BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002F11

Length=308
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006357406.1|  PREDICTED: subtilisin-like protease-like           106   5e-24   Solanum tuberosum [potatoes]
ref|XP_009613479.1|  PREDICTED: subtilisin-like protease                101   3e-22   Nicotiana tomentosiformis
ref|XP_009758461.1|  PREDICTED: subtilisin-like protease              96.3    2e-20   Nicotiana sylvestris
ref|XP_010322825.1|  PREDICTED: subtilisin-like protease              89.7    3e-18   Solanum lycopersicum
emb|CBI35855.3|  unnamed protein product                              89.0    8e-18   Vitis vinifera
ref|XP_002272769.1|  PREDICTED: subtilisin-like protease              88.2    1e-17   Vitis vinifera
emb|CDP20511.1|  unnamed protein product                              87.0    3e-17   Coffea canephora [robusta coffee]
ref|XP_006342924.1|  PREDICTED: subtilisin-like protease-like         86.7    3e-17   Solanum tuberosum [potatoes]
ref|XP_010111996.1|  Subtilisin-like protease                         84.0    3e-16   
gb|EYU21314.1|  hypothetical protein MIMGU_mgv1a001662mg              80.1    6e-15   Erythranthe guttata [common monkey flower]
ref|XP_007024651.1|  Subtilase family protein                         79.3    1e-14   
gb|KJB57037.1|  hypothetical protein B456_009G146000                  78.6    3e-14   Gossypium raimondii
ref|XP_010088794.1|  Subtilisin-like protease                         77.4    6e-14   Morus notabilis
emb|CDX97540.1|  BnaA05g25390D                                        74.3    8e-14   
ref|XP_006465903.1|  PREDICTED: subtilisin-like protease-like         76.3    2e-13   Citrus sinensis [apfelsine]
ref|XP_006426684.1|  hypothetical protein CICLE_v10024936mg           75.9    2e-13   Citrus clementina [clementine]
ref|XP_010088796.1|  Subtilisin-like protease                         74.7    4e-13   Morus notabilis
ref|XP_009146419.1|  PREDICTED: subtilisin-like protease              74.3    6e-13   Brassica rapa
ref|XP_002885009.1|  subtilase family protein                         73.9    8e-13   
ref|XP_004305758.1|  PREDICTED: subtilisin-like protease              73.9    8e-13   Fragaria vesca subsp. vesca
ref|XP_006407132.1|  hypothetical protein EUTSA_v10022348mg           73.6    1e-12   
ref|XP_011072593.1|  PREDICTED: subtilisin-like protease              72.8    2e-12   Sesamum indicum [beniseed]
ref|NP_566473.2|  Subtilase family protein                            71.6    5e-12   Arabidopsis thaliana [mouse-ear cress]
dbj|BAE98521.1|  putative subtilisin-like serine proteinase           71.6    5e-12   Arabidopsis thaliana [mouse-ear cress]
emb|CDY33251.1|  BnaC01g37240D                                        71.2    7e-12   Brassica napus [oilseed rape]
ref|XP_009610930.1|  PREDICTED: subtilisin-like protease              71.2    7e-12   
emb|CDY39093.1|  BnaA01g29630D                                        70.5    1e-11   Brassica napus [oilseed rape]
ref|XP_009117189.1|  PREDICTED: subtilisin-like protease              70.5    1e-11   Brassica rapa
ref|XP_009788688.1|  PREDICTED: subtilisin-like protease              70.5    1e-11   Nicotiana sylvestris
gb|KJB70156.1|  hypothetical protein B456_011G061400                  70.1    2e-11   Gossypium raimondii
ref|XP_003547763.1|  PREDICTED: subtilisin-like protease-like         69.7    3e-11   
ref|XP_010111995.1|  Subtilisin-like protease                         69.3    3e-11   Morus notabilis
gb|KFK38761.1|  hypothetical protein AALP_AA3G157200                  69.3    4e-11   Arabis alpina [alpine rockcress]
ref|XP_010654422.1|  PREDICTED: subtilisin-like protease              69.3    4e-11   Vitis vinifera
emb|CDY52259.1|  BnaC05g52030D                                        68.9    5e-11   Brassica napus [oilseed rape]
ref|XP_007135429.1|  hypothetical protein PHAVU_010G128600g           68.9    5e-11   Phaseolus vulgaris [French bean]
emb|CAN75239.1|  hypothetical protein VITISV_014205                   68.6    7e-11   Vitis vinifera
ref|XP_002534468.1|  Cucumisin precursor, putative                    67.4    8e-11   
ref|XP_006841679.1|  hypothetical protein AMTR_s00003p00245290        67.8    1e-10   Amborella trichopoda
ref|XP_002304129.2|  hypothetical protein POPTR_0003s06530g           67.8    1e-10   Populus trichocarpa [western balsam poplar]
ref|XP_008391410.1|  PREDICTED: subtilisin-like protease              67.0    2e-10   Malus domestica [apple tree]
ref|XP_010465286.1|  PREDICTED: subtilisin-like protease              66.6    3e-10   Camelina sativa [gold-of-pleasure]
ref|XP_011036446.1|  PREDICTED: subtilisin-like protease              66.6    3e-10   Populus euphratica
ref|XP_010261833.1|  PREDICTED: subtilisin-like protease              66.6    3e-10   Nelumbo nucifera [Indian lotus]
ref|XP_006369129.1|  subtilase family protein                         66.2    4e-10   
gb|EPS74243.1|  subtilase family protein                              66.2    4e-10   Genlisea aurea
gb|KCW53526.1|  hypothetical protein EUGRSUZ_J02805                   65.5    8e-10   Eucalyptus grandis [rose gum]
ref|XP_010033727.1|  PREDICTED: subtilisin-like protease              65.1    9e-10   Eucalyptus grandis [rose gum]
emb|CDY33400.1|  BnaA07g04390D                                        65.1    1e-09   Brassica napus [oilseed rape]
ref|XP_007217156.1|  hypothetical protein PRUPE_ppa001739mg           65.1    1e-09   Prunus persica
ref|XP_008228179.1|  PREDICTED: subtilisin-like protease              65.1    1e-09   Prunus mume [ume]
ref|XP_010487192.1|  PREDICTED: subtilisin-like protease              64.3    2e-09   Camelina sativa [gold-of-pleasure]
ref|XP_010501588.1|  PREDICTED: subtilisin-like protease              63.5    3e-09   Camelina sativa [gold-of-pleasure]
ref|XP_009403290.1|  PREDICTED: subtilisin-like protease              63.2    4e-09   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008462294.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...  63.2    5e-09   Cucumis melo [Oriental melon]
gb|EYU44466.1|  hypothetical protein MIMGU_mgv1a0020561mg             60.8    1e-08   Erythranthe guttata [common monkey flower]
ref|XP_006298979.1|  hypothetical protein CARUB_v10015104mg           62.0    1e-08   Capsella rubella
ref|XP_011035735.1|  PREDICTED: subtilisin-like protease              62.0    1e-08   Populus euphratica
ref|XP_007156742.1|  hypothetical protein PHAVU_002G013500g           62.0    1e-08   Phaseolus vulgaris [French bean]
ref|XP_009416811.1|  PREDICTED: subtilisin-like protease              61.6    2e-08   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDP15538.1|  unnamed protein product                              61.2    2e-08   Coffea canephora [robusta coffee]
gb|ACN39811.1|  unknown                                               61.2    2e-08   Picea sitchensis
gb|KJB58524.1|  hypothetical protein B456_009G213600                  61.2    2e-08   Gossypium raimondii
ref|XP_004252763.1|  PREDICTED: subtilisin-like protease              60.8    3e-08   Solanum lycopersicum
ref|XP_010527146.1|  PREDICTED: subtilisin-like protease              60.5    4e-08   Tarenaya hassleriana [spider flower]
ref|XP_008780900.1|  PREDICTED: subtilisin-like protease              60.1    4e-08   Phoenix dactylifera
gb|ABF70004.1|  subtilisin-like serine proteinase, putative           60.1    5e-08   Musa acuminata [banana]
gb|KDP40686.1|  hypothetical protein JCGZ_24685                       60.1    6e-08   Jatropha curcas
ref|XP_006583162.1|  PREDICTED: subtilisin-like protease-like iso...  59.7    7e-08   
emb|CDP02570.1|  unnamed protein product                              59.7    8e-08   Coffea canephora [robusta coffee]
ref|XP_011099335.1|  PREDICTED: subtilisin-like protease              58.9    1e-07   Sesamum indicum [beniseed]
emb|CDY18042.1|  BnaC07g04280D                                        58.9    1e-07   Brassica napus [oilseed rape]
gb|AAM10321.1|  AT5g67360/K8K14_8                                     58.9    1e-07   Arabidopsis thaliana [mouse-ear cress]
ref|NP_569048.1|  subtilisin-like protease                            58.9    1e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006342632.1|  PREDICTED: subtilisin-like protease-like         58.5    2e-07   Solanum tuberosum [potatoes]
ref|XP_010068558.1|  PREDICTED: subtilisin-like protease              58.5    2e-07   Eucalyptus grandis [rose gum]
gb|KCW63975.1|  hypothetical protein EUGRSUZ_G01657                   58.5    2e-07   Eucalyptus grandis [rose gum]
emb|CAA59963.1|  subtilisin-like protease                             58.2    2e-07   Arabidopsis thaliana [mouse-ear cress]
gb|ABR17987.1|  unknown                                               57.8    3e-07   Picea sitchensis
gb|EYU36340.1|  hypothetical protein MIMGU_mgv1a001790mg              57.8    3e-07   Erythranthe guttata [common monkey flower]
ref|XP_009407416.1|  PREDICTED: subtilisin-like protease              57.8    3e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002267740.1|  PREDICTED: subtilisin-like protease              57.8    3e-07   Vitis vinifera
ref|XP_009102354.1|  PREDICTED: subtilisin-like protease              57.8    3e-07   Brassica rapa
gb|ABR18065.1|  unknown                                               57.4    5e-07   Picea sitchensis
gb|ACN40199.1|  unknown                                               57.4    5e-07   Picea sitchensis
ref|XP_011010186.1|  PREDICTED: subtilisin-like protease              57.0    5e-07   Populus euphratica
ref|XP_007017194.1|  Subtilisin-like serine endopeptidase family ...  57.0    5e-07   
gb|EYU36337.1|  hypothetical protein MIMGU_mgv1a020902mg              57.0    6e-07   Erythranthe guttata [common monkey flower]
gb|ADW11233.1|  subtilisin-like protease 2                            56.6    7e-07   Phaseolus vulgaris [French bean]
ref|XP_006383545.1|  hypothetical protein POPTR_0005s18880g           56.2    9e-07   
ref|XP_010547540.1|  PREDICTED: subtilisin-like protease              56.2    9e-07   Tarenaya hassleriana [spider flower]
ref|XP_004141887.1|  PREDICTED: subtilisin-like protease-like         56.2    1e-06   Cucumis sativus [cucumbers]
ref|XP_004167070.1|  PREDICTED: subtilisin-like protease-like         55.8    1e-06   
ref|XP_011017137.1|  PREDICTED: subtilisin-like protease              55.8    1e-06   Populus euphratica
ref|XP_009770992.1|  PREDICTED: subtilisin-like protease              55.5    2e-06   Nicotiana sylvestris
gb|AFS34694.1|  subtilisin-like serine protease                       55.5    2e-06   Pisum sativum [garden pea]
ref|XP_008220348.1|  PREDICTED: subtilisin-like protease              55.5    2e-06   
ref|XP_010906269.1|  PREDICTED: subtilisin-like protease              55.1    2e-06   Elaeis guineensis
gb|ABR16566.1|  unknown                                               54.7    2e-06   Picea sitchensis
ref|XP_010070627.1|  PREDICTED: subtilisin-like protease              55.1    3e-06   Eucalyptus grandis [rose gum]
ref|XP_007012625.1|  Subtilase family protein                         54.7    3e-06   
ref|XP_006343203.1|  PREDICTED: subtilisin-like protease-like         54.7    3e-06   Solanum tuberosum [potatoes]
ref|XP_008440346.1|  PREDICTED: subtilisin-like protease              54.7    4e-06   Cucumis melo [Oriental melon]
ref|XP_009613609.1|  PREDICTED: subtilisin-like protease              54.7    4e-06   Nicotiana tomentosiformis
ref|XP_002301156.2|  hypothetical protein POPTR_0002s12130g           54.3    5e-06   
ref|XP_006393933.1|  hypothetical protein EUTSA_v10003693mg           53.9    5e-06   Eutrema salsugineum [saltwater cress]
ref|XP_006345404.1|  PREDICTED: subtilisin-like protease-like         53.9    6e-06   Solanum tuberosum [potatoes]
ref|XP_004512211.1|  PREDICTED: subtilisin-like protease-like         53.9    6e-06   Cicer arietinum [garbanzo]
ref|XP_007017192.1|  Subtilisin-like serine protease 2, putative      53.9    6e-06   
emb|CDY22001.1|  BnaC09g01070D                                        53.9    6e-06   Brassica napus [oilseed rape]
gb|EYU36342.1|  hypothetical protein MIMGU_mgv1a001789mg              53.9    6e-06   Erythranthe guttata [common monkey flower]
emb|CDY63219.1|  BnaAnng18730D                                        53.9    6e-06   Brassica napus [oilseed rape]
ref|XP_007158029.1|  hypothetical protein PHAVU_002G118200g           53.5    7e-06   Phaseolus vulgaris [French bean]
emb|CDY63302.1|  BnaCnng41810D                                        53.5    7e-06   Brassica napus [oilseed rape]
gb|KJB08038.1|  hypothetical protein B456_001G060600                  53.5    8e-06   Gossypium raimondii
ref|XP_003538797.2|  PREDICTED: subtilisin-like protease-like         53.5    8e-06   Glycine max [soybeans]
ref|XP_010542387.1|  PREDICTED: subtilisin-like protease              53.5    8e-06   Tarenaya hassleriana [spider flower]
ref|XP_009758000.1|  PREDICTED: subtilisin-like protease              53.1    9e-06   Nicotiana sylvestris
ref|XP_008792659.1|  PREDICTED: subtilisin-like protease              53.1    1e-05   Phoenix dactylifera
gb|KHG16003.1|  Subtilisin-like protease                              53.1    1e-05   Gossypium arboreum [tree cotton]
ref|XP_009599383.1|  PREDICTED: subtilisin-like protease              53.1    1e-05   Nicotiana tomentosiformis
ref|XP_008782639.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...  53.1    1e-05   
gb|EYU36336.1|  hypothetical protein MIMGU_mgv1a019012mg              53.1    1e-05   Erythranthe guttata [common monkey flower]
ref|XP_010464171.1|  PREDICTED: subtilisin-like protease              52.8    1e-05   Camelina sativa [gold-of-pleasure]
ref|XP_009357945.1|  PREDICTED: subtilisin-like protease              52.8    1e-05   Pyrus x bretschneideri [bai li]
ref|XP_006487072.1|  PREDICTED: subtilisin-like protease-like         52.8    1e-05   Citrus sinensis [apfelsine]
ref|XP_002865008.1|  hypothetical protein ARALYDRAFT_496864           52.8    1e-05   Arabidopsis lyrata subsp. lyrata
gb|EYU45081.1|  hypothetical protein MIMGU_mgv1a002217mg              52.8    2e-05   Erythranthe guttata [common monkey flower]
ref|XP_002518750.1|  Xylem serine proteinase 1 precursor, putative    52.8    2e-05   Ricinus communis
emb|CDP01316.1|  unnamed protein product                              52.8    2e-05   Coffea canephora [robusta coffee]
ref|XP_011029629.1|  PREDICTED: subtilisin-like protease              52.4    2e-05   Populus euphratica
ref|XP_010679580.1|  PREDICTED: subtilisin-like protease              52.4    2e-05   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009357900.1|  PREDICTED: subtilisin-like protease isoform X2   52.4    2e-05   Pyrus x bretschneideri [bai li]
ref|XP_009357899.1|  PREDICTED: subtilisin-like protease isoform X1   52.4    2e-05   Pyrus x bretschneideri [bai li]
ref|XP_004141706.1|  PREDICTED: subtilisin-like protease-like         52.4    2e-05   Cucumis sativus [cucumbers]
ref|XP_004249505.1|  PREDICTED: subtilisin-like protease              52.4    2e-05   Solanum lycopersicum
ref|XP_009141044.1|  PREDICTED: subtilisin-like protease              52.4    2e-05   Brassica rapa
emb|CDY29697.1|  BnaA04g17300D                                        52.4    2e-05   Brassica napus [oilseed rape]
ref|XP_006847079.1|  hypothetical protein AMTR_s00017p00212440        52.4    2e-05   
gb|AES61117.2|  subtilisin-like serine protease                       52.0    2e-05   Medicago truncatula
ref|XP_003590866.1|  Subtilisin-like protease                         52.0    2e-05   
ref|XP_006280051.1|  hypothetical protein CARUB_v10025930mg           52.0    2e-05   Capsella rubella
ref|XP_006374912.1|  hypothetical protein POPTR_0014s02640g           52.0    2e-05   
ref|XP_006422995.1|  hypothetical protein CICLE_v10030049mg           52.0    2e-05   
ref|XP_010939822.1|  PREDICTED: subtilisin-like protease              52.0    3e-05   Elaeis guineensis
ref|XP_004234656.1|  PREDICTED: subtilisin-like protease              52.0    3e-05   Solanum lycopersicum
ref|XP_011072681.1|  PREDICTED: subtilisin-like protease              52.0    3e-05   Sesamum indicum [beniseed]
emb|CDY12840.1|  BnaC07g15930D                                        51.6    3e-05   Brassica napus [oilseed rape]
gb|KJB82990.1|  hypothetical protein B456_013G223900                  51.6    3e-05   Gossypium raimondii
ref|XP_009404128.1|  PREDICTED: subtilisin-like protease              51.6    3e-05   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010029506.1|  PREDICTED: subtilisin-like protease              51.6    3e-05   Eucalyptus grandis [rose gum]
ref|XP_004512212.1|  PREDICTED: subtilisin-like protease-like         51.6    3e-05   Cicer arietinum [garbanzo]
ref|XP_003608462.1|  Subtilisin-like protease                         51.6    3e-05   Medicago truncatula
ref|XP_004496012.1|  PREDICTED: subtilisin-like protease-like         51.6    3e-05   Cicer arietinum [garbanzo]
ref|XP_002534008.1|  Xylem serine proteinase 1 precursor, putative    51.6    3e-05   
ref|XP_002533167.1|  Xylem serine proteinase 1 precursor, putative    51.6    4e-05   Ricinus communis
gb|EYU36339.1|  hypothetical protein MIMGU_mgv1a001782mg              51.6    4e-05   Erythranthe guttata [common monkey flower]
gb|KJB70050.1|  hypothetical protein B456_011G056000                  51.6    4e-05   Gossypium raimondii
gb|KCW56428.1|  hypothetical protein EUGRSUZ_I02156                   51.6    4e-05   Eucalyptus grandis [rose gum]
emb|CAA59964.1|  subtilisin-like protease                             51.2    4e-05   Alnus glutinosa
ref|XP_009604890.1|  PREDICTED: subtilisin-like protease              51.2    4e-05   Nicotiana tomentosiformis
ref|XP_003516516.1|  PREDICTED: subtilisin-like protease-like         51.2    5e-05   Glycine max [soybeans]
ref|XP_007131701.1|  hypothetical protein PHAVU_011G034700g           51.2    5e-05   Phaseolus vulgaris [French bean]
ref|XP_010444660.1|  PREDICTED: subtilisin-like protease              51.2    5e-05   Camelina sativa [gold-of-pleasure]
ref|XP_006466502.1|  PREDICTED: subtilisin-like protease-like         50.8    5e-05   Citrus sinensis [apfelsine]
gb|KDO79000.1|  hypothetical protein CISIN_1g004301mg                 50.8    5e-05   Citrus sinensis [apfelsine]
ref|XP_010540359.1|  PREDICTED: subtilisin-like protease              50.8    5e-05   Tarenaya hassleriana [spider flower]
ref|XP_007017191.1|  Subtilisin-like serine protease 2, putative      50.8    6e-05   
gb|KDO84128.1|  hypothetical protein CISIN_1g047470mg                 50.8    6e-05   Citrus sinensis [apfelsine]
ref|XP_006434737.1|  hypothetical protein CICLE_v10000364mg           50.8    6e-05   
gb|KDO84129.1|  hypothetical protein CISIN_1g004265mg                 50.8    6e-05   Citrus sinensis [apfelsine]
ref|XP_006434736.1|  hypothetical protein CICLE_v10003898mg           50.8    6e-05   Citrus clementina [clementine]
ref|XP_009336065.1|  PREDICTED: subtilisin-like protease              50.8    6e-05   
ref|XP_004287970.1|  PREDICTED: subtilisin-like protease              50.8    6e-05   Fragaria vesca subsp. vesca
ref|XP_007147252.1|  hypothetical protein PHAVU_006G108700g           50.8    6e-05   Phaseolus vulgaris [French bean]
ref|XP_006473885.1|  PREDICTED: subtilisin-like protease-like         50.8    6e-05   Citrus sinensis [apfelsine]
ref|XP_007224572.1|  hypothetical protein PRUPE_ppa1027224mg          50.8    6e-05   
gb|EYU28325.1|  hypothetical protein MIMGU_mgv1a001748mg              50.8    6e-05   Erythranthe guttata [common monkey flower]
ref|XP_002282856.2|  PREDICTED: subtilisin-like protease              50.8    6e-05   
emb|CAN60788.1|  hypothetical protein VITISV_034534                   50.8    6e-05   Vitis vinifera
ref|XP_010446282.1|  PREDICTED: uncharacterized protein LOC104729087  50.8    6e-05   
ref|XP_009771086.1|  PREDICTED: subtilisin-like protease              50.8    6e-05   Nicotiana sylvestris
ref|XP_011069659.1|  PREDICTED: subtilisin-like protease              50.8    6e-05   Sesamum indicum [beniseed]
ref|XP_006342631.1|  PREDICTED: subtilisin-like protease-like         50.8    7e-05   Solanum tuberosum [potatoes]
gb|KDP32042.1|  hypothetical protein JCGZ_12503                       50.4    7e-05   Jatropha curcas
emb|CBI19501.3|  unnamed protein product                              50.8    7e-05   Vitis vinifera
ref|XP_002282841.2|  PREDICTED: uncharacterized protein LOC100259061  50.8    7e-05   
ref|XP_003553808.1|  PREDICTED: subtilisin-like protease-like         50.4    8e-05   Glycine max [soybeans]
ref|XP_007047459.1|  Subtilase family protein                         50.4    8e-05   
ref|XP_003535388.1|  PREDICTED: subtilisin-like protease-like         50.4    8e-05   Glycine max [soybeans]
ref|XP_004142884.1|  PREDICTED: subtilisin-like protease-like iso...  50.4    8e-05   Cucumis sativus [cucumbers]
ref|XP_004961962.1|  PREDICTED: subtilisin-like protease-like         50.4    8e-05   Setaria italica
ref|XP_003597117.1|  Subtilisin-like protease                         50.4    9e-05   
emb|CDY43570.1|  BnaC02g16670D                                        48.5    9e-05   Brassica napus [oilseed rape]
gb|KDO59723.1|  hypothetical protein CISIN_1g046220mg                 50.4    9e-05   Citrus sinensis [apfelsine]
ref|XP_004496643.1|  PREDICTED: subtilisin-like protease-like         50.1    1e-04   Cicer arietinum [garbanzo]
ref|XP_007143987.1|  hypothetical protein PHAVU_007G119500g           50.1    1e-04   Phaseolus vulgaris [French bean]
ref|XP_003547873.1|  PREDICTED: subtilisin-like protease-like         50.1    1e-04   Glycine max [soybeans]
gb|EYU36350.1|  hypothetical protein MIMGU_mgv1a001799mg              49.7    1e-04   Erythranthe guttata [common monkey flower]
gb|KHN40450.1|  Subtilisin-like protease                              49.7    1e-04   Glycine soja [wild soybean]
emb|CDY18653.1|  BnaA09g07420D                                        49.7    1e-04   Brassica napus [oilseed rape]
ref|XP_003552427.1|  PREDICTED: subtilisin-like protease-like         49.7    2e-04   Glycine max [soybeans]
ref|XP_003605881.1|  Subtilisin-like protease                         49.7    2e-04   
ref|XP_003636375.1|  Subtilisin-like protease                         49.7    2e-04   
emb|CDY67452.1|  BnaCnng55020D                                        49.3    2e-04   Brassica napus [oilseed rape]
gb|KJB27211.1|  hypothetical protein B456_004G284900                  49.3    2e-04   Gossypium raimondii
ref|XP_009103426.1|  PREDICTED: subtilisin-like protease              49.3    2e-04   Brassica rapa
gb|KHN12975.1|  Subtilisin-like protease                              49.3    2e-04   Glycine soja [wild soybean]
ref|XP_003579757.1|  PREDICTED: subtilisin-like protease              49.3    2e-04   Brachypodium distachyon [annual false brome]
emb|CDY57437.1|  BnaAnng14520D                                        49.3    2e-04   Brassica napus [oilseed rape]
ref|XP_009343011.1|  PREDICTED: subtilisin-like protease              49.3    2e-04   Pyrus x bretschneideri [bai li]
ref|XP_006345494.1|  PREDICTED: subtilisin-like protease-like         49.3    2e-04   
ref|XP_011093838.1|  PREDICTED: subtilisin-like protease              49.3    2e-04   Sesamum indicum [beniseed]
ref|XP_009337959.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...  49.3    2e-04   
ref|XP_007208070.1|  hypothetical protein PRUPE_ppa001701mg           49.3    2e-04   Prunus persica
gb|EMS67510.1|  Subtilisin-like protease                              48.9    2e-04   Triticum urartu
gb|KJB27210.1|  hypothetical protein B456_004G284900                  48.9    2e-04   Gossypium raimondii
ref|XP_004231902.2|  PREDICTED: subtilisin-like protease              48.9    2e-04   Solanum lycopersicum
emb|CDY55359.1|  BnaCnng28690D                                        48.9    2e-04   Brassica napus [oilseed rape]
ref|XP_004142885.1|  PREDICTED: subtilisin-like protease-like iso...  48.9    3e-04   
ref|XP_010273846.1|  PREDICTED: subtilisin-like protease              48.9    3e-04   Nelumbo nucifera [Indian lotus]
ref|XP_004155899.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...  48.9    3e-04   
ref|XP_010105479.1|  Subtilisin-like protease                         48.9    3e-04   
emb|CBI27801.3|  unnamed protein product                              48.9    3e-04   Vitis vinifera
ref|XP_006849717.1|  hypothetical protein AMTR_s00024p00243520        48.9    3e-04   Amborella trichopoda
ref|XP_011088593.1|  PREDICTED: subtilisin-like protease              48.9    3e-04   Sesamum indicum [beniseed]
ref|XP_008462247.1|  PREDICTED: subtilisin-like protease              48.9    3e-04   Cucumis melo [Oriental melon]
emb|CDY44380.1|  BnaA02g29970D                                        48.5    3e-04   Brassica napus [oilseed rape]
ref|XP_009769989.1|  PREDICTED: subtilisin-like protease              48.9    3e-04   Nicotiana sylvestris
ref|XP_004231903.1|  PREDICTED: subtilisin-like protease              48.5    3e-04   Solanum lycopersicum
ref|XP_008785920.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...  48.5    3e-04   
gb|KJB57084.1|  hypothetical protein B456_009G147400                  48.5    3e-04   Gossypium raimondii
ref|XP_002278292.1|  PREDICTED: subtilisin-like protease              48.5    3e-04   Vitis vinifera
ref|XP_009769987.1|  PREDICTED: subtilisin-like protease isoform X1   48.5    3e-04   Nicotiana sylvestris
ref|XP_007155854.1|  hypothetical protein PHAVU_003G237300g           48.5    3e-04   Phaseolus vulgaris [French bean]
ref|XP_008238402.1|  PREDICTED: subtilisin-like protease              48.5    3e-04   Prunus mume [ume]
ref|XP_002510119.1|  Xylem serine proteinase 1 precursor, putative    48.5    4e-04   Ricinus communis
ref|XP_010112177.1|  Subtilisin-like protease                         48.5    4e-04   Morus notabilis
emb|CBI36893.3|  unnamed protein product                              48.5    4e-04   Vitis vinifera
gb|KJB58523.1|  hypothetical protein B456_009G213500                  48.5    4e-04   Gossypium raimondii
emb|CDY18654.1|  BnaA09g07410D                                        48.5    4e-04   Brassica napus [oilseed rape]
ref|XP_006426043.1|  hypothetical protein CICLE_v10024951mg           48.5    4e-04   Citrus clementina [clementine]
ref|XP_004499011.1|  PREDICTED: subtilisin-like protease-like         48.5    4e-04   Cicer arietinum [garbanzo]
ref|XP_009112375.1|  PREDICTED: subtilisin-like protease isoform X2   48.1    4e-04   
ref|XP_006339823.1|  PREDICTED: subtilisin-like protease-like         48.1    4e-04   Solanum tuberosum [potatoes]
dbj|BAJ87780.1|  predicted protein                                    48.1    4e-04   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004229661.1|  PREDICTED: subtilisin-like protease              48.1    4e-04   
ref|XP_002277899.1|  PREDICTED: subtilisin-like protease              48.1    4e-04   Vitis vinifera
ref|XP_010070634.1|  PREDICTED: subtilisin-like protease              48.1    4e-04   Eucalyptus grandis [rose gum]
ref|XP_006396129.1|  hypothetical protein EUTSA_v10002410mg           48.1    4e-04   Eutrema salsugineum [saltwater cress]
gb|EMT30759.1|  Subtilisin-like protease                              48.1    4e-04   
ref|XP_007160895.1|  hypothetical protein PHAVU_001G026100g           48.1    4e-04   Phaseolus vulgaris [French bean]
ref|XP_010690381.1|  PREDICTED: subtilisin-like protease              48.1    5e-04   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006374838.1|  hypothetical protein POPTR_0014s01910g           48.1    5e-04   Populus trichocarpa [western balsam poplar]
ref|XP_006365833.1|  PREDICTED: subtilisin-like protease-like         48.1    5e-04   Solanum tuberosum [potatoes]
emb|CAN71376.1|  hypothetical protein VITISV_001491                   48.1    5e-04   Vitis vinifera
ref|XP_008392153.1|  PREDICTED: subtilisin-like protease              48.1    5e-04   
dbj|BAJ88858.1|  predicted protein                                    48.1    5e-04   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB29423.1|  hypothetical protein B456_005G099900                  48.1    5e-04   Gossypium raimondii
ref|XP_004305780.1|  PREDICTED: subtilisin-like protease              48.1    5e-04   Fragaria vesca subsp. vesca
ref|XP_004510506.1|  PREDICTED: subtilisin-like protease-like iso...  48.1    5e-04   
emb|CDY63300.1|  BnaCnng41800D                                        48.1    5e-04   Brassica napus [oilseed rape]
ref|XP_011036534.1|  PREDICTED: subtilisin-like protease              48.1    5e-04   Populus euphratica
ref|XP_010248001.1|  PREDICTED: subtilisin-like protease              48.1    5e-04   Nelumbo nucifera [Indian lotus]
ref|XP_010484513.1|  PREDICTED: subtilisin-like protease              48.1    5e-04   Camelina sativa [gold-of-pleasure]
emb|CBI32394.3|  unnamed protein product                              48.1    5e-04   Vitis vinifera
ref|XP_010090170.1|  Subtilisin-like protease                         48.1    5e-04   Morus notabilis
ref|XP_004509085.1|  PREDICTED: subtilisin-like protease-like         48.1    5e-04   Cicer arietinum [garbanzo]
ref|XP_010920139.1|  PREDICTED: subtilisin-like protease              47.8    5e-04   Elaeis guineensis
ref|XP_010089708.1|  Subtilisin-like protease                         47.8    6e-04   Morus notabilis
ref|XP_003624105.1|  Xylem serine proteinase                          47.8    6e-04   Medicago truncatula
ref|XP_006422997.1|  hypothetical protein CICLE_v10027850mg           47.8    6e-04   Citrus clementina [clementine]
ref|XP_003632775.1|  PREDICTED: subtilisin-like protease              47.8    6e-04   Vitis vinifera
ref|XP_006495263.1|  PREDICTED: subtilisin-like protease-like         47.8    6e-04   Citrus sinensis [apfelsine]
ref|XP_007024751.1|  Subtilase family protein isoform 2               47.8    6e-04   
ref|XP_006487124.1|  PREDICTED: subtilisin-like protease-like         47.8    6e-04   Citrus sinensis [apfelsine]
ref|XP_006487074.1|  PREDICTED: subtilisin-like protease-like         47.8    6e-04   
ref|XP_006339058.1|  PREDICTED: subtilisin-like protease-like         47.8    6e-04   Solanum tuberosum [potatoes]
ref|XP_006487073.1|  PREDICTED: subtilisin-like protease-like         47.8    7e-04   
ref|XP_007226597.1|  hypothetical protein PRUPE_ppa023578mg           47.8    7e-04   
ref|XP_007135377.1|  hypothetical protein PHAVU_010G124400g           47.8    7e-04   
emb|CDP17236.1|  unnamed protein product                              47.8    7e-04   
gb|KJB43875.1|  hypothetical protein B456_007G221100                  47.4    7e-04   
ref|XP_009350566.1|  PREDICTED: subtilisin-like protease              47.4    8e-04   
ref|XP_011000657.1|  PREDICTED: subtilisin-like protease              47.4    8e-04   
gb|EMS48667.1|  Subtilisin-like protease                              47.4    8e-04   
ref|XP_010269647.1|  PREDICTED: subtilisin-like protease              47.4    8e-04   
gb|EMT15112.1|  hypothetical protein F775_52727                       47.4    8e-04   
gb|KDP33922.1|  hypothetical protein JCGZ_07493                       47.4    8e-04   
ref|XP_007024750.1|  Subtilase family protein isoform 1               47.4    8e-04   
ref|XP_009112374.1|  PREDICTED: subtilisin-like protease isoform X1   47.4    8e-04   
ref|XP_010271938.1|  PREDICTED: subtilisin-like protease              47.4    9e-04   
ref|XP_007047285.1|  Subtilisin-like serine endopeptidase family ...  47.4    0.001   
ref|XP_008357007.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...  47.0    0.001   
ref|XP_007225532.1|  hypothetical protein PRUPE_ppa025871mg           47.0    0.001   



