BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002F10

Length=508
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_007215964.1|  hypothetical protein PRUPE_ppa011439mg             214   9e-67   
ref|XP_008387435.1|  PREDICTED: hexokinase-2-like                       215   3e-66   
ref|XP_009338735.1|  PREDICTED: hexokinase-1-like isoform X2            218   7e-66   Pyrus x bretschneideri [bai li]
ref|XP_009338734.1|  PREDICTED: hexokinase-1-like isoform X1            219   3e-65   Pyrus x bretschneideri [bai li]
ref|XP_008458873.1|  PREDICTED: hexokinase-1-like isoform X3            219   4e-65   Cucumis melo [Oriental melon]
ref|XP_008458856.1|  PREDICTED: hexokinase-1-like isoform X2            219   4e-65   
gb|ACJ04704.1|  hexokinase 1                                            218   4e-65   Cucumis melo [Oriental melon]
ref|XP_008387327.1|  PREDICTED: hexokinase-1-like                       218   5e-65   
ref|XP_008228416.1|  PREDICTED: hexokinase-1-like                       218   9e-65   Prunus mume [ume]
ref|XP_004141023.1|  PREDICTED: hexokinase-1-like                       217   1e-64   
ref|XP_008458849.1|  PREDICTED: hexokinase-1-like isoform X1            219   1e-64   Cucumis melo [Oriental melon]
gb|AFO84084.1|  hexokinase                                              217   2e-64   Actinidia deliciosa [Chinese gooseberry]
ref|XP_002283608.1|  PREDICTED: hexokinase-1-like                       216   4e-64   Vitis vinifera
emb|CAN83149.1|  hypothetical protein VITISV_024177                     216   4e-64   Vitis vinifera
gb|KCW82327.1|  hypothetical protein EUGRSUZ_C03728                     212   4e-64   Eucalyptus grandis [rose gum]
gb|KCW82328.1|  hypothetical protein EUGRSUZ_C03728                     211   6e-64   Eucalyptus grandis [rose gum]
ref|XP_009352555.1|  PREDICTED: hexokinase-1                            215   8e-64   Pyrus x bretschneideri [bai li]
ref|XP_008242483.1|  PREDICTED: hexokinase-1                            214   1e-63   Prunus mume [ume]
gb|KDO66593.1|  hypothetical protein CISIN_1g010895mg                   209   1e-63   Citrus sinensis [apfelsine]
gb|KCW82326.1|  hypothetical protein EUGRSUZ_C03728                     211   3e-63   Eucalyptus grandis [rose gum]
ref|XP_010915190.1|  PREDICTED: hexokinase-2-like                       213   6e-63   Elaeis guineensis
ref|XP_006451308.1|  hypothetical protein CICLE_v10008086mg             209   6e-63   
ref|XP_007203872.1|  hypothetical protein PRUPE_ppa004637mg             213   7e-63   Prunus persica
ref|XP_008337603.1|  PREDICTED: hexokinase-1-like                       212   9e-63   
gb|AID50967.1|  hexokinase 1                                            212   9e-63   Malus domestica [apple tree]
ref|XP_010049611.1|  PREDICTED: hexokinase-1-like                       212   1e-62   Eucalyptus grandis [rose gum]
gb|KDO66588.1|  hypothetical protein CISIN_1g010895mg                   208   1e-62   Citrus sinensis [apfelsine]
ref|XP_007013021.1|  Hexokinase 1 isoform 2                             211   2e-62   Theobroma cacao [chocolate]
gb|ADZ96378.1|  hexokinase 1                                            211   2e-62   Eriobotrya japonica [loquat]
emb|CDP03250.1|  unnamed protein product                                211   2e-62   Coffea canephora [robusta coffee]
gb|AEJ95926.1|  HXK1                                                    211   2e-62   Vitis vinifera
ref|XP_008380854.1|  PREDICTED: hexokinase-1-like isoform X2            209   2e-62   Malus domestica [apple tree]
ref|XP_002514221.1|  hexokinase, putative                               211   4e-62   Ricinus communis
gb|KHN40379.1|  Hexokinase-2                                            211   4e-62   Glycine soja [wild soybean]
ref|XP_003516735.1|  PREDICTED: hexokinase-1-like                       211   4e-62   Glycine max [soybeans]
ref|XP_006451309.1|  hypothetical protein CICLE_v10008086mg             208   4e-62   
ref|XP_003516783.1|  PREDICTED: hexokinase-1-like                       210   4e-62   Glycine max [soybeans]
gb|KDP33801.1|  hypothetical protein JCGZ_07372                         211   5e-62   Jatropha curcas
gb|KDO66587.1|  hypothetical protein CISIN_1g010895mg                   208   6e-62   Citrus sinensis [apfelsine]
