacao]
 gb|EOY13123.1| UDP-Glycosyltransferase superfamily protein [Theobroma cacao]
Length=458

 Score =   159 bits (402),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 111/167 (66%), Gaps = 1/167 (1%)
 Frame = +2

Query  44   SQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISF  223
            + ++ +H+ M+ WF +GH+T F  LANKLA KGHRI+F++P+   ++LE  NL+P  ISF
Sbjct  4    ANSSDFHVLMFSWFAIGHMTPFLHLANKLAEKGHRITFVLPRKAVNQLEHLNLYPDFISF  63

Query  224  VPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWL  403
             P+ VPS+ GLPPGAET SD+P   +H L  AMD+T++ +E ++  +K ++V YD  HW+
Sbjct  64   HPVTVPSVTGLPPGAETASDIPIFLSHFLSIAMDRTRDQVESVISSVKPNLVLYDTAHWI  123

Query  404  PSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQ-LTEADMMKAP  541
            P +A+ +GIK++ Y+ +        L P R    ++ +TEA++   P
Sbjct  124  PEIAKPLGIKTICYNVVCAAAIAIVLVPARNAARERPITEAELAVPP  170



>ref|XP_008350006.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyltransferase 79B3-like 
[Malus domestica]
Length=471

 Score =   159 bits (403),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 78/171 (46%), Positives = 110/171 (64%), Gaps = 8/171 (5%)
 Frame = +2

Query  53   TTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPI  232
            + +H+AM+PWF +GHLT F  L N+LA +GHRI+FL+PK  Q+KL+  N HPHLI+F  I
Sbjct  11   SNFHIAMFPWFAMGHLTPFLHLPNELAARGHRITFLLPKKAQTKLQHLNHHPHLITFHSI  70

Query  233  VVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILK----DLK--VDVVFYDFT  394
             VP + GLP GAET S++P  S H L  AMD+T++ I   LK    D K  +D++ +D  
Sbjct  71   TVPHVEGLPKGAETASEIPLSSIHFLTIAMDRTRDQIHDFLKASAADPKHIIDMIVFDLA  130

Query  395  HWLPSLARKIGIKSVFYSTISPLMHGYAL--SPERRVVGKQLTEADMMKAP  541
            HW+P +AR +GIKS++Y  I   ++  AL  +PE   V   +TE    + P
Sbjct  131  HWIPDIARGLGIKSIYYGVICAAVYAAALVPTPECNSVPMTVTEERQRRNP  181



>ref|XP_002282717.1| PREDICTED: UDP-glycosyltransferase 79B9-like [Vitis vinifera]
Length=459

 Score =   159 bits (402),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 98/132 (74%), Gaps = 0/132 (0%)
 Frame = +2

Query  62   HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVP  241
            H+AM+PWF  GH+  +  L+N+LAG+GH+I+F++P+  QSKL+  N HP LI+F P++VP
Sbjct  10   HIAMFPWFAFGHMIPYLNLSNELAGRGHKITFILPRKAQSKLQHLNFHPALITFHPLIVP  69

Query  242  SIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARK  421
             + GLPPG ET SD+P   T+LL  A+D+T++ +E  L+ L  D++FYDF +W P+LA +
Sbjct  70   HVDGLPPGTETASDIPVSLTYLLATALDRTRDQVEAALRTLNPDLLFYDFAYWAPALASQ  129

Query  422  IGIKSVFYSTIS  457
            +GIKS++Y  + 
Sbjct  130  LGIKSIYYCVVC  141



>emb|CDP05961.1| unnamed protein product [Coffea canephora]
Length=446

 Score =   159 bits (401),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 77/158 (49%), Positives = 103/158 (65%), Gaps = 1/158 (1%)
 Frame = +2

Query  71   MYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVPSIP  250
            M+PWF  GH+T F  L+NKLA KGHRISFL+P   + +LE  NLHP LI+F  + VP + 
Sbjct  1    MFPWFATGHMTPFLHLSNKLAEKGHRISFLLPNKAKHQLEHLNLHPSLITFYTLTVPHVE  60

Query  251  GLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARKIGI  430
            GLPPG ET SDVP   T LL  AMD  ++ +  +L+ LK  +VFYD  HW+P LA +IG 
Sbjct  61   GLPPGTETASDVPIFLTSLLATAMDNMRDRVRDLLQKLKPSIVFYDMAHWIPELASEIGF  120

Query  431  KSVFYSTISPLMHGYALSPERR-VVGKQLTEADMMKAP  541
            K+V Y+ +S      AL P R+ V  + +T A++M+ P
Sbjct  121  KTVNYNVVSAASIAIALVPSRKPVEDRTITGAELMEPP  158



>gb|KJB13265.1| hypothetical protein B456_002G065500 [Gossypium raimondii]
Length=472

 Score =   159 bits (401),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 77/166 (46%), Positives = 111/166 (67%), Gaps = 2/166 (1%)
 Frame = +2

Query  44   SQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISF  223
            S  +  H+AM+PW   GH   F  L+NKLA KGH+ISF++PK  Q KLE+ N +P+LI F
Sbjct  4    SGYSKLHIAMFPWVAYGHFIPFLHLSNKLAHKGHQISFILPKGVQPKLENMNQYPNLIQF  63

Query  224  VPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWL  403
            VP+V+P + GLPPGAETTS VP      L  ++D+T++ +E IL  LK D+VFYDF  W+
Sbjct  64   VPLVIPHVDGLPPGAETTSVVPLNQQKYLAFSVDQTRDQVEGILGALKPDMVFYDFWFWI  123

Query  404  PSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
            P LAR++GI+ +FY  +S ++   +L    R + K++T  ++ K P
Sbjct  124  PDLARQLGIQPIFYVVVSSMI--MSLGSNIRTLTKEMTVEEVTKLP  167



>gb|AEM37037.1| UDP-glucose:flavonoid 3-O-glucosyltransferase 2 [Brassica rapa 
subsp. oleifera]
Length=468

 Score =   159 bits (401),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 80/173 (46%), Positives = 114/173 (66%), Gaps = 5/173 (3%)
 Frame = +2

Query  32   GSMGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPH  211
            GS GS + +  + MYPW   GH+T F  L+NKLA KGH I FL+PK    +++  NL+P+
Sbjct  5    GSDGSSSMS--IVMYPWLAFGHMTAFLHLSNKLAEKGHEIVFLLPKKALDQVKPLNLYPN  62

Query  212  LISFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDF  391
            LI+F  I +P + GLPPGAET SDVPF  THLL  AM++T+ ++E IL+  K D+VFYD 
Sbjct  63   LITFHTISIPHVKGLPPGAETNSDVPFFLTHLLAVAMNQTRPEVETILRTNKPDLVFYDS  122

Query  392  THWLPSLARKIGIKSVFYSTISPLMHGYALSP--ERRVV-GKQLTEADMMKAP  541
              W+P +AR +G K+V Y+T+S       L P  ER ++ GK+++  ++ K P
Sbjct  123  ADWIPEIARPVGAKTVCYNTVSAASIALTLVPAAEREIIDGKEMSAEELAKPP  175



>ref|XP_007021621.1| UDP-Glycosyltransferase superfamily protein [Theobroma cacao]
 gb|EOY13146.1| UDP-Glycosyltransferase superfamily protein [Theobroma cacao]
Length=581

 Score =   159 bits (402),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 74/165 (45%), Positives = 112/165 (68%), Gaps = 3/165 (2%)
 Frame = +2

Query  47   QATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFV  226
             ++  H+AM+PWF  GH   +  L+NKLA KGH +SFL+PK  Q KLE  N +P+LI F 
Sbjct  131  NSSKLHLAMFPWFSFGHFIPYLHLSNKLAEKGHEVSFLLPKGAQPKLEQLNQYPNLIQFF  190

Query  227  PIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLP  406
            P+VV  + G+ PGA+TTSDVP P   L   A D+T++ +E IL+ +K D+VF+D  +W+P
Sbjct  191  PLVVSHVDGILPGAQTTSDVPLPLHSLFAIAFDQTRDQVEAILRAIKPDIVFHDLGYWIP  250

Query  407  SLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
            +LA +IGIKS++Y  ++   H  AL P ++V  +++T  ++M+ P
Sbjct  251  ALAHQIGIKSIYYPPVTAAAH--ALLPTKKVT-REMTVEELMEVP  292



>gb|AEM37036.1| UDP-glucose:flavonoid 3-O-glucosyltransferase 1 [Brassica rapa 
subsp. oleifera]
Length=468

 Score =   158 bits (399),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 80/173 (46%), Positives = 114/173 (66%), Gaps = 5/173 (3%)
 Frame = +2

Query  32   GSMGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPH  211
            GS GS + +  + MYPW   GH+T F  L+NKLA KGH I FL+PK    +++  NL+P+
Sbjct  5    GSDGSSSMS--IVMYPWLAFGHMTAFLHLSNKLAEKGHEIVFLLPKKALDQVKPLNLYPN  62

Query  212  LISFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDF  391
            LI+F  I +P + GLPPGAET SDVPF  THLL  AM++T+ ++E IL+  K D+VFYD 
Sbjct  63   LITFHTISIPHVKGLPPGAETNSDVPFFLTHLLAVAMNQTRPEVETILRTNKPDLVFYDS  122

Query  392  THWLPSLARKIGIKSVFYSTISPLMHGYALSP--ERRVV-GKQLTEADMMKAP  541
              W+P +AR +G K+V Y+T+S       L P  ER ++ GK+++  ++ K P
Sbjct  123  ADWIPEIARPVGAKTVCYNTVSAASIALTLVPAAEREIIDGKEMSGEELAKPP  175



>ref|XP_003634640.2| PREDICTED: UDP-glycosyltransferase 79B9-like [Vitis vinifera]
Length=457

 Score =   157 bits (398),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 98/132 (74%), Gaps = 0/132 (0%)
 Frame = +2

Query  62   HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVP  241
            H+AM+PWF  GH+  +  L+N+LAG+GH+I+F++P+  QSKL+  N HP LI+F P++VP
Sbjct  8    HIAMFPWFAFGHMIPYLNLSNELAGRGHKITFILPRKAQSKLQHLNFHPALITFHPLIVP  67

Query  242  SIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARK  421
             + GLPPG ET SD+P   T+LL  A+D+T++ +E  L+ L   ++FYDF +W P+LA +
Sbjct  68   HVDGLPPGTETASDIPVSLTYLLATALDRTRDQVEAALRTLNPHLLFYDFAYWAPALASQ  127

Query  422  IGIKSVFYSTIS  457
            +GIKS++YS + 
Sbjct  128  LGIKSIYYSAVC  139



>ref|XP_011464322.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Fragaria vesca subsp. vesca]
Length=350

 Score =   155 bits (392),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 99/141 (70%), Gaps = 2/141 (1%)
 Frame = +2

Query  44   SQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISF  223
            S  TT H+AM+P F +GHLT F  ++NKLA +GH+ISF +P  T+SKL+ +NLHPHLI+F
Sbjct  37   SDQTTLHIAMFPGFAMGHLTPFLHISNKLAERGHKISFFVPLKTRSKLQHYNLHPHLITF  96

Query  224  VPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWL  403
            VP+ V  + GLPPG ET +D+      LL  AMD T+  IE  L  LK D+VF+D +HWL
Sbjct  97   VPLNVSHVHGLPPGTETKADIDLSLGSLLATAMDLTRTQIEQSLVKLKPDIVFFDISHWL  156

Query  404  PSLARKIG--IKSVFYSTISP  460
            P+L R +G  IKSV YS I+P
Sbjct  157  PALLRGLGTNIKSVCYSVINP  177



>ref|XP_002285228.1| PREDICTED: UDP-glycosyltransferase 79B9-like [Vitis vinifera]
Length=458

 Score =   157 bits (396),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 76/152 (50%), Positives = 108/152 (71%), Gaps = 0/152 (0%)
 Frame = +2

Query  44   SQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISF  223
            ++ T + +AMYPWF  GHLT +  L+N+LA +GH+I+F++P+ TQS+L+  NLHP LI+F
Sbjct  4    ARNTKFQIAMYPWFAFGHLTPYLHLSNELAERGHKITFILPEKTQSQLQHLNLHPTLITF  63

Query  224  VPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWL  403
             P+ +P + GLPPGAET SDVPF S HLL  AMD+T + +E  L+ LK D  F+DF +W 
Sbjct  64   HPLTIPHVDGLPPGAETASDVPFFSHHLLATAMDRTSDQVEAALRALKPDFFFFDFPYWA  123

Query  404  PSLARKIGIKSVFYSTISPLMHGYALSPERRV  499
            P+LA K+GIKS++YS +      +   P R+V
Sbjct  124  PALASKLGIKSIYYSAVCASAVAHHPPPGRQV  155



>ref|XP_008386210.1| PREDICTED: UDP-glycosyltransferase 79B9-like [Malus domestica]
Length=468

 Score =   157 bits (396),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 71/164 (43%), Positives = 107/164 (65%), Gaps = 4/164 (2%)
 Frame = +2

Query  50   ATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVP  229
            ++++H+AM+PWF +GH+T F  L+N+LA +GH+I+FL+PK  Q  L+  NLHPHL++F P
Sbjct  2    SSSFHIAMFPWFALGHMTPFLHLSNELAARGHKITFLLPKKAQILLQHLNLHPHLVTFHP  61

Query  230  IVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILK----DLKVDVVFYDFTH  397
            + VP I GLP   E  S++P   +H L  A+D+T++ I+  LK    + KVD++F+D  H
Sbjct  62   VTVPHIEGLPDKTEFVSEIPLSLSHFLTLAIDRTRDQIQDFLKTSVANCKVDMIFFDSAH  121

Query  398  WLPSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADM  529
            W+P +AR +GIKS+FY  I    +  +L P    V K    A M
Sbjct  122  WIPEIARGLGIKSIFYGVICAAAYALSLVPICNYVTKDACMAPM  165



>gb|EYU43362.1| hypothetical protein MIMGU_mgv1a019428mg [Erythranthe guttata]
Length=443

 Score =   156 bits (395),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 75/140 (54%), Positives = 94/140 (67%), Gaps = 0/140 (0%)
 Frame = +2

Query  71   MYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVPSIP  250
            MYPWF +GHLT F  ++NK A KGH+I F++P   QSKL  FN HP LI F+PI VP + 
Sbjct  1    MYPWFAMGHLTTFLHVSNKFAEKGHKIFFILPTKVQSKLNQFNHHPTLIEFIPITVPEVE  60

Query  251  GLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARKIGI  430
            GLP G ETTSDVPF    LL  AMD T++ +E +LK++K   VF+DFT WLPSLAR +GI
Sbjct  61   GLPNGTETTSDVPFTMYSLLRHAMDLTKSTVENLLKEIKPHFVFFDFTPWLPSLARSLGI  120

Query  431  KSVFYSTISPLMHGYALSPE  490
            KS+ Y  I+     +    E
Sbjct  121  KSIHYFIITTASAAFLFRDE  140



>ref|XP_006361070.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Solanum tuberosum]
Length=460

 Score =   156 bits (395),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 107/157 (68%), Gaps = 5/157 (3%)
 Frame = +2

Query  71   MYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVPSIP  250
            MYPW+ +GHLT F  L+NKLA +GH+I F+ P NT SKLE FN +P LI+F  + VP + 
Sbjct  10   MYPWYAMGHLTSFLHLSNKLAHRGHKIFFVHPTNTLSKLEKFNRYPELINFKSVTVPHVD  69

Query  251  GLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARKIGI  430
            GLP GAETTSDVP  + +LL +A+D T   IE +++++K   +FYDF +W+PS+ARK  +
Sbjct  70   GLPLGAETTSDVPIFNQNLLCQALDLTLPKIESLIQEIKPHFIFYDFAYWVPSIARKYKV  129

Query  431  KSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
            KSV Y +I+P   GY +  E        +EA+MM+ P
Sbjct  130  KSVHYCSITPSSVGYLMRGENPS-----SEAEMMEPP  161



>emb|CAN63799.1| hypothetical protein VITISV_026416 [Vitis vinifera]
Length=250

 Score =   151 bits (382),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 92/133 (69%), Gaps = 0/133 (0%)
 Frame = +2

Query  59   YHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVV  238
            +H+ MYPW   GH+  +  L+N+LA +GH I+F++PK  QS+L+  NLHP LISF  + +
Sbjct  9    FHIVMYPWSAFGHMIPYLHLSNELAERGHSITFILPKKVQSQLQHLNLHPTLISFHSLTI  68