>ref|XP_006357406.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=776

 Score =   106 bits (264),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 67/86 (78%), Gaps = 1/86 (1%)
 Frame = +2

Query  47   MAVPSRVSSLLFIF-LCFVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAI  223
            MA  S +SS+ FI   C   V ++V S+G ETFI+ V+KS+KPHVFSTHHHWYSSI+R+I
Sbjct  1    MAKISVLSSIFFIISFCLTPVAISVQSDGHETFIIHVAKSDKPHVFSTHHHWYSSIVRSI  60

Query  224  SPLSRHPSELLYSYGRAANGFSARLT  301
            SP S H S++LY+Y RAA GFSARLT
Sbjct  61   SPPSHHRSKILYTYERAAVGFSARLT  86



>ref|XP_009613479.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=774

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 50/79 (63%), Positives = 63/79 (80%), Gaps = 5/79 (6%)
 Frame = +2

Query  71   SLLFIFL--CFVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHP  244
            SL FI +  C  S+T+ V S+G ETFI+ VSKS+KP VF+THHHWYSSIIR++   S+HP
Sbjct  8    SLFFIIISFCITSITIPVQSDGHETFIIHVSKSDKPRVFATHHHWYSSIIRSV---SQHP  64

Query  245  SELLYSYGRAANGFSARLT  301
            S++LY+Y RAA GFSARLT
Sbjct  65   SKILYTYSRAAVGFSARLT  83



>ref|XP_009758461.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=774

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 63/83 (76%), Gaps = 7/83 (8%)
 Frame = +2

Query  65   VSSLLFIFL----CFVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPL  232
            +S L F F+    C   VT++V S+G ETFI+ VSKS+KP VF+THHHWYSSIIR++   
Sbjct  4    ISVLSFFFIVISFCLTPVTISVQSDGHETFIIHVSKSDKPRVFTTHHHWYSSIIRSV---  60

Query  233  SRHPSELLYSYGRAANGFSARLT  301
            S+HPS++LY+Y RAA GFSA LT
Sbjct  61   SQHPSKILYTYKRAAVGFSAHLT  83



>ref|XP_010322825.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=776

 Score = 89.7 bits (221),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 64/80 (80%), Gaps = 1/80 (1%)
 Frame = +2

Query  65   VSSLLFIF-LCFVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRH  241
            V S+LFI   C   VT++V S+  ETFI+ V+KS KPHVFSTHHHWYSSI+R++SP S H
Sbjct  6    VLSILFILSFCLAPVTISVQSDDHETFIIHVAKSHKPHVFSTHHHWYSSIVRSVSPSSHH  65

Query  242  PSELLYSYGRAANGFSARLT  301
            PS++LY+Y RAA GFSARLT
Sbjct  66   PSKILYTYERAAVGFSARLT  85



>emb|CBI35855.3| unnamed protein product [Vitis vinifera]
Length=1791

 Score = 89.0 bits (219),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 63/87 (72%), Gaps = 4/87 (5%)
 Frame = +2

Query  41    TSMAVPSRVSSLLFIFLCFVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRA  220
             +SM +PS   SL  + LC   V+  +S +  +TF+V VSKS KP  ++THHHWYSSI+R+
Sbjct  1196  SSMGIPS---SLFSLILCLSLVSATLSLDESQTFVVHVSKSHKPSAYATHHHWYSSIVRS  1252

Query  221   ISPLSRHPSELLYSYGRAANGFSARLT  301
             ++  S  PS++LYSY RAANGFSARLT
Sbjct  1253  LAS-SGQPSKILYSYERAANGFSARLT  1278


 Score = 69.7 bits (169),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 47/66 (71%), Gaps = 1/66 (2%)
 Frame = +2

Query  104  VTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYSYGRAANG  283
            V+ A SS   + FIV VSKS KP  F++HH WY+SI+++++  S  PS +LYSY  AA G
Sbjct  648  VSAAFSSNDSQNFIVHVSKSHKPTAFASHHQWYASIVQSLTS-STQPSRILYSYEHAATG  706

Query  284  FSARLT  301
            FSARLT
Sbjct  707  FSARLT  712



>ref|XP_002272769.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=771

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 61/85 (72%), Gaps = 4/85 (5%)
 Frame = +2

Query  47   MAVPSRVSSLLFIFLCFVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAIS  226
            M +PS   SL  + LC   V+  +S +  +TF+V VSKS KP  ++THHHWYSSI+R+++
Sbjct  1    MGIPS---SLFSLILCLSLVSATLSLDESQTFVVHVSKSHKPSAYATHHHWYSSIVRSLA  57

Query  227  PLSRHPSELLYSYGRAANGFSARLT  301
              S  PS++LYSY RAANGFSARLT
Sbjct  58   S-SGQPSKILYSYERAANGFSARLT  81



>emb|CDP20511.1| unnamed protein product [Coffea canephora]
Length=777

 Score = 87.0 bits (214),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 57/69 (83%), Gaps = 2/69 (3%)
 Frame = +2

Query  101  SVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRH--PSELLYSYGRA  274
            ++ +A SS+G ET+IV V+K++KP VF THHHWYSSI+R++SPLS H  P++L+Y+Y  A
Sbjct  18   ALIIAASSDGRETYIVHVAKAQKPSVFPTHHHWYSSILRSLSPLSAHHPPTKLIYTYDHA  77

Query  275  ANGFSARLT  301
             +GFSARLT
Sbjct  78   VHGFSARLT  86



>ref|XP_006342924.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=767

 Score = 86.7 bits (213),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 64/86 (74%), Gaps = 6/86 (7%)
 Frame = +2

Query  47   MAVPSR-VSSLLFIFLCFVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAI  223
            MA+PS   S L+F+FL   S+ ++V S+G +TFIV VS S KP +F+THHHWYSSI+R++
Sbjct  1    MALPSSSFSPLVFLFLS--SLAISVKSDGPKTFIVHVSISHKPLIFTTHHHWYSSILRSV  58

Query  224  SPLSRHPSELLYSYGRAANGFSARLT  301
               S+H   +LYSY RAA GFSARLT
Sbjct  59   ---SQHSPNILYSYDRAARGFSARLT  81



>ref|XP_010111996.1| Subtilisin-like protease [Morus notabilis]
 gb|EXC32307.1| Subtilisin-like protease [Morus notabilis]
Length=826

 Score = 84.0 bits (206),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 64/100 (64%), Gaps = 11/100 (11%)
 Frame = +2

Query  32   RLVTSMAVPSRVSSLLFI----FLCFVSVTVAVSS------EGWETFIVLVSKSEKPHVF  181
            RL      PS +++LL +    FLC  S T +  S      +   TFIV VSKS KP  F
Sbjct  38   RLDMESFAPSLLATLLLVVFSFFLCIASATSSDPSSDHYLIDAPRTFIVHVSKSHKPSFF  97

Query  182  STHHHWYSSIIRAISPLSRHPSELLYSYGRAANGFSARLT  301
            ++HHHWY+SIIR++ P S HPS+LLY+YG++ NGFSA LT
Sbjct  98   TSHHHWYTSIIRSL-PSSPHPSKLLYTYGKSINGFSATLT  136



>gb|EYU21314.1| hypothetical protein MIMGU_mgv1a001662mg [Erythranthe guttata]
Length=777

 Score = 80.1 bits (196),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 47/61 (77%), Gaps = 1/61 (2%)
 Frame = +2

Query  119  SSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYSYGRAANGFSARL  298
            S  G ETFIV V KSEKP  FSTHHHWYSSII+++ P  R P+E+LY+Y RA  GFSARL
Sbjct  24   SDAGQETFIVHVIKSEKPLTFSTHHHWYSSIIKSLPPHHR-PAEILYTYDRAVRGFSARL  82

Query  299  T  301
            +
Sbjct  83   S  83



>ref|XP_007024651.1| Subtilase family protein [Theobroma cacao]
 gb|EOY27273.1| Subtilase family protein [Theobroma cacao]
Length=767

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 49/61 (80%), Gaps = 1/61 (2%)
 Frame = +2

Query  119  SSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYSYGRAANGFSARL  298
            SS+  E FI+ VSKS KP +FS+HHHWYSSII ++ P S HP++LLY+Y RA NGFSARL
Sbjct  20   SSDRPENFIIHVSKSHKPSLFSSHHHWYSSIIHSLPP-SPHPTKLLYTYERAINGFSARL  78

Query  299  T  301
            T
Sbjct  79   T  79



>gb|KJB57037.1| hypothetical protein B456_009G146000 [Gossypium raimondii]
Length=768

 Score = 78.6 bits (192),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 48/61 (79%), Gaps = 1/61 (2%)
 Frame = +2

Query  119  SSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYSYGRAANGFSARL  298
            SS+G E FI+ VSKS KP +FS+HHHWYSSI+ ++ P S HP +LLY+Y R  NGFSARL
Sbjct  20   SSDGPENFIIHVSKSHKPPLFSSHHHWYSSILASLPP-SPHPIKLLYTYERVINGFSARL  78

Query  299  T  301
            T
Sbjct  79   T  79



>ref|XP_010088794.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB36977.1| Subtilisin-like protease [Morus notabilis]
Length=789

 Score = 77.4 bits (189),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 56/80 (70%), Gaps = 5/80 (6%)
 Frame = +2

Query  77   LFIFLCFVSVT----VAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHP  244
            +F+F C + +T    ++  S+   TFIV ++K  KP +F++  HWY+SII+++ P+SRHP
Sbjct  14   IFLFFCLIQITFSNPLSDDSDHPMTFIVHMTKQHKPLLFTSQFHWYNSIIKSL-PISRHP  72

Query  245  SELLYSYGRAANGFSARLTP  304
            S LLY+Y R ANGF+  LTP
Sbjct  73   SMLLYTYERVANGFAVSLTP  92



>emb|CDX97540.1| BnaA05g25390D [Brassica napus]
Length=261

 Score = 74.3 bits (181),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 58/81 (72%), Gaps = 2/81 (2%)
 Frame = +2

Query  65   VSSLLFIFLCFVSVTVAVSS-EGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRH  241
            +SS+ F+F  F+    ++SS +G E++IV V  S KP +FS+H HW++S++R++ P S  
Sbjct  6    LSSVFFVFPLFLCFFSSLSSWDGLESYIVHVQSSHKPSLFSSHDHWHNSLLRSL-PSSPQ  64

Query  242  PSELLYSYGRAANGFSARLTP  304
            P+ LLYSY RA  GFSARL+P
Sbjct  65   PATLLYSYSRAVQGFSARLSP  85



>ref|XP_006465903.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
Length=776

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 48/64 (75%), Gaps = 2/64 (3%)
 Frame = +2

Query  122  SEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHP--SELLYSYGRAANGFSAR  295
            S+G +TFI+ VS+S KP +FS+H  WYSSII+++ P   HP  S+LLY+Y +A NGFSA 
Sbjct  27   SDGPQTFIIYVSRSHKPALFSSHDDWYSSIIQSLPPSPDHPHSSKLLYTYSKAINGFSAH  86

Query  296  LTPF  307
            LTP 
Sbjct  87   LTPL  90



>ref|XP_006426684.1| hypothetical protein CICLE_v10024936mg [Citrus clementina]
 gb|ESR39924.1| hypothetical protein CICLE_v10024936mg [Citrus clementina]
Length=776

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 48/64 (75%), Gaps = 2/64 (3%)
 Frame = +2

Query  122  SEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHP--SELLYSYGRAANGFSAR  295
            S+G +TFI+ VS+S KP +FS+H  WYSSII+++ P   HP  S+LLY+Y +A NGFSA 
Sbjct  27   SDGPQTFIIYVSRSHKPALFSSHDDWYSSIIQSLPPSPDHPHSSKLLYTYSKAINGFSAH  86

Query  296  LTPF  307
            LTP 
Sbjct  87   LTPL  90



>ref|XP_010088796.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB36979.1| Subtilisin-like protease [Morus notabilis]
Length=789

 Score = 74.7 bits (182),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 55/80 (69%), Gaps = 5/80 (6%)
 Frame = +2

Query  77   LFIFLCFVSVT----VAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHP  244
            +F+F C + +T    ++  S+   TFIV ++K  KP +F++  HWY+SII+++ P SRHP
Sbjct  14   IFLFFCLIPITFSNPLSDDSDHPMTFIVHMAKQHKPLLFTSQFHWYNSIIKSL-PHSRHP  72

Query  245  SELLYSYGRAANGFSARLTP  304
            S LLY+Y R ANGF+  LTP
Sbjct  73   SRLLYTYERVANGFAVSLTP  92



>ref|XP_009146419.1| PREDICTED: subtilisin-like protease [Brassica rapa]
Length=776

 Score = 74.3 bits (181),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 58/81 (72%), Gaps = 2/81 (2%)
 Frame = +2

Query  65   VSSLLFIFLCFVSVTVAVSS-EGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRH  241
            +SS+ F+F  F+    ++SS +G E++IV V  S KP +FS+H HW++S++R++ P S  
Sbjct  6    LSSVFFVFPLFLCFFSSLSSWDGLESYIVHVQSSHKPSLFSSHDHWHNSLLRSL-PSSPQ  64

Query  242  PSELLYSYGRAANGFSARLTP  304
            P+ LLYSY RA  GFSARL+P
Sbjct  65   PATLLYSYSRAVQGFSARLSP  85



>ref|XP_002885009.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61268.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=777

 Score = 73.9 bits (180),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 62/84 (74%), Gaps = 5/84 (6%)
 Frame = +2

Query  65   VSSLLFIF---LCFVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLS  235
            +SS+ F+F   LCF+S + + SS+G E++IV V  S KP +FS+H+HW+ S++R++ P S
Sbjct  6    ISSVFFVFSLFLCFLSSSYS-SSDGLESYIVHVQSSHKPSLFSSHNHWHVSLLRSL-PSS  63

Query  236  RHPSELLYSYGRAANGFSARLTPF  307
              P+ LLYSY RA +GFSARL+P 
Sbjct  64   PQPATLLYSYSRAVHGFSARLSPI  87



>ref|XP_004305758.1| PREDICTED: subtilisin-like protease [Fragaria vesca subsp. vesca]
Length=773

 Score = 73.9 bits (180),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 43/88 (49%), Positives = 57/88 (65%), Gaps = 5/88 (6%)
 Frame = +2

Query  47   MAVPSRVSSLLFIFLCFVSVTVAVSSEGWE---TFIVLVSKSEKPHVFSTHHHWYSSIIR  217
            MAVPS  S   F+ LCFV  T +      +   TFIV VSK  KP +FS+   WY+SI+R
Sbjct  1    MAVPSP-SLFFFLVLCFVHATFSTDQSDRDSPRTFIVHVSKYSKPALFSSQRRWYTSILR  59

Query  218  AISPLSRHPSELLYSYGRAANGFSARLT  301
            ++ P S HP++LLY+Y RA +GFSA L+
Sbjct  60   SLPP-SPHPTKLLYTYSRAVHGFSATLS  86



>ref|XP_006407132.1| hypothetical protein EUTSA_v10022348mg, partial [Eutrema salsugineum]
 gb|ESQ48585.1| hypothetical protein EUTSA_v10022348mg, partial [Eutrema salsugineum]
Length=1359