gb|KDO66582.1|  hypothetical protein CISIN_1g010895mg                   209   7e-62   Citrus sinensis [apfelsine]
ref|NP_001275786.1|  hexokinase                                         209   1e-61   Citrus sinensis [apfelsine]
gb|AHY84731.1|  hexokinase                                              209   2e-61   Manihot esculenta [manioc]
ref|XP_007152969.1|  hypothetical protein PHAVU_004G175500g             209   2e-61   Phaseolus vulgaris [French bean]
ref|XP_011093636.1|  PREDICTED: hexokinase-1                            208   3e-61   Sesamum indicum [beniseed]
ref|NP_001280783.1|  uncharacterized protein LOC103443741               208   4e-61   Malus domestica [apple tree]
ref|XP_009406171.1|  PREDICTED: hexokinase-2-like                       208   4e-61   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010110881.1|  hypothetical protein L484_006996                   204   7e-61   Morus notabilis
ref|XP_010249484.1|  PREDICTED: hexokinase-1                            207   7e-61   Nelumbo nucifera [Indian lotus]
ref|XP_009601881.1|  PREDICTED: hexokinase-2-like                       207   1e-60   Nicotiana tomentosiformis
gb|KHN40378.1|  Hexokinase-1                                            206   1e-60   Glycine soja [wild soybean]
ref|XP_009795017.1|  PREDICTED: hexokinase-2-like                       206   1e-60   Nicotiana sylvestris
ref|XP_010688341.1|  PREDICTED: hexokinase-1                            206   2e-60   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011014418.1|  PREDICTED: hexokinase-1-like                       206   2e-60   Populus euphratica
gb|AAS60195.1|  hexokinase 4a                                           206   2e-60   Nicotiana tabacum [American tobacco]
ref|XP_002325031.1|  Hexokinase 1 family protein                        206   2e-60   Populus trichocarpa [western balsam poplar]
ref|XP_009392524.1|  PREDICTED: hexokinase-2-like                       206   2e-60   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011008120.1|  PREDICTED: hexokinase-1-like                       206   2e-60   Populus euphratica
ref|XP_004287480.1|  PREDICTED: hexokinase-1                            206   2e-60   Fragaria vesca subsp. vesca
gb|AAS60194.1|  hexokinase 3                                            206   3e-60   Nicotiana tabacum [American tobacco]
ref|XP_009777315.1|  PREDICTED: hexokinase-2                            206   3e-60   Nicotiana sylvestris
gb|KJB83118.1|  hypothetical protein B456_013G230400                    202   4e-60   Gossypium raimondii
gb|AAS60196.1|  hexokinase 4b                                           205   4e-60   Nicotiana tabacum [American tobacco]
ref|XP_008795842.1|  PREDICTED: hexokinase-2-like isoform X2            205   4e-60   Phoenix dactylifera
ref|XP_008795834.1|  PREDICTED: hexokinase-2-like isoform X1            205   7e-60   Phoenix dactylifera
ref|XP_010098150.1|  hypothetical protein L484_026284                   205   7e-60   Morus notabilis
ref|XP_009415191.1|  PREDICTED: hexokinase-2-like                       205   7e-60   Musa acuminata subsp. malaccensis [pisang utan]
gb|AHG98487.1|  hexokinase                                              204   7e-60   Dimocarpus longan [longan]
gb|AHB32106.1|  hexokinase                                              204   1e-59   Camellia sinensis [black tea]
ref|XP_010267128.1|  PREDICTED: hexokinase-1-like                       204   1e-59   Nelumbo nucifera [Indian lotus]
gb|AHD25654.1|  hexokinase 1                                            204   1e-59   Camellia sinensis [black tea]
ref|XP_004302852.1|  PREDICTED: hexokinase-1-like                       204   1e-59   Fragaria vesca subsp. vesca
gb|AAT77511.1|  hexokinase                                              201   2e-59   Nicotiana sylvestris
ref|XP_009622660.1|  PREDICTED: hexokinase-2                            203   2e-59   Nicotiana tomentosiformis
ref|XP_004503491.1|  PREDICTED: hexokinase-1-like isoform X2            203   3e-59   Cicer arietinum [garbanzo]
gb|KHG25517.1|  Hexokinase-1 -like protein                              203   4e-59   Gossypium arboreum [tree cotton]
ref|XP_003529000.1|  PREDICTED: hexokinase-1-like                       202   4e-59   Glycine max [soybeans]
gb|KEH21333.1|  hexokinase                                              199   5e-59   Medicago truncatula