Query  239  PSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLAR  418
            P + GLPPGAET SDVP    HLL  AMD+T + +E  L+ LK D +FYD  +W P LA 
Sbjct  69   PYVDGLPPGAETASDVPISLHHLLATAMDRTTDQVEAALRALKSDFLFYDTAYWAPPLAS  128

Query  419  KIGIKSVFYSTIS  457
            K+G+K +FYS +S
Sbjct  129  KLGMKPIFYSAVS  141



>gb|KJB13261.1| hypothetical protein B456_002G0654002, partial [Gossypium raimondii]
Length=394

 Score =   155 bits (391),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/166 (45%), Positives = 109/166 (66%), Gaps = 2/166 (1%)
 Frame = +2

Query  44   SQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISF  223
            S  +  H+AM+PW   GH   +  L+NKLA KGH+ISF +PK  Q KLE+ N +P+LI F
Sbjct  4    SGCSKLHIAMFPWVAYGHFIPYLHLSNKLAHKGHKISFFLPKGVQPKLENLNQYPNLIRF  63

Query  224  VPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWL  403
             P+ +P + GLPPGAETTS VP      L  A+D+T++ +E ILK +K D+VFYDF  W+
Sbjct  64   FPLHIPHVDGLPPGAETTSVVPMNQQKYLAFAVDQTRDQVEGILKVIKPDMVFYDFWFWI  123

Query  404  PSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
            P LAR++GI  +FY  +S ++   ++ P  + + K++T  ++ K P
Sbjct  124  PDLARQLGILPIFYVVVSSMI--MSIGPSTKTLTKEMTVEEVTKLP  167



>ref|XP_009610402.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Nicotiana tomentosiformis]
Length=461

 Score =   156 bits (394),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 72/141 (51%), Positives = 99/141 (70%), Gaps = 0/141 (0%)
 Frame = +2

Query  71   MYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVPSIP  250
            MYPW+ +GHLT F  L+NKLA +GH I F+ P NT SKLE FNL+P LI+F+ I VP + 
Sbjct  10   MYPWYAMGHLTSFLHLSNKLADRGHTIFFIHPTNTLSKLEKFNLYPQLINFISIKVPHVE  69

Query  251  GLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARKIGI  430
            GLP GAETTSD+     +LL +A+D TQ  IE ++++LK   + YDF +W+P +ARK G+
Sbjct  70   GLPLGAETTSDISIFKQNLLWQALDLTQQKIESLIQELKPHFILYDFAYWVPLVARKYGV  129

Query  431  KSVFYSTISPLMHGYALSPER  493
            KS+ Y +I+P   GY +  E+
Sbjct  130  KSIHYCSITPSSVGYLMRGEK  150



>ref|XP_006401632.1| hypothetical protein EUTSA_v10013471mg [Eutrema salsugineum]
 gb|ESQ43085.1| hypothetical protein EUTSA_v10013471mg [Eutrema salsugineum]
Length=463

 Score =   156 bits (394),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 78/174 (45%), Positives = 117/174 (67%), Gaps = 7/174 (4%)
 Frame = +2

Query  29   IGSMGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHP  208
            +G  GS +    + MYPW   GH+T F  L+NKLA KGH+I FL+PK   S+LE FNL+P
Sbjct  1    MGDSGSMS----IVMYPWLAFGHMTPFLHLSNKLAEKGHKIVFLLPKKALSQLEPFNLYP  56

Query  209  HLISFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYD  388
            +LI+F  I +P + GLP GAET SDVPF  THLL  AM++TQ +++ IL+ +K ++VFYD
Sbjct  57   NLITFHTISIPQVKGLPLGAETNSDVPFFLTHLLAVAMNQTQPEVDTILRTIKPNLVFYD  116

Query  389  FTHWLPSLARKIGIKSVFYSTISPLMHGYALSP--ERRVV-GKQLTEADMMKAP  541
              +W+P +A+ +G K+V Y+ +S      +L P  ER +  GK+++  ++ ++P
Sbjct  117  SAYWIPEIAKPVGAKTVCYNIVSAASIALSLVPAAERELTDGKEISLEELARSP  170



>ref|XP_002316802.1| glycosyltransferase family protein [Populus trichocarpa]
 gb|EEE97414.1| glycosyltransferase family protein [Populus trichocarpa]
Length=463

 Score =   156 bits (394),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 77/167 (46%), Positives = 107/167 (64%), Gaps = 1/167 (1%)
 Frame = +2

Query  44   SQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISF  223
            S+ +++ + M+PWF VGHLT F  L+NKLA KG  ISFL+P      L+ FNL+P  I+F
Sbjct  6    SKRSSFRILMFPWFAVGHLTPFLHLSNKLAEKGCTISFLLPNKAIKLLQHFNLYPDHITF  65

Query  224  VPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWL  403
             P+ VP + GLP G ET SD+P   TH L  AMD+T++ +E I++D K D V YD  +W+
Sbjct  66   HPVKVPHVEGLPLGTETASDIPIHLTHFLCVAMDRTRDQVEKIIRDQKPDFVMYDMAYWI  125

Query  404  PSLARKIGIKSVFYSTISPLMHGYALSPERRVV-GKQLTEADMMKAP  541
            P +AR +GIK++ YS +S       L P R VV GK +T A++   P
Sbjct  126  PEVARPLGIKTIKYSVVSAAAIAIVLVPARNVVEGKAITAAELSVPP  172



>ref|XP_010644165.1| PREDICTED: UDP-glycosyltransferase 79B9-like [Vitis vinifera]
Length=454

 Score =   155 bits (393),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/147 (48%), Positives = 99/147 (67%), Gaps = 0/147 (0%)
 Frame = +2

Query  59   YHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVV  238
            +H+ MYPW   GH+  +  L+N+LA +GH I+F++PK  QS+L+  NLHP LISF  + +
Sbjct  9    FHIVMYPWSAFGHMIPYLHLSNELAERGHSITFILPKKVQSQLQHLNLHPTLISFHSLTI  68

Query  239  PSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLAR  418
            P + GLPPGAET SDVP    HLL  AMD+T + +E  L+ LK D +FYD  +W P LA 
Sbjct  69   PYVDGLPPGAETASDVPISLHHLLATAMDRTTDQVEAALRALKSDFLFYDTAYWAPPLAS  128

Query  419  KIGIKSVFYSTISPLMHGYALSPERRV  499
            K+G+KS+FYS +S     Y L  ++++
Sbjct  129  KLGMKSIFYSAVSASAFSYCLVLDQQI  155



>emb|CAN63555.1| hypothetical protein VITISV_034119 [Vitis vinifera]
Length=458

 Score =   155 bits (393),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 76/152 (50%), Positives = 108/152 (71%), Gaps = 0/152 (0%)
 Frame = +2

Query  44   SQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISF  223
            ++ T + +AMYPWF  GHLT +  L+N+LA +GH+I+F++P+ TQS+L+  NLHP LI+F
Sbjct  4    ARNTKFXIAMYPWFAFGHLTPYLHLSNELAERGHKITFILPEKTQSQLQHLNLHPTLITF  63

Query  224  VPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWL  403
             P+ +P + GLPPGAET SDVPF S HLL  AMD+T + +E  L+ LK D  F+DF +W 
Sbjct  64   HPLTIPHVDGLPPGAETASDVPFFSHHLLATAMDRTXDQVEAALRALKPDFFFFDFPYWA  123

Query  404  PSLARKIGIKSVFYSTISPLMHGYALSPERRV  499
            P+LA K+GIKS++YS +      +   P R+V
Sbjct  124  PALASKLGIKSIYYSAVCASAVAHHPPPGRQV  155



>ref|XP_004144601.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Cucumis sativus]
Length=462

 Score =   155 bits (392),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 77/165 (47%), Positives = 110/165 (67%), Gaps = 2/165 (1%)
 Frame = +2

Query  53   TTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPI  232
            ++ H+AMYPWF  GH+  F ++ANKLA KGHRIS  IP  T  +L+ FN  P+LI+FV I
Sbjct  7    SSLHIAMYPWFAFGHMIPFLQIANKLANKGHRISIFIPSKTLPELQHFNHFPNLITFVLI  66

Query  233  VVPSIPGLPPGAETTSDVPFPSTH-LLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPS  409
             VP + GLPPGA+TT+D+  PS   LLM +MD T+ +I   L+D+K +V+FYDF +W+  
Sbjct  67   TVPHVDGLPPGAQTTADISHPSQLPLLMISMDLTEPEIASCLQDIKPNVIFYDFAYWVTK  126

Query  410  LARKIGIKSVFYSTISPLMHGYALSPERRVVGKQ-LTEADMMKAP  541
            LA ++GI S++Y+ +S +  GY       + G   LT+ D M+ P
Sbjct  127  LADQMGITSIYYNVVSAVTVGYVQGKIWELSGHDTLTQDDFMQPP  171



>gb|KGN43487.1| hypothetical protein Csa_7G041320 [Cucumis sativus]
Length=473

 Score =   155 bits (392),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 77/165 (47%), Positives = 110/165 (67%), Gaps = 2/165 (1%)
 Frame = +2

Query  53   TTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPI  232
            ++ H+AMYPWF  GH+  F ++ANKLA KGHRIS  IP  T  +L+ FN  P+LI+FV I
Sbjct  18   SSLHIAMYPWFAFGHMIPFLQIANKLANKGHRISIFIPSKTLPELQHFNHFPNLITFVLI  77

Query  233  VVPSIPGLPPGAETTSDVPFPSTH-LLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPS  409
             VP + GLPPGA+TT+D+  PS   LLM +MD T+ +I   L+D+K +V+FYDF +W+  
Sbjct  78   TVPHVDGLPPGAQTTADISHPSQLPLLMISMDLTEPEIASCLQDIKPNVIFYDFAYWVTK  137

Query  410  LARKIGIKSVFYSTISPLMHGYALSPERRVVGKQ-LTEADMMKAP  541
            LA ++GI S++Y+ +S +  GY       + G   LT+ D M+ P
Sbjct  138  LADQMGITSIYYNVVSAVTVGYVQGKIWELSGHDTLTQDDFMQPP  182



>emb|CAN63797.1| hypothetical protein VITISV_026414 [Vitis vinifera]
Length=443

 Score =   154 bits (390),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 63/132 (48%), Positives = 97/132 (73%), Gaps = 0/132 (0%)
 Frame = +2

Query  62   HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVP  241
            H+AM+PW   GH+  +  L+N+LAG+GH+I+F++P+  QSKL+  N HP LI+F P++VP
Sbjct  8    HIAMFPWXAFGHMIPYLNLSNELAGRGHKITFILPRKAQSKLQHLNFHPALITFHPLIVP  67

Query  242  SIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARK  421
             + GLPPG ET SD+P   T+LL  A+D+T++ +E  L+ L   ++FYDF +W P+LA +
Sbjct  68   HVDGLPPGTETASDIPVSLTYLLATALDRTRDQVEAALRTLNPHLLFYDFAYWAPALASQ  127

Query  422  IGIKSVFYSTIS  457
            +GIKS++YS + 
Sbjct  128  LGIKSIYYSAVC  139



>ref|XP_004164964.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Cucumis sativus]
Length=462

 Score =   155 bits (391),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 77/165 (47%), Positives = 110/165 (67%), Gaps = 2/165 (1%)
 Frame = +2

Query  53   TTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPI  232
            ++ H+AMYPWF  GH+  F ++ANKLA KGHRIS  IP  T  +L+ FN  P+LI+FV I
Sbjct  7    SSLHIAMYPWFAFGHMIPFLQIANKLANKGHRISIFIPSKTLPELQHFNHFPNLITFVLI  66

Query  233  VVPSIPGLPPGAETTSDVPFPSTH-LLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPS  409
             VP + GLPPGA+TT+D+  PS   LLM +MD T+ +I   L+D+K +V+FYDF +W+  
Sbjct  67   TVPHVDGLPPGAQTTADISHPSQLPLLMISMDLTEPEIASCLQDIKPNVIFYDFAYWVTK  126

Query  410  LARKIGIKSVFYSTISPLMHGYALSPERRVVGKQ-LTEADMMKAP  541
            LA ++GI S++Y+ +S +  GY       + G   LT+ D M+ P
Sbjct  127  LADQMGITSIYYNVVSAVTIGYVQGKIWELSGHDTLTQDDFMQPP  171



>gb|KCW69984.1| hypothetical protein EUGRSUZ_F03295 [Eucalyptus grandis]
Length=449

 Score =   154 bits (390),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 72/158 (46%), Positives = 104/158 (66%), Gaps = 1/158 (1%)
 Frame = +2

Query  71   MYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVPSIP  250
            M+PWF VGH+T +  L+N+LA +GH+ISF +P+     LE+ NLHP+LI+F P+ VPS+ 
Sbjct  1    MFPWFAVGHITPYLHLSNELAKRGHKISFFLPRKALILLENLNLHPNLITFHPLTVPSVA  60

Query  251  GLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARKIGI  430
             LPPG ET SD+ F  +  L  AMD T+  +E+ L+ ++ D +FYD+ HW+P +AR +GI
Sbjct  61   TLPPGTETASDITFSDSPFLAAAMDLTRPQLEVSLQAMQPDFIFYDYAHWIPQVARPLGI  120

Query  431  KSVFYSTISPLMHGYALSPERRVV-GKQLTEADMMKAP  541
            ++V Y+ IS       L P R V  GK  TE ++ K P
Sbjct  121  RTVCYNVISAAAIAMVLVPVREVTQGKPCTEEELEKPP  158



>ref|XP_010260356.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Nelumbo nucifera]
Length=472

 Score =   155 bits (391),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 111/164 (68%), Gaps = 3/164 (2%)
 Frame = +2

Query  59   YHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVV  238
            +H+AMYPWF +GH+T +  L+NKLA KGHR+SF +P  T+SKLE  N +PHLI F+ I +
Sbjct  10   FHVAMYPWFAIGHITPYLHLSNKLAEKGHRVSFFLPLKTKSKLEHLNRYPHLIRFITIPI  69

Query  239  PSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLAR  418
              + GLPP AETT+DV  P   LLM  +D T++ +E  L DLK D+VFYD  +WLP+LAR
Sbjct  70   ARVDGLPPTAETTADVSSPMVPLLMTTLDLTKDHVEAFLLDLKPDLVFYDLAYWLPALAR  129

Query  419  KIGIKSVFYSTISPLMHGYALSPER---RVVGKQLTEADMMKAP  541
             +GIKS+ YS +S     Y  SP R       KQLT+ ++M+ P
Sbjct  130  HLGIKSIHYSVVSSAASSYLASPARMPPSAGVKQLTQEELMQPP  173



>ref|XP_006401633.1| hypothetical protein EUTSA_v10013535mg [Eutrema salsugineum]
 gb|ESQ43086.1| hypothetical protein EUTSA_v10013535mg [Eutrema salsugineum]
Length=447

 Score =   154 bits (389),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 99/152 (65%), Gaps = 3/152 (2%)
 Frame = +2

Query  38   MGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLI  217
            MGS+   +H  M+PWFG GH+T F  LANKLA KGH+I+FL+PK    +LE  NL P+ I
Sbjct  1    MGSK---FHAFMFPWFGFGHMTAFLHLANKLAEKGHKITFLLPKKALKQLEPLNLFPNRI  57

Query  218  SFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTH  397
             F  I VPS+ GLP GAETTSD+P      L  AMD+T+N ++  +   K D++F+DF H
Sbjct  58   VFDTITVPSVEGLPAGAETTSDIPISLGSFLASAMDRTRNQVKERVSMSKPDLIFFDFAH  117

Query  398  WLPSLARKIGIKSVFYSTISPLMHGYALSPER  493
            W+P +AR+ G KSV + TIS      + SP R
Sbjct  118  WIPEIAREYGAKSVNFVTISAACVAISFSPGR  149



>ref|XP_006281795.1| hypothetical protein CARUB_v10027966mg [Capsella rubella]
 gb|EOA14693.1| hypothetical protein CARUB_v10027966mg [Capsella rubella]
Length=447

 Score =   153 bits (387),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 74/150 (49%), Positives = 96/150 (64%), Gaps = 3/150 (2%)
 Frame = +2

Query  38   MGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLI  217
            MGS+   +H  M+PWFG GH+T F  LANKLA  GHRI+FL+PK    +LE  NL P  I
Sbjct  1    MGSK---FHAFMFPWFGFGHMTAFLHLANKLAEGGHRITFLLPKKALKQLEPLNLFPDFI  57