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 56/80 (70%), Gaps = 6/80 (8%)
 Frame = +2

Query  65   VSSLLFIFLCFVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHP  244
            V SL F FL  VS     SSEG  ++IV V  S KP +FS+H+HW++S++R++ P S  P
Sbjct  616  VFSLFFCFLSSVS-----SSEGIASYIVHVQSSHKPSLFSSHNHWHNSLLRSL-PSSPQP  669

Query  245  SELLYSYGRAANGFSARLTP  304
            + LLYSY RA +GFSARL+P
Sbjct  670  ATLLYSYSRAVHGFSARLSP  689



>ref|XP_011072593.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=774

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 46/58 (79%), Gaps = 1/58 (2%)
 Frame = +2

Query  113  AVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYSYGRAANGF  286
            A+SS+  ETFI+ VSKS KP  FSTHHHWYSSII+++ P +R P+++LY+Y RA  GF
Sbjct  21   ALSSDDQETFIIHVSKSHKPLAFSTHHHWYSSIIQSLPPHNR-PAKILYTYDRAVRGF  77



>ref|NP_566473.2| Subtilase family protein [Arabidopsis thaliana]
 dbj|BAB02339.1| cucumisin-like serine protease; subtilisin-like protease [Arabidopsis 
thaliana]
 gb|AAS49055.1| At3g14067 [Arabidopsis thaliana]
 gb|AAS76762.1| At3g14067 [Arabidopsis thaliana]
 dbj|BAF00939.1| putative subtilisin-like serine proteinase [Arabidopsis thaliana]
 gb|AEE75461.1| Subtilase family protein [Arabidopsis thaliana]
Length=777

 Score = 71.6 bits (174),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 62/84 (74%), Gaps = 5/84 (6%)
 Frame = +2

Query  65   VSSLLFIF---LCFVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLS  235
            +SS+ F+F   LCF S + + SS+G E++IV V +S KP +FS+H++W+ S++R++ P S
Sbjct  6    LSSIFFVFPLLLCFFSPSSS-SSDGLESYIVHVQRSHKPSLFSSHNNWHVSLLRSL-PSS  63

Query  236  RHPSELLYSYGRAANGFSARLTPF  307
              P+ LLYSY RA +GFSARL+P 
Sbjct  64   PQPATLLYSYSRAVHGFSARLSPI  87



>dbj|BAE98521.1| putative subtilisin-like serine proteinase [Arabidopsis thaliana]
Length=777

 Score = 71.6 bits (174),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 62/84 (74%), Gaps = 5/84 (6%)
 Frame = +2

Query  65   VSSLLFIF---LCFVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLS  235
            +SS+ F+F   LCF S + + SS+G E++IV V +S KP +FS+H++W+ S++R++ P S
Sbjct  6    LSSIFFVFPLLLCFFSPSSS-SSDGLESYIVHVQRSHKPSLFSSHNNWHVSLLRSL-PSS  63

Query  236  RHPSELLYSYGRAANGFSARLTPF  307
              P+ LLYSY RA +GFSARL+P 
Sbjct  64   PQPATLLYSYSRAVHGFSARLSPI  87



>emb|CDY33251.1| BnaC01g37240D [Brassica napus]
Length=775

 Score = 71.2 bits (173),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 61/89 (69%), Gaps = 6/89 (7%)
 Frame = +2

Query  47   MAVPSRVSSLLFI---FLCFVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIR  217
            MA    +SS+L +   F+CF S + +   +G E++IV V  S KP +FS+H HW++S++R
Sbjct  1    MAAKLSLSSVLIVLSLFICFSSSSSSW--DGLESYIVHVQGSHKPSLFSSHSHWHNSLLR  58

Query  218  AISPLSRHPSELLYSYGRAANGFSARLTP  304
            ++ P S  P+ LLYSY RA +GFSARL+P
Sbjct  59   SL-PSSPQPATLLYSYSRAVHGFSARLSP  86



>ref|XP_009610930.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=779

 Score = 71.2 bits (173),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = +2

Query  110  VAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYSYGRAANGFS  289
            ++V S+G ETFIV VSKS KPH+F+THHHWYSSI+R++S  S++ +++LYSY  A+ GFS
Sbjct  25   ISVQSDGSETFIVHVSKSHKPHIFTTHHHWYSSILRSVSSSSQYSAKILYSYDYASQGFS  84

Query  290  ARLT  301
            ARLT
Sbjct  85   ARLT  88



>emb|CDY39093.1| BnaA01g29630D [Brassica napus]
Length=775

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 46/60 (77%), Gaps = 1/60 (2%)
 Frame = +2

Query  125  EGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYSYGRAANGFSARLTP  304
            +G E++IV V  S KP +FS+H HW++S++R++ P S  P+ LLYSY RA NGFSARL+P
Sbjct  28   DGLESYIVHVQGSHKPSLFSSHSHWHNSLLRSL-PSSPQPATLLYSYSRAVNGFSARLSP  86



>ref|XP_009117189.1| PREDICTED: subtilisin-like protease [Brassica rapa]
Length=775

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 46/60 (77%), Gaps = 1/60 (2%)
 Frame = +2

Query  125  EGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYSYGRAANGFSARLTP  304
            +G E++IV V  S KP +FS+H HW++S++R++ P S  P+ LLYSY RA NGFSARL+P
Sbjct  28   DGLESYIVHVQGSHKPSLFSSHSHWHNSLLRSL-PSSPQPATLLYSYSRAVNGFSARLSP  86



>ref|XP_009788688.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=776

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +2

Query  101  SVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYSYGRAAN  280
            S+ ++V S+G ETFIV VSKS KPH+F+THH+WYSSI+R++S  S+H +++LYSY  AA 
Sbjct  19   SLAISVQSDGHETFIVHVSKSHKPHIFTTHHNWYSSILRSVSSSSQHSAKILYSYDYAAR  78

Query  281  GFSARLT  301
            GFSAR+T
Sbjct  79   GFSARIT  85



>gb|KJB70156.1| hypothetical protein B456_011G061400 [Gossypium raimondii]
Length=764

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 44/56 (79%), Gaps = 1/56 (2%)
 Frame = +2

Query  134  ETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYSYGRAANGFSARLT  301
            + FI+ VSKS KP +FS+HHHWYSSI+ ++ P S HP +LLY+Y  + NGFSARLT
Sbjct  26   QNFIIHVSKSHKPSLFSSHHHWYSSILHSLPP-SPHPIKLLYTYQLSINGFSARLT  80



>ref|XP_003547763.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=773

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 49/64 (77%), Gaps = 1/64 (2%)
 Frame = +2

Query  113  AVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYSYGRAANGFSA  292
            A S +  +T+I+ V++S+KP +F++H  WYSSI+R++ P S HP+ LLY+Y  AA+GFS 
Sbjct  22   ASSDDAPQTYIIHVAQSQKPSLFTSHTTWYSSILRSLPP-SPHPATLLYTYSSAASGFSV  80

Query  293  RLTP  304
            RLTP
Sbjct  81   RLTP  84



>ref|XP_010111995.1| Subtilisin-like protease [Morus notabilis]
 gb|EXC32306.1| Subtilisin-like protease [Morus notabilis]
Length=733

 Score = 69.3 bits (168),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 57/90 (63%), Gaps = 5/90 (6%)
 Frame = +2

Query  44   SMAVPSRVSSLLFIFLCFVSVT----VAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSI  211
            SMA+ S+    L IFLC + ++    +    +   TFIV ++KS++P VF     WY+SI
Sbjct  3    SMAITSQRLFFLTIFLCLLPISFPNPLLDDHDRPMTFIVHMAKSQRPSVFPPPRQWYTSI  62

Query  212  IRAISPLSRHPSELLYSYGRAANGFSARLT  301
            I ++ P SRHPS++LY+Y + ANGF+A L 
Sbjct  63   IESLPP-SRHPSKILYAYEKVANGFAASLN  91



>gb|KFK38761.1| hypothetical protein AALP_AA3G157200 [Arabis alpina]
Length=775

 Score = 69.3 bits (168),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 48/61 (79%), Gaps = 1/61 (2%)
 Frame = +2

Query  125  EGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYSYGRAANGFSARLTP  304
            EG+E++IV V +S KP +FS+H HW++S++R++ P S  P+ LLYSY RA +GFSA+L+P
Sbjct  25   EGFESYIVHVQRSHKPSLFSSHKHWHNSLLRSL-PSSPKPATLLYSYSRAVHGFSAQLSP  83

Query  305  F  307
             
Sbjct  84   I  84



>ref|XP_010654422.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=788

 Score = 69.3 bits (168),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 47/66 (71%), Gaps = 1/66 (2%)
 Frame = +2

Query  104  VTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYSYGRAANG  283
            V+ A SS   + FIV VSKS KP  F++HH WY+SI+++++  S  PS +LYSY  AA G
Sbjct  38   VSAAFSSNDSQNFIVHVSKSHKPTAFASHHQWYASIVQSLTS-STQPSRILYSYEHAATG  96

Query  284  FSARLT  301
            FSARLT
Sbjct  97   FSARLT  102



>emb|CDY52259.1| BnaC05g52030D [Brassica napus]
Length=736

 Score = 68.9 bits (167),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 58/81 (72%), Gaps = 2/81 (2%)
 Frame = +2

Query  65   VSSLLFIFLCFVSVTVAVSS-EGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRH  241
            +SS+ F+F  F+    ++SS +G E++IV V  S KP +FS+H HW++S++R++ P S  
Sbjct  6    LSSVFFVFPLFLCSFSSLSSWDGLESYIVHVQSSHKPSLFSSHDHWHNSLLRSL-PSSPQ  64

Query  242  PSELLYSYGRAANGFSARLTP  304
            P+ LLYSY RA  GFSARL+P
Sbjct  65   PATLLYSYSRAVQGFSARLSP  85



>ref|XP_007135429.1| hypothetical protein PHAVU_010G128600g [Phaseolus vulgaris]
 gb|ESW07423.1| hypothetical protein PHAVU_010G128600g [Phaseolus vulgaris]
Length=778

 Score = 68.9 bits (167),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 45/56 (80%), Gaps = 1/56 (2%)
 Frame = +2

Query  137  TFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYSYGRAANGFSARLTP  304
            T+IV V++S+KP +FSTHH+WY+SI+ ++ P S HP+ LLY+Y  AA GFS R+TP
Sbjct  35   TYIVHVAQSQKPTLFSTHHNWYTSILHSLPP-SSHPATLLYTYSAAAAGFSVRITP  89



>emb|CAN75239.1| hypothetical protein VITISV_014205 [Vitis vinifera]
Length=768

 Score = 68.6 bits (166),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 47/66 (71%), Gaps = 1/66 (2%)
 Frame = +2

Query  104  VTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYSYGRAANG  283
            V+ A SS   + FIV VSKS KP  F++HH WY+SI+++++  S  PS +LYSY  AA G
Sbjct  18   VSAAFSSNESQNFIVHVSKSHKPTAFASHHQWYASIVQSLTS-STQPSRILYSYEHAATG  76

Query  284  FSARLT  301
            FSARLT
Sbjct  77   FSARLT  82



>ref|XP_002534468.1| Cucumisin precursor, putative [Ricinus communis]
 gb|EEF27917.1| Cucumisin precursor, putative [Ricinus communis]
Length=369

 Score = 67.4 bits (163),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 44/59 (75%), Gaps = 1/59 (2%)
 Frame = +2

Query  134  ETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLS-RHPSELLYSYGRAANGFSARLTPF  307
            +TFIV +SK  KP +F++HH WY+SII ++ P S  HP+++LY+Y  A NGFSA LT +
Sbjct  35   KTFIVHISKPHKPTLFTSHHDWYASIINSLPPASPHHPAKILYTYNHAVNGFSAHLTSY  93



>ref|XP_006841679.1| hypothetical protein AMTR_s00003p00245290 [Amborella trichopoda]
 gb|ERN03354.1| hypothetical protein AMTR_s00003p00245290 [Amborella trichopoda]
Length=765

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = +2

Query  137  TFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYSYGRAANGFSARLTP  304
            TFIV VSK+ KP +F+THHHWY +I+R++         LLYSY R A+GFSAR+ P
Sbjct  26   TFIVHVSKAHKPAIFTTHHHWYKAILRSLRRAGEPKPTLLYSYDRVAHGFSARILP  81



>ref|XP_002304129.2| hypothetical protein POPTR_0003s06530g [Populus trichocarpa]
 gb|EEE79108.2| hypothetical protein POPTR_0003s06530g [Populus trichocarpa]
Length=774

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 47/61 (77%), Gaps = 1/61 (2%)
 Frame = +2

Query  119  SSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYSYGRAANGFSARL  298
            SS+  +TFI+ VS+S KP +FS+HH WY+SII ++ P S HP++LLY+Y  A  GFSA+L
Sbjct  26   SSDHPQTFIIHVSRSHKPSLFSSHHDWYTSIIHSLPP-SPHPAKLLYNYNHAIRGFSAQL  84

Query  299  T  301
            T
Sbjct  85   T  85



>ref|XP_008391410.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=772

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 45/56 (80%), Gaps = 2/56 (4%)
 Frame = +2

Query  134  ETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYSYGRAANGFSARLT  301
            +TFIV VSKS+KP +FS+H  WY+SII+++   S HP++LLY+Y RA +GFSA LT
Sbjct  32   KTFIVHVSKSDKPALFSSHRSWYTSIIQSLP--SPHPTKLLYTYDRAVHGFSAALT  85



>ref|XP_010465286.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=789

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 44/56 (79%), Gaps = 1/56 (2%)
 Frame = +2

Query  140  FIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYSYGRAANGFSARLTPF  307
            +IV V  S KP +FS+H+HW+ S++R++ PLS  P+ LLYSY RAA+GFSARL+P 
Sbjct  35   YIVHVQSSHKPSLFSSHNHWHVSLLRSL-PLSPQPATLLYSYTRAAHGFSARLSPL  89



>ref|XP_011036446.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=774

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 44/55 (80%), Gaps = 1/55 (2%)
 Frame = +2

Query  137  TFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYSYGRAANGFSARLT  301
            TFI+ VS+S KP +FS+HH WY+SII ++ P S HP++LLY+Y  A +GFSA+LT
Sbjct  32   TFIIHVSRSHKPSLFSSHHDWYTSIIHSLPP-SPHPAKLLYNYNHATHGFSAQLT  85



>ref|XP_010261833.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=783

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 42/88 (48%), Positives = 61/88 (69%), Gaps = 5/88 (6%)
 Frame = +2

Query  44   SMAVPSRVSSLLFIFLCFVSVTVA--VSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIR  217
            +++VPS ++S+ F+FLC V  T++  +S  G +TFIV VSKS++P  + T HHWYSSI+R
Sbjct  2    AISVPSMINSV-FLFLCVVLTTISPTLSFHGVQTFIVHVSKSQRPP-YLTSHHWYSSILR  59

Query  218  AISPLSRHPSELLYSYGRAANGFSARLT  301
            ++ P S   + +LY Y  A  GFSA LT
Sbjct  60   SL-PQSPPSTRILYVYDHAITGFSAHLT  86



>ref|XP_006369129.1| subtilase family protein [Populus trichocarpa]
 gb|ERP65698.1| subtilase family protein [Populus trichocarpa]
Length=772

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 44/57 (77%), Gaps = 1/57 (2%)
 Frame = +2

Query  134  ETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYSYGRAANGFSARLTP  304
            +TFI+ VSKS KP +FS+HH WY+SII+++ P S  P+++LY+Y  A +GFS  LTP
Sbjct  29   QTFIIHVSKSHKPSLFSSHHDWYTSIIQSLPP-SPQPAKILYNYNHAIHGFSVHLTP  84



>gb|EPS74243.1| subtilase family protein, partial [Genlisea aurea]
Length=751

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 43/57 (75%), Gaps = 3/57 (5%)
 Frame = +2

Query  137  TFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSR--HPSELLYSYGRAANGFSARLT  301
            T+IV VSKS KP VFS+HHHWYSS++ ++ P  R   P++LLYSY RA  GFSA L+
Sbjct  5    TYIVHVSKSHKPRVFSSHHHWYSSVVESL-PRRRGEGPAKLLYSYDRAVRGFSAHLS  60



>gb|KCW53526.1| hypothetical protein EUGRSUZ_J02805 [Eucalyptus grandis]
Length=778

 Score = 65.5 bits (158),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 43/56 (77%), Gaps = 1/56 (2%)
 Frame = +2

Query  134  ETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYSYGRAANGFSARLT  301
            +TFI+  S S KP +FS+HHHWYSS++ ++ P S  PS++LY+Y  AA GFSARLT
Sbjct  39   QTFIIHASSSHKPSLFSSHHHWYSSLLHSLPP-SHPPSQILYTYRAAAAGFSARLT  93



>ref|XP_010033727.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
Length=829

 Score = 65.1 bits (157),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 43/56 (77%), Gaps = 1/56 (2%)
 Frame = +2

Query  134  ETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYSYGRAANGFSARLT  301
            +TFI+  S S KP +FS+HHHWYSS++ ++ P S  PS++LY+Y  AA GFSARLT
Sbjct  90   QTFIIHASSSHKPSLFSSHHHWYSSLLHSLPP-SHPPSQILYTYRAAAAGFSARLT  144



>emb|CDY33400.1| BnaA07g04390D [Brassica napus]
Length=751

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 55/88 (63%), Gaps = 11/88 (13%)
 Frame = +2

Query  47   MAVPSRVSSLLFIFLCFVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAIS  226
            MA P  + +L+F+FL +       S+E   T+IV V  S+KP  FSTHH WY+S +++IS
Sbjct  1    MASPITIITLIFLFLLY-------SAEAKRTYIVRVKHSDKPESFSTHHDWYTSQLQSIS  53

Query  227  --PLSRHPSE--LLYSYGRAANGFSARL  298
              P S+  SE  LLY+Y  + NGFSA L
Sbjct  54   TDPQSQSESESPLLYTYTTSFNGFSAFL  81



>ref|XP_007217156.1| hypothetical protein PRUPE_ppa001739mg [Prunus persica]
 gb|EMJ18355.1| hypothetical protein PRUPE_ppa001739mg [Prunus persica]
Length=772

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 44/56 (79%), Gaps = 2/56 (4%)
 Frame = +2

Query  134  ETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYSYGRAANGFSARLT  301
            +TFIV VSKS+KP +FS+H  WY+SII+ +   S HP++LLY+Y R+ +GFSA LT
Sbjct  32   KTFIVHVSKSQKPSLFSSHRSWYTSIIQNLP--SPHPTKLLYTYDRSVHGFSATLT  85



>ref|XP_008228179.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=810

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 44/56 (79%), Gaps = 2/56 (4%)
 Frame = +2

Query  134  ETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYSYGRAANGFSARLT  301
            +TFIV VSKS+KP +FS+H  WY+SII+ +   S HP++LLY+Y R+ +GFSA LT
Sbjct  70   KTFIVHVSKSQKPSLFSSHRSWYTSIIQNLP--SPHPTKLLYTYDRSVHGFSATLT  123



>ref|XP_010487192.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=786

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 43/56 (77%), Gaps = 1/56 (2%)
 Frame = +2

Query  140  FIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYSYGRAANGFSARLTPF  307
            +IV V  S KP +FS+H+HW+ S++R++ P S  P+ LLYSY RAA+GFSARL+P 
Sbjct  33   YIVHVQSSHKPSLFSSHNHWHVSLLRSL-PSSPQPATLLYSYSRAAHGFSARLSPL  87



>ref|XP_010501588.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=788

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 42/56 (75%), Gaps = 1/56 (2%)
 Frame = +2

Query  140  FIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYSYGRAANGFSARLTPF  307
            +IV V  S KP +FS+H+HW+ S++R++ P S  P  LLYSY RAA+GFSARL+P 
Sbjct  34   YIVHVQSSHKPSLFSSHNHWHVSLLRSL-PSSPQPPTLLYSYSRAAHGFSARLSPL  88



>ref|XP_009403290.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=773

 Score = 63.2 bits (152),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 43/66 (65%), Gaps = 2/66 (3%)
 Frame = +2

Query  107  TVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYSYGRAANGF  286
            T  V ++   T+IV +S S KP    +H HWY+  +R++    R P+ LLY+Y RAA+GF
Sbjct  24   TAQVDTDAQATYIVHLSPSRKPASSPSHAHWYARTLRSLP--GRQPARLLYAYSRAASGF  81

Query  287  SARLTP  304
            +ARLTP
Sbjct  82   AARLTP  87



>ref|XP_008462294.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Cucumis 
melo]
Length=770

 Score = 63.2 bits (152),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 51/59 (86%), Gaps = 1/59 (2%)
 Frame = +2

Query  125  EGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYSYGRAANGFSARLT  301
            E  ET+IV VSKSEKP +FS+HHHW+SSI+ ++SP S HP++LLY+Y RAANGFSAR+T
Sbjct  29   ETQETYIVHVSKSEKPSLFSSHHHWHSSILESLSP-SPHPTKLLYNYERAANGFSARIT  86



>gb|EYU44466.1| hypothetical protein MIMGU_mgv1a0020561mg, partial [Erythranthe 
guttata]
Length=293

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 42/71 (59%), Gaps = 4/71 (6%)
 Frame = +2

Query  92   CFVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYSYGR  271
            C VS   AV  E   T+IV ++KSE P  +  H HWY S +R++S      +E+LY+Y  
Sbjct  25   CHVSAAAAVEEERRGTYIVHMAKSEMPERYDDHTHWYESSLRSVS----GSAEMLYTYTN  80

Query  272  AANGFSARLTP  304
              +GFS RLTP
Sbjct  81   VVHGFSTRLTP  91



>ref|XP_006298979.1| hypothetical protein CARUB_v10015104mg [Capsella rubella]
 gb|EOA31877.1| hypothetical protein CARUB_v10015104mg [Capsella rubella]
Length=784

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 44/59 (75%), Gaps = 1/59 (2%)
 Frame = +2

Query  125  EGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYSYGRAANGFSARLT  301
            +G E++IV V  S KP +FS+H+HW+ S++R++ P S  P+ LLYSY R  +GFSARL+
Sbjct  34   DGLESYIVHVQSSHKPSLFSSHNHWHVSLLRSL-PSSPQPATLLYSYSRVLHGFSARLS  91



>ref|XP_011035735.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=774

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 42/57 (74%), Gaps = 1/57 (2%)
 Frame = +2

Query  134  ETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYSYGRAANGFSARLTP  304
            +TFI+ VSKS KP +F ++H WY+SII+++ P S  P+ +LY+Y  A +GFS  LTP
Sbjct  31   QTFIIHVSKSHKPSLFCSYHDWYTSIIQSLPP-SPQPARILYNYNHAIHGFSVHLTP  86



>ref|XP_007156742.1| hypothetical protein PHAVU_002G013500g [Phaseolus vulgaris]
 gb|ESW28736.1| hypothetical protein PHAVU_002G013500g [Phaseolus vulgaris]
Length=728

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 35/83 (42%), Positives = 54/83 (65%), Gaps = 6/83 (7%)
 Frame = +2

Query  59   SRVSSLLFIFLCFVSVTVAVSSEGWE--TFIVLVSKSEKPHVFSTHHHWYSSIIRAISPL  232
            S  + +LF  LC VS+  A +++  +  T+IV V+KSE P + + H  WY SI+++IS  
Sbjct  9    SATAFVLFFILCDVSLATAENTKDNQKSTYIVHVAKSEMPTILNHHSIWYRSILKSIS--  66

Query  233  SRHPSELLYSYGRAANGFSARLT  301
              + +E+LY+Y  A +GFSARLT
Sbjct  67   --NSAEILYTYDNAIHGFSARLT  87



>ref|XP_009416811.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=757

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 30/68 (44%), Positives = 45/68 (66%), Gaps = 4/68 (6%)
 Frame = +2

Query  101  SVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYSYGRAAN  280
            S T AV++    T+IV ++KS+ P  F+ H HWY + +R++S      +E+LY+Y   A+
Sbjct  19   SSTAAVAAAKKRTYIVHMAKSQMPPAFAEHRHWYDASLRSVS----DTAEILYAYDTVAH  74

Query  281  GFSARLTP  304
            GFSARLTP
Sbjct  75   GFSARLTP  82



>emb|CDP15538.1| unnamed protein product [Coffea canephora]
Length=764

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 51/80 (64%), Gaps = 1/80 (1%)
 Frame = +2

Query  65   VSSLLFIFLCFVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHP  244
            +S L+F+F     +  A S  G++T+IV VS+S KP   ++HH W+SSI+R +       
Sbjct  10   LSLLIFLFCIHARIIAASSHYGYKTYIVYVSESAKPPFNTSHHDWHSSILRNVY-YDLPK  68

Query  245  SELLYSYGRAANGFSARLTP  304
            ++LLYSY  A +GF+ARL P
Sbjct  69   TKLLYSYEHAIHGFAARLIP  88



>gb|ACN39811.1| unknown [Picea sitchensis]
Length=690

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 52/81 (64%), Gaps = 2/81 (2%)
 Frame = +2

Query  62   RVSSLLFIFLCFVSVTVAVSSEG-WETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSR  238
            +  S+L +  C  +V  A+S +G  +T++V ++KS+ P  F++H HWY+S ++++     
Sbjct  9    KCVSVLLVLGCLATVLAAISHDGVKKTYVVHMAKSQMPAGFTSHEHWYASAVKSVLSEEE  68

Query  239  HPSELLYSYGRAANGFSARLT  301
             PS +LY+Y  A +GF+ARL 
Sbjct  69   EPS-ILYNYDDAFHGFAARLN  88



>gb|KJB58524.1| hypothetical protein B456_009G213600 [Gossypium raimondii]
Length=734

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 32/81 (40%), Positives = 47/81 (58%), Gaps = 1/81 (1%)
 Frame = +2

Query  65   VSSLLFIFLCFVSVTVAVSS-EGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRH  241
            +S L F+      +   +S  E ++T+IV +  S+KP  F TH  W+ +I++++S     
Sbjct  8    ISILTFLLALLFGINNVLSKPEEYKTYIVYLDHSQKPSSFLTHETWHQTILKSLSKPVHG  67

Query  242  PSELLYSYGRAANGFSARLTP  304
               LLYSY  A NGFSARLTP
Sbjct  68   KEMLLYSYNHAMNGFSARLTP  88



>ref|XP_004252763.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=775

 Score = 60.8 bits (146),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 31/79 (39%), Positives = 50/79 (63%), Gaps = 1/79 (1%)
 Frame = +2

Query  65   VSSLLFIFLCFVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHP  244
            +++ + ++LCF+++    S    ET+I+ +  S  P  FS+HH WY S + +IS  S H 
Sbjct  27   MANYIALWLCFLAILFPFSMSKLETYIIHMDLSAMPIAFSSHHSWYLSTLASISDSSNHG  86

Query  245  SELLYSYGRAANGFSARLT  301
            S L+Y+Y  A +GFSARL+
Sbjct  87   S-LVYAYTNAIHGFSARLS  104



>ref|XP_010527146.1| PREDICTED: subtilisin-like protease [Tarenaya hassleriana]
Length=727

 Score = 60.5 bits (145),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 46/76 (61%), Gaps = 4/76 (5%)
 Frame = +2

Query  77   LFIFLCFVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELL  256
            L + L F  V+ A +  G  T+IV +++S+ P  F  H HWY S +R++S      +ELL
Sbjct  15   LVLHLGFCHVSSAPAGHGRATYIVHMARSQMPASFDRHSHWYDSSLRSVS----DSAELL  70

Query  257  YSYGRAANGFSARLTP  304
            Y+Y  A +GFS RLTP
Sbjct  71   YTYDNAIHGFSTRLTP  86



>ref|XP_008780900.1| PREDICTED: subtilisin-like protease [Phoenix dactylifera]
Length=769

 Score = 60.1 bits (144),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 43/64 (67%), Gaps = 4/64 (6%)
 Frame = +2

Query  110  VAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYSYGRAANGFS  289
            VAV  E  +T+IV ++KS +P  F+ H HWY + +R++S      +E+LYSY   A+GFS
Sbjct  25   VAVGEEKRQTYIVHMAKSRRPSTFAEHGHWYDASLRSVS----SSAEILYSYDTVAHGFS  80

Query  290  ARLT  301
            ARLT
Sbjct  81   ARLT  84



>gb|ABF70004.1| subtilisin-like serine proteinase, putative [Musa acuminata]
Length=757

 Score = 60.1 bits (144),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 47/74 (64%), Gaps = 6/74 (8%)
 Frame = +2

Query  83   IFLCFVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYS  262
            +  C  S T AV++    T+IV ++KS+ P  F+ H HWY + +R++S      +E+LY+
Sbjct  15   VICC--SSTAAVAAAKKRTYIVHMAKSQMPPAFAEHRHWYDASLRSVS----DTAEILYA  68

Query  263  YGRAANGFSARLTP  304
            Y   A+GFSARLTP
Sbjct  69   YDTVAHGFSARLTP  82



>gb|KDP40686.1| hypothetical protein JCGZ_24685 [Jatropha curcas]
Length=773

 Score = 60.1 bits (144),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 45/61 (74%), Gaps = 1/61 (2%)
 Frame = +2

Query  119  SSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYSYGRAANGFSARL  298
            SS+  +TFIV V KS KP +FS+HH WY+SIIR++   S   S++LY+Y RA NGFSA L
Sbjct  25   SSDRPQTFIVHVLKSHKPVLFSSHHDWYTSIIRSLP-SSSPSSKILYTYDRAINGFSAHL  83

Query  299  T  301
            T
Sbjct  84   T  84



>ref|XP_006583162.1| PREDICTED: subtilisin-like protease-like isoform X1 [Glycine 
max]
Length=817

 Score = 59.7 bits (143),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 42/56 (75%), Gaps = 1/56 (2%)
 Frame = +2

Query  137  TFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYSYGRAANGFSARLTP  304
            T+I+ V++S+KP +F++H  WYSSI+R++ P S  P+  LY+Y  AA GFS RL+P
Sbjct  71   TYIIHVAQSQKPSLFTSHKTWYSSILRSLPP-SSPPATPLYTYSSAAAGFSVRLSP  125



>emb|CDP02570.1| unnamed protein product [Coffea canephora]
Length=780

 Score = 59.7 bits (143),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 48/79 (61%), Gaps = 4/79 (5%)
 Frame = +2

Query  65   VSSLLFIFLCFVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHP  244
            V+ L+F+ +C VSV  +   +   T+IV V+KS+ P  F  H  WY S ++++S      
Sbjct  13   VTFLVFLGVCRVSVAASAVQQKKNTYIVHVAKSQMPASFDDHTRWYDSSLKSVS----ES  68

Query  245  SELLYSYGRAANGFSARLT  301
            +E+LY+Y  A +GF+ RLT
Sbjct  69   AEMLYTYNNAIHGFATRLT  87



>ref|XP_011099335.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=768

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 46/77 (60%), Gaps = 10/77 (13%)
 Frame = +2

Query  74   LLFIFLCFVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSEL  253
            +LF+ LC +S+          T+IV ++KSE P VF  H HWY S ++++S      +E+
Sbjct  16   VLFLALCQLSLAEK------RTYIVHMAKSEMPAVFQDHTHWYDSSLKSVS----DSAEM  65

Query  254  LYSYGRAANGFSARLTP  304
            LY+Y    +GFS RLTP
Sbjct  66   LYTYNNVIHGFSTRLTP  82



>emb|CDY18042.1| BnaC07g04280D [Brassica napus]
Length=737

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 54/88 (61%), Gaps = 12/88 (14%)
 Frame = +2

Query  47   MAVPSRVSSLLFIFLCFVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAIS  226
            MA P  ++ L+F+FL +       S+E   T+IV V  S+KP  FSTHH WY+  +++IS
Sbjct  1    MASPITIT-LIFLFLLY-------SAEAKRTYIVRVKHSDKPESFSTHHDWYTWQLQSIS  52

Query  227  --PLSRHPSE--LLYSYGRAANGFSARL  298
              P S+  SE  LLY+Y  + NGFSA L
Sbjct  53   TDPQSQTESESPLLYTYKTSFNGFSAFL  80



>gb|AAM10321.1| AT5g67360/K8K14_8 [Arabidopsis thaliana]
 gb|AAN46863.1| At5g67360/K8K14_8 [Arabidopsis thaliana]
Length=757

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 46/78 (59%), Gaps = 4/78 (5%)
 Frame = +2

Query  68   SSLLFIFLCFVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPS  247
            S+  F+ LC     V+ SS    T+IV ++KS+ P  F  H +WY S +R+IS      +
Sbjct  8    STAFFLLLCLGFCHVSSSSSDQGTYIVHMAKSQMPSSFDLHSNWYDSSLRSIS----DSA  63

Query  248  ELLYSYGRAANGFSARLT  301
            ELLY+Y  A +GFS RLT
Sbjct  64   ELLYTYENAIHGFSTRLT  81



>ref|NP_569048.1| subtilisin-like protease [Arabidopsis thaliana]
 sp|O65351.1|SBT17_ARATH RecName: Full=Subtilisin-like protease SBT1.7; AltName: Full=Cucumisin-like 
serine protease; AltName: Full=Subtilase subfamily 
1 member 7; Short=AtSBT1.7; AltName: Full=Subtilisin-like 
serine protease 1; Short=At-SLP1; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAK25995.1|AF360285_1 putative subtilisin serine protease ARA12 [Arabidopsis thaliana]
 gb|AAC18851.1| cucumisin-like serine protease [Arabidopsis thaliana]
 dbj|BAB09021.1| cucumisin-like serine protease [Arabidopsis thaliana]
 gb|AAN13181.1| putative subtilisin serine protease ARA12 [Arabidopsis thaliana]
 gb|AED98332.1| subtilisin-like protease [Arabidopsis thaliana]
 dbj|BAP16469.1| cucumisin-like serine protease [Cloning vector pTACAtg1]
Length=757

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 46/78 (59%), Gaps = 4/78 (5%)
 Frame = +2

Query  68   SSLLFIFLCFVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPS  247
            S+  F+ LC     V+ SS    T+IV ++KS+ P  F  H +WY S +R+IS      +
Sbjct  8    STAFFLLLCLGFCHVSSSSSDQGTYIVHMAKSQMPSSFDLHSNWYDSSLRSIS----DSA  63

Query  248  ELLYSYGRAANGFSARLT  301
            ELLY+Y  A +GFS RLT
Sbjct  64   ELLYTYENAIHGFSTRLT  81



>ref|XP_006342632.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=749

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 29/72 (40%), Positives = 43/72 (60%), Gaps = 1/72 (1%)
 Frame = +2

Query  89   LCFVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYSYG  268
             CF+++    +    ET+I+ +  S  P  FS+HH WY S + +IS  + H S L+Y+Y 
Sbjct  9    FCFLAILFPFTMSKSETYIIHMDLSAMPKAFSSHHSWYLSTLASISDSTNHGS-LVYAYT  67

Query  269  RAANGFSARLTP  304
             A +GFSA LTP
Sbjct  68   NAIHGFSASLTP  79



>ref|XP_010068558.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
Length=765

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 47/82 (57%), Gaps = 1/82 (1%)
 Frame = +2

Query  62   RVSSLLFIFLCFVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISP-LSR  238
            R + L  + L  V+  V   SE  +T+I+ +  S+KP  F TH  W+ + + +ISP LS 
Sbjct  14   RNAILWLLLLSTVTSFVMSESEERQTYIIHMDHSQKPASFPTHETWHRATVDSISPSLSD  73

Query  239  HPSELLYSYGRAANGFSARLTP  304
               + LYSY    +GFSARLTP
Sbjct  74   GEDKFLYSYNHVTHGFSARLTP  95



>gb|KCW63975.1| hypothetical protein EUGRSUZ_G01657, partial [Eucalyptus grandis]
Length=743

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 47/82 (57%), Gaps = 1/82 (1%)
 Frame = +2

Query  62   RVSSLLFIFLCFVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISP-LSR  238
            R + L  + L  V+  V   SE  +T+I+ +  S+KP  F TH  W+ + + +ISP LS 
Sbjct  9    RNAILWLLLLSTVTSFVMSESEERQTYIIHMDHSQKPASFPTHETWHRATVDSISPSLSD  68

Query  239  HPSELLYSYGRAANGFSARLTP  304
               + LYSY    +GFSARLTP
Sbjct  69   GEDKFLYSYNHVTHGFSARLTP  90



>emb|CAA59963.1| subtilisin-like protease [Arabidopsis thaliana]
Length=746

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 44/74 (59%), Gaps = 4/74 (5%)
 Frame = +2

Query  80   FIFLCFVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLY  259
            F+ LC     V+ SS    T+IV ++KS+ P  F  H +WY S +R+IS      +ELLY
Sbjct  3    FLLLCLGFCHVSSSSSDQGTYIVHMAKSQTPSSFDLHSNWYDSSLRSIS----DSAELLY  58

Query  260  SYGRAANGFSARLT  301
            +Y  A +GFS RLT
Sbjct  59   TYENAIHGFSTRLT  72



>gb|ABR17987.1| unknown [Picea sitchensis]
Length=772

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 49/80 (61%), Gaps = 3/80 (4%)
 Frame = +2

Query  71   SLLFIFLCFVSVTVAVSS---EGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRH  241
            +++F+ +  V  + A+++   E  +++IV + KS KP  FS H HWY+S+I  +S     
Sbjct  9    AIVFVIISLVLASEALATSDDEEIKSYIVYMDKSMKPDHFSLHQHWYASMIDRVSGSKSD  68

Query  242  PSELLYSYGRAANGFSARLT  301
            P+ +LY Y    +GFSA+LT
Sbjct  69   PAAMLYMYDTVMHGFSAKLT  88



>gb|EYU36340.1| hypothetical protein MIMGU_mgv1a001790mg [Erythranthe guttata]
Length=759

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 49/82 (60%), Gaps = 3/82 (4%)
 Frame = +2

Query  47   MAVPSRVSSLLFIFLCFVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAIS  226
            M +P   ++L+ + +  ++  V        T+IV V KS  P  FS+HHHWYSS+++++ 
Sbjct  1    MELPLMAAALILVSIFLLAGDVLAERS---TYIVHVDKSSMPKAFSSHHHWYSSMLKSVK  57

Query  227  PLSRHPSELLYSYGRAANGFSA  292
             +    S+++Y+Y  A +GFSA
Sbjct  58   SIDESESKIIYTYDNAFHGFSA  79



>ref|XP_009407416.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=769

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 44/71 (62%), Gaps = 4/71 (6%)
 Frame = +2

Query  92   CFVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYSYGR  271
            C  S  V  +     T+IV ++KS+ P  F+ H HWY + +R++S      +E++Y+Y  
Sbjct  19   CCSSTAVVAAVAKKRTYIVHMAKSQMPPAFAEHRHWYDASLRSVS----DAAEIIYAYDT  74

Query  272  AANGFSARLTP  304
            AA+GFSARL+P
Sbjct  75   AAHGFSARLSP  85



>ref|XP_002267740.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=762

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 52/90 (58%), Gaps = 4/90 (4%)
 Frame = +2

Query  47   MAVPSRVSSLLFIFLCFVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAIS  226
            MA  + +  L FI      +T   S++  +T+IV +  S  P  FS+HH W+S+I+ AIS
Sbjct  1    MASANDLKILCFIIFTISYLTSNYSAQSADTYIVHMDSSAMPKPFSSHHTWFSAIVSAIS  60

Query  227  PLSRHP----SELLYSYGRAANGFSARLTP  304
              S  P    ++L+YSY  + +GFSA LTP
Sbjct  61   DDSAPPPTTTNKLIYSYTSSIHGFSAILTP  90



>ref|XP_009102354.1| PREDICTED: subtilisin-like protease [Brassica rapa]
Length=763

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 52/90 (58%), Gaps = 13/90 (14%)
 Frame = +2

Query  47   MAVPSRVSSLLFIFLCFVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAIS  226
            MA P  + +L+F+FL +       S+E   T+IV V  S+KP  FSTHH WY+S +++IS
Sbjct  1    MASPITIITLIFLFLLY-------SAEAKRTYIVRVKHSDKPESFSTHHDWYTSQLQSIS  53

Query  227  P------LSRHPSELLYSYGRAANGFSARL  298
                    S   S LLY+Y  + NGFSA L
Sbjct  54   TDPQSQSQSESESPLLYTYTTSFNGFSAFL  83



>gb|ABR18065.1| unknown [Picea sitchensis]
Length=783

 Score = 57.4 bits (137),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = +2

Query  134  ETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYSYGRAANGFSARLT  301
            +++IV + KS KP  FS H HWY+S+I  +S  +  P+ +LY+Y    +GF+A+LT
Sbjct  43   QSYIVYMDKSMKPEHFSLHQHWYTSLIDEVSGSNSDPAAMLYTYDTVTHGFAAKLT  98



>gb|ACN40199.1| unknown [Picea sitchensis]
Length=766

 Score = 57.4 bits (137),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = +2

Query  134  ETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYSYGRAANGFSARLT  301
            +++IV + KS KP  FS H HWY+S+I  +S  +  P+ +LY+Y    +GF+A+LT
Sbjct  43   QSYIVYMDKSMKPEHFSLHQHWYTSLIDEVSGSNSDPAAMLYTYDTVTHGFAAKLT  98



>ref|XP_011010186.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=766

 Score = 57.0 bits (136),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 48/78 (62%), Gaps = 5/78 (6%)
 Frame = +2

Query  71   SLLFIFLCFVS-VTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPS  247
            S+L + +C VS  T+A + E   T+IV +SK E P  F  H HWY S ++++S      +
Sbjct  15   SILLLGVCHVSRATLATNKEKKATYIVHMSKPEMPASFEHHTHWYESSLKSVS----DSA  70

Query  248  ELLYSYGRAANGFSARLT  301
            ++LY+Y  A +GFS RLT
Sbjct  71   QMLYTYENAIHGFSTRLT  88



>ref|XP_007017194.1| Subtilisin-like serine endopeptidase family protein [Theobroma 
cacao]
 gb|EOY14419.1| Subtilisin-like serine endopeptidase family protein [Theobroma 
cacao]
Length=793

 Score = 57.0 bits (136),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 53/88 (60%), Gaps = 7/88 (8%)
 Frame = +2

Query  62   RVSSLLFIFLCFVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAI----SP  229
            +++ L  +FL FV  T+ V S    T+IV + KS  P +F++HH WYSS + ++    + 
Sbjct  9    QLNCLHSVFLTFVMFTLHVHSVSVNTYIVHMDKSFMPKIFASHHSWYSSTVDSLKSRNTA  68

Query  230  LSRHP---SELLYSYGRAANGFSARLTP  304
            LS +P     LLYSY   A+GFSA L+P
Sbjct  69   LSSNPRTSPTLLYSYDSGAHGFSAVLSP  96



>gb|EYU36337.1| hypothetical protein MIMGU_mgv1a020902mg, partial [Erythranthe 
guttata]
Length=734

 Score = 57.0 bits (136),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 37/55 (67%), Gaps = 0/55 (0%)
 Frame = +2

Query  137  TFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYSYGRAANGFSARLT  301
            T+IV + KS  P  FS+HHHWYSS++    PL    S+L+Y+Y  A +GFSA L+
Sbjct  4    TYIVHMDKSSMPKAFSSHHHWYSSMLSFGKPLDEPESKLIYTYDNAFHGFSAVLS  58



>gb|ADW11233.1| subtilisin-like protease 2 [Phaseolus vulgaris]
Length=810

 Score = 56.6 bits (135),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 59/97 (61%), Gaps = 12/97 (12%)
 Frame = +2

Query  35   LVTSMAVPSRVSSLLFI---FLCFV-SVTVAVS---SEGWETFIVLVSKSEKPHVFSTHH  193
            +  SM  P + SSL  I    L FV S+   +S   S+   T+IV V++S+KP  F THH
Sbjct  26   VADSMKAP-KASSLTLISSPILTFVYSLVPDLSHPPSDAPRTYIVHVAQSQKPR-FLTHH  83

Query  194  HWYSSIIRAISPLSRHPSELLYSYGRAANGFSARLTP  304
            +WY+SI+    P S HP+ LLY+  RAA GFS R+TP
Sbjct  84   NWYTSILHL--PPSSHPATLLYTT-RAAAGFSVRITP  117



>ref|XP_006383545.1| hypothetical protein POPTR_0005s18880g [Populus trichocarpa]
 gb|ERP61342.1| hypothetical protein POPTR_0005s18880g [Populus trichocarpa]
Length=766

 Score = 56.2 bits (134),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 48/78 (62%), Gaps = 5/78 (6%)
 Frame = +2

Query  71   SLLFIFLCFVS-VTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPS  247
            S+L + +C VS  T+A + E   T+IV +SK E P  F  H HWY S ++++S      +
Sbjct  15   SILLLGVCHVSRATLASNKEKKATYIVHMSKPEMPASFEHHTHWYESSLKSVS----DSA  70

Query  248  ELLYSYGRAANGFSARLT  301
            ++LY+Y  A +GFS RLT
Sbjct  71   QMLYTYENAIHGFSTRLT  88



>ref|XP_010547540.1| PREDICTED: subtilisin-like protease [Tarenaya hassleriana]
Length=764

 Score = 56.2 bits (134),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 47/80 (59%), Gaps = 7/80 (9%)
 Frame = +2

Query  74   LLFIFLCFVSVTVAVSSEGWE---TFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHP  244
            LL + L    V  A + +G +   T+IV +++S+ P  F  H HWY S +R++S      
Sbjct  11   LLVLHLGLYHVPSAATGDGRQRRATYIVHMARSQMPASFDHHSHWYDSSLRSVS----DS  66

Query  245  SELLYSYGRAANGFSARLTP  304
            +ELLY+Y  A +GFS RLTP
Sbjct  67   AELLYTYDNAIHGFSTRLTP  86



>ref|XP_004141887.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
 gb|KGN48584.1| hypothetical protein Csa_6G493920 [Cucumis sativus]
Length=761

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 48/76 (63%), Gaps = 7/76 (9%)
 Frame = +2

Query  77   LFIFLCFVSV-TVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSEL  253
            +F+ LCF SV ++AV  +  +T+IV ++K + P  F  H HWY S +R++S      +E+
Sbjct  7    MFLLLCFFSVPSMAVGDK--KTYIVHMAKYQMPESFEHHLHWYDSSLRSVS----DSAEM  60

Query  254  LYSYGRAANGFSARLT  301
            +Y+Y    +GFS RLT
Sbjct  61   IYAYNNVVHGFSTRLT  76



>ref|XP_004167070.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
Length=761

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 48/76 (63%), Gaps = 7/76 (9%)
 Frame = +2

Query  77   LFIFLCFVSV-TVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSEL  253
            +F+ LCF SV ++AV  +  +T+IV ++K + P  F  H HWY S +R++S      +E+
Sbjct  7    IFLLLCFFSVPSMAVGDK--KTYIVHMAKYQMPESFEHHLHWYDSSLRSVS----DSAEM  60

Query  254  LYSYGRAANGFSARLT  301
            +Y+Y    +GFS RLT
Sbjct  61   IYAYNNVVHGFSTRLT  76



>ref|XP_011017137.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=779

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/83 (29%), Positives = 45/83 (54%), Gaps = 4/83 (5%)
 Frame = +2

Query  56   PSRVSSLLFIFLCFVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLS  235
            P  ++++L +  C+      V  +  +TFI+ + KS  P  +  H  WY S ++++S   
Sbjct  17   PQLIATVLVLCFCYTYAIAEVKKQTKKTFIIQMDKSNMPATYYDHFQWYDSSLKSVS---  73

Query  236  RHPSELLYSYGRAANGFSARLTP  304
               +++LY+Y    +GFS +LTP
Sbjct  74   -ESADMLYTYNNIIHGFSTQLTP  95



>ref|XP_009770992.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
 gb|ABQ58080.1| subtilisin-like protease [Nicotiana tabacum]
Length=768

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 39/65 (60%), Gaps = 4/65 (6%)
 Frame = +2

Query  107  TVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYSYGRAANGF  286
            T+  SS    T+IV V+KS+ P  F  H HWY S ++++S      +E+LY Y    +GF
Sbjct  24   TIGSSSNKKSTYIVHVAKSQMPESFENHKHWYDSSLKSVS----DSAEMLYVYNNVVHGF  79

Query  287  SARLT  301
            SARLT
Sbjct  80   SARLT  84



>gb|AFS34694.1| subtilisin-like serine protease [Pisum sativum]
Length=793

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 35/95 (37%), Positives = 51/95 (54%), Gaps = 8/95 (8%)
 Frame = +2

Query  29   HRLVTSMAVPSR---VSSLLFIFLCFVSVTVAVSSEGWE-TFIVLVSKSEKPHVFSTHHH  196
             R + +M  P +   V   + + LC VS+  +  SE  + T+IV  +KS  P  F  H  
Sbjct  24   QRKLFNMKTPEKPLVVILFVIVILCDVSLARSEKSENKKITYIVHAAKSTMPSSFDHHSF  83

Query  197  WYSSIIRAISPLSRHPSELLYSYGRAANGFSARLT  301
            WY SI+ +IS      +E+LY+Y +A NGFS  LT
Sbjct  84   WYKSILNSIS----KSAEMLYTYDKAINGFSTSLT  114



>ref|XP_008220348.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=781

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 38/101 (38%), Positives = 56/101 (55%), Gaps = 5/101 (5%)
 Frame = +2