Query  218  SFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTH  397
             F  + +PS+ GLP GAETTSD+P  S   L  AMD+T+N +E  +   K D++F+DF H
Sbjct  58   IFQTLTIPSVDGLPAGAETTSDIPISSGSFLASAMDRTRNQVEEAVSIGKPDLIFFDFAH  117

Query  398  WLPSLARKIGIKSVFYSTISPLMHGYALSP  487
            W+P +AR+ G KSV Y TIS      +  P
Sbjct  118  WIPEIAREYGAKSVNYITISAACVAISFVP  147



>ref|XP_010520927.1| PREDICTED: anthocyanidin 3-O-glucoside 2'''-O-xylosyltransferase 
[Tarenaya hassleriana]
Length=468

 Score =   154 bits (388),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 73/169 (43%), Positives = 106/169 (63%), Gaps = 2/169 (1%)
 Frame = +2

Query  41   GSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLIS  220
            G++ ++  + MYPW  +GH+T F  L+NKLA KGHRI FL+PK  ++ LE  NLHP+LI+
Sbjct  5    GTEGSSMSIVMYPWLALGHMTAFLHLSNKLAEKGHRIVFLLPKKARAHLEPINLHPNLIT  64

Query  221  FVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHW  400
            F  I +P + GLP GAET SDVP   THLL  AMD+T+ ++E +++ +K D+VFYDF  W
Sbjct  65   FRTISIPHVHGLPLGAETNSDVPIFLTHLLAVAMDRTRPEVETVVRTVKPDLVFYDFADW  124

Query  401  LPSLARKIGIKSVFYSTISPLMHGYALSP--ERRVVGKQLTEADMMKAP  541
            +P ++  +G K+V + T S       L P   R +    +   D +  P
Sbjct  125  VPGISAPVGAKTVCFDTASAASIALTLVPAAAREMADGAMLSGDELSRP  173



>gb|KJB11800.1| hypothetical protein B456_002G0654001 [Gossypium raimondii]
Length=454

 Score =   153 bits (387),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 75/163 (46%), Positives = 107/163 (66%), Gaps = 4/163 (2%)
 Frame = +2

Query  53   TTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPI  232
            +  H+AM+PW   GH   F  L+NKLA KGH+ISF +PK  Q KLE+ N +P+LI F P+
Sbjct  7    SKLHIAMFPWVAYGHFIPFLHLSNKLAHKGHQISFFLPKGVQPKLENLNQYPNLIRFFPL  66

Query  233  VVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSL  412
             +P + GLPPGAETTS VP      L  A+D+T++ +E ILK +K D+VFYDF  W+P L
Sbjct  67   HIPHVDGLPPGAETTSVVPMNQQKYLAFAVDQTRDQVEGILKVIKPDMVFYDFWFWIPDL  126

Query  413  ARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
            AR++GI  +FY  +S +  G       +V+ K++T  ++M+ P
Sbjct  127  ARQLGILPIFYVVVSSMSMGL----NTKVLTKEMTVEEVMELP  165



>ref|XP_009340549.1| PREDICTED: UDP-glycosyltransferase 79B3-like [Pyrus x bretschneideri]
Length=456

 Score =   153 bits (386),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 105/165 (64%), Gaps = 8/165 (5%)
 Frame = +2

Query  71   MYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVPSIP  250
            M+PWF +GHLT F  L+N+LA +GHRI+FL+PK  Q+KL+  N HPHLI+F  I VP + 
Sbjct  1    MFPWFAMGHLTPFLHLSNELAARGHRITFLLPKKAQTKLQHLNHHPHLITFHSITVPHVE  60

Query  251  GLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILK----DLK--VDVVFYDFTHWLPSL  412
            GLP  AET S++P  S H L  AMD+T++ I   LK    D K  +D++ +D  HW+P +
Sbjct  61   GLPKSAETASEIPLSSIHFLTIAMDRTRDQIHAFLKASAADPKHIIDMIVFDLAHWIPDI  120

Query  413  ARKIGIKSVFYSTISPLMHGYAL--SPERRVVGKQLTEADMMKAP  541
            AR +GIKS++Y  I   ++  AL  +PE   V   +TE    + P
Sbjct  121  ARGLGIKSIYYGVICAAVYAAALVPAPECNSVPMTVTEERQRRNP  165



>ref|XP_011008292.1| PREDICTED: anthocyanidin 3-O-glucoside 2'''-O-xylosyltransferase-like 
[Populus euphratica]
Length=463

 Score =   153 bits (386),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 76/166 (46%), Positives = 105/166 (63%), Gaps = 1/166 (1%)
 Frame = +2

Query  47   QATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFV  226
            + + + + M+PWF VGHLT F  L+NKLA KG  ISFL+P      L+ FNL+P  I+F 
Sbjct  7    KRSNFRILMFPWFAVGHLTPFLHLSNKLAEKGCTISFLLPNKAIKLLQHFNLYPDHITFH  66

Query  227  PIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLP  406
            P+ VP + GLP G ET SD+P   TH L  AMD+T++ +E I++D K D V YD  +W+P
Sbjct  67   PVQVPHVEGLPLGTETASDIPIYLTHFLCVAMDRTRDQVEKIIRDQKPDFVMYDMAYWIP  126

Query  407  SLARKIGIKSVFYSTISPLMHGYALSPERRVV-GKQLTEADMMKAP  541
             +AR +GIK++ YS +S       L P R VV GK +T A++   P
Sbjct  127  EVARPLGIKTIKYSVVSAAAIAIVLVPARNVVEGKPITAAELSVPP  172



>ref|XP_002866013.1| glycosyltransferase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42272.1| glycosyltransferase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=446

 Score =   152 bits (385),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/150 (48%), Positives = 97/150 (65%), Gaps = 3/150 (2%)
 Frame = +2

Query  38   MGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLI  217
            MGS+   +H  M+PWFG GH+T F  LANKLA KGH+I+FL+PK    +LE  NL PH I
Sbjct  1    MGSK---FHAFMFPWFGFGHMTAFLHLANKLAEKGHKITFLLPKKALKQLEPLNLFPHCI  57

Query  218  SFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTH  397
             F  + +PS+ GLP GAETTSD+P      L  AMD+T+N +E  +   + D++F+DF H
Sbjct  58   VFHTLTIPSVDGLPAGAETTSDIPISLGSFLASAMDRTRNQVEEAVSIRQPDMIFFDFAH  117

Query  398  WLPSLARKIGIKSVFYSTISPLMHGYALSP  487
            W+P +AR+ G KSV + TIS      +  P
Sbjct  118  WIPEIAREYGAKSVNFITISAACVAISFVP  147



>ref|XP_010482811.1| PREDICTED: anthocyanidin 3-O-glucoside 2'''-O-xylosyltransferase-like 
[Camelina sativa]
Length=468

 Score =   152 bits (385),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 74/175 (42%), Positives = 117/175 (67%), Gaps = 4/175 (2%)
 Frame = +2

Query  29   IGSMGSQ-ATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLH  205
            +G+ GS  +++  + MYPW   GH+T F  L+NKLA KGH+I FL+PK   ++LE  NL+
Sbjct  1    MGAFGSNGSSSMSIVMYPWLAFGHMTPFLHLSNKLAEKGHKIVFLLPKKALTQLEPLNLY  60

Query  206  PHLISFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFY  385
            P+LI+F  I +P + GLPPGAET SDVP+  T+LL  AM++T+ ++E I   +K D+VF+
Sbjct  61   PNLITFHTISIPQVKGLPPGAETNSDVPYFLTYLLRVAMNQTRPEVETIFHTIKPDLVFF  120

Query  386  DFTHWLPSLARKIGIKSVFYSTISPLMHGYALSP--ERRVV-GKQLTEADMMKAP  541
            D   W+P +A+ +G K+V ++ +S      +L P  ER+V+ G +++  ++ K P
Sbjct  121  DTADWIPEVAKPVGAKTVCFNIVSAAAIALSLVPAAERKVIDGNEMSGEELAKTP  175



>ref|XP_010260530.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Nelumbo nucifera]
Length=471

 Score =   152 bits (384),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 81/164 (49%), Positives = 110/164 (67%), Gaps = 3/164 (2%)
 Frame = +2

Query  59   YHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVV  238
            +H+ MYPWF +GH+T +  L+N+LA KGHR+SF +P  T+SKLE  N +PHLI F+ I +
Sbjct  9    FHVTMYPWFAIGHITPYLHLSNQLAEKGHRVSFFLPPKTKSKLEHLNRYPHLIRFITIPI  68

Query  239  PSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLAR  418
              + GLPP AETT+DV  P   LLM  +D T++ +E  L DLK D+VFYD  +WLP+LAR
Sbjct  69   ARVDGLPPTAETTADVSSPMVPLLMTTLDLTKDHVEAFLLDLKPDLVFYDLAYWLPALAR  128

Query  419  KIGIKSVFYSTISPLMHGYALSPER---RVVGKQLTEADMMKAP  541
             +GIKS+ YS +S     Y  SP R       KQLT+ ++M+ P
Sbjct  129  HLGIKSIHYSVVSSAASSYLASPARMPPSAGVKQLTQEELMQPP  172



>gb|KFK30258.1| hypothetical protein AALP_AA7G237800 [Arabis alpina]
Length=452

 Score =   152 bits (383),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 67/132 (51%), Positives = 92/132 (70%), Gaps = 0/132 (0%)
 Frame = +2

Query  50   ATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVP  229
            A+ +H  MYPWF  GH+T F  LANKL  KGHR++FL+PK    + E  NL+PH I F  
Sbjct  2    ASKFHALMYPWFATGHITPFMHLANKLGEKGHRVTFLLPKKALKQFEHLNLYPHHIVFRT  61

Query  230  IVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPS  409
            + VP + GLP G ET+S++P  ST+LL  AMD T++ +E +++ LK DV+F+DF HW+P 
Sbjct  62   VTVPHVDGLPLGVETSSEIPISSTNLLASAMDLTRSQVEDVVRALKPDVIFFDFAHWIPE  121

Query  410  LARKIGIKSVFY  445
            +AR+ G KSV Y
Sbjct  122  VAREFGAKSVDY  133



>ref|XP_010442978.1| PREDICTED: UDP-glycosyltransferase 79B6 isoform X2 [Camelina 
sativa]
Length=422

 Score =   151 bits (381),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 69/147 (47%), Positives = 95/147 (65%), Gaps = 0/147 (0%)
 Frame = +2

Query  53   TTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPI  232
            + +H  M+PWFG GH+T F  LANKLA KGH+I+FL+PK    +L+  N+ P  I F  +
Sbjct  3    SKFHAFMFPWFGFGHMTAFLHLANKLAEKGHKITFLLPKKALKQLKPLNIFPDCIVFHTL  62

Query  233  VVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSL  412
             +PS+ GLP GAETTSD+P  S   L  AMD+T+N +E  +   K D++F+DF HW+P +
Sbjct  63   TIPSVDGLPAGAETTSDIPISSGSFLASAMDQTRNQVEEAVSIGKPDLIFFDFAHWIPEI  122

Query  413  ARKIGIKSVFYSTISPLMHGYALSPER  493
            AR+ G KSV + TIS      +  P R
Sbjct  123  ARECGAKSVNFITISAACVAISFVPGR  149



>ref|XP_010442976.1| PREDICTED: UDP-glycosyltransferase 79B6 isoform X1 [Camelina 
sativa]
Length=447

 Score =   151 bits (381),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 69/147 (47%), Positives = 95/147 (65%), Gaps = 0/147 (0%)
 Frame = +2

Query  53   TTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPI  232
            + +H  M+PWFG GH+T F  LANKLA KGH+I+FL+PK    +L+  N+ P  I F  +
Sbjct  3    SKFHAFMFPWFGFGHMTAFLHLANKLAEKGHKITFLLPKKALKQLKPLNIFPDCIVFHTL  62

Query  233  VVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSL  412
             +PS+ GLP GAETTSD+P  S   L  AMD+T+N +E  +   K D++F+DF HW+P +
Sbjct  63   TIPSVDGLPAGAETTSDIPISSGSFLASAMDQTRNQVEEAVSIGKPDLIFFDFAHWIPEI  122

Query  413  ARKIGIKSVFYSTISPLMHGYALSPER  493
            AR+ G KSV + TIS      +  P R
Sbjct  123  ARECGAKSVNFITISAACVAISFVPGR  149



>ref|NP_194487.1| UDP-glycosyltransferase 79B3 [Arabidopsis thaliana]
 sp|Q9T081.1|U79B3_ARATH RecName: Full=UDP-glycosyltransferase 79B3 [Arabidopsis thaliana]
 emb|CAB38269.1| UDP rhamnose--anthocyanidin-3-glucoside rhamnosyltransferase-like 
protein [Arabidopsis thaliana]
 emb|CAB81407.1| UDP rhamnose--anthocyanidin-3-glucoside rhamnosyltransferase-like 
protein [Arabidopsis thaliana]
 dbj|BAC43080.1| putative UDP rhamnose--anthocyanidin-3-glucoside rhamnosyltransferase 
[Arabidopsis thaliana]
 gb|AAO63434.1| At4g27570 [Arabidopsis thaliana]
 gb|AEE85358.1| UDP-glycosyltransferase 79B3 [Arabidopsis thaliana]
 gb|AHL38673.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=453

 Score =   151 bits (381),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 66/133 (50%), Positives = 94/133 (71%), Gaps = 0/133 (0%)
 Frame = +2

Query  59   YHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVV  238
            +H+ MYPWF  GH+T F  LANKLA KGH ++FL+PK +  +LE FNL PH I F  + V
Sbjct  6    FHVLMYPWFATGHMTPFLFLANKLAEKGHTVTFLLPKKSLKQLEHFNLFPHNIVFRSVTV  65

Query  239  PSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLAR  418
            P + GLP G ET S++P  ST LLM AMD T++ +E +++ ++ D++F+DF HW+P +AR
Sbjct  66   PHVDGLPVGTETASEIPVTSTDLLMSAMDLTRDQVEAVVRAVEPDLIFFDFAHWIPEVAR  125

Query  419  KIGIKSVFYSTIS  457
              G+K+V Y  +S
Sbjct  126  DFGLKTVKYVVVS  138



>ref|XP_002867497.1| glycosyltransferase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43756.1| glycosyltransferase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=460

 Score =   151 bits (381),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 93/133 (70%), Gaps = 0/133 (0%)
 Frame = +2

Query  59   YHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVV  238
            +H+ MYPWF  GH+T F  LANKLA KGH ++FL+PK    +LE  NL PH I F  + +
Sbjct  6    FHVLMYPWFATGHMTPFLYLANKLAEKGHMVTFLLPKKALKQLEHLNLFPHNIVFRSVTI  65

Query  239  PSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLAR  418
            P + GLP G ET S++P  S  LLM AMD T++ +E++L+ ++ D++F+DF HW+P +AR
Sbjct  66   PHVDGLPVGTETVSEIPVTSADLLMSAMDLTRDQVEVVLRAVEPDLIFFDFAHWIPQVAR  125

Query  419  KIGIKSVFYSTIS  457
             +GIK+V Y  +S
Sbjct  126  DLGIKTVKYVVVS  138



>ref|XP_010474328.1| PREDICTED: anthocyanidin 3-O-glucoside 2'''-O-xylosyltransferase 
[Camelina sativa]
Length=454

 Score =   151 bits (381),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 73/160 (46%), Positives = 108/160 (68%), Gaps = 3/160 (2%)
 Frame = +2

Query  71   MYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVPSIP  250
            MYPW   GH+T F  L+NKLA KGH+I FL+PK   ++LE  NL+P+LI+F  I +P + 
Sbjct  1    MYPWLAFGHMTPFLHLSNKLAEKGHKIVFLLPKKALTQLEPLNLYPNLITFHTISIPQVK  60

Query  251  GLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARKIGI  430
            GLPPGAET SDVP+  T+LL  AM++T+ ++E I   +K D+VF+D   W+P +A+ +G 
Sbjct  61   GLPPGAETNSDVPYFLTYLLRVAMNQTRPEVETIFHTIKPDLVFFDTADWIPEVAKSVGA  120

Query  431  KSVFYSTISPLMHGYALSP--ERRVV-GKQLTEADMMKAP  541
            K+V ++ +S      +L P  ER V+ GK+L+  ++ K P
Sbjct  121  KTVCFNIVSAAAIALSLVPAAEREVIDGKELSGEELAKTP  160



>emb|CBI20242.3| unnamed protein product [Vitis vinifera]
Length=368

 Score =   149 bits (376),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 66/141 (47%), Positives = 94/141 (67%), Gaps = 0/141 (0%)
 Frame = +2

Query  71   MYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVPSIP  250
            M+PWF  GH+T F  L+NKLA +GH+I+F++PK  QS+L++ N HP LISF P+ +P + 
Sbjct  1    MFPWFAFGHMTAFLHLSNKLAERGHKITFMLPKKAQSQLQTLNFHPTLISFHPLSIPHVD  60

Query  251  GLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARKIGI  430
            GLPPGAET SD+P   THLL  AMD+  + +E  L+    D +FYD +H  P LA ++GI
Sbjct  61   GLPPGAETASDIPIFLTHLLATAMDRATDQLEAALRASNPDFLFYDCSHLAPVLASRLGI  120

Query  431  KSVFYSTISPLMHGYALSPER  493
            K++ Y+ +       AL P +
Sbjct  121  KAICYNVVCAASIAIALVPAQ  141



>ref|XP_011460590.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Fragaria vesca subsp. vesca]
Length=451

 Score =   150 bits (379),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 75/158 (47%), Positives = 104/158 (66%), Gaps = 2/158 (1%)
 Frame = +2

Query  56   TYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIV  235
            T H+AMYPWF +GHLT F  ++NKLA +G++ISF +P  T+SKL+ +NLHP LI+F+P+ 
Sbjct  5    TLHIAMYPWFAMGHLTAFLHISNKLAERGNKISFFLPLKTRSKLQHYNLHPRLITFIPLS  64

Query  236  VPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLA  415
            VP + GLP G ETT+D+      LL  AMD T+  IE  L +LK D VF+D ++WLP++ 
Sbjct  65   VPHVDGLPLGTETTADIDLSLGSLLATAMDLTRPQIEQSLIELKPDFVFFDLSYWLPAML  124

Query  416  RKIG--IKSVFYSTISPLMHGYALSPERRVVGKQLTEA  523
            R +   IKS++YS I+P    + L         QL EA
Sbjct  125  RGLATNIKSIYYSVINPATIWFGLRNLVLPRKNQLDEA  162



>ref|XP_010537036.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Tarenaya hassleriana]
Length=461

 Score =   149 bits (377),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 69/142 (49%), Positives = 97/142 (68%), Gaps = 0/142 (0%)
 Frame = +2

Query  62   HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVP  241
            H+ M+PWF  GH+T F  LANKLA KGH++++L+PK  Q +LE+ NLHP  ISF  + VP
Sbjct  7    HVLMFPWFAFGHMTPFLHLANKLAEKGHKVTYLLPKKAQEQLENLNLHPESISFNLVSVP  66

Query  242  SIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARK  421
            S+  LP GAET SD+P   +  L  AMD T++ +E  +  LK D++FYDF HW+P +A++
Sbjct  67   SVNDLPAGAETASDIPISLSSSLASAMDLTRDQVEARVHALKPDLIFYDFAHWIPEIAQR  126

Query  422  IGIKSVFYSTISPLMHGYALSP  487
            IG+K+V Y T+S      +L P
Sbjct  127  IGVKTVCYVTVSAATVAISLVP  148



>gb|AAL09791.1| AT4g27560/T29A15_50 [Arabidopsis thaliana]
Length=461

 Score =   149 bits (376),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 93/133 (70%), Gaps = 0/133 (0%)
 Frame = +2

Query  59   YHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVV  238
            +H+ MYPWF  GH+T F  LANKLA KGH ++FLIPK    +LE+ NL PH I+F  + V
Sbjct  6    FHVLMYPWFATGHMTPFLFLANKLAEKGHTVTFLIPKKALKQLENLNLFPHNIAFRSVTV  65

Query  239  PSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLAR  418
            P + GLP G ET S++P  S  LLM AMD T++ +E +++ ++ D++F+DF HW+P +AR
Sbjct  66   PHVDGLPVGTETVSEIPVTSADLLMSAMDLTRDQVEGVVRAVEPDLIFFDFAHWIPEVAR  125

Query  419  KIGIKSVFYSTIS  457
              G+K+V Y  +S
Sbjct  126  DFGLKTVKYVVVS  138



>ref|NP_200212.1| UDP-glycosyltransferase 79B6 [Arabidopsis thaliana]
 sp|Q9FN26.1|U79B6_ARATH RecName: Full=UDP-glycosyltransferase 79B6 [Arabidopsis thaliana]
 dbj|BAB10731.1| flavonol 3-O-glucosyltransferase-like protein [Arabidopsis thaliana]
 gb|AAV84494.1| At5g54010 [Arabidopsis thaliana]
 gb|AAW30019.1| At5g54010 [Arabidopsis thaliana]
 gb|AED96438.1| UDP-glycosyltransferase 79B6 [Arabidopsis thaliana]
 gb|AHL38580.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=453

 Score =   149 bits (376),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 71/152 (47%), Positives = 98/152 (64%), Gaps = 3/152 (2%)
 Frame = +2

Query  38   MGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLI  217
            MGS+   +H  M+PWFG GH+T F  LANKLA K H+I+FL+PK  + +LES NL P  I
Sbjct  1    MGSK---FHAFMFPWFGFGHMTAFLHLANKLAEKDHKITFLLPKKARKQLESLNLFPDCI  57

Query  218  SFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTH  397
             F  + +PS+ GLP GAETTSD+P      L  AMD+T+  ++  +   K D++F+DF H
Sbjct  58   VFQTLTIPSVDGLPDGAETTSDIPISLGSFLASAMDRTRIQVKEAVSVGKPDLIFFDFAH  117

Query  398  WLPSLARKIGIKSVFYSTISPLMHGYALSPER  493
            W+P +AR+ G+KSV + TIS      +  P R
Sbjct  118  WIPEIAREYGVKSVNFITISAACVAISFVPGR  149



>ref|XP_011460764.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Fragaria vesca 
subsp. vesca]
Length=457

 Score =   149 bits (375),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 63/132 (48%), Positives = 96/132 (73%), Gaps = 0/132 (0%)
 Frame = +2

Query  53   TTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPI  232
            +++H+AM+PWF +GH+T +  L+N+LA +GHRI+ L+PK  Q +L+  NLHP+LI F P+
Sbjct  4    SSFHIAMFPWFAMGHMTPYVHLSNELASRGHRITILVPKKAQDQLQHLNLHPNLIIFRPV  63

Query  233  VVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSL  412
            +VP   GLP G ET S++P  ++ LL  A+DKT+  +E  ++  K D+VFYD   W+P +
Sbjct  64   LVPHFEGLPEGTETASEIPLSASWLLAAAVDKTRKQLEEYMQAHKPDMVFYDAACWIPEI  123

Query  413  ARKIGIKSVFYS  448
            ARK+GIK+V Y+
Sbjct  124  ARKLGIKTVCYN  135



>ref|XP_008355387.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Malus domestica]
Length=460

 Score =   148 bits (374),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 67/152 (44%), Positives = 97/152 (64%), Gaps = 0/152 (0%)
 Frame = +2

Query  44   SQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISF  223
            ++ +++H+AM+PW  +GH+T +  L+N+LA +GHR++ L+PK    +LE  N HP+LI+F
Sbjct  2    AEPSSFHLAMFPWLAMGHITPYVHLSNELAARGHRVTLLVPKKAILQLEHLNHHPNLITF  61

Query  224  VPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWL  403
             P+ VP   GLP G E  S++P  + H L  AMD T++ IE  L   K D V YD  HW+
Sbjct  62   SPVTVPHFNGLPEGTEIASEIPIHNIHFLAAAMDLTRDQIEHFLSANKPDFVLYDAAHWV  121

Query  404  PSLARKIGIKSVFYSTISPLMHGYALSPERRV  499
            P +ARK GIKSV Y+ +       AL P R+V
Sbjct  122  PEIARKNGIKSVCYNVVCAAALAIALVPARQV  153



>ref|XP_009339314.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Pyrus x bretschneideri]
Length=464

 Score =   148 bits (374),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 67/150 (45%), Positives = 96/150 (64%), Gaps = 0/150 (0%)
 Frame = +2

Query  50   ATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVP  229
            ++++H+AM+PW  +GH+T +  L+N+LA +GHR++ L+PK    +LE  N HP+LI+F P
Sbjct  8    SSSFHLAMFPWLAMGHITPYVHLSNELAARGHRVTLLVPKKAILQLEHLNHHPNLITFSP  67

Query  230  IVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPS  409
            + VP   GLP G E  S++P  + H L  AMD T++ IE  L   K D V YD  HW+P 
Sbjct  68   VTVPHFDGLPEGTEIASEIPIHNIHFLAAAMDLTRDQIEHFLSANKPDFVLYDAAHWVPE  127

Query  410  LARKIGIKSVFYSTISPLMHGYALSPERRV  499
            +ARK GIKSV Y+ +       AL P R+V
Sbjct  128  IARKNGIKSVCYNVVCAAALAIALVPARQV  157



>gb|KDO58530.1| hypothetical protein CISIN_1g012080mg [Citrus sinensis]
Length=471

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 68/160 (43%), Positives = 104/160 (65%), Gaps = 1/160 (1%)
 Frame = +2

Query  65   MAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVPS  244
            + M PWF VGH+T F  L+NKLA KGH+I+ L+P+  Q++L+ FNLHP LI+  P+ VP 
Sbjct  17   IVMLPWFAVGHMTPFLHLSNKLAEKGHKITILLPRKAQTQLQHFNLHPDLITLHPLTVPH  76

Query  245  IPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARKI  424
            + GLP GAET SDVP  S +LL+ AMD+ +  +E ++K  K  ++FYD  +W+ ++++ +
Sbjct  77   VDGLPAGAETASDVPMSSINLLVIAMDRCRGQVEAVIKAAKPRLLFYDIAYWMATISKSL  136

Query  425  GIKSVFYSTISPLMHGYALSPERRV-VGKQLTEADMMKAP  541
             IK + Y+ +       AL P R V   + +TEA++   P
Sbjct  137  SIKCIKYNVVCAASIATALVPARNVPKDRPVTEAELAMPP  176



>ref|XP_006451768.1| hypothetical protein CICLE_v10008184mg [Citrus clementina]
 ref|XP_006464820.1| PREDICTED: UDP-glycosyltransferase 79B3-like [Citrus sinensis]
 gb|ESR65008.1| hypothetical protein CICLE_v10008184mg [Citrus clementina]
Length=471

 Score =   148 bits (373),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 68/160 (43%), Positives = 104/160 (65%), Gaps = 1/160 (1%)
 Frame = +2

Query  65   MAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVPS  244
            + M PWF VGH+T F  L+NKLA KGH+I+ L+P+  Q++L+ FNLHP LI+  P+ VP 
Sbjct  17   IVMLPWFAVGHMTPFLHLSNKLAEKGHKITILLPRKAQTQLQHFNLHPDLITLHPLTVPY  76

Query  245  IPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARKI  424
            + GLP GAET SDVP  S +LL+ AMD+ +  +E ++K  K  ++FYD  +W+ ++++ +
Sbjct  77   VDGLPAGAETASDVPMSSINLLVIAMDRCRGQVEAVIKAAKPRLLFYDIAYWMATISKSL  136

Query  425  GIKSVFYSTISPLMHGYALSPERRV-VGKQLTEADMMKAP  541
             IK + Y+ +       AL P R V   + +TEA++   P
Sbjct  137  SIKCIKYNVVCAASIATALVPARNVPKDRPVTEAELAMPP  176



>ref|NP_194486.1| UDP-glycosyltransferase 79B2 [Arabidopsis thaliana]
 sp|Q9T080.1|U79B2_ARATH RecName: Full=UDP-glycosyltransferase 79B2 [Arabidopsis thaliana]
 emb|CAB38268.1| UDP rhamnose-anthocyanidin-3-glucoside rhamnosyltransferase-like 
protein [Arabidopsis thaliana]
 emb|CAB81406.1| UDP rhamnose-anthocyanidin-3-glucoside rhamnosyltransferase-like 
protein [Arabidopsis thaliana]
 gb|AAL49923.1| putative UDP rhamnose-anthocyanidin-3-glucoside rhamnosyltransferase 
[Arabidopsis thaliana]
 gb|AAN13158.1| putative UDP rhamnose-anthocyanidin-3-glucoside rhamnosyltransferase 
[Arabidopsis thaliana]
 gb|AEE85357.1| UDP-glycosyltransferase 79B2 [Arabidopsis thaliana]
 gb|AHL38674.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=455

 Score =   147 bits (372),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 92/133 (69%), Gaps = 0/133 (0%)
 Frame = +2

Query  59   YHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVV  238
            +H+ MYPWF  GH+T F  LANKLA KGH ++FLIPK    +LE+ NL PH I F  + V
Sbjct  6    FHVLMYPWFATGHMTPFLFLANKLAEKGHTVTFLIPKKALKQLENLNLFPHNIVFRSVTV  65

Query  239  PSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLAR  418
            P + GLP G ET S++P  S  LLM AMD T++ +E +++ ++ D++F+DF HW+P +AR
Sbjct  66   PHVDGLPVGTETVSEIPVTSADLLMSAMDLTRDQVEGVVRAVEPDLIFFDFAHWIPEVAR  125

Query  419  KIGIKSVFYSTIS  457
              G+K+V Y  +S
Sbjct  126  DFGLKTVKYVVVS  138



>emb|CBI20246.3| unnamed protein product [Vitis vinifera]
Length=425

 Score =   147 bits (371),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/147 (46%), Positives = 96/147 (65%), Gaps = 0/147 (0%)
 Frame = +2

Query  59   YHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVV  238
            +H+ MYPW   GH+  +  L+N+LA +GH I+F++PK  QS+L+  NLHP LISF  + +
Sbjct  9    FHIVMYPWSAFGHMIPYLHLSNELAERGHSITFILPKKVQSQLQHLNLHPTLISFHSLTI  68

Query  239  PSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLAR  418
            P + GLPPGAET SDVP    HLL  AMD+T + +E  L+ LK D +FYD  +W P LA 
Sbjct  69   PYVDGLPPGAETASDVPISLHHLLATAMDRTTDQVEAALRALKSDFLFYDTAYWAPPLAS  128

Query  419  KIGIKSVFYSTISPLMHGYALSPERRV  499
            K+G+K +FY+    L+    +S  R +
Sbjct  129  KLGMKPIFYTFSYCLVLDQQISKSRPI  155



>ref|XP_009132454.1| PREDICTED: UDP-glycosyltransferase 79B6 [Brassica rapa]
Length=447

 Score =   147 bits (371),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/152 (47%), Positives = 97/152 (64%), Gaps = 3/152 (2%)
 Frame = +2

Query  38   MGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLI  217
            MGS+   +H  M+PWFG GH+T F  LANKLA KGH+I+FL+PK    +LE  NL P  I
Sbjct  1    MGSK---FHAFMFPWFGFGHMTAFLHLANKLAEKGHKITFLLPKKGLKQLEPLNLFPKSI  57

Query  218  SFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTH  397
             F  + +PS+ GLP GAETTSD+P      L  AMD+T+  +E  ++  K D++F+DF H
Sbjct  58   VFHILTIPSVDGLPDGAETTSDIPITLGSFLASAMDRTRGQVEETVRLGKPDLIFFDFAH  117

Query  398  WLPSLARKIGIKSVFYSTISPLMHGYALSPER  493
            W+P +AR+ G KSV + TIS      +  P R
Sbjct  118  WIPDIAREYGAKSVNFVTISAACVAISFVPGR  149



>ref|NP_189604.1| UDP-glycosyltransferase 79B4 [Arabidopsis thaliana]
 sp|Q9LJA6.1|U79B4_ARATH RecName: Full=UDP-glycosyltransferase 79B4 [Arabidopsis thaliana]
 dbj|BAB01199.1| UDP-glycose: flavonoid glucosyltransferase-like protein [Arabidopsis 
thaliana]
 gb|AEE77593.1| UDP-glycosyltransferase 79B4 [Arabidopsis thaliana]
Length=448

 Score =   147 bits (370),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 68/140 (49%), Positives = 96/140 (69%), Gaps = 3/140 (2%)
 Frame = +2

Query  38   MGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLI  217
            MGS+   +H  +YPWFG GH+  +  LANKLA KGHR++FL PK  Q +LE  NL P+ I
Sbjct  1    MGSK---FHAFLYPWFGFGHMIPYLHLANKLAEKGHRVTFLAPKKAQKQLEPLNLFPNSI  57

Query  218  SFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTH  397
             F  + +P + GLP GAETT+D+P  S  +L +AMD  +  IE+ ++ LK D++F+DF  
Sbjct  58   HFENVTLPHVDGLPVGAETTADLPNSSKRVLADAMDLLREQIEVKIRSLKPDLIFFDFVD  117