Query  14   TMSGAHRLVTSMAVPSRVSSLLFIFLCFVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHH  193
            ++S A RL+T       V S+L + L  ++   A ++E ++T+I+ +  S KP  F TH 
Sbjct  10   SISSAIRLITRKMGLYNVISILLLMLLQIT-NAASNAEEYQTYIIHMDHSHKPAYFLTHE  68

Query  194  HWY---SSIIRAISPLSRHPSE-LLYSYGRAANGFSARLTP  304
             W+      + + SP  R  SE LLYSY    +GFSARLTP
Sbjct  69   AWHRSTLKSLSSTSPADRDDSEMLLYSYSHVMHGFSARLTP  109



>ref|XP_010906269.1| PREDICTED: subtilisin-like protease [Elaeis guineensis]
Length=764

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 41/65 (63%), Gaps = 4/65 (6%)
 Frame = +2

Query  110  VAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYSYGRAANGFS  289
            VA + E   T+IV ++KS  P  F+ H HWY + +R++S      +E+LYSY   ++GFS
Sbjct  20   VAAAEEKRRTYIVHMAKSRMPATFTDHGHWYHASLRSVS----DSAEILYSYDTVSHGFS  75

Query  290  ARLTP  304
             RLTP
Sbjct  76   TRLTP  80



>gb|ABR16566.1| unknown [Picea sitchensis]
Length=522

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = +2

Query  134  ETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYSYGRAANGFSARLT  301
            +++I+ + KS  P  FS H HWYSS+I+ +S  +  P+ LLY+Y    +GF+A LT
Sbjct  35   QSYIIYMDKSMMPDHFSLHQHWYSSMIKEVSGSNSDPTALLYTYDTVTHGFAACLT  90



>ref|XP_010070627.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
 gb|KCW59522.1| hypothetical protein EUGRSUZ_H02274 [Eucalyptus grandis]
Length=768

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 39/55 (71%), Gaps = 4/55 (7%)
 Frame = +2

Query  137  TFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYSYGRAANGFSARLT  301
            T+IV V+KS+ P  F  H HWY SI++++S L    + ++YSY  AA+GF+ARLT
Sbjct  39   TYIVHVAKSQMPAAFQHHAHWYDSILKSVSGL----AHMVYSYDTAAHGFAARLT  89



>ref|XP_007012625.1| Subtilase family protein [Theobroma cacao]
 gb|EOY30244.1| Subtilase family protein [Theobroma cacao]
Length=759

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 36/57 (63%), Gaps = 3/57 (5%)
 Frame = +2

Query  134  ETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYSYGRAANGFSARLTP  304
            +T+IV +   +KP  F THH WYSS ++A   LS  P  LLYSY  A NGF+A L P
Sbjct  23   KTYIVHMKHHDKPLSFETHHDWYSSSLQA---LSAAPDSLLYSYTTAFNGFAASLDP  76



>ref|XP_006343203.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=770

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 42/71 (59%), Gaps = 8/71 (11%)
 Frame = +2

Query  92   CFVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYSYGR  271
            C  SV + + S     FI+ ++KS+ P  F  H HWY S +R++S      +E+LY Y  
Sbjct  26   CHFSVGMTMKSN----FIIHMAKSQMPEGFEDHTHWYDSSLRSVS----ASAEMLYVYNN  77

Query  272  AANGFSARLTP  304
            A +GF+ARLTP
Sbjct  78   AVHGFAARLTP  88



>ref|XP_008440346.1| PREDICTED: subtilisin-like protease [Cucumis melo]
Length=761

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 42/74 (57%), Gaps = 4/74 (5%)
 Frame = +2

Query  80   FIFLCFVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLY  259
            F+ LC  SV      +  +T+IV ++K + P  F  H HWY S +R++S      +E++Y
Sbjct  8    FLLLCLFSVPSMAVGDKKKTYIVHMAKYQMPESFEHHLHWYDSSLRSVS----DSAEMIY  63

Query  260  SYGRAANGFSARLT  301
            +Y    +GFS RLT
Sbjct  64   AYNNVVHGFSTRLT  77



>ref|XP_009613609.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
 gb|ABQ58079.1| subtilisin-like protease [Nicotiana tabacum]
Length=768

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 39/65 (60%), Gaps = 4/65 (6%)
 Frame = +2

Query  107  TVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYSYGRAANGF  286
            T+  +S    T+IV V+KS+ P  F  H HWY S ++++S      +E+LY Y    +GF
Sbjct  24   TIGSTSNKKSTYIVHVAKSQMPESFEDHKHWYDSSLKSVS----DSAEMLYVYNNVVHGF  79

Query  287  SARLT  301
            SARLT
Sbjct  80   SARLT  84



>ref|XP_002301156.2| hypothetical protein POPTR_0002s12130g [Populus trichocarpa]
 gb|EEE80429.2| hypothetical protein POPTR_0002s12130g [Populus trichocarpa]
Length=779

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 25/83 (30%), Positives = 45/83 (54%), Gaps = 4/83 (5%)
 Frame = +2

Query  56   PSRVSSLLFIFLCFVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLS  235
            P  +++LL +  C+      V  +  +TFI+ + KS  P  +  H  WY S ++++S   
Sbjct  17   PQLIATLLVLCFCYTYAVAEVKKQTKKTFIIQMDKSNMPANYYDHFQWYDSSLKSVS---  73

Query  236  RHPSELLYSYGRAANGFSARLTP  304
               +++LY+Y    +GFS +LTP
Sbjct  74   -ESADMLYTYNNIIHGFSTQLTP  95



>ref|XP_006393933.1| hypothetical protein EUTSA_v10003693mg [Eutrema salsugineum]
 gb|ESQ31219.1| hypothetical protein EUTSA_v10003693mg [Eutrema salsugineum]
Length=758

 Score = 53.9 bits (128),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 47/82 (57%), Gaps = 6/82 (7%)
 Frame = +2

Query  65   VSSLLFIFLCFVSVTVAVSSEGWE--TFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSR  238
            +SS  F FL  + +     S+G +  T+IV + KSE P  F  H  WY S +R++S    
Sbjct  6    LSSTAFFFLVLLYLGFFHVSDGAQQGTYIVHMEKSEMPSSFDLHSLWYDSSLRSVS----  61

Query  239  HPSELLYSYGRAANGFSARLTP  304
              +ELLY+Y  A +GFS RLTP
Sbjct  62   ESAELLYTYTNAIHGFSTRLTP  83



>ref|XP_006345404.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=782

 Score = 53.9 bits (128),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 53/92 (58%), Gaps = 11/92 (12%)
 Frame = +2

Query  47   MAVPSRVSSLLFIFLCFVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAIS  226
            M  P+  S L+F FL    + +A  S    T+IV + KS  P +F+THHHW+SS I +I 
Sbjct  1    MEWPNNYSFLVFFFLFAPLLCLAERS----TYIVHLDKSLMPKIFATHHHWHSSTIESIK  56

Query  227  PL------SRHPS-ELLYSYGRAANGFSARLT  301
             +      S HP+ +LLYSY    +GFSA L+
Sbjct  57   IITPASLNSHHPAPKLLYSYDNVFHGFSAVLS  88



>ref|XP_004512211.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=767

 Score = 53.9 bits (128),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 33/78 (42%), Positives = 49/78 (63%), Gaps = 7/78 (9%)
 Frame = +2

Query  77   LFIFL--CFVSVTVAVSSEGWE-TFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPS  247
            LF+ L  C +S+    +SE  + T+IV VSK   P +F+ H  WY SI+++IS    + +
Sbjct  12   LFVILVACDISLARTKNSENEKITYIVHVSKPRMPTIFNHHSIWYQSILKSIS----NSA  67

Query  248  ELLYSYGRAANGFSARLT  301
            E+LY+Y  A +GFSA LT
Sbjct  68   EMLYTYDNAIHGFSASLT  85



>ref|XP_007017192.1| Subtilisin-like serine protease 2, putative [Theobroma cacao]
 gb|EOY14417.1| Subtilisin-like serine protease 2, putative [Theobroma cacao]
Length=1160

 Score = 53.9 bits (128),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 26/60 (43%), Positives = 36/60 (60%), Gaps = 0/60 (0%)
 Frame = +2

Query  125  EGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYSYGRAANGFSARLTP  304
            E ++T+IV +  S KP  F TH  W+ + +R++S        LLYSY    +GFSARLTP
Sbjct  436  EKYKTYIVHMDHSRKPSSFLTHESWHRATLRSLSKPVDDKDMLLYSYNHVMHGFSARLTP  495



>emb|CDY22001.1| BnaC09g01070D [Brassica napus]
Length=734

 Score = 53.9 bits (128),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 44/77 (57%), Gaps = 9/77 (12%)
 Frame = +2

Query  74   LLFIFLCFVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSEL  253
            LL++  C +S     S     T+IV ++KS+ P  F  H  WY S +R++S      +EL
Sbjct  16   LLYLGACHISDGAQQS-----TYIVHMAKSQMPSSFDQHSLWYESSLRSVS----ESAEL  66

Query  254  LYSYGRAANGFSARLTP  304
            LY+Y  A +GFS RLTP
Sbjct  67   LYTYNSAIHGFSTRLTP  83



>gb|EYU36342.1| hypothetical protein MIMGU_mgv1a001789mg [Erythranthe guttata]
Length=759

 Score = 53.9 bits (128),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 47/81 (58%), Gaps = 3/81 (4%)
 Frame = +2

Query  47   MAVPSRVSSLLFIFLCFVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAIS  226
            M +P   ++L+ + +  ++  V+       T+IV + KS  P  FS+HHHWYSS++ +  
Sbjct  1    MELPLMAAALILVSIFLLAGDVSAERS---TYIVHMDKSSMPKAFSSHHHWYSSMLTSAK  57

Query  227  PLSRHPSELLYSYGRAANGFS  289
             L    S+++Y+Y  A +GFS
Sbjct  58   SLDESESKIIYTYDNAFHGFS  78



>emb|CDY63219.1| BnaAnng18730D [Brassica napus]
Length=743

 Score = 53.9 bits (128),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 44/77 (57%), Gaps = 9/77 (12%)
 Frame = +2

Query  74   LLFIFLCFVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSEL  253
            LL++  C +S     S     T+IV ++KS+ P  F  H  WY S +R++S      +EL
Sbjct  16   LLYLGACHISDGAQQS-----TYIVHMAKSQMPSSFDQHSLWYESSLRSVS----ESAEL  66

Query  254  LYSYGRAANGFSARLTP  304
            LY+Y  A +GFS RLTP
Sbjct  67   LYTYNSAIHGFSTRLTP  83



>ref|XP_007158029.1| hypothetical protein PHAVU_002G118200g [Phaseolus vulgaris]
 gb|ESW30023.1| hypothetical protein PHAVU_002G118200g [Phaseolus vulgaris]
Length=773

 Score = 53.5 bits (127),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 47/78 (60%), Gaps = 6/78 (8%)
 Frame = +2

Query  74   LLFIFLCFVSVTVAVSSEGWE--TFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPS  247
            +L +  C VS+         E  T+IV V+KSE P +F+ H  WY+SI+ ++S       
Sbjct  14   VLLLVQCDVSLAKEEKRTNNEKSTYIVHVAKSEMPTIFNHHAIWYNSILTSVS----KSQ  69

Query  248  ELLYSYGRAANGFSARLT  301
            E++Y+Y +A +GFSARLT
Sbjct  70   EMIYTYEKAIHGFSARLT  87



>emb|CDY63302.1| BnaCnng41810D [Brassica napus]
Length=748

 Score = 53.5 bits (127),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 51/81 (63%), Gaps = 6/81 (7%)
 Frame = +2

Query  68   SSLLFIFLCFVSVTVAVSSEGWE--TFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRH  241
            S+ LF F+  ++++   +S+G +  T+IV ++KS+ P  F  H  WY S +R++S     
Sbjct  6    STALFFFIVLLNLSSFHASDGAQQATYIVHMAKSQMPSSFDHHSLWYDSSLRSVS----E  61

Query  242  PSELLYSYGRAANGFSARLTP  304
             +E++Y+Y  A +GF+ RLTP
Sbjct  62   SAEMIYTYNNAIHGFATRLTP  82



>gb|KJB08038.1| hypothetical protein B456_001G060600 [Gossypium raimondii]
Length=752

 Score = 53.5 bits (127),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 31/82 (38%), Positives = 47/82 (57%), Gaps = 3/82 (4%)
 Frame = +2

Query  59   SRVSSLLFIFLCFVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSR  238
            S + S L + L  ++  +    E ++T+IV +  S KP  F TH  W+ +I+R++S   +
Sbjct  7    SLIVSFLLVLLLGINNAMP-EHEEYKTYIVHIDHSLKPSSFLTHETWHRAILRSLSKSDK  65

Query  239  HPSELLYSYGRAANGFSARLTP  304
                LLYSY    +GFSARLTP
Sbjct  66   E--MLLYSYNHVMHGFSARLTP  85



>ref|XP_003538797.2| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=770

 Score = 53.5 bits (127),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 29/76 (38%), Positives = 46/76 (61%), Gaps = 6/76 (8%)
 Frame = +2

Query  74   LLFIFLCFVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSEL  253
            +LF+ LC   V++A       T+IV ++KS+ P  F+ H  WY SI+++IS    + +E+
Sbjct  17   VLFMILC--DVSLATKDNQKNTYIVHMAKSKMPASFNHHSVWYKSIMKSIS----NSTEM  70

Query  254  LYSYGRAANGFSARLT  301
            LY+Y    +G S RLT
Sbjct  71   LYTYDNTIHGLSTRLT  86



>ref|XP_010542387.1| PREDICTED: subtilisin-like protease [Tarenaya hassleriana]
Length=781

 Score = 53.5 bits (127),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 51/71 (72%), Gaps = 2/71 (3%)
 Frame = +2

Query  92   CFVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYSYGR  271
            C  S T + S     TFIV VS+S+KP +FS+HHHW+SSI+R++ P  R P+ L+YSY R
Sbjct  21   CLFSATSS-SDASQATFIVHVSRSQKPSLFSSHHHWHSSILRSLPPSPR-PATLIYSYSR  78

Query  272  AANGFSARLTP  304
            A NGFSA L+P
Sbjct  79   AVNGFSAVLSP  89



>ref|XP_009758000.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=773

 Score = 53.1 bits (126),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 45/76 (59%), Gaps = 9/76 (12%)
 Frame = +2

Query  80   FIFLCFVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHH-HWYSSIIRAISPLSRHPSELL  256
             +F C +SV +       +T+I+ ++KS+ P  F+  H HWY S +R++S      +E+L
Sbjct  22   LLFRCHMSVAMVKK----KTYIIHMAKSQMPATFNDDHTHWYDSSLRSVS----DSAEML  73

Query  257  YSYGRAANGFSARLTP  304
            Y Y    +GFSARLTP
Sbjct  74   YVYNNVIHGFSARLTP  89



>ref|XP_008792659.1| PREDICTED: subtilisin-like protease [Phoenix dactylifera]
Length=766

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 40/65 (62%), Gaps = 4/65 (6%)
 Frame = +2

Query  110  VAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYSYGRAANGFS  289
            +A + +   T+IV ++KS  P  F+ H HWY + +R++S       E+LYSY   A+GFS
Sbjct  25   MAAAEDKRRTYIVHMAKSRMPATFAEHGHWYDASVRSVS----DSVEILYSYNTVAHGFS  80

Query  290  ARLTP  304
            A LTP
Sbjct  81   AHLTP  85



>gb|KHG16003.1| Subtilisin-like protease [Gossypium arboreum]
Length=760

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 46/80 (58%), Gaps = 10/80 (13%)
 Frame = +2

Query  68   SSLLFIFLCFVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPS  247
            SS  F FL  ++VT        +T+IV +   +KP  F TH+ WY S +++   L+  P+
Sbjct  6    SSTFFFFLLCLTVTAK------KTYIVHMKHQDKPLSFETHNDWYRSSLQS---LTSTPA  56

Query  248  E-LLYSYGRAANGFSARLTP  304
            E LLYSY  A NGF+A L P
Sbjct  57   ESLLYSYNAAFNGFAASLDP  76



>ref|XP_009599383.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=773

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 46/76 (61%), Gaps = 9/76 (12%)
 Frame = +2

Query  80   FIFLCFVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHH-HWYSSIIRAISPLSRHPSELL  256
             + LC +SV +    E  +T+I+ ++KS+ P  F+  H HWY S ++++S      +E+L
Sbjct  22   LLSLCRMSVAM----EEKKTYIIHMAKSQMPATFNDDHAHWYDSSLKSVS----DSAEML  73

Query  257  YSYGRAANGFSARLTP  304
            Y Y    +GFSARLTP
Sbjct  74   YVYNNVVHGFSARLTP  89



>ref|XP_008782639.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Phoenix 
dactylifera]
Length=772

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 40/62 (65%), Gaps = 6/62 (10%)
 Frame = +2

Query  125  EGWETFIVLVSKSEKPHVFSTHHHWYSSIIR--AISPLSRHPSELLYSYGRAANGFSARL  298
            +G  T+IV ++ + +P V  TH HWY + ++  AI P  RH   LLYSY  AANGF+ARL
Sbjct  31   QGNRTYIVYMNPAHRPAVHPTHAHWYRAHLQSLAIDP-DRH---LLYSYSAAANGFAARL  86

Query  299  TP  304
             P
Sbjct  87   LP  88



>gb|EYU36336.1| hypothetical protein MIMGU_mgv1a019012mg, partial [Erythranthe 
guttata]
Length=733

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 37/55 (67%), Gaps = 0/55 (0%)
 Frame = +2

Query  137  TFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYSYGRAANGFSARLT  301
            T+IV + K   P  FS+HHHWYSS++++   L    S+++Y+Y  A +GFSA L+
Sbjct  3    TYIVHMDKFSMPKAFSSHHHWYSSMLKSAKSLDEPESKIIYTYDNAFHGFSAVLS  57



>ref|XP_010464171.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=758

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 47/81 (58%), Gaps = 4/81 (5%)
 Frame = +2

Query  59   SRVSSLLFIFLCFVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSR  238
            S  ++  F+ LC     V+ SS    T+IV +++S+ P  F  H +WY S +R+IS    
Sbjct  6    SSSTTAFFLILCLGLRHVSSSSSEHGTYIVHMAQSQMPSSFDLHSNWYDSSLRSIS----  61

Query  239  HPSELLYSYGRAANGFSARLT  301
              +ELLY+Y  A +GF+ RLT
Sbjct  62   DSAELLYTYENAIHGFATRLT  82



>ref|XP_009357945.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=691

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 40/62 (65%), Gaps = 0/62 (0%)
 Frame = +2

Query  119  SSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYSYGRAANGFSARL  298
             ++G +TFIV V    KP +F THH WYSS + ++S  S  P  +L++Y    +GFSA+L
Sbjct  34   QNDGGKTFIVQVQPDSKPSIFPTHHDWYSSSLSSLSSSSSQPPTILHTYSTVFHGFSAKL  93

Query  299  TP  304
            +P
Sbjct  94   SP  95



>ref|XP_006487072.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
Length=775

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 46/78 (59%), Gaps = 3/78 (4%)
 Frame = +2

Query  74   LLFIFLCFVSVTVAVSSEG--WETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPS  247
            +L IFL FVS+  ++S  G   +T+I+ + KS  P  FSTHHHWY SI+ ++S       
Sbjct  11   ILSIFL-FVSLATSLSMSGNNRKTYIIHMDKSAMPAPFSTHHHWYMSILSSLSSPDGDAP  69

Query  248  ELLYSYGRAANGFSARLT  301
              LY+Y    +GFS  L+
Sbjct  70   THLYTYNHVMDGFSGVLS  87



>ref|XP_002865008.1| hypothetical protein ARALYDRAFT_496864 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41267.1| hypothetical protein ARALYDRAFT_496864 [Arabidopsis lyrata subsp. 
lyrata]
Length=753

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 44/71 (62%), Gaps = 6/71 (8%)
 Frame = +2

Query  89   LCFVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYSYG  268
            L F  V+ + S +G  T+IV ++KS+ P  F  H +WY S +R++S      +ELLY+Y 
Sbjct  13   LGFCHVSSSSSQQG--TYIVHMAKSQMPSTFDLHSNWYDSSLRSVS----DSAELLYTYE  66

Query  269  RAANGFSARLT  301
             A +GFS RLT
Sbjct  67   NAIHGFSTRLT  77



>gb|EYU45081.1| hypothetical protein MIMGU_mgv1a002217mg [Erythranthe guttata]
Length=700

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 47/79 (59%), Gaps = 5/79 (6%)
 Frame = +2

Query  80   FIFLCFVSVTVAVS---SEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISP--LSRHP  244
            ++FLCF  ++VA     S+ +ET+IV +  S  P  F++HH WY+S +  ++        
Sbjct  7    YVFLCFFFLSVASQQSISKAYETYIVHMDVSLMPKPFTSHHSWYTSSLATVADSSSPPSS  66

Query  245  SELLYSYGRAANGFSARLT  301
            S LLY+Y  A NGFSA L+
Sbjct  67   SRLLYTYSNAINGFSAILS  85



>ref|XP_002518750.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF43675.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=778

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 30/76 (39%), Positives = 42/76 (55%), Gaps = 0/76 (0%)
 Frame = +2

Query  74   LLFIFLCFVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSEL  253
            LL +FL F       +S G + +I+ + KS KP  FSTHH WY S + ++S    +    
Sbjct  10   LLTVFLLFTIAKSLPTSNGRKAYIIHMDKSAKPAAFSTHHEWYLSTLSSLSSSDGYSPAH  69

Query  254  LYSYGRAANGFSARLT  301
            LYSY    +GFSA L+
Sbjct  70   LYSYKHVMDGFSAVLS  85



>emb|CDP01316.1| unnamed protein product [Coffea canephora]
Length=759

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 51/85 (60%), Gaps = 8/85 (9%)
 Frame = +2

Query  62   RVSSLLFIFLCFVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSI---IRAISPL  232
            ++ S LF+F  F+   + ++S    T+IV + KS  P  F++H HWYSS    +++ SP 
Sbjct  6    KLISFLFMFATFL---LNLTSAERSTYIVHMDKSFMPKAFASHQHWYSSTLNSLKSTSPN  62

Query  233  S--RHPSELLYSYGRAANGFSARLT  301
            S  + P ELLY+Y    +GFSA L+
Sbjct  63   SDPQKPLELLYTYDNVFHGFSAVLS  87



>ref|XP_011029629.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=764

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 36/63 (57%), Gaps = 0/63 (0%)
 Frame = +2

Query  116  VSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYSYGRAANGFSAR  295
            + SE ++T+IV +  S KP  F TH  W+   +R++S  +      LYSY     GFSAR
Sbjct  31   LESEEYQTYIVHMDNSHKPATFLTHESWHRFTLRSLSNPADGEGTFLYSYSHVMQGFSAR  90

Query  296  LTP  304
            LTP
Sbjct  91   LTP  93



>ref|XP_010679580.1| PREDICTED: subtilisin-like protease [Beta vulgaris subsp. vulgaris]
Length=768

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 46/76 (61%), Gaps = 8/76 (11%)
 Frame = +2

Query  74   LLFIFLCFVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSEL  253
            ++F++LC VS     SS    T+IV ++KS+ P  F  H  WY S +R +S      +E+
Sbjct  14   VVFLYLCHVSS----SSPEKNTYIVHMAKSQMPATFDHHTKWYESSLRHVS----DTAEM  65

Query  254  LYSYGRAANGFSARLT  301
            +Y+Y  AA+G++ RLT
Sbjct  66   IYTYSNAAHGYATRLT  81



>ref|XP_009357900.1| PREDICTED: subtilisin-like protease isoform X2 [Pyrus x bretschneideri]
Length=797

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +2

Query  125  EGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYSYGRAANGFSARLTP  304
            +G +TFIV V    KP +F THH WYSS + ++S  S  P  +L++Y    +GFSA+L+P
Sbjct  37   DGGKTFIVQVQPDSKPSIFPTHHDWYSSSLSSLSSSSSQPPTILHTYSTVFHGFSAKLSP  96



>ref|XP_009357899.1| PREDICTED: subtilisin-like protease isoform X1 [Pyrus x bretschneideri]
Length=797

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +2

Query  125  EGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYSYGRAANGFSARLTP  304
            +G +TFIV V    KP +F THH WYSS + ++S  S  P  +L++Y    +GFSA+L+P
Sbjct  37   DGGKTFIVQVQPDSKPSIFPTHHDWYSSSLSSLSSSSSQPPTILHTYSTVFHGFSAKLSP  96



>ref|XP_004141706.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
 ref|XP_004155913.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
 gb|KGN45480.1| Subtilase family protein [Cucumis sativus]
Length=771

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 50/59 (85%), Gaps = 1/59 (2%)
 Frame = +2