Query  398  WLPSLARKIGIKSVFYSTIS  457
            W+P +A+++GIKSV Y  IS
Sbjct  118  WIPQMAKELGIKSVSYQIIS  137



>gb|KDP36254.1| hypothetical protein JCGZ_09819 [Jatropha curcas]
Length=442

 Score =   147 bits (370),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 66/166 (40%), Positives = 107/166 (64%), Gaps = 1/166 (1%)
 Frame = +2

Query  47   QATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFV  226
            + + +H+ M+PWF VGH+T F  L+N+LA KG   +FL+P     +L+ FNL+P LI+F 
Sbjct  6    KNSIFHIVMFPWFAVGHMTPFLHLSNRLAEKGLSTTFLLPNKAIQQLKHFNLYPDLIAFH  65

Query  227  PIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLP  406
             +++P + GLP G ET SD+P   TH L  AMD+T++ +E ++ + K  +V YD  HW+P
Sbjct  66   SLIIPPVDGLPAGTETASDIPIHLTHFLTIAMDRTRDQVEKVIHEKKPKLVIYDVAHWIP  125

Query  407  SLARKIGIKSVFYSTISPLMHGYALSPERRV-VGKQLTEADMMKAP  541
             + + +GIK++ Y+ +S       L+P R+V + K +TEA++   P
Sbjct  126  EITKSVGIKAINYTVVSAASLAIVLNPARKVTLEKPITEAELAVPP  171



>gb|KFK27016.1| hypothetical protein AALP_AA8G323600 [Arabis alpina]
Length=447

 Score =   147 bits (370),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 66/147 (45%), Positives = 96/147 (65%), Gaps = 0/147 (0%)
 Frame = +2

Query  53   TTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPI  232
            + +H  M+PWFG GH+T F  LANKLA KGH+I+FL+PK    +LE  NL P+ I F  +
Sbjct  3    SQFHAFMFPWFGFGHMTAFLHLANKLAEKGHKINFLLPKKALKQLEPLNLFPNSIVFHIL  62

Query  233  VVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSL  412
             +P + GLP GAETT+D+P      L  AMD+T+N ++ ++ + K D++F+DF HW+P +
Sbjct  63   TIPPVDGLPAGAETTADIPISLGSFLASAMDRTRNQVKEMVSNDKPDLIFFDFAHWIPEI  122

Query  413  ARKIGIKSVFYSTISPLMHGYALSPER  493
            A++ G K+V Y TIS      +  P R
Sbjct  123  AKEYGAKTVNYVTISAACVAISFVPGR  149



>dbj|BAE99810.1| putative flavonol 3-O-glucosyltransferase [Arabidopsis thaliana]
Length=448

 Score =   147 bits (370),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 68/140 (49%), Positives = 96/140 (69%), Gaps = 3/140 (2%)
 Frame = +2

Query  38   MGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLI  217
            MGS+   +H  +YPWFG GH+  +  LANKLA KGHR++FL PK  Q +LE  NL P+ I
Sbjct  1    MGSK---FHAFLYPWFGFGHMIPYLHLANKLAEKGHRVTFLAPKKAQKQLEPLNLFPNSI  57

Query  218  SFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTH  397
             F  + +P + GLP GAETT+D+P  S  +L +AMD  +  IE+ ++ LK D++F+DF  
Sbjct  58   HFENVTLPHVDGLPVGAETTADLPNSSKRVLADAMDLLREQIEVKIRSLKPDLIFFDFVD  117

Query  398  WLPSLARKIGIKSVFYSTIS  457
            W+P +A+++GIKSV Y  IS
Sbjct  118  WIPQMAKELGIKSVSYQIIS  137



>ref|XP_010098447.1| UDP-glycosyltransferase [Morus notabilis]
 gb|EXB75038.1| UDP-glycosyltransferase [Morus notabilis]
Length=459

 Score =   147 bits (370),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 73/163 (45%), Positives = 95/163 (58%), Gaps = 0/163 (0%)
 Frame = +2

Query  53   TTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPI  232
              + +AM+PWF  GH+  F  +AN+LA +GHRIS L+PK  Q  L+  NLHP+LI+F  I
Sbjct  2    ANFDVAMFPWFATGHIAPFIHVANELAVRGHRISILLPKKAQILLQHLNLHPNLITFHTI  61

Query  233  VVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSL  412
             VP + GLPPG ET SD+    THLL  AMD T+  +   L   K  +VFYDF HW+P +
Sbjct  62   TVPHVDGLPPGVETASDIHLSKTHLLAAAMDLTRPQVHDFLSAAKPQIVFYDFAHWVPDI  121

Query  413  ARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
               IG  SV YS +S      AL P R V   +    + +K P
Sbjct  122  TAHIGAISVCYSVVSASSLAIALVPARNVPCDRTVTVEDIKDP  164



>ref|XP_002523261.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF39100.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=460

 Score =   146 bits (369),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 65/166 (39%), Positives = 105/166 (63%), Gaps = 1/166 (1%)
 Frame = +2

Query  47   QATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFV  226
            +++ +H+ M+PWF VGH+T F  LAN++A +G   +FL+P   + +LE FN HP LI+F 
Sbjct  5    KSSNFHIVMFPWFAVGHMTPFLHLANRVAERGCSTTFLLPNKAKLQLEHFNTHPDLITFH  64

Query  227  PIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLP  406
             I VP + GLP G ET SD+P   TH L  A+D+T+  +E ++ D +  +V +D  HW+P
Sbjct  65   SITVPHVEGLPLGTETASDIPIHLTHFLAIALDRTRRQVEKVIVDTRPKLVIFDVAHWIP  124

Query  407  SLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQ-LTEADMMKAP  541
             + + +GIK++ Y+ +       AL P R V   + +TEA++++ P
Sbjct  125  KITKDLGIKAINYNVVCAASIAIALVPARNVTKDRPVTEAELLQPP  170



>ref|XP_006361401.1| PREDICTED: anthocyanidin 3-O-glucoside 2'''-O-xylosyltransferase-like 
[Solanum tuberosum]
Length=463

 Score =   146 bits (369),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 72/149 (48%), Positives = 102/149 (68%), Gaps = 3/149 (2%)
 Frame = +2

Query  62   HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVP  241
             + M+PW   GHL  F  L+N+LA KGHRISFL+PKN + KL++FNL+P+LI+F  + +P
Sbjct  10   QIVMFPWLAFGHLIPFLSLSNELAKKGHRISFLLPKNAEIKLQNFNLYPNLITFHTLKIP  69

Query  242  SIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARK  421
             I GLP GAETT+DVP     LL  AMD+  ++I+  L++LK   VF+DF HW+P +A +
Sbjct  70   HIHGLPYGAETTADVPRSLETLLATAMDELYDEIKSFLRNLKPHFVFFDFAHWVPEIATE  129

Query  422  I-GIKSVFYSTISPLMHGYAL--SPERRV  499
            I GIK++ Y  + P    Y+L  SP++ V
Sbjct  130  IGGIKTLCYKIVCPATSAYSLVRSPKKSV  158



>emb|CAN71740.1| hypothetical protein VITISV_005149 [Vitis vinifera]
Length=990

 Score =   149 bits (377),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 65/126 (52%), Positives = 94/126 (75%), Gaps = 0/126 (0%)
 Frame = +2

Query  71   MYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVPSIP  250
            M PWFG GH+  +  L+N+LA +GH+I+F++P+  QS+L++ NLHP LI+F P+ +P + 
Sbjct  1    MXPWFGFGHMIPYLHLSNELADRGHKITFILPRKAQSQLQNLNLHPTLITFHPLTIPHVD  60

Query  251  GLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARKIGI  430
            GLPPGAET SDVPF   HLL+ AMD+T + +E  L+ LK D + +DF +W P+ A K+GI
Sbjct  61   GLPPGAETASDVPFFLHHLLVTAMDRTTDQVEAALRALKPDFLPFDFLYWAPASASKLGI  120

Query  431  KSVFYS  448
            KS++YS
Sbjct  121  KSIYYS  126



>ref|NP_179877.1| UDP-glycosyltransferase 79B8 [Arabidopsis thaliana]
 sp|O81010.1|U79B8_ARATH RecName: Full=UDP-glycosyltransferase 79B8 [Arabidopsis thaliana]
 gb|AAC32440.1| putative flavonol 3-O-glucosyltransferase [Arabidopsis thaliana]
 gb|AAO64763.1| At2g22930 [Arabidopsis thaliana]
 dbj|BAE99613.1| putative flavonol 3-O-glucosyltransferase [Arabidopsis thaliana]
 gb|AEC07376.1| UDP-glycosyltransferase 79B8 [Arabidopsis thaliana]
 gb|AHL38844.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=442

 Score =   145 bits (367),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 67/144 (47%), Positives = 95/144 (66%), Gaps = 0/144 (0%)
 Frame = +2

Query  56   TYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIV  235
            T+H  M+PWF  GH+  F  LANKLA KGH+I+FL+PK  Q +LE  NL P  I F P+ 
Sbjct  4    TFHAFMFPWFAFGHMIPFLHLANKLAEKGHQITFLLPKKAQKQLEHHNLFPDSIVFHPLT  63

Query  236  VPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLA  415
            +P + GLP GAETTSD+     +LL EA+D T++ +E  ++ L+ D++F+DF HW+P +A
Sbjct  64   IPHVNGLPAGAETTSDISISMDNLLSEALDLTRDQVEAAVRALRPDLIFFDFAHWIPEIA  123

Query  416  RKIGIKSVFYSTISPLMHGYALSP  487
            ++  IKSV Y  +S     Y  +P
Sbjct  124  KEHMIKSVSYMIVSATTIAYTFAP  147



>ref|XP_010448113.1| PREDICTED: UDP-glycosyltransferase 79B3-like isoform X1 [Camelina 
sativa]
 ref|XP_010448114.1| PREDICTED: UDP-glycosyltransferase 79B3-like isoform X1 [Camelina 
sativa]
 ref|XP_010448115.1| PREDICTED: UDP-glycosyltransferase 79B3-like isoform X2 [Camelina 
sativa]
 ref|XP_010448116.1| PREDICTED: UDP-glycosyltransferase 79B3-like isoform X3 [Camelina 
sativa]
Length=453

 Score =   146 bits (368),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 66/140 (47%), Positives = 95/140 (68%), Gaps = 2/140 (1%)
 Frame = +2

Query  38   MGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLI  217
            MGS  + +H  MYPWF  GH+T F  LANKLA KGH ++FL+PK    +LE  NL PH I
Sbjct  1    MGS--SRFHALMYPWFAAGHITPFLYLANKLAEKGHMVTFLLPKKALKQLEHLNLFPHNI  58

Query  218  SFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTH  397
             F  + VP + GLP G ET S++P  + +LLM AMD T++ +E +++ ++ D++F+DF H
Sbjct  59   VFRFVTVPHVDGLPIGTETASEIPVSTNNLLMSAMDLTRDQVEAVVRAVEPDLIFFDFAH  118

Query  398  WLPSLARKIGIKSVFYSTIS  457
            W+P +AR  G+K+V Y  +S
Sbjct  119  WIPEVARDFGLKTVKYVVVS  138



>ref|XP_010442979.1| PREDICTED: anthocyanidin 3-O-glucoside 2'''-O-xylosyltransferase-like 
[Camelina sativa]
Length=447

 Score =   145 bits (367),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 69/150 (46%), Positives = 100/150 (67%), Gaps = 2/150 (1%)
 Frame = +2

Query  65   MAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVPS  244
            + MYPW   GH+T F  L+NKLA KGH+I FL+PK   ++LE  NL P+LI+F  I +P 
Sbjct  3    IVMYPWLAFGHMTPFLHLSNKLAEKGHKIVFLLPKKALTQLEPLNLFPNLITFHTIAIPQ  62

Query  245  IPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARKI  424
            + GLPPGAET SDVP+  T+LL  AM++T+ ++E I   +K D+VF+D  HW+P +A+ +
Sbjct  63   VKGLPPGAETNSDVPYLLTYLLRVAMNQTRPEVETIFHKIKPDLVFFDTAHWIPEVAKPV  122

Query  425  GIKSVFYSTISPLMHGYALSP--ERRVVGK  508
            G K+V ++ +S      +L P  ER  + K
Sbjct  123  GAKTVCFNIVSAAAIALSLVPAAEREELAK  152



>ref|XP_003527222.1| PREDICTED: UDP-glycosyltransferase 79B3-like [Glycine max]
Length=462

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 64/146 (44%), Positives = 95/146 (65%), Gaps = 0/146 (0%)
 Frame = +2

Query  62   HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVP  241
            H+AM+PWF  GH+T F  L+N+LA +GH+I+FL+PK  + +L+  N HPHLI+F  + +P
Sbjct  10   HIAMFPWFATGHMTPFLHLSNELAKRGHKITFLLPKKAKLQLQHLNNHPHLITFHTLTIP  69

Query  242  SIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARK  421
             + GLP G ET S++P    HLL+ AMDKT++ +E  L     D V YD  +W+P +A+K
Sbjct  70   HVKGLPHGTETASEIPISLNHLLVIAMDKTRDQVEHTLSATNPDFVLYDNAYWVPQIAKK  129

Query  422  IGIKSVFYSTISPLMHGYALSPERRV  499
            +GIK++ Y+ +        L P R V
Sbjct  130  LGIKTICYNVVCAASLAIVLVPARNV  155



>ref|XP_010421894.1| PREDICTED: UDP-glycosyltransferase 79B8-like [Camelina sativa]
Length=447

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/135 (49%), Positives = 92/135 (68%), Gaps = 0/135 (0%)
 Frame = +2

Query  53   TTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPI  232
            + +H  M+PWF  GH+  F  LANKLA KGHR++FL+PK  Q ++E  NL P  I F P+
Sbjct  3    SKFHAFMFPWFAFGHMIPFLHLANKLAEKGHRVTFLLPKKAQKQVEHHNLFPDSIVFHPL  62

Query  233  VVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSL  412
             VP + GLPPGAETTSD+     +LL EA+D T+  +E  ++ L+ D++F+DF HW+P L
Sbjct  63   TVPHVNGLPPGAETTSDISISEDNLLSEALDLTRGQVEAAVRALRPDLIFFDFAHWIPEL  122

Query  413  ARKIGIKSVFYSTIS  457
            A++  IKSV Y  +S
Sbjct  123  AKEHMIKSVSYMIVS  137



>ref|XP_006289802.1| hypothetical protein CARUB_v10003406mg [Capsella rubella]
 gb|EOA22700.1| hypothetical protein CARUB_v10003406mg [Capsella rubella]
Length=447

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/135 (49%), Positives = 91/135 (67%), Gaps = 0/135 (0%)
 Frame = +2

Query  53   TTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPI  232
            + +H  M+PWF  GH+  F  LANKLA KGHR++FL+PK  Q ++E  NL P  I F P+
Sbjct  3    SKFHAFMFPWFAFGHMIPFLHLANKLAEKGHRVTFLLPKKAQKQMEHHNLFPDSIVFHPL  62

Query  233  VVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSL  412
             +P + GLP GAETTSD+     +LL EA D TQ+ +E ++  LK D++F+DF HW+P L
Sbjct  63   TIPHVDGLPAGAETTSDISLSLDNLLSEAFDLTQDQVEAVVCYLKPDIIFFDFAHWIPEL  122

Query  413  ARKIGIKSVFYSTIS  457
            A++  IKSV Y  +S
Sbjct  123  AKEHKIKSVSYMIVS  137



>gb|KHN13063.1| UDP-glycosyltransferase 79B3 [Glycine soja]
Length=480

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 64/146 (44%), Positives = 95/146 (65%), Gaps = 0/146 (0%)
 Frame = +2

Query  62   HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVP  241
            H+AM+PWF  GH+T F  L+N+LA +GH+I+FL+PK  + +L+  N HPHLI+F  + +P
Sbjct  10   HIAMFPWFATGHMTPFLHLSNELAKRGHKITFLLPKKAKLQLQHLNNHPHLITFHTLTIP  69

Query  242  SIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARK  421
             + GLP G ET S++P    HLL+ AMDKT++ +E  L     D V YD  +W+P +A+K
Sbjct  70   HVKGLPHGTETASEIPISLNHLLVIAMDKTRDQVEHTLSATNPDFVLYDNAYWVPQIAKK  129

Query  422  IGIKSVFYSTISPLMHGYALSPERRV  499
            +GIK++ Y+ +        L P R V
Sbjct  130  LGIKTICYNVVCAASLAIVLVPARNV  155