Query  125  EGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYSYGRAANGFSARLT  301
            E  ET+IV VSKSEKP +FS+HHHW+SSI+ ++S  S HP++LLY+Y RAANGFSAR+T
Sbjct  29   ENQETYIVHVSKSEKPSLFSSHHHWHSSILESLS-SSPHPTKLLYNYERAANGFSARIT  86



>ref|XP_004249505.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=765

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 51/87 (59%), Gaps = 7/87 (8%)
 Frame = +2

Query  62   RVSSLLFIFLCFVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAI---SPL  232
            RV  LLF +  F +  +  +S    T+IV + KS  P +F+TH +W+SSII  I   +P 
Sbjct  3    RVPKLLFSWFLFSTSLLLGTSAERSTYIVHLDKSFMPKIFATHQNWHSSIIDTIKIEAPT  62

Query  233  SR---HP-SELLYSYGRAANGFSARLT  301
            ++   HP  +LLYSY    +GFSA L+
Sbjct  63   TQNDYHPLPKLLYSYDNVIHGFSAVLS  89



>ref|XP_009141044.1| PREDICTED: subtilisin-like protease [Brassica rapa]
Length=757

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 45/77 (58%), Gaps = 9/77 (12%)
 Frame = +2

Query  74   LLFIFLCFVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSEL  253
            LL++  C VS     +     T+IV ++KS+ P  F  H  WY+S ++++S      +EL
Sbjct  16   LLYLGSCHVS-----NGAQQATYIVHMAKSQMPSSFDLHSLWYASSLKSVS----ESAEL  66

Query  254  LYSYGRAANGFSARLTP  304
            LY+Y  A +GFS RLTP
Sbjct  67   LYTYNNAIHGFSTRLTP  83



>emb|CDY29697.1| BnaA04g17300D [Brassica napus]
Length=747

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 45/77 (58%), Gaps = 9/77 (12%)
 Frame = +2

Query  74   LLFIFLCFVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSEL  253
            LL++  C VS     +     T+IV ++KS+ P  F  H  WY+S ++++S      +EL
Sbjct  16   LLYLGSCHVS-----NGAQQATYIVHMAKSQMPSSFDLHSLWYASSLKSVS----ESAEL  66

Query  254  LYSYGRAANGFSARLTP  304
            LY+Y  A +GFS RLTP
Sbjct  67   LYTYNNAIHGFSTRLTP  83



>ref|XP_006847079.1| hypothetical protein AMTR_s00017p00212440 [Amborella trichopoda]
 gb|ERN08660.1| hypothetical protein AMTR_s00017p00212440 [Amborella trichopoda]
Length=762

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 40/78 (51%), Gaps = 0/78 (0%)
 Frame = +2

Query  68   SSLLFIFLCFVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPS  247
            S LLF  +    VT + + + +  +IV +  S  P  FSTH HWY S++ +I      P 
Sbjct  3    SKLLFFLVITGFVTSSATDDVYMPYIVHMDTSAMPATFSTHEHWYESLVSSIGSSRGKPP  62

Query  248  ELLYSYGRAANGFSARLT  301
             LLY Y     GFSA L+
Sbjct  63   RLLYVYRHVIKGFSAMLS  80



>gb|AES61117.2| subtilisin-like serine protease [Medicago truncatula]
Length=766

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 50/85 (59%), Gaps = 7/85 (8%)
 Frame = +2

Query  71   SLLFIFLC---FVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSR-  238
            SL  +FL    F+ + +    E   T+IV + KS  P VF++HH+WY S + + +  S  
Sbjct  8    SLPLVFLIITPFLLLPLHAKDETSSTYIVHMDKSLMPQVFTSHHNWYESTLHSTTTQSDD  67

Query  239  --HPS-ELLYSYGRAANGFSARLTP  304
              HPS +L+Y+Y  A +GFSA L+P
Sbjct  68   HVHPSKKLVYTYNHAMHGFSAVLSP  92



>ref|XP_003590866.1| Subtilisin-like protease [Medicago truncatula]
Length=752

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 50/85 (59%), Gaps = 7/85 (8%)
 Frame = +2

Query  71   SLLFIFLC---FVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSR-  238
            SL  +FL    F+ + +    E   T+IV + KS  P VF++HH+WY S + + +  S  
Sbjct  8    SLPLVFLIITPFLLLPLHAKDETSSTYIVHMDKSLMPQVFTSHHNWYESTLHSTTTQSDD  67

Query  239  --HPS-ELLYSYGRAANGFSARLTP  304
              HPS +L+Y+Y  A +GFSA L+P
Sbjct  68   HVHPSKKLVYTYNHAMHGFSAVLSP  92



>ref|XP_006280051.1| hypothetical protein CARUB_v10025930mg [Capsella rubella]
 gb|EOA12949.1| hypothetical protein CARUB_v10025930mg [Capsella rubella]
Length=764

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 40/64 (63%), Gaps = 4/64 (6%)
 Frame = +2

Query  110  VAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYSYGRAANGFS  289
            V+ SS    T+IV ++KS+ P  F  H +WY S +R+IS      +ELLY+Y  A +GFS
Sbjct  29   VSSSSSEQGTYIVHMAKSQMPSTFDLHSNWYDSSLRSIS----DSAELLYTYENAIHGFS  84

Query  290  ARLT  301
             RLT
Sbjct  85   TRLT  88



>ref|XP_006374912.1| hypothetical protein POPTR_0014s02640g [Populus trichocarpa]
 gb|ERP52709.1| hypothetical protein POPTR_0014s02640g [Populus trichocarpa]
Length=760

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 36/63 (57%), Gaps = 0/63 (0%)
 Frame = +2

Query  116  VSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYSYGRAANGFSAR  295
            + SE ++T+IV +  S KP  F TH  W+   +R++S  +      LYSY     GFSAR
Sbjct  27   LKSEEYQTYIVHMDSSHKPATFLTHESWHRFTLRSLSNPADGEGTFLYSYSHVMQGFSAR  86

Query  296  LTP  304
            LTP
Sbjct  87   LTP  89



>ref|XP_006422995.1| hypothetical protein CICLE_v10030049mg [Citrus clementina]
 gb|ESR36235.1| hypothetical protein CICLE_v10030049mg [Citrus clementina]
Length=712

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 29/77 (38%), Positives = 41/77 (53%), Gaps = 1/77 (1%)
 Frame = +2

Query  74   LLFIFLCFV-SVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSE  250
            ++   LC V S T A      +T+IV + K+  P  FSTHHHWY S + ++S        
Sbjct  1    MILSILCLVLSATSAYMPGDRKTYIVHMDKAAMPAPFSTHHHWYMSTLSSLSSPDGDAPT  60

Query  251  LLYSYGRAANGFSARLT  301
             LY+Y    +GFSA L+
Sbjct  61   HLYTYNHVVDGFSAVLS  77



>ref|XP_010939822.1| PREDICTED: subtilisin-like protease [Elaeis guineensis]
Length=769

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 41/65 (63%), Gaps = 4/65 (6%)
 Frame = +2

Query  110  VAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYSYGRAANGFS  289
            VA + E   T+IV ++KS  P  F+ H +WY + +R++S      +++LY Y   A+GFS
Sbjct  26   VAAAKEKRVTYIVHMAKSRMPATFTEHGNWYDASLRSVS----DSAKILYLYDTVAHGFS  81

Query  290  ARLTP  304
            ARLTP
Sbjct  82   ARLTP  86



>ref|XP_004234656.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=771

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 35/55 (64%), Gaps = 4/55 (7%)
 Frame = +2

Query  137  TFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYSYGRAANGFSARLT  301
             FIV ++KS+ P  F  H HWY S +R++S      +E+LY Y  A +GF+ARLT
Sbjct  38   NFIVHMAKSQMPESFEDHTHWYDSSLRSVS----GSAEMLYVYNNAVHGFAARLT  88



>ref|XP_011072681.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=792

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 44/84 (52%), Gaps = 8/84 (10%)
 Frame = +2

Query  74   LLFIFLCFVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIR--------AISP  229
             L I L   S +    +E  +TFI+ V    KP +F TH+HWY S +R        A SP
Sbjct  15   FLVISLLIFSPSPTQEAEQRKTFIIHVQHDAKPSIFPTHNHWYESSLRSLSTVSVNAASP  74

Query  230  LSRHPSELLYSYGRAANGFSARLT  301
             S   S +++SY    +GFSA+L+
Sbjct  75   DSADASRIIHSYNNVFHGFSAKLS  98



>emb|CDY12840.1| BnaC07g15930D [Brassica napus]
Length=760

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 46/77 (60%), Gaps = 5/77 (6%)
 Frame = +2

Query  77   LFIFLCFVSVTVAVSSEGWE-TFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSEL  253
             F+F+ ++  +  VS    + T+IV ++KS+ P  +  H  WY S +R++S      ++L
Sbjct  12   FFLFILYLLGSSQVSDGAQQATYIVHMAKSQMPSSYDLHSLWYDSSLRSVS----ESAQL  67

Query  254  LYSYGRAANGFSARLTP  304
            LY+Y  A +GFS RLTP
Sbjct  68   LYTYNNAIHGFSTRLTP  84



>gb|KJB82990.1| hypothetical protein B456_013G223900 [Gossypium raimondii]
Length=760

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 47/80 (59%), Gaps = 10/80 (13%)
 Frame = +2

Query  68   SSLLFIFLCFVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPS  247
            SS  F FL  ++VT        +T+IV +   +KP  F TH+ WYSS +++   L+  P+
Sbjct  6    SSTFFFFLLCLTVTAK------KTYIVHMKHQDKPLSFETHNDWYSSSLQS---LTATPA  56

Query  248  E-LLYSYGRAANGFSARLTP  304
            E LLYSY  A +GF+A L P
Sbjct  57   ESLLYSYNAAFHGFAASLDP  76



>ref|XP_009404128.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=767

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 37/56 (66%), Gaps = 4/56 (7%)
 Frame = +2

Query  137  TFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYSYGRAANGFSARLTP  304
            T+IV ++KS  P  F+ H HWY + +R++S      +E+LY Y   A+GFSARLTP
Sbjct  28   TYIVHMAKSRMPPSFAEHRHWYDASLRSVS----GSAEVLYFYDTVAHGFSARLTP  79



>ref|XP_010029506.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
Length=780

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 50/85 (59%), Gaps = 5/85 (6%)
 Frame = +2

Query  65   VSSLLFIFLCFV-----SVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISP  229
            +SSL FIFL  +     S + + S E  +TFIV V    KP VF TH HWY S + ++S 
Sbjct  3    LSSLFFIFLAILLPLSSSSSSSSSEEAAKTFIVQVQPDAKPSVFPTHAHWYDSTLSSLSS  62

Query  230  LSRHPSELLYSYGRAANGFSARLTP  304
             +   + +L++Y    +GFSA+L+P
Sbjct  63   SAGPTARVLHTYSTVFHGFSAKLSP  87



>ref|XP_004512212.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=757

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 44/78 (56%), Gaps = 7/78 (9%)
 Frame = +2

Query  77   LFIFLCFVSVTVAVSSEGWE---TFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPS  247
            LF+ LC   V++A + +      T+IV VSKS  P  F  H  WY SI+ +IS      +
Sbjct  12   LFVILCVCDVSLARTEKSENEKITYIVHVSKSIMPTSFDHHSIWYKSILTSIS----KSA  67

Query  248  ELLYSYGRAANGFSARLT  301
            E+LY+Y  A +GFS  LT
Sbjct  68   EILYTYDNAMHGFSTSLT  85



>ref|XP_003608462.1| Subtilisin-like protease [Medicago truncatula]
 gb|AES90659.1| subtilisin-like serine protease [Medicago truncatula]
Length=757

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/77 (38%), Positives = 45/77 (58%), Gaps = 10/77 (13%)
 Frame = +2

Query  74   LLFIFLCFVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSEL  253
            +LF+ LC  S ++        T+IV ++KSE P  F  H  WY S ++++S      +E+
Sbjct  15   VLFMGLCDASSSLK------STYIVHMAKSEMPESFEHHTLWYESSLQSVS----DSAEM  64

Query  254  LYSYGRAANGFSARLTP  304
            +Y+Y  A +GFS RLTP
Sbjct  65   MYTYENAIHGFSTRLTP  81



>ref|XP_004496012.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=761

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 45/76 (59%), Gaps = 1/76 (1%)
 Frame = +2

Query  74   LLFIFLCFVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSEL  253
            LL I   FV +++   +E   T+IV + KS  P VF+TH +WY S +++ +       +L
Sbjct  13   LLNIITPFVLLSLHAKAES-STYIVHMDKSLMPQVFTTHQNWYESTLQSTNSEVDQSKKL  71

Query  254  LYSYGRAANGFSARLT  301
            LY+Y  A +GFSA L+
Sbjct  72   LYTYNHAMHGFSAVLS  87



>ref|XP_002534008.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF28379.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=706

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 21/56 (38%), Positives = 34/56 (61%), Gaps = 0/56 (0%)
 Frame = +2

Query  137  TFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYSYGRAANGFSARLTP  304
            TFI+ V    KP +F+ H HWY S + ++S  +   S ++++Y    +GFSA L+P
Sbjct  26   TFIIKVQHDAKPSIFTLHKHWYQSFLSSLSETTPSSSRIIHTYENVFHGFSAMLSP  81



>ref|XP_002533167.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF29226.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=760

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 43/72 (60%), Gaps = 6/72 (8%)
 Frame = +2

Query  92   CFVSV--TVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYSY  265
            C+VS+  T+        T+IV +SKSE P  F  H HWY S ++++S      ++++Y+Y
Sbjct  16   CYVSIASTMEEKDGSKSTYIVHMSKSEMPASFQHHTHWYDSSLKSVS----DSAQMIYTY  71

Query  266  GRAANGFSARLT  301
              A +GFS RLT
Sbjct  72   ENAIHGFSTRLT  83



>gb|EYU36339.1| hypothetical protein MIMGU_mgv1a001782mg [Erythranthe guttata]
Length=760

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 41/72 (57%), Gaps = 5/72 (7%)
 Frame = +2

Query  74   LLFIFLCFVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSEL  253
            L+ IFL    V+   S     T+IV + KS  P  FS+HHHWYSS++ +   L     ++
Sbjct  13   LVSIFLLADDVSAERS-----TYIVHMDKSSMPKAFSSHHHWYSSMLNSAKSLDERGLKI  67

Query  254  LYSYGRAANGFS  289
            +Y+Y  A +GFS
Sbjct  68   IYTYDNAFHGFS  79



>gb|KJB70050.1| hypothetical protein B456_011G056000 [Gossypium raimondii]
Length=772

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 39/58 (67%), Gaps = 3/58 (5%)
 Frame = +2

Query  134  ETFIVLVSKSEKPHVFSTHHHWY-SSIIRAISPLSRHPSELLYSYGRAANGFSARLTP  304
            +TFIV V    KP +F+TH HWY SS+   +SP +  P+++L+ Y    +GFSA+L+P
Sbjct  24   KTFIVRVQNDAKPSIFTTHKHWYESSLASVLSPST--PAQVLHVYDTVFHGFSAKLSP  79



>gb|KCW56428.1| hypothetical protein EUGRSUZ_I02156 [Eucalyptus grandis]
Length=897

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 50/85 (59%), Gaps = 5/85 (6%)
 Frame = +2

Query  65   VSSLLFIFLCFV-----SVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISP  229
            +SSL FIFL  +     S + + S E  +TFIV V    KP VF TH HWY S + ++S 
Sbjct  120  LSSLFFIFLAILLPLSSSSSSSSSEEAAKTFIVQVQPDAKPSVFPTHAHWYDSTLSSLSS  179

Query  230  LSRHPSELLYSYGRAANGFSARLTP  304
             +   + +L++Y    +GFSA+L+P
Sbjct  180  SAGPTARVLHTYSTVFHGFSAKLSP  204



>emb|CAA59964.1| subtilisin-like protease [Alnus glutinosa]
Length=761

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 44/77 (57%), Gaps = 2/77 (3%)
 Frame = +2

Query  77   LFIFLCFVSVTVAVSSEGWE--TFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSE  250
            LF+F   + + +  SS   E  T+IV + KS  P  F++HH+WYSSI+  ++      S 
Sbjct  12   LFLFASCICLALHASSTSMEKSTYIVHMDKSHMPKAFTSHHNWYSSIVDCLNSEKPTTSS  71

Query  251  LLYSYGRAANGFSARLT  301
             +Y+Y    +GFSA L+
Sbjct  72   FVYTYNHVLHGFSASLS  88



>ref|XP_009604890.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=755

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 47/82 (57%), Gaps = 11/82 (13%)
 Frame = +2

Query  74   LLFIFLCFVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRH----  241
            LLF F+  +S+         ET+I+ +  S  P  F++HH+WY + + ++S  S +    
Sbjct  24   LLFFFISIISLAKP------ETYIIHMDLSAMPKAFASHHNWYLTTLASLSDSSTNHKEF  77

Query  242  -PSELLYSYGRAANGFSARLTP  304
              S+L+Y+Y  A NGFSA L+P
Sbjct  78   LSSKLVYAYTNAINGFSASLSP  99



>ref|XP_003516516.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=775

 Score = 51.2 bits (121),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 51/84 (61%), Gaps = 9/84 (11%)
 Frame = +2

Query  65   VSSLLFIFLCFVSVTVAV----SSEGWE-TFIVLVSKSEKPHVFSTHHHWYSSIIRAISP  229
            V++LL +F     V++A     S+E  + T+IV ++KSE P  F+ H  WY S++++ S 
Sbjct  9    VATLLVLFFILYDVSLATMENKSAENPKGTYIVHLAKSEMPSSFNQHSIWYKSVLKSAS-  67

Query  230  LSRHPSELLYSYGRAANGFSARLT  301
               + +E+LY+Y    +GFS RLT
Sbjct  68   ---NSAEMLYTYDNVIHGFSTRLT  88



>ref|XP_007131701.1| hypothetical protein PHAVU_011G034700g [Phaseolus vulgaris]
 gb|ESW03695.1| hypothetical protein PHAVU_011G034700g [Phaseolus vulgaris]
Length=775

 Score = 51.2 bits (121),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 47/91 (52%), Gaps = 10/91 (11%)
 Frame = +2

Query  32   RLVTSMAVPSRVSSLLFIFLCFVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSI  211
            + V  + +P    S++F F+ F SV   +S E  +TFI  V    KP VF TH+HWY+S 
Sbjct  3    KQVLKLNLPQFAFSIVFFFVLFHSV---ISDEASKTFIFRVDSQSKPSVFPTHYHWYTSE  59

Query  212  IRAISPLSRHPSELLYSYGRAANGFSARLTP  304
                       + +L+ Y    +GFSA LTP
Sbjct  60   F-------AQQTHILHVYNTVFHGFSALLTP  83



>ref|XP_010444660.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=759

 Score = 51.2 bits (121),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 47/79 (59%), Gaps = 5/79 (6%)
 Frame = +2

Query  68   SSLLFIFLCFVSVTVAVSSEGWE-TFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHP  244
            ++  F+ LC     V+ SS   + T+IV +++S+ P  F  H +WY S +R+IS      
Sbjct  9    TTAFFLILCLGLRHVSSSSSNEQGTYIVHMAQSQMPSSFDLHSNWYDSSLRSIS----DS  64

Query  245  SELLYSYGRAANGFSARLT  301
            +ELLY+Y  A +GF+ RLT
Sbjct  65   AELLYTYENAIHGFATRLT  83



>ref|XP_006466502.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
Length=762

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 45/76 (59%), Gaps = 5/76 (7%)
 Frame = +2

Query  77   LFIFLCFVSVTVAVSS-EGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSEL  253
            L + L F  V+VA  + +   T+I+ ++KSE P  F  H HWY S ++++S      +E+
Sbjct  10   LLLVLGFFDVSVAAQNPDQRATYIIHMAKSEMPASFEHHTHWYESSLKSVS----DSAEI  65

Query  254  LYSYGRAANGFSARLT  301
            LY+Y    +GFS +LT
Sbjct  66   LYTYDNVIHGFSTQLT  81



>gb|KDO79000.1| hypothetical protein CISIN_1g004301mg [Citrus sinensis]
Length=762

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 45/76 (59%), Gaps = 5/76 (7%)
 Frame = +2

Query  77   LFIFLCFVSVTVAVSS-EGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSEL  253
            L + L F  V+VA  + +   T+I+ ++KSE P  F  H HWY S ++++S      +E+
Sbjct  10   LLLVLGFFDVSVAAQNPDQRATYIIHMAKSEMPASFEHHTHWYESSLKSVS----DSAEI  65

Query  254  LYSYGRAANGFSARLT  301
            LY+Y    +GFS +LT
Sbjct  66   LYTYDNVIHGFSTQLT  81



>ref|XP_010540359.1| PREDICTED: subtilisin-like protease [Tarenaya hassleriana]
Length=768

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 41/76 (54%), Gaps = 6/76 (8%)
 Frame = +2

Query  77   LFIFLCFVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELL  256
            LF FL F+       +E  + +IV +  SE P  FS+ H WY S + +IS  S H    L
Sbjct  13   LFFFLVFI--CPFSRAEDDDVYIVHMDLSEMPKAFSSQHSWYMSTLASISSASDH----L  66

Query  257  YSYGRAANGFSARLTP  304
            Y+Y R   GFSA L+P
Sbjct  67   YTYNRVLRGFSAVLSP  82



>ref|XP_007017191.1| Subtilisin-like serine protease 2, putative [Theobroma cacao]
 gb|EOY14416.1| Subtilisin-like serine protease 2, putative [Theobroma cacao]
Length=761

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 38/59 (64%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  EGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYSYGRAANGFSARLT  301
            E ++T++V ++ S KP  FSTH  W+ S +R++S       +LLYSY    +GFSARLT
Sbjct  34   EEYKTYVVHMNHSHKPTSFSTHELWHRSTLRSLSNPVDDEEKLLYSYNHIIHGFSARLT  92



>gb|KDO84128.1| hypothetical protein CISIN_1g047470mg [Citrus sinensis]
Length=757

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = +2

Query  122  SEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYSYGRAANGFSARLT  301
            +E  +T+I+ +  S KP  F TH  W+ SI+++ S  +   + LLYSY     GFSARLT
Sbjct  33   NEDHQTYIIHMDHSHKPSAFLTHESWHLSILKSASYPADRNNMLLYSYNHVIQGFSARLT  92

Query  302  P  304
            P
Sbjct  93   P  93



>ref|XP_006434737.1| hypothetical protein CICLE_v10000364mg [Citrus clementina]
 gb|ESR47977.1| hypothetical protein CICLE_v10000364mg [Citrus clementina]
Length=765

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 11/70 (16%)
 Frame = +2

Query  119  SSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSE---------LLYSYGR  271
            SS+   T+IV + KS  P  F  HHHWYSS++ ++   S+ P++         L+YSY  
Sbjct  27   SSDERSTYIVHMDKSHMPKAFFNHHHWYSSVVHSLK--SKKPAKSNHHRFSPSLVYSYDN  84

Query  272  AANGFSARLT  301
            AA+GFSA L+
Sbjct  85   AAHGFSAVLS  94



>gb|KDO84129.1| hypothetical protein CISIN_1g004265mg [Citrus sinensis]
Length=765

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 11/70 (16%)
 Frame = +2

Query  119  SSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSE---------LLYSYGR  271
            SS+   T+IV + KS  P  F  HHHWYSS++ ++   S+ P++         L+YSY  
Sbjct  27   SSDERSTYIVHMDKSHMPKAFFNHHHWYSSVVHSLK--SKKPAKSNHHRFSPSLVYSYDN  84

Query  272  AANGFSARLT  301
            AA+GFSA L+
Sbjct  85   AAHGFSAVLS  94



>ref|XP_006434736.1| hypothetical protein CICLE_v10003898mg [Citrus clementina]
 gb|ESR47976.1| hypothetical protein CICLE_v10003898mg [Citrus clementina]
Length=757

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = +2

Query  122  SEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYSYGRAANGFSARLT  301
            +E  +T+I+ +  S KP  F TH  W+ SI+++ S  +   + LLYSY     GFSARLT
Sbjct  33   NEDHQTYIIHMDHSHKPSAFLTHESWHLSILKSASYPADRNNMLLYSYNHVIQGFSARLT  92

Query  302  P  304
            P
Sbjct  93   P  93



>ref|XP_009336065.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=771

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 37/56 (66%), Gaps = 4/56 (7%)
 Frame = +2

Query  137  TFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYSYGRAANGFSARLTP  304
            T+IV ++KS+ P  F  H HWY S ++++S      +E+LY+Y  A +GFS RLTP
Sbjct  40   TYIVHMAKSQMPASFEHHTHWYDSSLKSVS----DSAEMLYTYTSAIHGFSTRLTP  91