>ref|XP_010438412.1| PREDICTED: UDP-glycosyltransferase 79B8 [Camelina sativa]
Length=442

 Score =   145 bits (365),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 65/135 (48%), Positives = 92/135 (68%), Gaps = 0/135 (0%)
 Frame = +2

Query  53   TTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPI  232
            + +H  M+PWF  GH+  F  LANKLA KGHR++FL+PK  Q ++E  NL P  I F P+
Sbjct  3    SKFHAFMFPWFAFGHMIPFLHLANKLAEKGHRVTFLLPKKAQKQVEHHNLFPDSIVFHPL  62

Query  233  VVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSL  412
             VP + GLPPGAETTSD+     +LL EA+D T+  +E  ++ L+ D++F+DF HW+P +
Sbjct  63   TVPHVNGLPPGAETTSDISISEDNLLSEALDLTRGQVEAAVRALRPDLIFFDFAHWIPEV  122

Query  413  ARKIGIKSVFYSTIS  457
            A++  IKSV Y  +S
Sbjct  123  AKEFMIKSVSYIIVS  137



>ref|XP_010496152.1| PREDICTED: UDP-glycosyltransferase 79B8-like [Camelina sativa]
Length=442

 Score =   145 bits (365),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 65/135 (48%), Positives = 92/135 (68%), Gaps = 0/135 (0%)
 Frame = +2

Query  53   TTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPI  232
            + +H  M+PWF  GH+  F  LANKLA KGHR++FL+PK  Q ++E  NL P  I F P+
Sbjct  3    SKFHAFMFPWFAFGHMIPFLHLANKLAEKGHRVTFLLPKKAQKQVEHHNLFPDSIVFHPL  62

Query  233  VVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSL  412
             VP + GLPPGAETTSD+     +LL EA+D T+  +E  ++ L+ D++F+DF HW+P L
Sbjct  63   TVPHVSGLPPGAETTSDISISEDNLLCEALDLTRGQVEAAVRALRPDLIFFDFAHWIPEL  122

Query  413  ARKIGIKSVFYSTIS  457
            A++  IK+V Y  +S
Sbjct  123  AKEHMIKTVSYIIVS  137



>ref|XP_007213912.1| hypothetical protein PRUPE_ppa005654mg [Prunus persica]
 gb|EMJ15111.1| hypothetical protein PRUPE_ppa005654mg [Prunus persica]
Length=449

 Score =   144 bits (364),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/158 (43%), Positives = 98/158 (62%), Gaps = 1/158 (1%)
 Frame = +2

Query  71   MYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVPSIP  250
            M+PWF +GH+T +  LAN+LA +GHRI+ L+P   + +L+   LH  LI F P+ VP + 
Sbjct  1    MFPWFAIGHITPYIHLANELASRGHRITLLVPNKARLQLQHLVLHADLIVFSPVAVPHVH  60

Query  251  GLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARKIGI  430
            GLP G E  S++P   THLL  AMD+T+ +IE  L   K+D V YD   W+P +AR+ GI
Sbjct  61   GLPEGTEIASEIPIHMTHLLATAMDRTRGEIEQFLTVSKLDFVLYDTAQWVPGIARRNGI  120

Query  431  KSVFYSTISPLMHGYALSPERRV-VGKQLTEADMMKAP  541
            K+V Y+ +       AL P R V   + +TE ++ +AP
Sbjct  121  KTVCYNVVCAAALAIALVPARNVPKDRPITEEELREAP  158



>ref|XP_009132456.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Brassica rapa]
Length=447

 Score =   144 bits (364),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/152 (45%), Positives = 96/152 (63%), Gaps = 3/152 (2%)
 Frame = +2

Query  38   MGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLI  217
            MGS+   +H  M+PWFG GH+T F  LANKLA KGH+I+FL+PK    +LE  NL P  I
Sbjct  1    MGSK---FHAFMFPWFGFGHMTAFLHLANKLAEKGHKITFLLPKKALKQLEPLNLFPECI  57

Query  218  SFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTH  397
             F  + +PS+ GLP GA+TT+D+P      L  AMD+T+  +E  ++  K D++F+DF H
Sbjct  58   VFHTLTIPSVDGLPDGAQTTADIPITLGGFLASAMDRTRGQVEEAVRLGKPDLIFFDFAH  117

Query  398  WLPSLARKIGIKSVFYSTISPLMHGYALSPER  493
            W+P +A++ G K V + TIS      +  P R
Sbjct  118  WIPEVAKEYGAKCVNFLTISAACVAISFVPGR  149



>ref|XP_010433351.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyltransferase 79B3-like 
[Camelina sativa]
Length=453

 Score =   144 bits (364),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 62/135 (46%), Positives = 92/135 (68%), Gaps = 0/135 (0%)
 Frame = +2

Query  53   TTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPI  232
            + +H  MYPWF  GH+T F   ANKLA +GH ++FL+PK    +LE  NL PH I F  +
Sbjct  4    SRFHALMYPWFATGHMTPFLYPANKLAERGHMVTFLLPKKALKQLEHLNLFPHNIVFRSV  63

Query  233  VVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSL  412
             VP + GLP G ET S++P  +T LLM AMD T++ +E++++ ++ D++F+DF HW+P +
Sbjct  64   TVPHVDGLPLGTETASEIPVSTTDLLMSAMDLTRDQVEVVVRAVEPDLIFFDFAHWIPEV  123

Query  413  ARKIGIKSVFYSTIS  457
            AR  G+K+V Y  +S
Sbjct  124  ARDFGLKTVKYVVVS  138



>ref|XP_006286630.1| hypothetical protein CARUB_v10002468mg [Capsella rubella]
 gb|EOA19528.1| hypothetical protein CARUB_v10002468mg [Capsella rubella]
Length=443

 Score =   144 bits (364),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/145 (47%), Positives = 94/145 (65%), Gaps = 0/145 (0%)
 Frame = +2

Query  53   TTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPI  232
            + +H  M+PWF  GH+  F  LANKLA KGHR++FL+PK  Q +LE  NL P  I F P+
Sbjct  3    SKFHAFMFPWFSFGHMIPFLHLANKLAEKGHRVTFLVPKKAQKQLEPHNLFPESIVFHPL  62

Query  233  VVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSL  412
             VP + GLP GAETTSD+     +LL EA D T++ +E  ++ LK D++F+DF HW+P L
Sbjct  63   TVPHVDGLPVGAETTSDISISMDNLLSEAFDLTRDQVEAAVRTLKPDLIFFDFAHWIPEL  122

Query  413  ARKIGIKSVFYSTISPLMHGYALSP  487
            A++  IK+V Y  +S     + L P
Sbjct  123  AKQHMIKNVSYMIVSATAIAHTLVP  147



>ref|XP_010446347.1| PREDICTED: UDP-glycosyltransferase 79B6-like isoform X2 [Camelina 
sativa]
Length=422

 Score =   144 bits (362),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 67/147 (46%), Positives = 93/147 (63%), Gaps = 0/147 (0%)
 Frame = +2

Query  53   TTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPI  232
            + +H  M+PWFG GH+T F  LANKLA KGH+I+FL+PK    +LE  NL P  I F  +
Sbjct  3    SKFHAFMFPWFGFGHMTAFLHLANKLAEKGHKITFLLPKKALKQLEPLNLFPDYIFFHTL  62

Query  233  VVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSL  412
             +PS+ GLP GAETTSD+   S   L  AMD+T+N ++  +   K D++F+DF HW+P +
Sbjct  63   TIPSVDGLPAGAETTSDIQISSGSFLASAMDRTRNQVQEAVSIGKPDLIFFDFAHWIPEI  122

Query  413  ARKIGIKSVFYSTISPLMHGYALSPER  493
            A + G +SV + TIS      +  P R
Sbjct  123  AGEYGARSVNFITISAACVAISFVPGR  149



>gb|AAM65481.1| UDP rhamnose-anthocyanidin-3-glucoside rhamnosyltransferase-like 
protein [Arabidopsis thaliana]
Length=446

 Score =   144 bits (363),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 89/129 (69%), Gaps = 0/129 (0%)
 Frame = +2

Query  71   MYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVPSIP  250
            MYPWF  GH+T F  LANKLA KGH ++FLIPK    +LE+ NL PH I F  + VP + 
Sbjct  1    MYPWFATGHMTPFLFLANKLAEKGHTVTFLIPKKALKQLENLNLFPHNIVFRSVTVPHVD  60

Query  251  GLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARKIGI  430
            GLP G ET S++P  S  LLM AMD T++ +E +++ ++ D++F+DF HW+P +AR  G+
Sbjct  61   GLPVGTETVSEIPVTSADLLMSAMDLTRDQVEGVVRAVEPDLIFFDFAHWIPEVARDFGL  120

Query  431  KSVFYSTIS  457
            K+V Y  +S
Sbjct  121  KTVKYVVVS  129



>ref|XP_010446338.1| PREDICTED: UDP-glycosyltransferase 79B6-like isoform X1 [Camelina 
sativa]
Length=447

 Score =   144 bits (362),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 67/147 (46%), Positives = 93/147 (63%), Gaps = 0/147 (0%)
 Frame = +2

Query  53   TTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPI  232
            + +H  M+PWFG GH+T F  LANKLA KGH+I+FL+PK    +LE  NL P  I F  +
Sbjct  3    SKFHAFMFPWFGFGHMTAFLHLANKLAEKGHKITFLLPKKALKQLEPLNLFPDYIFFHTL  62

Query  233  VVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSL  412
             +PS+ GLP GAETTSD+   S   L  AMD+T+N ++  +   K D++F+DF HW+P +
Sbjct  63   TIPSVDGLPAGAETTSDIQISSGSFLASAMDRTRNQVQEAVSIGKPDLIFFDFAHWIPEI  122

Query  413  ARKIGIKSVFYSTISPLMHGYALSPER  493
            A + G +SV + TIS      +  P R
Sbjct  123  AGEYGARSVNFITISAACVAISFVPGR  149



>ref|XP_002866011.1| glycosyltransferase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42270.1| glycosyltransferase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=447

 Score =   143 bits (361),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 65/143 (45%), Positives = 92/143 (64%), Gaps = 0/143 (0%)
 Frame = +2

Query  59   YHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVV  238
            +H  M+PWF  GH+T +  LANKLA KGHR++FL+PK  Q +LE  NL P  I F P+ +
Sbjct  5    FHAFMFPWFAYGHMTPYLHLANKLAEKGHRVTFLLPKKAQKQLEHHNLFPDSIVFYPLTI  64

Query  239  PSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLAR  418
            P + GLP GAET SD+P      L  AMD T++ +E  ++ LK D++F+DF +W+P +AR
Sbjct  65   PHVDGLPDGAETASDIPISLGKFLTAAMDLTRDQVEAAVRALKPDLIFFDFAYWVPEMAR  124

Query  419  KIGIKSVFYSTISPLMHGYALSP  487
            +  +KSV Y  +S     + L P
Sbjct  125  EHNVKSVLYFVVSANSIAHELVP  147



>ref|XP_006397072.1| hypothetical protein EUTSA_v10028656mg [Eutrema salsugineum]
 gb|ESQ38525.1| hypothetical protein EUTSA_v10028656mg [Eutrema salsugineum]
Length=443

 Score =   143 bits (361),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 65/135 (48%), Positives = 89/135 (66%), Gaps = 0/135 (0%)
 Frame = +2

Query  53   TTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPI  232
            + +H  MYPWF  GH+T F  LANKLA KGHR++FL+PK T  + E  NL P  I F  +
Sbjct  3    SKFHALMYPWFATGHMTPFLHLANKLADKGHRVTFLLPKKTLKQYEHLNLFPDKIVFHSV  62

Query  233  VVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSL  412
             VP + GLP G ET S++P  ST+LL  AMD T+  IE  +  +K D++F+DF HW+P +
Sbjct  63   TVPHVDGLPIGTETASEIPVSSTNLLASAMDLTRAQIEDQVLAVKPDLIFFDFAHWIPEM  122

Query  413  ARKIGIKSVFYSTIS  457
            A+  G+K+V Y  +S
Sbjct  123  AKDFGVKTVMYVVVS  137



>gb|EPS58858.1| glucosyltransferase, partial [Genlisea aurea]
Length=450

 Score =   142 bits (359),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 66/136 (49%), Positives = 94/136 (69%), Gaps = 1/136 (1%)
 Frame = +2

Query  71   MYPWFGVGHLTGFFRLANKLAGKG-HRISFLIPKNTQSKLESFNLHPHLISFVPIVVPSI  247
            M+PWF +GHLT F  ++NKLA +G HRI F +P+N+ +++   N  P LI F+P+ VP +
Sbjct  9    MFPWFAMGHLTTFLHISNKLAQRGGHRIFFAVPRNSIARVRHLNRFPELIEFLPLAVPHV  68

Query  248  PGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARKIG  427
             GLP GAE T+DVPFP   L++ AMD T+  IE ++ +L+ + V +DF+HWLP  A K G
Sbjct  69   EGLPAGAELTADVPFPMIPLILTAMDLTRPQIEDLISELRPNFVLFDFSHWLPGSAAKFG  128

Query  428  IKSVFYSTISPLMHGY  475
             K+VFY+TIS    G+
Sbjct  129  AKTVFYNTISAAAVGW  144



>gb|EYU44977.1| hypothetical protein MIMGU_mgv1a006277mg [Erythranthe guttata]
Length=450

 Score =   142 bits (359),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 70/160 (44%), Positives = 98/160 (61%), Gaps = 1/160 (1%)
 Frame = +2

Query  65   MAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVPS  244
            +AM+PW  +GH+T F  LAN+LA +GH IS  IP  +  +L   NL+P LI F P+ VP 
Sbjct  5    IAMFPWIAIGHITPFIHLANELAKRGHSISIFIPPKSVLQLAHHNLYPDLIEFTPVGVPH  64

Query  245  IPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARKI  424
            + GLP GAET SD+   +   L  A D    DIE +L++LK D+VFYDF  W+P+LA KI
Sbjct  65   VDGLPTGAETASDIDISAKDPLAVAFDAMSGDIETLLQNLKPDIVFYDFADWIPALAAKI  124

Query  425  GIKSVFYSTISPLMHGYALSPERRV-VGKQLTEADMMKAP  541
            G K+V Y+ I   +    + P R +   + LT  ++M+ P
Sbjct  125  GFKTVCYNVICASVMAIGIVPARSIPTDRPLTLQELMEPP  164



>ref|XP_010064901.1| PREDICTED: anthocyanidin 3-O-glucoside 2'''-O-xylosyltransferase-like 
[Eucalyptus grandis]
Length=287

 Score =   139 bits (350),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/159 (42%), Positives = 98/159 (62%), Gaps = 1/159 (1%)
 Frame = +2

Query  65   MAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVPS  244
            + M+PW G+ H T F  L+NKLA  GH+++ L+P+  Q KLES N H +LI F  I +P 
Sbjct  12   VVMFPWLGISHATQFLHLSNKLAQNGHQVTVLLPRKAQLKLESLNQHQNLIHFSSITIPQ  71

Query  245  IPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARKI  424
            + GLP GAET SDVP      L  A D+T++ I  +L DLK D+VFYDF  W+P++ R +
Sbjct  72   VDGLPSGAETASDVPVQLHRSLYTAFDQTRDQILPLLIDLKPDIVFYDFAPWIPAIPRPM  131

Query  425  GIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
             +K+++Y        G  L+P R+ + K +T  ++M  P
Sbjct  132  NVKAIYYVATGVAGLGLRLTPARK-ISKGVTVEELMHPP  169



>ref|XP_004166346.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyltransferase 79B6-like 
[Cucumis sativus]
Length=471

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/168 (40%), Positives = 101/168 (60%), Gaps = 1/168 (1%)
 Frame = +2

Query  41   GSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLIS  220
            G +    H+ M+PWF  GH+T F  ++N LA K HRI+FL+P N  S   S NL+P LIS
Sbjct  4    GKETQNLHILMFPWFATGHITPFLHISNHLASKNHRITFLLPNNPSSLFSSLNLYPDLIS  63

Query  221  FVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHW  400
            F  + +PS+PGLPP A + SD+P   T LL  A+D T+  ++ I+  L+ D VF+DF HW
Sbjct  64   FHFLSLPSVPGLPPSAHSASDIPLSLTPLLASALDLTRPQVDRIIHSLRPDFVFFDFAHW  123