>ref|XP_004287970.1| PREDICTED: subtilisin-like protease [Fragaria vesca subsp. vesca]
Length=761

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 29/77 (38%), Positives = 42/77 (55%), Gaps = 4/77 (5%)
 Frame = +2

Query  74   LLFIFLCFVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSEL  253
            LL + L   S   A       T+IV ++KSE P  F  H HWY + +++ S      +E+
Sbjct  7    LLVVLLLGFSGYAAAEVSSRSTYIVHMAKSEMPASFQHHTHWYDASLKSAS----DSAEM  62

Query  254  LYSYGRAANGFSARLTP  304
            LY+Y  A +GFS +LTP
Sbjct  63   LYTYSNAIHGFSTQLTP  79



>ref|XP_007147252.1| hypothetical protein PHAVU_006G108700g [Phaseolus vulgaris]
 gb|ESW19246.1| hypothetical protein PHAVU_006G108700g [Phaseolus vulgaris]
Length=765

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = +2

Query  137  TFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYSYGRAANGFSARLTP  304
            T+IV + KS  P VF++H HWYSS + ++       S +LYSY  A +GFS  L+P
Sbjct  35   TYIVHMDKSYMPKVFTSHRHWYSSTLTSLDSTQHVNSSILYSYENALHGFSVALSP  90



>ref|XP_006473885.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
Length=757

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = +2

Query  122  SEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYSYGRAANGFSARLT  301
            +E  +T+I+ +  S KP  F TH  W+ SI+++ S  +   + LLYSY     GFSARLT
Sbjct  33   NEDHQTYIIHMDHSHKPSAFLTHESWHLSILKSASYPADRNNMLLYSYNHVIQGFSARLT  92

Query  302  P  304
            P
Sbjct  93   P  93



>ref|XP_007224572.1| hypothetical protein PRUPE_ppa1027224mg [Prunus persica]
 gb|EMJ25771.1| hypothetical protein PRUPE_ppa1027224mg [Prunus persica]
Length=760

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 33/84 (39%), Positives = 48/84 (57%), Gaps = 5/84 (6%)
 Frame = +2

Query  65   VSSLLFIFLCFVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWY---SSIIRAISPLS  235
            V S+L + L  ++   A ++E ++T+I+ +  S KP  F TH  W+      + + SP  
Sbjct  6    VISILLLMLLQIT-NAASNAEEYQTYIIHMDHSHKPAYFLTHEAWHRSTLKSLSSTSPAD  64

Query  236  RHPSE-LLYSYGRAANGFSARLTP  304
            R  SE LLYSY    +GFSARLTP
Sbjct  65   RDDSEMLLYSYSHVMHGFSARLTP  88



>gb|EYU28325.1| hypothetical protein MIMGU_mgv1a001748mg [Erythranthe guttata]
Length=765

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 47/77 (61%), Gaps = 5/77 (6%)
 Frame = +2

Query  74   LLFIFLCFVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSEL  253
            LL  +L  VS T A + +   T+IV +  ++KP  ++TH  WYS  +++++  S  P  L
Sbjct  16   LLHSWLPLVSATAAAAVK---TYIVHMKHNQKPASYATHTEWYSDHLQSLT--SAAPDSL  70

Query  254  LYSYGRAANGFSARLTP  304
            LY+Y  A +GF+A LTP
Sbjct  71   LYTYDAAYSGFAAALTP  87



>ref|XP_002282856.2| PREDICTED: subtilisin-like protease [Vitis vinifera]
 emb|CBI19500.3| unnamed protein product [Vitis vinifera]
Length=766

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 39/62 (63%), Gaps = 3/62 (5%)
 Frame = +2

Query  125  EGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAI--SPLSRHPSELLYSYGRAANGFSARL  298
            E  +T+I+ +  S KP  FSTH  W+ S ++++  SP++ H   LLYSY     GFSARL
Sbjct  35   EERQTYIIHMDHSYKPDSFSTHESWHLSTLKSVSTSPVN-HKEMLLYSYSHVMQGFSARL  93

Query  299  TP  304
            TP
Sbjct  94   TP  95



>emb|CAN60788.1| hypothetical protein VITISV_034534 [Vitis vinifera]
Length=766

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 39/62 (63%), Gaps = 3/62 (5%)
 Frame = +2

Query  125  EGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAI--SPLSRHPSELLYSYGRAANGFSARL  298
            E  +T+I+ +  S KP  FSTH  W+ S ++++  SP++ H   LLYSY     GFSARL
Sbjct  35   EERQTYIIHMDHSYKPDSFSTHESWHLSTLKSVSTSPVN-HKEMLLYSYSHVMQGFSARL  93

Query  299  TP  304
            TP
Sbjct  94   TP  95



>ref|XP_010446282.1| PREDICTED: uncharacterized protein LOC104729087 [Camelina sativa]
Length=825

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 41/74 (55%), Gaps = 8/74 (11%)
 Frame = +2

Query  80   FIFLCFVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLY  259
            F+ LC   V    SS    T+I  +++ + P  F  H +WY S +R+IS      +ELLY
Sbjct  13   FLLLCLCHV----SSSKQGTYIARIAQCQMPSSFDLHSNWYHSSLRSIS----DSTELLY  64

Query  260  SYGRAANGFSARLT  301
            +Y  A +GFS RLT
Sbjct  65   TYENAIHGFSTRLT  78



>ref|XP_009771086.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=772

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 48/82 (59%), Gaps = 11/82 (13%)
 Frame = +2

Query  74   LLFIFLCFVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRH----  241
            LLF F+  +S+  +      ET+I+ +  S  P  FS+HH+WY + + ++S  S +    
Sbjct  24   LLFFFISIISLAKS------ETYIIHMDFSAMPKAFSSHHNWYLTTLSSVSDSSTNYKDF  77

Query  242  -PSELLYSYGRAANGFSARLTP  304
              S+L+YSY  A +GFSA L+P
Sbjct  78   LSSKLVYSYTNAIHGFSASLSP  99



>ref|XP_011069659.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=754

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 29/84 (35%), Positives = 51/84 (61%), Gaps = 5/84 (6%)
 Frame = +2

Query  65   VSSLLFIFLCFVSVTVA---VSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLS  235
            + ++L + LCF+++TV     +S   +T+IV +  +  P  FS+H  WYS+ + ++S  +
Sbjct  3    ILNILCLCLCFLAITVPQLMSTSTDSDTYIVHMDLTAMPKAFSSHRTWYSTTLSSVSNSN  62

Query  236  RH--PSELLYSYGRAANGFSARLT  301
            +    S L+Y+Y  A NGFSA L+
Sbjct  63   KATTTSNLVYAYTTAINGFSAVLS  86



>ref|XP_006342631.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=755

 Score = 50.8 bits (120),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 27/77 (35%), Positives = 43/77 (56%), Gaps = 5/77 (6%)
 Frame = +2

Query  89   LCFVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSR-----HPSEL  253
            L F S+   ++    ET+I+ +  S  P  FS+HH WY S + ++S  S      + + L
Sbjct  9    LWFFSILFPITMSQSETYIIHMDLSAMPKAFSSHHSWYLSTLASVSDSSNLDYASNKNSL  68

Query  254  LYSYGRAANGFSARLTP  304
            +Y+Y  A +GFSA L+P
Sbjct  69   VYAYTNAIHGFSAILSP  85



>gb|KDP32042.1| hypothetical protein JCGZ_12503 [Jatropha curcas]
Length=742

 Score = 50.4 bits (119),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 37/57 (65%), Gaps = 4/57 (7%)
 Frame = +2

Query  134  ETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYSYGRAANGFSARLTP  304
            +T+IV ++KS+ P  F  H HWY S ++++S      +++LY Y  A +GFS RLTP
Sbjct  10   KTYIVHMAKSQMPASFEQHVHWYDSSLKSVS----GSAQMLYFYDNAIHGFSTRLTP  62



>emb|CBI19501.3| unnamed protein product [Vitis vinifera]
Length=1686

 Score = 50.8 bits (120),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 41/62 (66%), Gaps = 7/62 (11%)
 Frame = +2

Query  137   TFIVLVSKSEKPHVFSTHHHWYSSIIRAI---SPLS----RHPSELLYSYGRAANGFSAR  295
             T+I+ + KS  P VF+THHHWYSSI+ AI   +P +    +  + L+Y+Y  A +GFSA 
Sbjct  1210  TYIIHMDKSVMPKVFATHHHWYSSILHAIKTDTPTTSAGLQSTARLIYTYDHALHGFSAL  1269

Query  296   LT  301
             L+
Sbjct  1270  LS  1271



>ref|XP_002282841.2| PREDICTED: uncharacterized protein LOC100259061 [Vitis vinifera]
Length=1529

 Score = 50.8 bits (120),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 41/62 (66%), Gaps = 7/62 (11%)
 Frame = +2

Query  137  TFIVLVSKSEKPHVFSTHHHWYSSIIRAI---SPLS----RHPSELLYSYGRAANGFSAR  295
            T+I+ + KS  P VF+THHHWYSSI+ AI   +P +    +  + L+Y+Y  A +GFSA 
Sbjct  36   TYIIHMDKSVMPKVFATHHHWYSSILHAIKTDTPTTSAGLQSTARLIYTYDHALHGFSAL  95

Query  296  LT  301
            L+
Sbjct  96   LS  97



>ref|XP_003553808.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=768

 Score = 50.4 bits (119),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 44/78 (56%), Gaps = 5/78 (6%)
 Frame = +2

Query  71   SLLFIFLCFVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSE  250
            S + I L  +S+  A S E   T+IV V +  KP +F TH HWY S +     L+   + 
Sbjct  6    SRIMILLFLLSLGTA-SEEKKTTYIVQVQQEAKPSIFPTHRHWYQSSLA----LADSTAS  60

Query  251  LLYSYGRAANGFSARLTP  304
            +L++Y    +GFSARL+P
Sbjct  61   ILHTYQTVFHGFSARLSP  78



>ref|XP_007047459.1| Subtilase family protein [Theobroma cacao]
 gb|EOX91616.1| Subtilase family protein [Theobroma cacao]
Length=760

 Score = 50.4 bits (119),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 46/77 (60%), Gaps = 5/77 (6%)
 Frame = +2

Query  74   LLFIFLCFVSVTVAVSSEGW-ETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSE  250
            +LF+  C VS+   +  +   +T+IV ++KSE P  F  H HWY S ++++S      ++
Sbjct  10   VLFLGFCHVSLAAPLEKKNQRKTYIVHMAKSEMPASFLHHTHWYDSSLKSVS----DSAQ  65

Query  251  LLYSYGRAANGFSARLT  301
            +LY+Y    +GFS +LT
Sbjct  66   MLYTYDNVIHGFSTQLT  82



>ref|XP_003535388.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=769

 Score = 50.4 bits (119),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 39/63 (62%), Gaps = 7/63 (11%)
 Frame = +2

Query  137  TFIVLVSKSEKPHVFSTHHHWYSSIIRAIS-PLSRHPSE------LLYSYGRAANGFSAR  295
            T+IV + KS  P VF++HH WY S I +I+   +  PSE      L+Y+Y  A +GFSA 
Sbjct  34   TYIVHMDKSLMPQVFASHHDWYESTIHSINLATADDPSEQQQSQKLVYTYDDAMHGFSAV  93

Query  296  LTP  304
            L+P
Sbjct  94   LSP  96



>ref|XP_004142884.1| PREDICTED: subtilisin-like protease-like isoform 1 [Cucumis sativus]
 ref|XP_004172333.1| PREDICTED: subtilisin-like protease-like isoform 1 [Cucumis sativus]
 gb|KGN62460.1| Xylem serine proteinase 1 [Cucumis sativus]
Length=770

 Score = 50.4 bits (119),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 44/86 (51%), Gaps = 10/86 (12%)
 Frame = +2

Query  62   RVSSLLFIFL---CFVSVTVAVSSEGW---ETFIVLVSKSEKPHVFSTHHHWYSSIIRAI  223
            RVS    +FL   C  S T A  S      +T+I+ + K+  P  F  H  WY S ++++
Sbjct  5    RVSQWFLLFLISFCSCSFTEAQKSNQQLKKKTYIIHMDKTNMPQAFDDHFQWYDSSLKSV  64

Query  224  SPLSRHPSELLYSYGRAANGFSARLT  301
            S      +++LYSY    +GFS RLT
Sbjct  65   S----DSAQMLYSYNTVIHGFSTRLT  86



>ref|XP_004961962.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=762

 Score = 50.4 bits (119),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 43/75 (57%), Gaps = 5/75 (7%)
 Frame = +2

Query  77   LFIFLCFVSV-TVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSEL  253
            L   +C +++  V  +S   E++IV + KS  P  FS+H  WY S + A +P     +++
Sbjct  16   LLALVCLLAMLRVPAASAETESYIVHMDKSAMPRAFSSHQRWYESTLSAAAP----GADM  71

Query  254  LYSYGRAANGFSARL  298
             Y Y  AA+GF+ARL
Sbjct  72   YYVYDHAAHGFAARL  86



>ref|XP_003597117.1| Subtilisin-like protease [Medicago truncatula]
 ref|XP_003611631.1| Subtilisin-like protease [Medicago truncatula]
 gb|AES94589.1| subtilisin-like serine protease [Medicago truncatula]
Length=764

 Score = 50.4 bits (119),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 50/89 (56%), Gaps = 8/89 (9%)
 Frame = +2

Query  47   MAVPSR--VSSLLFIFL-CFVSVTVAVSSEGWE-TFIVLVSKSEKPHVFSTHHHWYSSII  214
            M  P +  V++  FI + C VS+     S+  + T+IV V+KS  P  F  H  WY SI+
Sbjct  1    MKTPMKSFVATFFFILVVCDVSLARTEKSQNDKITYIVHVAKSMMPTSFDHHSIWYKSIL  60

Query  215  RAISPLSRHPSELLYSYGRAANGFSARLT  301
            +++S    + +E+LY+Y    NGFS  LT
Sbjct  61   KSVS----NSAEMLYTYDNTINGFSTSLT  85



>emb|CDY43570.1| BnaC02g16670D [Brassica napus]
Length=196

 Score = 48.5 bits (114),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 35/56 (63%), Gaps = 4/56 (7%)
 Frame = +2

Query  137  TFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYSYGRAANGFSARLTP  304
            T+IV +++S+ P  F  H  WY S +R +S      ++LLY+Y  A +GFS RLTP
Sbjct  34   TYIVHMAQSQMPSGFDLHSLWYDSSLRTVS----QSAQLLYTYANAIHGFSTRLTP  85



>gb|KDO59723.1| hypothetical protein CISIN_1g046220mg [Citrus sinensis]
Length=774

 Score = 50.4 bits (119),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 29/77 (38%), Positives = 41/77 (53%), Gaps = 1/77 (1%)
 Frame = +2

Query  74   LLFIFLCFV-SVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSE  250
            ++   LC V S T A      +T+IV + K+  P  FSTHHHWY S + ++S        
Sbjct  10   MILSILCLVLSATSAYMPGDRKTYIVHMDKAAMPAPFSTHHHWYMSTLSSLSSPDGDAPT  69

Query  251  LLYSYGRAANGFSARLT  301
             LY+Y    +GFSA L+
Sbjct  70   HLYTYNHVVDGFSAVLS  86



>ref|XP_004496643.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=780

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 30/101 (30%), Positives = 56/101 (55%), Gaps = 15/101 (15%)
 Frame = +2

Query  29   HRLVTSMAVPSRVSSLLFIFLCFVSVTVAVSSEGW---ETFIVLVSKSEKPHVFSTHHHW  199
            H ++T M    ++S +L    CF+   + VSS      +T+I+ + KS KP++FS H  W
Sbjct  4    HLIITPM---EKMSCILT--FCFLLSFIVVSSNAEFVKKTYIIQMDKSAKPNIFSNHKEW  58

Query  200  YSSIIRAISPLS-------RHPSELLYSYGRAANGFSARLT  301
            YSS ++++  +S        +   ++Y+Y  A +G +A+L+
Sbjct  59   YSSKVKSVMSISLEAERDNNNEERIIYNYNTAFHGMAAKLS  99



>ref|XP_007143987.1| hypothetical protein PHAVU_007G119500g [Phaseolus vulgaris]
 gb|ESW15981.1| hypothetical protein PHAVU_007G119500g [Phaseolus vulgaris]
Length=763

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 37/61 (61%), Gaps = 6/61 (10%)
 Frame = +2

Query  137  TFIVLVSKSEKPHVFSTHHHWYSSIIRAI------SPLSRHPSELLYSYGRAANGFSARL  298
            T++V + K+  P VF+THH WY SII +I       P  +   +L+YSY  A +GFSA L
Sbjct  31   TYVVHMDKTLMPQVFATHHDWYQSIIHSIDLETADDPSKQQVLKLVYSYDDAMHGFSAVL  90

Query  299  T  301
            +
Sbjct  91   S  91



>ref|XP_003547873.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=776

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 45/78 (58%), Gaps = 5/78 (6%)
 Frame = +2

Query  74   LLFIFLCFVSVTVAVS-SEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSE  250
            ++  FL   +VT + S  E  +TFIV V    KP +F TH HWY S + +IS      + 
Sbjct  8    VILPFLLIATVTCSTSEKENSKTFIVQVHHQTKPSIFPTHKHWYDSSLSSISTT----AS  63

Query  251  LLYSYGRAANGFSARLTP  304
            ++++Y    +GFSA+L+P
Sbjct  64   VIHTYDTVFHGFSAKLSP  81



>gb|EYU36350.1| hypothetical protein MIMGU_mgv1a001799mg [Erythranthe guttata]
Length=757

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 48/87 (55%), Gaps = 12/87 (14%)
 Frame = +2

Query  65   VSSLLFIFLC--FVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLS-  235
            +  +  +FLC  F+S  +   S    ++IV + KS  P  F++HHHWYS  I ++   S 
Sbjct  6    IRQVCVVFLCTMFLSHVLGERS----SYIVHMDKSLMPKAFASHHHWYSFTINSLKKSSK  61

Query  236  -----RHPSELLYSYGRAANGFSARLT  301
                 R P EL+Y+Y  A +GFSA L+
Sbjct  62   SLHRHRKPLELVYTYDNAFHGFSAVLS  88



>gb|KHN40450.1| Subtilisin-like protease [Glycine soja]
Length=765

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 35/60 (58%), Gaps = 5/60 (8%)
 Frame = +2

Query  137  TFIVLVSKSEKPHVFSTHHHWYSSIIRAISPL-----SRHPSELLYSYGRAANGFSARLT  301
            T+IV + KS  PHVF+THH W+ S I +I        S    +L+YSY  A  GFSA LT
Sbjct  34   TYIVHMDKSLFPHVFTTHHDWFESTIDSIKSAKLGHSSNQSQKLVYSYNHAMYGFSAVLT  93



>emb|CDY18653.1| BnaA09g07420D [Brassica napus]
Length=717

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 46/79 (58%), Gaps = 11/79 (14%)
 Frame = +2

Query  74   LLFIFL--CFVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPS  247
            ++F++L  C VS     +     T+IV ++KS+ P  F  H  WY S +R++S      +
Sbjct  14   IVFLYLGSCHVS-----NGAQQATYIVHMAKSQMPSSFDQHSLWYDSSLRSVS----ESA  64

Query  248  ELLYSYGRAANGFSARLTP  304
            E++Y+Y  A +GF+ RLTP
Sbjct  65   EMIYTYNNAIHGFATRLTP  83



>ref|XP_003552427.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=764

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 35/60 (58%), Gaps = 5/60 (8%)
 Frame = +2

Query  137  TFIVLVSKSEKPHVFSTHHHWYSSIIRAISPL-----SRHPSELLYSYGRAANGFSARLT  301
            T+IV + KS  PHVF+THH W+ S I +I        S    +L+YSY  A  GFSA LT
Sbjct  34   TYIVHMDKSLFPHVFTTHHDWFESTIDSIKSAKLGHSSNQSQKLVYSYNHAMYGFSAVLT  93



>ref|XP_003605881.1| Subtilisin-like protease [Medicago truncatula]
 gb|KEH17073.1| subtilisin-like serine protease [Medicago truncatula]
Length=760

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 45/78 (58%), Gaps = 7/78 (9%)
 Frame = +2

Query  77   LFIFLCFVSVTVAVSSEGWE---TFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPS  247
            LF+ L    V++A + +      T+IV V+KS  P  F  H  WY SI++++S    + +
Sbjct  8    LFVILVVCDVSLARTEKNENEKITYIVHVAKSIMPTSFKHHSIWYKSILKSVS----NST  63

Query  248  ELLYSYGRAANGFSARLT  301
            ++LY+Y  A NGFS  LT
Sbjct  64   KMLYTYDNAINGFSTSLT  81



>ref|XP_003636375.1| Subtilisin-like protease [Medicago truncatula]
Length=742

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 45/78 (58%), Gaps = 7/78 (9%)
 Frame = +2

Query  77   LFIFLCFVSVTVAVSSEGWE---TFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPS  247
            LF+ L    V++A + +      T+IV V+KS  P  F  H  WY SI++++S    + +
Sbjct  8    LFVILVVCDVSLARTEKNENEKITYIVHVAKSIMPTSFKHHSIWYKSILKSVS----NST  63

Query  248  ELLYSYGRAANGFSARLT  301
            ++LY+Y  A NGFS  LT
Sbjct  64   KMLYTYDNAINGFSTSLT  81



>emb|CDY67452.1| BnaCnng55020D [Brassica napus]
Length=748

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/77 (38%), Positives = 45/77 (58%), Gaps = 5/77 (6%)
 Frame = +2

Query  74   LLFIFLCFVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSEL  253
             LF+ L   S  V+  ++   T+IV ++KS+ P  F  H  WY S +++IS      +E+
Sbjct  12   FLFVLLYIGSFHVSDGAQ-QGTYIVHMAKSQMPSSFDHHSLWYESSLKSIS----ESAEM  66

Query  254  LYSYGRAANGFSARLTP  304
            LY+Y  A +GF+ RLTP
Sbjct  67   LYTYNNAIHGFATRLTP  83



>gb|KJB27211.1| hypothetical protein B456_004G284900 [Gossypium raimondii]
Length=630

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 35/56 (63%), Gaps = 2/56 (4%)
 Frame = +2

Query  134  ETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYSYGRAANGFSARLT  301
            +T+IV +   +KP  F THH W+SS +++++     P  LLYSY  A NGF+A L 
Sbjct  27   KTYIVQMKHQDKPLSFETHHDWHSSSLQSLT--DSPPESLLYSYTEAFNGFAASLN  80



>ref|XP_009103426.1| PREDICTED: subtilisin-like protease [Brassica rapa]
Length=760

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 40/63 (63%), Gaps = 6/63 (10%)
 Frame = +2

Query  122  SEGWE--TFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYSYGRAANGFSAR  295
            S+G +  T+IV ++KS+ P  +  H  WY S +R++S      ++LLY+Y  A +GFS R
Sbjct  27   SDGAQQSTYIVHMAKSQMPSSYDLHSLWYDSSLRSVS----ESAQLLYTYNNAIHGFSTR  82

Query  296  LTP  304
            LTP
Sbjct  83   LTP  85



>gb|KHN12975.1| Subtilisin-like protease [Glycine soja]
Length=751

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 27/73 (37%), Positives = 43/73 (59%), Gaps = 6/73 (8%)
 Frame = +2

Query  83   IFLCFVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYS  262
            + LC   V++A       T+IV ++KS+ P  F+ H  WY SI+++IS    + +E+LY+
Sbjct  1    MILC--DVSLATKDNQKNTYIVHMAKSKMPASFNHHSVWYKSIMKSIS----NSTEMLYT  54

Query  263  YGRAANGFSARLT  301
            Y    +G S RLT
Sbjct  55   YDNTIHGLSTRLT  67



>ref|XP_003579757.1| PREDICTED: subtilisin-like protease [Brachypodium distachyon]
Length=775

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 43/78 (55%), Gaps = 3/78 (4%)
 Frame = +2

Query  71   SLLFIFLCFVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSE  250
            S+ F FL  V+ T A   +    +IV +  S  P  F+TH  WY+S++ ++      P E
Sbjct  10   SVSFFFL-LVAYTCAAGGD-RRPYIVQMDVSAMPAPFTTHEGWYTSVLSSLGNKEAAP-E  66

Query  251  LLYSYGRAANGFSARLTP  304
             LY+Y  A NGFSA LTP
Sbjct  67   HLYTYAHAMNGFSAVLTP  84



>emb|CDY57437.1| BnaAnng14520D [Brassica napus]
Length=760

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 40/63 (63%), Gaps = 6/63 (10%)
 Frame = +2

Query  122  SEGWE--TFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYSYGRAANGFSAR  295
            S+G +  T+IV ++KS+ P  +  H  WY S +R++S      ++LLY+Y  A +GFS R
Sbjct  27   SDGAQQATYIVHMAKSQMPSSYDLHSLWYDSSLRSVS----ESAQLLYTYNNAIHGFSTR  82