Query  401  LPSLARKIGIKSVFYSTISPLMHGYALSPERRV-VGKQLTEADMMKAP  541
            +P +   + I+S+ ++ +S       + P RRV +   LT+ D  + P
Sbjct  124  IPDITAPLQIRSICFTVVSAASVAVTVFPGRRVSLDHPLTDEDFREPP  171



>dbj|BAF75891.1| glucosyltransferase [Dianthus caryophyllus]
Length=461

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 72/168 (43%), Positives = 106/168 (63%), Gaps = 9/168 (5%)
 Frame = +2

Query  44   SQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISF  223
            +  T  H+AMYPW  +GH+T F R+ NKLA +GHRISF +P  TQ +  S N +P LI+F
Sbjct  4    NNGTPLHIAMYPWLAMGHITSFLRIGNKLAERGHRISFFLPPKTQLRFTSQNHYPELITF  63

Query  224  VPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWL  403
            + I +P + G P  AETT+D+   +  LLM AMD T++ IE  L DL+ + VF+DFT W+
Sbjct  64   ISITLPPVDGFPAEAETTNDISAHARPLLMTAMDLTKDTIEAHLVDLRPNFVFFDFTCWM  123

Query  404  PSLARKIGIKSVFYST-----ISPLMHGYALSPERRVVGKQLTEADMM  532
            P LA K GIK ++Y +      + ++H   ++P+    G+ + EA +M
Sbjct  124  PELAHKHGIKPIYYMSALLVRAAYILHLSVITPK----GQPIKEAHLM  167



>gb|AFJ52978.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=462

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 71/171 (42%), Positives = 100/171 (58%), Gaps = 3/171 (2%)
 Frame = +2

Query  38   MGSQATT--YHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPH  211
            M S   T  +H+ M+PW   GH+T F  L+N LA KG  I+F++PK    +   FN HP+
Sbjct  1    MASSCETKKFHIVMFPWLATGHITPFLHLSNTLASKGFTITFILPKKAIQQFSRFNQHPN  60

Query  212  LISFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDF  391
            LI F PI +P + GLP G ET S+VP   TH L  AMD+T++ +E I++     VV YD 
Sbjct  61   LIDFHPITLPPVDGLPAGVETASEVPIEVTHFLCIAMDRTRDQVEKIIRGTNPKVVVYDM  120

Query  392  THWLPSLARKIGIKSVFYSTISPLMHGYALSPERRVV-GKQLTEADMMKAP  541
             HW+  +   +GIKSV Y+ +S     +A  P R +V GK+LT  ++   P
Sbjct  121  AHWVSDITASLGIKSVNYTVLSAAAVAFADVPVRGIVKGKELTVDELAVPP  171



>ref|XP_004146274.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Cucumis sativus]
Length=471

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/168 (40%), Positives = 101/168 (60%), Gaps = 1/168 (1%)
 Frame = +2

Query  41   GSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLIS  220
            G +    H+ M+PWF  GH+T F  ++N LA K HRI+FL+P N  S   S NL+P LIS
Sbjct  4    GKETQNLHILMFPWFATGHITPFLHISNHLASKNHRITFLLPNNPSSLFSSLNLYPDLIS  63

Query  221  FVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHW  400
            F  + +PS+PGLPP A + SD+P   T LL  A+D T+  ++ I+  L+ D VF+DF HW
Sbjct  64   FHFLSLPSVPGLPPSAHSASDIPLSLTPLLASALDLTRPQVDRIIHSLRPDFVFFDFAHW  123

Query  401  LPSLARKIGIKSVFYSTISPLMHGYALSPERRV-VGKQLTEADMMKAP  541
            +P +   + I+S+ ++ +S       + P RRV +   LT+ D  + P
Sbjct  124  IPDITAPLQIRSICFTVVSAASVAVTVFPGRRVSLDHPLTDEDFREPP  171



>ref|XP_010455340.1| PREDICTED: UDP-glycosyltransferase 79B8-like [Camelina sativa]
Length=442

 Score =   142 bits (357),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 92/135 (68%), Gaps = 0/135 (0%)
 Frame = +2

Query  53   TTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPI  232
            + +H  M+PWF  GH+  F  LANKLA KGHR++FL+PK  Q ++E  NL P  I F P+
Sbjct  3    SKFHAFMFPWFAFGHMIPFLHLANKLAEKGHRVTFLLPKKAQKQVEHHNLFPDSIVFHPL  62

Query  233  VVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSL  412
             VP + GLPPGAETTSD+     +LL EA+D T+  +E  ++ L+ D++F+DF  W+P +
Sbjct  63   TVPHVNGLPPGAETTSDISISEDNLLSEALDLTRGQVEAAVRALRPDLIFFDFALWIPEV  122

Query  413  ARKIGIKSVFYSTIS  457
            A+++ IKSV Y  +S
Sbjct  123  AKELMIKSVSYIIVS  137



>gb|KGN57635.1| hypothetical protein Csa_3G236030 [Cucumis sativus]
Length=521

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/168 (40%), Positives = 101/168 (60%), Gaps = 1/168 (1%)
 Frame = +2

Query  41   GSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLIS  220
            G +    H+ M+PWF  GH+T F  ++N LA K HRI+FL+P N  S   S NL+P LIS
Sbjct  54   GKETQNLHILMFPWFATGHITPFLHISNHLASKNHRITFLLPNNPSSLFSSLNLYPDLIS  113

Query  221  FVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHW  400
            F  + +PS+PGLPP A + SD+P   T LL  A+D T+  ++ I+  L+ D VF+DF HW
Sbjct  114  FHFLSLPSVPGLPPSAHSASDIPLSLTPLLASALDLTRPQVDRIIHSLRPDFVFFDFAHW  173

Query  401  LPSLARKIGIKSVFYSTISPLMHGYALSPERRV-VGKQLTEADMMKAP  541
            +P +   + I+S+ ++ +S       + P RRV +   LT+ D  + P
Sbjct  174  IPDITAPLQIRSICFTVVSAASVAVTVFPGRRVSLDHPLTDEDFREPP  221



>ref|NP_175473.1| UDP-glycosyltransferase 79B5 [Arabidopsis thaliana]
 sp|Q9LPS8.1|U79B5_ARATH RecName: Full=UDP-glycosyltransferase 79B5 [Arabidopsis thaliana]
 gb|AAF87877.1|AC012561_10 Putative glucosyl transferase [Arabidopsis thaliana]
 gb|AAG51184.1|AC079279_5 UDP rhamnose: anthocyanidin-3-glucoside rhamnosyltransferase, 
putative [Arabidopsis thaliana]
 gb|AEE32566.1| UDP-glycosyltransferase 79B5 [Arabidopsis thaliana]
 gb|AHL38908.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=448

 Score =   141 bits (355),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 68/154 (44%), Positives = 95/154 (62%), Gaps = 3/154 (2%)
 Frame = +2

Query  38   MGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLI  217
            MGS+   +H  MYPWFG GH+  +  LANKLA KGHR++F +PK    +L+  NL P  I
Sbjct  1    MGSK---FHAFMYPWFGFGHMIPYLHLANKLAEKGHRVTFFLPKKAHKQLQPLNLFPDSI  57

Query  218  SFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTH  397
             F P+ +P + GLP GAET SD+P  +   +  AMD  ++ IE  ++ LK D++F+DF H
Sbjct  58   VFEPLTLPPVDGLPFGAETASDLPNSTKKPIFVAMDLLRDQIEAKVRALKPDLIFFDFVH  117

Query  398  WLPSLARKIGIKSVFYSTISPLMHGYALSPERRV  499
            W+P +A + GIKSV Y  IS       L+P   +
Sbjct  118  WVPEMAEEFGIKSVNYQIISAACVAMVLAPRAEL  151



>ref|XP_010496151.1| PREDICTED: UDP-glycosyltransferase 79B8-like [Camelina sativa]
Length=442

 Score =   141 bits (355),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 62/135 (46%), Positives = 92/135 (68%), Gaps = 0/135 (0%)
 Frame = +2

Query  53   TTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPI  232
            + +H  M+PWF  GH+  F  LANKLA KGHR++FL+PK  Q ++E  NL P  I F P+
Sbjct  3    SKFHAFMFPWFAFGHMIPFLHLANKLAEKGHRVTFLLPKKAQKQVEHHNLFPDSIVFHPL  62

Query  233  VVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSL  412
             VP + GLP GAETTSD+     +LL E +D T++ +E  ++ L+ D++F+DF HW+P +
Sbjct  63   TVPHVNGLPRGAETTSDISISEDNLLCEVLDLTRDQVEAAVRALRPDLIFFDFAHWIPEV  122

Query  413  ARKIGIKSVFYSTIS  457
            A+++ IK+V Y  +S
Sbjct  123  AKELLIKTVSYIIVS  137



>emb|CDY59372.1| BnaA08g29640D [Brassica napus]
Length=451

 Score =   141 bits (355),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 71/152 (47%), Positives = 100/152 (66%), Gaps = 6/152 (4%)
 Frame = +2

Query  38   MGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLI  217
            MGS+   +H  MYP F  GH+  +  LANKLA KGH I+FL+PK  Q +LES NLHP  I
Sbjct  1    MGSK---FHAFMYPCFAFGHMIPYLHLANKLAEKGHSITFLLPKKAQKQLESLNLHPESI  57

Query  218  SFVPIVVPSIPGLPPGAETTSDVPFPST--HLLMEAMDKTQNDIEIILKDLKVDVVFYDF  391
             F P+ +P + GLP GAETT+D+P P+T   L+ +AMD  ++ IE  ++ LK D++F+D 
Sbjct  58   CFHPLTLPPVEGLPVGAETTADLP-PNTTGKLISDAMDLLRDQIEAKVRVLKPDLIFFDL  116

Query  392  THWLPSLARKIGIKSVFYSTISPLMHGYALSP  487
              W+P +A++ G+KSV Y  +S      AL+P
Sbjct  117  VPWVPEMAKEFGVKSVSYQIVSAACVAVALAP  148



>ref|XP_006393137.1| hypothetical protein EUTSA_v10012257mg [Eutrema salsugineum]
 gb|ESQ30423.1| hypothetical protein EUTSA_v10012257mg [Eutrema salsugineum]
Length=450

 Score =   141 bits (355),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 67/150 (45%), Positives = 99/150 (66%), Gaps = 3/150 (2%)
 Frame = +2

Query  38   MGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLI  217
            MGS+   +H  MYP F  GH   +  LANKLA KGHRI+FL+PK  + +LES NL P+ I
Sbjct  1    MGSK---FHAFMYPCFAFGHFIPYLHLANKLAEKGHRITFLLPKKAKKQLESLNLFPYSI  57

Query  218  SFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTH  397
               P+ +P + GLP GAETT+D+   +  ++ +AM+  ++ IE  ++ LK D++F+DF H
Sbjct  58   VLDPLTLPPVDGLPVGAETTADLSNLNGKVITDAMNLLRDQIEAKVRALKPDLIFFDFVH  117

Query  398  WLPSLARKIGIKSVFYSTISPLMHGYALSP  487
            W+P +A++IG+KSV Y  +S      AL+P
Sbjct  118  WVPEMAKEIGVKSVSYQIVSAACVAMALAP  147



>ref|XP_009107252.1| PREDICTED: UDP-glycosyltransferase 79B5-like [Brassica rapa]
Length=451

 Score =   141 bits (355),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 71/152 (47%), Positives = 100/152 (66%), Gaps = 6/152 (4%)
 Frame = +2

Query  38   MGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLI  217
            MGS+   +H  MYP F  GH+  +  LANKLA KGH I+FL+PK  Q +LES NLHP  I
Sbjct  1    MGSK---FHAFMYPCFAFGHMIPYLHLANKLAEKGHSITFLLPKKAQKQLESLNLHPESI  57

Query  218  SFVPIVVPSIPGLPPGAETTSDVPFPST--HLLMEAMDKTQNDIEIILKDLKVDVVFYDF  391
             F P+ +P + GLP GAETT+D+P P+T   L+ +AMD  ++ IE  ++ LK D++F+D 
Sbjct  58   CFHPLTLPPVEGLPVGAETTADLP-PNTTGKLISDAMDLLRDQIEAKVRVLKPDLIFFDL  116

Query  392  THWLPSLARKIGIKSVFYSTISPLMHGYALSP  487
              W+P +A++ G+KSV Y  +S      AL+P
Sbjct  117  VPWVPEMAKEFGVKSVSYQIVSAACVAVALAP  148



>gb|EYU19000.1| hypothetical protein MIMGU_mgv1a021196mg [Erythranthe guttata]
Length=464

 Score =   141 bits (355),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 69/162 (43%), Positives = 97/162 (60%), Gaps = 2/162 (1%)
 Frame = +2

Query  62   HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVP  241
            H+AM+PW G+GH+T F  L N+L+ +GHRISFL+P     KL+  + H H I F  + VP
Sbjct  14   HIAMFPWIGMGHVTTFLHLGNELSQRGHRISFLLPMKALVKLDHNHDHSHPIKFHILNVP  73

Query  242  SIPGLPPGAETTSDVP--FPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLA  415
             + GLPPGAET SD+       + L  A D     +E +L+ L  D+VFYDF HW+P LA
Sbjct  74   HVDGLPPGAETCSDIDDNLTEKNPLAVAFDAMSEQVEALLRSLNPDIVFYDFAHWIPRLA  133

Query  416  RKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
              IG K+V Y+T+S     Y + P RR+   ++  A+ +  P
Sbjct  134  AVIGFKTVCYNTVSASCMSYTVVPARRIPKDRMMTAEELAEP  175



>ref|XP_010430891.1| PREDICTED: UDP-glycosyltransferase 79B4 [Camelina sativa]
Length=274

 Score =   137 bits (345),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 66/150 (44%), Positives = 97/150 (65%), Gaps = 3/150 (2%)
 Frame = +2

Query  38   MGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLI  217
            MGS+   +H  +YPWFG GH+  +  LANKLA KGH ++FL PK    ++E+ +L P  I
Sbjct  1    MGSK---FHAFLYPWFGFGHMIPYLHLANKLAEKGHMVTFLSPKKALKQVEALSLFPDNI  57

Query  218  SFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTH  397
             F  + +P + GLP GAETTSD+P  S  +L +AMD  +  IE  ++DLK D++F+D+  
Sbjct  58   YFYYVTLPHVDGLPVGAETTSDLPNSSKRVLADAMDLLRGQIEAEIRDLKPDLIFFDYVD  117

Query  398  WLPSLARKIGIKSVFYSTISPLMHGYALSP  487
            W+P +A+++GIKSV Y  +S       L+P
Sbjct  118  WIPEMAKELGIKSVSYQIVSAAFVSMFLAP  147



>ref|XP_006287748.1| hypothetical protein CARUB_v10000959mg [Capsella rubella]
 gb|EOA20646.1| hypothetical protein CARUB_v10000959mg [Capsella rubella]
Length=445

 Score =   140 bits (353),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 66/135 (49%), Positives = 88/135 (65%), Gaps = 0/135 (0%)
 Frame = +2

Query  53   TTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPI  232
            + +H  M+PWF  GH+  F  LANKLA KGHR++FL+PK  Q +LE  NL P  I F P+
Sbjct  3    SKFHAFMFPWFAFGHMIPFLHLANKLAEKGHRVTFLVPKKAQKQLEPHNLFPESIVFHPL  62

Query  233  VVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSL  412
             VP + GLP GAETTSDVP    + L EA D T + +E  ++ LK D++F+DF HW+  L
Sbjct  63   TVPHVNGLPVGAETTSDVPISMDNFLSEAFDLTHDQVEAAVRALKPDLIFFDFAHWIAKL  122

Query  413  ARKIGIKSVFYSTIS  457
            A++   KSV Y  +S
Sbjct  123  AKEHMFKSVSYMIVS  137



>ref|NP_192688.2| UDP-glycosyltransferase 79B7 [Arabidopsis thaliana]
 gb|AEE82757.1| UDP-glycosyltransferase 79B7 [Arabidopsis thaliana]
Length=417

 Score =   140 bits (352),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 91/133 (68%), Gaps = 0/133 (0%)
 Frame = +2

Query  59   YHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVV  238
            +H  M+PWF  GH+  F  LANKLA KGHR++FL+PK  Q +LE  NL P  I F P+ V
Sbjct  5    FHAFMFPWFAFGHMIPFLHLANKLAEKGHRVTFLLPKKAQKQLEHHNLFPDSIVFHPLTV  64

Query  239  PSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLAR  418
            P + GLP GAETTSD+P    +LL +A+D T++ +E  ++ L+ D++F+DF  W+P +A+
Sbjct  65   PPVNGLPAGAETTSDIPISLDNLLSKALDLTRDQVEAAVRALRPDLIFFDFAQWIPDMAK  124