Query  296  LTP  304
            LTP
Sbjct  83   LTP  85



>ref|XP_009343011.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=764

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/87 (36%), Positives = 49/87 (56%), Gaps = 13/87 (15%)
 Frame = +2

Query  71   SLLFIFLCFVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPS-  247
            SL+ +FL  + V V+ +     T+IV + KS  P  +++H HWYSSI+ +    S +P+ 
Sbjct  14   SLVALFLLALQVNVSFADR--STYIVHMDKSLMPKSYTSHDHWYSSIVDSFK--SENPTS  69

Query  248  --------ELLYSYGRAANGFSARLTP  304
                     +LY+Y  A +GFSA L+P
Sbjct  70   FDGNKIWPSILYTYDNAFHGFSAVLSP  96



>ref|XP_006345494.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=754

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 53/95 (56%), Gaps = 13/95 (14%)
 Frame = +2

Query  47   MAVPSRVSSLL---FIFLCFVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIR  217
            MA+PS    LL   F+F  F  + V        T+IV + KS  P++F++HHHW+SS I 
Sbjct  1    MAMPSFPPLLLLSWFLFAHFFCLVVIAERS---TYIVHLDKSLMPNMFASHHHWHSSTIE  57

Query  218  AISPL------SRHP-SELLYSYGRAANGFSARLT  301
            +I  +      S HP  +LLYSY    +GFSA L+
Sbjct  58   SIKIVNPALLNSHHPVPKLLYSYDNVFHGFSAVLS  92



>ref|XP_011093838.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=743

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 37/56 (66%), Gaps = 2/56 (4%)
 Frame = +2

Query  134  ETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYSYGRAANGFSARLT  301
            +T+IV ++  +KP  ++TH  WYS  ++ ++  S  P  +LY+YG A NGF+A L+
Sbjct  27   KTYIVQMNHQQKPPSYATHGQWYSDHLQTLT--SAAPESILYTYGSAYNGFAAALS  80



>ref|XP_009337959.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Pyrus 
x bretschneideri]
Length=798

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 30/81 (37%), Positives = 43/81 (53%), Gaps = 11/81 (14%)
 Frame = +2

Query  89   LCFVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPS-------  247
            L FV  T  +      T+IV + KS  P  +S+H HWYSSI+ +    S +P+       
Sbjct  52   LTFVMYTXNIHLXNRSTYIVHMDKSLMPKSYSSHDHWYSSIVDSFK--SENPTSFDGNKI  109

Query  248  --ELLYSYGRAANGFSARLTP  304
               +LY+Y  A +GFSA L+P
Sbjct  110  LPSILYTYDTAFHGFSAVLSP  130



>ref|XP_007208070.1| hypothetical protein PRUPE_ppa001701mg [Prunus persica]
 gb|EMJ09269.1| hypothetical protein PRUPE_ppa001701mg [Prunus persica]
Length=777

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 35/56 (63%), Gaps = 4/56 (7%)
 Frame = +2

Query  137  TFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYSYGRAANGFSARLTP  304
            T+IV ++KSE P  F  H HWY S ++ +S      +E++Y Y  A +GFS +LTP
Sbjct  41   TYIVHMAKSEMPASFEHHTHWYDSSLKTVS----DSAEMMYIYSNAIHGFSTKLTP  92



>gb|EMS67510.1| Subtilisin-like protease [Triticum urartu]
Length=574

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/81 (31%), Positives = 45/81 (56%), Gaps = 7/81 (9%)
 Frame = +2

Query  77   LFIFLCFVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSE--  250
            L + L  +  +++  +   +T+IV ++ SEKP  F  HH WY+S ++++S       E  
Sbjct  13   LCMALVLLQASISACAGAPKTYIVQMAASEKPSSFDFHHEWYASTVKSVSSAQVEAEEED  72

Query  251  -----LLYSYGRAANGFSARL  298
                 ++Y+Y  A +GF+ARL
Sbjct  73   GAYARIVYNYETAFHGFAARL  93



>gb|KJB27210.1| hypothetical protein B456_004G284900 [Gossypium raimondii]
Length=762

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 35/56 (63%), Gaps = 2/56 (4%)
 Frame = +2

Query  134  ETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYSYGRAANGFSARLT  301
            +T+IV +   +KP  F THH W+SS +++++     P  LLYSY  A NGF+A L 
Sbjct  27   KTYIVQMKHQDKPLSFETHHDWHSSSLQSLT--DSPPESLLYSYTEAFNGFAASLN  80



>ref|XP_004231902.2| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=763

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 41/64 (64%), Gaps = 4/64 (6%)
 Frame = +2

Query  110  VAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYSYGRAANGFS  289
            ++V+ E  +T+I+ ++KS+ P  F  H HWY + ++++S      +E++Y Y    +GF+
Sbjct  29   MSVAMEEKKTYIIHMAKSQMPATFDDHTHWYDASLKSVS----ESAEMIYVYNNVIHGFA  84

Query  290  ARLT  301
            ARLT
Sbjct  85   ARLT  88



>emb|CDY55359.1| BnaCnng28690D [Brassica napus]
Length=704

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 36/56 (64%), Gaps = 4/56 (7%)
 Frame = +2

Query  137  TFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYSYGRAANGFSARLTP  304
            T+IV ++KS+ P  F  H  WY S +R++S      +E+LY+Y  A +GF+ RLTP
Sbjct  33   TYIVHMAKSQMPSSFDHHSLWYDSSLRSVS----ESAEMLYTYNNAIHGFATRLTP  84



>ref|XP_004142885.1| PREDICTED: subtilisin-like protease-like isoform 2 [Cucumis sativus]
 ref|XP_004172334.1| PREDICTED: subtilisin-like protease-like isoform 2 [Cucumis sativus]
Length=641

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 30/86 (35%), Positives = 44/86 (51%), Gaps = 10/86 (12%)
 Frame = +2

Query  62   RVSSLLFIFL---CFVSVTVAVSSEGW---ETFIVLVSKSEKPHVFSTHHHWYSSIIRAI  223
            RVS    +FL   C  S T A  S      +T+I+ + K+  P  F  H  WY S ++++
Sbjct  5    RVSQWFLLFLISFCSCSFTEAQKSNQQLKKKTYIIHMDKTNMPQAFDDHFQWYDSSLKSV  64

Query  224  SPLSRHPSELLYSYGRAANGFSARLT  301
            S      +++LYSY    +GFS RLT
Sbjct  65   S----DSAQMLYSYNTVIHGFSTRLT  86



>ref|XP_010273846.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=761

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 33/57 (58%), Gaps = 7/57 (12%)
 Frame = +2

Query  134  ETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYSYGRAANGFSARLTP  304
            +T+IV ++  +KP  F THH WY S       LS  PS L+YSY  A +GF+  L P
Sbjct  27   QTYIVHMNHQQKPTSFPTHHDWYQS-------LSTDPSSLIYSYNNAFHGFAISLDP  76



>ref|XP_004155899.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease-like 
[Cucumis sativus]
Length=776

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/76 (36%), Positives = 45/76 (59%), Gaps = 1/76 (1%)
 Frame = +2

Query  80   FIFLCFVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLY  259
            F+F   +  + + S +  ETFIV V K  KP +F TH +WY S + +IS ++     +++
Sbjct  9    FLFSLLIPFSSSSSIDASETFIVQVHKDSKPSIFPTHKNWYESSLASISSVN-DVGAIIH  67

Query  260  SYGRAANGFSARLTPF  307
            +Y    +GFSA+L+P 
Sbjct  68   TYETLFHGFSAKLSPL  83



>ref|XP_010105479.1| Subtilisin-like protease [Morus notabilis]
 gb|EXC04835.1| Subtilisin-like protease [Morus notabilis]
Length=776

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 35/55 (64%), Gaps = 4/55 (7%)
 Frame = +2

Query  137  TFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYSYGRAANGFSARLT  301
            T+I+ + KS KP VF  H +WY S ++++S      +E+LY+Y    +GFS R+T
Sbjct  37   TYIIHMDKSNKPAVFDDHVNWYDSSLKSVS----DSAEMLYTYDNVIHGFSTRIT  87



>emb|CBI27801.3| unnamed protein product [Vitis vinifera]
Length=703

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 51/87 (59%), Gaps = 8/87 (9%)
 Frame = +2

Query  44   SMAVPSRVSSLLFIFLCFVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAI  223
            S+A+ S V    F F CF S++V        T+IV ++  +KP  ++TH  WYS+ +++I
Sbjct  40   SVAMASVVWLFSFWFACF-SLSVMAK----RTYIVQMNHRQKPLSYATHDDWYSASLQSI  94

Query  224  SPLSRHPSELLYSYGRAANGFSARLTP  304
            S  S    +LLY+Y  A +GF+A L P
Sbjct  95   SSNS---DDLLYTYSTAYHGFAASLDP  118



>ref|XP_006849717.1| hypothetical protein AMTR_s00024p00243520 [Amborella trichopoda]
 gb|ERN11298.1| hypothetical protein AMTR_s00024p00243520 [Amborella trichopoda]
Length=780

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = +2

Query  140  FIVLVSKSEKPHVFSTHHHWYSSIIR-AISPLSRHPSELLYSYGRAANGFSARLTPF  307
            +IV +SK+  P VF+TH HWY+S ++  I   +   S LLY+Y  A +G++A L+P+
Sbjct  41   YIVRMSKAHMPPVFTTHDHWYASELQTTIDADANADSRLLYTYDSAFHGYAALLSPY  97



>ref|XP_011088593.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=791

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 35/58 (60%), Gaps = 7/58 (12%)
 Frame = +2

Query  134  ETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYSYGRAANGFSARLTPF  307
            +T+I+ V  S KP VF TH+HWY++   A       P+ +L+ Y    +GFSA LTPF
Sbjct  50   QTYIIRVDSSSKPSVFPTHYHWYTAEFTA-------PTTILHVYDTVFHGFSAVLTPF  100



>ref|XP_008462247.1| PREDICTED: subtilisin-like protease [Cucumis melo]
Length=777

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 37/58 (64%), Gaps = 1/58 (2%)
 Frame = +2

Query  134  ETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYSYGRAANGFSARLTPF  307
            +TFIV V K  KP +F TH HWY S + +IS ++     ++++Y    +GFSA+L+P 
Sbjct  28   KTFIVQVHKDSKPSIFPTHKHWYESSLASISSVNDG-GAIIHTYETLFHGFSAKLSPL  84



>emb|CDY44380.1| BnaA02g29970D [Brassica napus]
Length=688

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 40/63 (63%), Gaps = 6/63 (10%)
 Frame = +2

Query  122  SEGWE--TFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYSYGRAANGFSAR  295
            S+G +  T+IV +++S+ P  F  H  WY S +R++S      ++LLY+Y  A +GFS R
Sbjct  27   SDGAQHATYIVHMAQSQMPLGFDLHSLWYDSSLRSVS----QSAQLLYTYANAIHGFSTR  82

Query  296  LTP  304
            LTP
Sbjct  83   LTP  85



>ref|XP_009769989.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=771

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 55/89 (62%), Gaps = 9/89 (10%)
 Frame = +2

Query  59   SRVSSLLFI-FLCFVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAIS-PL  232
            +R+  L+F  FL  +S+ + +S++   T+IV + KS  P +F++H +W+SSII AI   +
Sbjct  3    TRLPPLMFSWFLLCLSLFLGISAQ-RSTYIVHLDKSFMPTIFASHQNWHSSIIDAIKIDV  61

Query  233  SRHPSE------LLYSYGRAANGFSARLT  301
            S  P++      LLYSY    +GFSA L+
Sbjct  62   STTPNDHHLTPKLLYSYDNVIHGFSAVLS  90



>ref|XP_004231903.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=754

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 37/56 (66%), Gaps = 4/56 (7%)
 Frame = +2

Query  134  ETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYSYGRAANGFSARLT  301
            +T+I+ ++KS+ P +F  H HWY + ++++S      +E++Y Y    +GF+ARLT
Sbjct  25   KTYIIHMAKSQMPAIFDDHTHWYDASLKSVS----ESAEMIYVYKNVVHGFAARLT  76



>ref|XP_008785920.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Phoenix 
dactylifera]
Length=764

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 35/60 (58%), Gaps = 3/60 (5%)
 Frame = +2

Query  137  TFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRH---PSELLYSYGRAANGFSARLTPF  307
            T+IV +  S  P  FS HH WY+S++ A +  S      S L+Y Y  A +GFSARL+P 
Sbjct  30   TYIVHMDLSAMPRAFSGHHSWYTSVVAAATATSDSISPTSNLIYVYDNAIHGFSARLSPL  89



>gb|KJB57084.1| hypothetical protein B456_009G147400 [Gossypium raimondii]
Length=772

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 26/57 (46%), Positives = 36/57 (63%), Gaps = 1/57 (2%)
 Frame = +2

Query  134  ETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYSYGRAANGFSARLTP  304
            +TFIV V    KP VF+TH HWY S + ++   S  P +LL+ Y    +GFSA+L+P
Sbjct  24   KTFIVRVQNEAKPSVFTTHKHWYESSLSSVLSPST-PIQLLHVYDSVFHGFSAKLSP  79



>ref|XP_002278292.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=761

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 45/75 (60%), Gaps = 8/75 (11%)
 Frame = +2

Query  80   FIFLCFVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLY  259
            F F CF S++V        T+IV ++  +KP  ++TH  WYS+ +++IS  S    +LLY
Sbjct  10   FWFACF-SLSVMAK----RTYIVQMNHRQKPLSYATHDDWYSASLQSISSNS---DDLLY  61

Query  260  SYGRAANGFSARLTP  304
            +Y  A +GF+A L P
Sbjct  62   TYSTAYHGFAASLDP  76



>ref|XP_009769987.1| PREDICTED: subtilisin-like protease isoform X1 [Nicotiana sylvestris]
 ref|XP_009769988.1| PREDICTED: subtilisin-like protease isoform X2 [Nicotiana sylvestris]
Length=765

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 52/84 (62%), Gaps = 9/84 (11%)
 Frame = +2

Query  74   LLFI-FLCFVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAI------SPL  232
            LLF  FL  +S+++ +S++   T+IV + KS  P +F++H +W+SSII  I      +P 
Sbjct  7    LLFSWFLLCLSLSLGISAQ-RSTYIVHLDKSFMPKIFASHQNWHSSIINNIKIEVPTTPN  65

Query  233  SRHP-SELLYSYGRAANGFSARLT  301
              HP  +++YSY    +GFSA L+
Sbjct  66   DHHPVPKIVYSYDNVIHGFSAVLS  89



>ref|XP_007155854.1| hypothetical protein PHAVU_003G237300g [Phaseolus vulgaris]
 gb|ESW27848.1| hypothetical protein PHAVU_003G237300g [Phaseolus vulgaris]
Length=794

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 37/56 (66%), Gaps = 4/56 (7%)
 Frame = +2

Query  137  TFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYSYGRAANGFSARLTP  304
            T+IV V+KSE P  F  H  WY S ++++S    + ++++Y+Y  A +G++ RLTP
Sbjct  67   TYIVHVAKSEMPQSFDHHAMWYESSLKSVS----NSAQMIYTYDNAIHGYATRLTP  118



>ref|XP_008238402.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=776

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 35/56 (63%), Gaps = 4/56 (7%)
 Frame = +2

Query  137  TFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYSYGRAANGFSARLTP  304
            T+IV ++KSE P  F  H HWY S ++ +S      +E++Y Y  A +GFS +LTP
Sbjct  40   TYIVHMAKSEMPASFEHHTHWYDSSLKTVS----DSAEMVYIYSNAIHGFSTKLTP  91



>ref|XP_002510119.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF52306.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=769

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 43/83 (52%), Gaps = 7/83 (8%)
 Frame = +2

Query  62   RVSSLLFIFLCFVSVTVAV---SSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPL  232
            R+  L+   LCF  + V     SS+   T+I+ + KS  P  F  H  WY S ++++S  
Sbjct  7    RLQLLVAALLCFCYMHVIAGVKSSQSKNTYIIHMDKSYMPASFDDHLQWYDSSLKSVS--  64

Query  233  SRHPSELLYSYGRAANGFSARLT  301
                +++LY Y    +GFS RLT
Sbjct  65   --ESADMLYDYNNVIHGFSTRLT  85



>ref|XP_010112177.1| Subtilisin-like protease [Morus notabilis]
 gb|EXC32843.1| Subtilisin-like protease [Morus notabilis]
Length=767

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 44/79 (56%), Gaps = 7/79 (9%)
 Frame = +2

Query  86   FLCFVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHP------S  247
            FL F++++  VS++  E +I+ +  S  P  F+ HH WYS+ +  +S            S
Sbjct  17   FLSFLALSRLVSAQ-TENYIIHMDLSTMPKAFANHHSWYSATLATLSKTVPKTISLDLSS  75

Query  248  ELLYSYGRAANGFSARLTP  304
            +L+YSY    NGFSA LTP
Sbjct  76   KLIYSYTHVINGFSASLTP  94



>emb|CBI36893.3| unnamed protein product [Vitis vinifera]
Length=755

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 43/78 (55%), Gaps = 4/78 (5%)
 Frame = +2

Query  68   SSLLFIFLCFVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPS  247
            S +L +FL F  V++  + E    FIV V    KP  FS   HWYSS +R++    R  S
Sbjct  35   SLVLIVFLSFSVVSIEANFERAHAFIVRVQNDLKPPEFSGVEHWYSSTLRSL----RLKS  90

Query  248  ELLYSYGRAANGFSARLT  301
            + ++ Y    +GFSA+LT
Sbjct  91   DFIHVYRTVFHGFSAKLT  108



>gb|KJB58523.1| hypothetical protein B456_009G213500 [Gossypium raimondii]
Length=759

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 38/58 (66%), Gaps = 2/58 (3%)
 Frame = +2

Query  134  ETFIVLVSKSEKPHVFSTHHHWYSSIIRAI--SPLSRHPSELLYSYGRAANGFSARLT  301
             T+IV + KS  P VF++HH WYSSI+ ++  + + +    L+YSY   A+GFSA L+
Sbjct  27   NTYIVHMDKSFMPKVFASHHSWYSSIVDSLKSTNIPQSSPSLIYSYDSGAHGFSAVLS  84



>emb|CDY18654.1| BnaA09g07410D [Brassica napus]
Length=745

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 41/74 (55%), Gaps = 4/74 (5%)
 Frame = +2

Query  83   IFLCFVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYS  262
            IFL ++S           T+IV ++KS+ P  F  H  WY S +++ S      +E+LY+
Sbjct  14   IFLLYLSSFHVSDGAQQSTYIVHMAKSQMPSSFDQHSLWYESSLKSAS----ESAEMLYT  69

Query  263  YGRAANGFSARLTP  304
            Y  A +GF+ RLTP
Sbjct  70   YNNAIHGFATRLTP  83



>ref|XP_006426043.1| hypothetical protein CICLE_v10024951mg [Citrus clementina]
 gb|ESR39283.1| hypothetical protein CICLE_v10024951mg [Citrus clementina]
Length=763

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 42/71 (59%), Gaps = 5/71 (7%)
 Frame = +2

Query  89   LCFVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYSYG  268
             C VSV  A + +   T+I+ ++KSE P  F  H HWY S ++++S      +E+LY+Y 
Sbjct  17   FCDVSV-AAQNPDQRATYIIHMAKSEMPASFEHHTHWYESSLKSVS----DSAEILYTYD  71

Query  269  RAANGFSARLT  301
               +GFS +LT
Sbjct  72   NVIHGFSTQLT  82



>ref|XP_004499011.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=769

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/76 (33%), Positives = 42/76 (55%), Gaps = 4/76 (5%)
 Frame = +2

Query  74   LLFIFLCFVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSEL  253
            LL +F    ++    S +   T+I+   KS  P  F+ H +W+ S ++++S      +E+
Sbjct  11   LLLLFCSRHTIAETKSPQTKNTYIIHTDKSTMPQTFTDHLNWFDSSLKSVS----ETAEI  66

Query  254  LYSYGRAANGFSARLT  301
            LY+Y   A+GFS RLT
Sbjct  67   LYTYKHVAHGFSTRLT  82



>ref|XP_009112375.1| PREDICTED: subtilisin-like protease isoform X2 [Brassica rapa]
Length=758

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 41/74 (55%), Gaps = 4/74 (5%)
 Frame = +2

Query  83   IFLCFVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYS  262
            IFL ++S           T+IV ++KS+ P  F  H  WY S +++ S      +E+LY+
Sbjct  14   IFLLYLSSFHVSDGAQQSTYIVHMAKSQMPSSFDQHSLWYESSLKSAS----ESAEMLYT  69

Query  263  YGRAANGFSARLTP  304
            Y  A +GF+ RLTP
Sbjct  70   YNNAIHGFATRLTP  83



>ref|XP_006339823.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=766

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 41/64 (64%), Gaps = 4/64 (6%)
 Frame = +2

Query  110  VAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYSYGRAANGFS  289
            ++V+ E  +T+I+ ++KS+ P  F  H HWY + ++++S      +E++Y Y    +GF+
Sbjct  30   MSVAMEEKKTYIIHMAKSQMPVTFDDHTHWYDASLKSVS----ESAEMIYVYKNVVHGFA  85

Query  290  ARLT  301
            ARLT
Sbjct  86   ARLT  89



>dbj|BAJ87780.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=778

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 45/82 (55%), Gaps = 8/82 (10%)
 Frame = +2

Query  77   LFIFLCFVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSE--  250
            L + L  +  +++  +   +T+IV ++ SEKP  F  HH WY+S ++++S       +  
Sbjct  13   LRLALVLLQASISACAGASQTYIVQMAASEKPSAFDFHHEWYASTVKSVSSAQVEAEQQE  72

Query  251  ------LLYSYGRAANGFSARL  298
                  ++Y+Y  A +GF+ARL
Sbjct  73   EDGYARIVYNYETAFHGFAARL  94



>ref|XP_004229661.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=769

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 39/62 (63%), Gaps = 7/62 (11%)
 Frame = +2

Query  137  TFIVLVSKSEKPHVFSTHHHWYSSIIRAISPL------SRHP-SELLYSYGRAANGFSAR  295
            T+IV + KS  P +F+THHHW+SS + +I  +      S HP  +LLYSY    +GFSA 
Sbjct  31   TYIVHLDKSLMPKIFATHHHWHSSTVESIKIVNPALLNSHHPVPKLLYSYDNVFHGFSAV  90

Query  296  LT  301
            L+
Sbjct  91   LS  92



>ref|XP_002277899.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=769

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 50/91 (55%), Gaps = 14/91 (15%)
 Frame = +2

Query  71   SLLFIFLCFVSVTVAVSS-----EGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLS  235
            SL    +CF + T+++ +     +  +T+IV +  S  P  FS HH WYSS++ ++S  S
Sbjct  6    SLSLKLVCFHAFTISLLASNHLGQSADTYIVHMDSSAMPKPFSGHHGWYSSMLSSVSDAS  65

Query  236  R------HPS---ELLYSYGRAANGFSARLT  301
                    PS   +L+Y+Y  + NGFSA LT
Sbjct  66   TPTGAAVTPSTTAKLIYTYSNSINGFSASLT  96



>ref|XP_010070634.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
 gb|KCW59525.1| hypothetical protein EUGRSUZ_H02279 [Eucalyptus grandis]
Length=767

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 40/71 (56%), Gaps = 5/71 (7%)
 Frame = +2

Query  92   CF-VSVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSELLYSYG  268
            CF   V      +   T+IV ++KS+ P  F  H HWY S ++++S      ++++YSY 
Sbjct  23   CFRADVDGNGQQQERRTYIVHMAKSQMPAAFQHHAHWYDSSLKSVS----GSAQMIYSYD  78

Query  269  RAANGFSARLT  301
               +GFSARLT
Sbjct  79   TVVHGFSARLT  89



>ref|XP_006396129.1| hypothetical protein EUTSA_v10002410mg [Eutrema salsugineum]
 gb|ESQ36908.1| hypothetical protein EUTSA_v10002410mg [Eutrema salsugineum]
Length=762

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 47/78 (60%), Gaps = 9/78 (12%)
 Frame = +2

Query  71   SLLFIFLCFVSVTVAVSSEGWETFIVLVSKSEKPHVFSTHHHWYSSIIRAISPLSRHPSE  250
            S L IFL +       S+E  +T+IV V  S+KP  F THH WY+S ++++S   +  SE
Sbjct  8    SFLLIFLLY-------STEAKKTYIVRVKHSDKPDSFPTHHDWYTSQLQSLSTQQQSESE  60

Query  251  --LLYSYGRAANGFSARL  298
              LLY+Y  + NGFSA L
Sbjct  61   SSLLYTYTTSFNGFSAFL  78



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 560813144135