Query  419  KIGIKSVFYSTIS  457
            +  IKSV Y  +S
Sbjct  125  EHMIKSVSYIIVS  137



>gb|AAO42032.1| unknown protein [Arabidopsis thaliana]
Length=417

 Score =   140 bits (352),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 91/133 (68%), Gaps = 0/133 (0%)
 Frame = +2

Query  59   YHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVV  238
            +H  M+PWF  GH+  F  LANKLA KGHR++FL+PK  Q +LE  NL P  I F P+ V
Sbjct  5    FHAFMFPWFAFGHMIPFLHLANKLAEKGHRVTFLLPKKAQKQLEHHNLFPDSIVFHPLTV  64

Query  239  PSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLAR  418
            P + GLP GAETTSD+P    +LL +A+D T++ +E  ++ L+ D++F+DF  W+P +A+
Sbjct  65   PPVNGLPAGAETTSDIPISLDNLLSKALDLTRDQVEAAVRALRPDLIFFDFAQWIPDMAK  124

Query  419  KIGIKSVFYSTIS  457
            +  IKSV Y  +S
Sbjct  125  EHMIKSVSYIIVS  137



>emb|CDY03578.1| BnaC03g68370D [Brassica napus]
Length=451

 Score =   140 bits (353),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 70/152 (46%), Positives = 100/152 (66%), Gaps = 6/152 (4%)
 Frame = +2

Query  38   MGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLI  217
            MGS+   +H  MYP F  GH+  +  LANKLA KGH I+FL+PK  Q +LES NLHP  I
Sbjct  1    MGSK---FHAFMYPCFAFGHMIPYLHLANKLAEKGHSITFLLPKKAQKQLESLNLHPESI  57

Query  218  SFVPIVVPSIPGLPPGAETTSDVPFPST--HLLMEAMDKTQNDIEIILKDLKVDVVFYDF  391
             F P+ +P + GLP G ETT+D+P P+T   L+ +AMD  +++IE  ++ LK D++F+D 
Sbjct  58   CFHPLTLPPVEGLPVGVETTADLP-PNTTGKLISDAMDLLRDEIEAKVRVLKPDLIFFDL  116

Query  392  THWLPSLARKIGIKSVFYSTISPLMHGYALSP  487
              W+P +A++ G+KSV Y  +S      AL+P
Sbjct  117  VPWVPEMAKEFGVKSVSYQIVSAACVAVALAP  148



>ref|XP_008456016.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyltransferase 79B6-like 
[Cucumis melo]
Length=472

 Score =   140 bits (353),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 67/168 (40%), Positives = 100/168 (60%), Gaps = 1/168 (1%)
 Frame = +2

Query  41   GSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLIS  220
            G +  + H+ M+PWF  GH+T F  ++N LA K HRI+FL+P N      S NL+P+LIS
Sbjct  5    GGETQSLHILMFPWFATGHITPFLHISNHLASKNHRITFLLPNNPSPXFHSLNLYPNLIS  64

Query  221  FVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHW  400
            F  + +PS+PGLPP A + SD+P   T LL  A D T+  +  I+  L+ D VF+DF HW
Sbjct  65   FHFLSLPSVPGLPPAAHSASDIPLSLTPLLASAFDLTRPQVHRIIHSLRPDFVFFDFAHW  124

Query  401  LPSLARKIGIKSVFYSTISPLMHGYALSPERRV-VGKQLTEADMMKAP  541
            +P +   + I+S+ ++ +S       + P RRV +   LT+ D  + P
Sbjct  125  IPDITAPLQIRSICFTVVSAASVAVTVFPGRRVSLDHPLTDEDFREPP  172



>ref|NP_974524.1| UDP-glycosyltransferase 79B7 [Arabidopsis thaliana]
 sp|Q9M0P3.1|U79B7_ARATH RecName: Full=UDP-glycosyltransferase 79B7 [Arabidopsis thaliana]
 emb|CAB78073.1| putative protein [Arabidopsis thaliana]
 gb|AAW52558.1| At4g09500 [Arabidopsis thaliana]
 gb|AEE82758.1| UDP-glycosyltransferase 79B7 [Arabidopsis thaliana]
 gb|AHL38704.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=442

 Score =   140 bits (352),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 91/133 (68%), Gaps = 0/133 (0%)
 Frame = +2

Query  59   YHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVV  238
            +H  M+PWF  GH+  F  LANKLA KGHR++FL+PK  Q +LE  NL P  I F P+ V
Sbjct  5    FHAFMFPWFAFGHMIPFLHLANKLAEKGHRVTFLLPKKAQKQLEHHNLFPDSIVFHPLTV  64

Query  239  PSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLAR  418
            P + GLP GAETTSD+P    +LL +A+D T++ +E  ++ L+ D++F+DF  W+P +A+
Sbjct  65   PPVNGLPAGAETTSDIPISLDNLLSKALDLTRDQVEAAVRALRPDLIFFDFAQWIPDMAK  124

Query  419  KIGIKSVFYSTIS  457
            +  IKSV Y  +S
Sbjct  125  EHMIKSVSYIIVS  137



>gb|KEH38979.1| UDP-glucose:flavonoid 3-O-glucosyltransferase, putative [Medicago 
truncatula]
Length=341

 Score =   138 bits (347),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 95/141 (67%), Gaps = 4/141 (3%)
 Frame = +2

Query  71   MYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVPSIP  250
            M PWF +GHL  +  L+N LA KG + SF IPK TQ+KLE FNL+P+LI+F P+ VP I 
Sbjct  1    MSPWFAMGHLIPYLHLSNILAKKGDKTSFFIPKKTQTKLEKFNLYPNLITFYPLNVPHIE  60

Query  251  GLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARKIGI  430
            GLP GAETTSDV F    L+M AMD+T+  IE  L  L  ++VF+DF  WLP +A+ +GI
Sbjct  61   GLPFGAETTSDVSFSLGPLIMTAMDQTKPQIE-PLTPLNPEMVFFDFAFWLPKIAQNLGI  119

Query  431  KSVFYSTISP---LMHGYALS  484
            KS  Y  ISP   L  G +LS
Sbjct  120  KSFQYWIISPATMLFIGLSLS  140



>ref|XP_010479520.1| PREDICTED: UDP-glycosyltransferase 79B5 [Camelina sativa]
Length=448

 Score =   140 bits (352),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/150 (45%), Positives = 93/150 (62%), Gaps = 3/150 (2%)
 Frame = +2

Query  38   MGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLI  217
            MGS+   +H  MYPWFG GH+  +  LANKLA KGH I+F +PK    +LE  NL P  I
Sbjct  1    MGSK---FHAFMYPWFGFGHMIPYLHLANKLAEKGHTITFFLPKKAHKQLEPLNLFPDSI  57

Query  218  SFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTH  397
               P+ +P + GLP GAET SD+P  +   + +AMD  ++ IE  ++ LK D++F+DF H
Sbjct  58   VLEPLTLPHVDGLPSGAETASDLPNSTKKPIFDAMDLLRDQIEAKVRALKPDLIFFDFIH  117

Query  398  WLPSLARKIGIKSVFYSTISPLMHGYALSP  487
            W+P +A++ G KSV Y  IS       L+P
Sbjct  118  WVPDMAKEFGFKSVNYQIISAACLAMVLAP  147



>ref|XP_009628388.1| PREDICTED: LOW QUALITY PROTEIN: anthocyanidin 3-O-glucoside 2'''-O-xylosyltransferase-like 
[Nicotiana tomentosiformis]
Length=458

 Score =   140 bits (352),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 71/163 (44%), Positives = 102/163 (63%), Gaps = 4/163 (2%)
 Frame = +2

Query  62   HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVP  241
            H+AM+PWF  GH T F  LAN+LA +GH+ISFL+PK  Q +L++ NLHP+LI+F  + +P
Sbjct  10   HIAMFPWFAFGHFTPFLHLANELAKRGHQISFLLPKKAQFQLQNINLHPNLITFHSLTIP  69

Query  242  SIPGLPPGAETTSDVP-FPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLAR  418
             + GLP G  T SDVP F + HL M  +D+ ++ I+ +L  LK  +VFYDF +W+P  A 
Sbjct  70   QVEGLPLGTXTASDVPIFLTCHLAM-XLDQMRDQIKSLLAKLKPHIVFYDFAYWIPDYAP  128

Query  419  KIGIKSVFYSTISPLMHGYALSPERRVV--GKQLTEADMMKAP  541
            +I  K++ Y+ +        L P R+    G   T  +MMK P
Sbjct  129  EISYKTICYNVVCAASIAIMLVPVRKSCPSGAPPTVEEMMKPP  171



>gb|KCW69986.1| hypothetical protein EUGRSUZ_F03297, partial [Eucalyptus grandis]
Length=419

 Score =   139 bits (350),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/160 (42%), Positives = 98/160 (61%), Gaps = 1/160 (1%)
 Frame = +2

Query  62   HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVP  241
             + M+PW G+ H T F  L+NKLA  GH+++ L+P+  Q KLES N H +LI F  I +P
Sbjct  11   RVVMFPWLGISHATQFLHLSNKLAQNGHQVTVLLPRKAQLKLESLNQHQNLIHFSSITIP  70

Query  242  SIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARK  421
             + GLP GAET SDVP      L  A D+T++ I  +L DLK D+VFYDF  W+P++ R 
Sbjct  71   QVDGLPSGAETASDVPVQLHRSLYTAFDQTRDQILPLLIDLKPDIVFYDFAPWIPAIPRP  130

Query  422  IGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAP  541
            + +K+++Y        G  L+P R+ + K +T  ++M  P
Sbjct  131  MNVKAIYYVATGVAGLGLRLTPARK-ISKGVTVEELMHPP  169



>ref|XP_006286772.1| hypothetical protein CARUB_v10003323mg [Capsella rubella]
 gb|EOA19670.1| hypothetical protein CARUB_v10003323mg [Capsella rubella]
Length=445

 Score =   139 bits (351),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 88/133 (66%), Gaps = 0/133 (0%)
 Frame = +2

Query  59   YHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVV  238
            +H  M+PWF  GH+  F  LANKLA KGHR++FL+PK  Q +LE  N+ P  I F P+ V
Sbjct  6    FHAFMFPWFAFGHMIPFLHLANKLAEKGHRVTFLVPKKAQKQLEHHNMFPDSIVFHPLTV  65

Query  239  PSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLAR  418
            P + GLP GAETTSD+     + L EA+D T++ +E  ++ LK D++F+DF  W+P LAR
Sbjct  66   PHVNGLPVGAETTSDISISVDNFLSEALDLTRDQVEAAVRALKPDLIFFDFARWIPELAR  125

Query  419  KIGIKSVFYSTIS  457
            +  IKSV Y   S
Sbjct  126  EHKIKSVSYMIAS  138



>ref|XP_011082713.1| PREDICTED: anthocyanidin 3-O-glucoside 2'''-O-xylosyltransferase-like 
isoform X3 [Sesamum indicum]
Length=458

 Score =   139 bits (351),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/166 (40%), Positives = 99/166 (60%), Gaps = 1/166 (1%)
 Frame = +2

Query  47   QATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFV  226
            + +  H+AM+PW  +GH+T F  LAN+LA +GH IS LIP     +L   +L+P LI F 
Sbjct  5    EKSKLHIAMFPWVAIGHITPFIHLANELAKRGHSISILIPNKPLLQLGHHSLYPDLIKFH  64

Query  227  PIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLP  406
             + +P + GLPPGAET SD+   + + L  A D T   +E IL  LK D+VFYDF  W+P
Sbjct  65   VVTIPQVEGLPPGAETASDIDITAKNPLAIAFDATAEQVETILSGLKPDIVFYDFADWIP  124

Query  407  SLARKIGIKSVFYSTISPLMHGYALSPERRV-VGKQLTEADMMKAP  541
             +A ++G K+V Y+ I        + P R +   ++LTE ++ + P
Sbjct  125  KMAARVGFKTVCYNVICASCMAIGIVPARHIPKDRRLTEEELGQPP  170



>ref|XP_011082711.1| PREDICTED: anthocyanidin 3-O-glucoside 2'''-O-xylosyltransferase-like 
isoform X1 [Sesamum indicum]
 ref|XP_011082712.1| PREDICTED: anthocyanidin 3-O-glucoside 2'''-O-xylosyltransferase-like 
isoform X2 [Sesamum indicum]
Length=457

 Score =   139 bits (351),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/166 (40%), Positives = 99/166 (60%), Gaps = 1/166 (1%)
 Frame = +2

Query  47   QATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFV  226
            + +  H+AM+PW  +GH+T F  LAN+LA +GH IS LIP     +L   +L+P LI F 
Sbjct  5    EKSKLHIAMFPWVAIGHITPFIHLANELAKRGHSISILIPNKPLLQLGHHSLYPDLIKFH  64

Query  227  PIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLP  406
             + +P + GLPPGAET SD+   + + L  A D T   +E IL  LK D+VFYDF  W+P
Sbjct  65   VVTIPQVEGLPPGAETASDIDITAKNPLAIAFDATAEQVETILSGLKPDIVFYDFADWIP  124

Query  407  SLARKIGIKSVFYSTISPLMHGYALSPERRV-VGKQLTEADMMKAP  541
             +A ++G K+V Y+ I        + P R +   ++LTE ++ + P
Sbjct  125  KMAARVGFKTVCYNVICASCMAIGIVPARHIPKDRRLTEEELGQPP  170



>ref|XP_010437932.1| PREDICTED: UDP-glycosyltransferase 79B8-like [Camelina sativa]
Length=444

 Score =   139 bits (349),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/142 (46%), Positives = 93/142 (65%), Gaps = 2/142 (1%)
 Frame = +2

Query  59   YHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVV  238
            +H  M+PWF   H+  F  LANKLA KGHR++FL+PK  Q +LE  NL P  I F P+ V
Sbjct  5    FHAFMFPWFAFVHMIPFLHLANKLAEKGHRVTFLLPKKAQKQLEHHNLFPDSIVFYPLTV  64

Query  239  PSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLAR  418
            P + GLP GAETTSD+     + L EA+D T++ +E   + L+ D++F+DF HW+P LA+
Sbjct  65   PHVNGLPAGAETTSDIAISKDNFLYEALDLTRDQVEAAFRALRPDLIFFDFAHWIPELAK  124

Query  419  KIGIKSVFY--STISPLMHGYA  478
            +  IKSV Y  ++ + + H +A
Sbjct  125  EHMIKSVSYMIASATAVAHSHA  146



>ref|XP_002872446.1| glycosyltransferase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48705.1| glycosyltransferase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=442

 Score =   138 bits (348),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/133 (47%), Positives = 89/133 (67%), Gaps = 0/133 (0%)
 Frame = +2

Query  59   YHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVV  238
            +H  M+PWF  GH+  F  LANKLA KGHR++FL+PK  Q +LE  NL P  I F P+ +
Sbjct  5    FHAFMFPWFAFGHMIPFLHLANKLAEKGHRVTFLLPKKAQKQLEHHNLFPDSIVFHPLTI  64

Query  239  PSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLAR  418
            P + GLP GAETTSD+P    + L EA+D T++ +E  ++ L+ D++F+DF  W+P +A+
Sbjct  65   PPVNGLPAGAETTSDIPISMDNFLSEALDLTRDQVEAAVRALRPDMIFFDFAQWVPEMAK  124

Query  419  KIGIKSVFYSTIS  457
            +  IKSV Y  + 
Sbjct  125  EHMIKSVSYIIVC  137



>ref|XP_010455377.1| PREDICTED: UDP-glycosyltransferase 79B8-like [Camelina sativa]
Length=446

 Score =   138 bits (348),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 90/135 (67%), Gaps = 0/135 (0%)
 Frame = +2

Query  53   TTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPI  232
            + +H  M+PWF  GH+  F  LANKLA KGHR++FL+PK  Q ++E  NL P  I F P+
Sbjct  3    SKFHAFMFPWFAFGHMIPFLHLANKLAEKGHRVTFLLPKKAQKQVEHHNLFPDSIFFHPL  62

Query  233  VVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSL  412
             V  + GLP GAETTSD+     +LL EA+D T++ +E  ++ L+ D +F+DF HW+P L
Sbjct  63   TVTHVNGLPLGAETTSDISISEDNLLSEALDLTRSQVEAAVRALRPDFIFFDFAHWIPEL  122

Query  413  ARKIGIKSVFYSTIS  457
            A++  IKSV Y  +S
Sbjct  123  AKEHKIKSVSYMIVS  137



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 565229601645