gb|KJB83117.1|  hypothetical protein B456_013G230400                    202   5e-59   Gossypium raimondii
ref|XP_010924444.1|  PREDICTED: hexokinase-2-like isoform X2            202   8e-59   Elaeis guineensis
gb|EYU45835.1|  hypothetical protein MIMGU_mgv1a005054mg                202   9e-59   Erythranthe guttata [common monkey flower]
ref|XP_010924442.1|  PREDICTED: hexokinase-2-like isoform X1            202   1e-58   Elaeis guineensis
gb|KHG22031.1|  Hexokinase-1                                            202   1e-58   Gossypium arboreum [tree cotton]
ref|XP_011000949.1|  PREDICTED: hexokinase-1-like                       201   1e-58   Populus euphratica
gb|KJB65034.1|  hypothetical protein B456_010G077400                    201   1e-58   Gossypium raimondii
ref|XP_002299739.1|  hypothetical protein POPTR_0001s19130g             201   1e-58   Populus trichocarpa [western balsam poplar]
ref|XP_003525287.1|  PREDICTED: hexokinase-1-like                       201   2e-58   Glycine max [soybeans]
ref|XP_003530493.1|  PREDICTED: hexokinase-1-like                       201   2e-58   Glycine max [soybeans]
ref|XP_009803252.1|  PREDICTED: hexokinase-1                            201   2e-58   Nicotiana sylvestris
ref|XP_009606563.1|  PREDICTED: hexokinase-1                            201   3e-58   Nicotiana tomentosiformis
sp|Q9SEK2.1|HXK1_TOBAC  RecName: Full=Hexokinase-1; AltName: Full...    201   3e-58   Nicotiana tabacum [American tobacco]
ref|XP_007013022.1|  Hexokinase 2 isoform 3                             199   5e-58   
sp|Q9SEK3.1|HXK1_SPIOL  RecName: Full=Hexokinase-1; AltName: Full...    199   7e-58   Spinacia oleracea
emb|CDO97969.1|  unnamed protein product                                199   8e-58   Coffea canephora [robusta coffee]
ref|XP_006353497.1|  PREDICTED: hexokinase-1-like isoform X2            199   8e-58   Solanum tuberosum [potatoes]
gb|AET05183.2|  hexokinase                                              199   9e-58   Medicago truncatula
ref|XP_007160283.1|  hypothetical protein PHAVU_002G308400g             199   1e-57   Phaseolus vulgaris [French bean]
gb|ABA01010.1|  hexokinase                                              199   1e-57   Solanum chacoense
ref|NP_001274841.1|  hexokinase-2                                       198   2e-57   Solanum tuberosum [potatoes]
gb|AAT77513.1|  hexokinase 3                                            198   2e-57   Nicotiana sylvestris
ref|XP_006353496.1|  PREDICTED: hexokinase-1-like isoform X1            198   2e-57   Solanum tuberosum [potatoes]
gb|AAS60197.1|  hexokinase 5                                            198   2e-57   Nicotiana tabacum [American tobacco]
ref|XP_007024321.1|  Hexokinase 2                                       198   2e-57   
gb|AIX02984.1|  hexokinase                                              198   2e-57   Morella rubra [Chinese arbutus]
gb|AAP40021.1|  hexokinase                                              198   2e-57   Nicotiana benthamiana
ref|XP_003630707.1|  Hexokinase                                         200   3e-57   
ref|XP_007013020.1|  Hexokinase 1 isoform 1                             198   4e-57   
gb|AFO84083.1|  hexokinase                                              197   5e-57   Actinidia chinensis
ref|XP_010540986.1|  PREDICTED: hexokinase-1-like                       197   7e-57   Tarenaya hassleriana [spider flower]
ref|NP_001234406.1|  hexokinase                                         196   9e-57   
gb|EPS70676.1|  hexokinase 1a                                           196   1e-56   Genlisea aurea
ref|XP_010322313.1|  PREDICTED: hexokinase isoform X1                   196   1e-56   Solanum lycopersicum
ref|XP_006299465.1|  hypothetical protein CARUB_v10015630mg             195   3e-56   Capsella rubella
ref|XP_004510315.1|  PREDICTED: hexokinase-1-like                       195   3e-56   Cicer arietinum [garbanzo]
ref|NP_001234710.1|  hexokinase                                         195   4e-56   Solanum lycopersicum
gb|ABI18156.1|  hexokinase                                              194   5e-56   Helianthus annuus
ref|XP_006408903.1|  hypothetical protein EUTSA_v10001968mg             194   6e-56   Eutrema salsugineum [saltwater cress]
ref|XP_002515958.1|  hexokinase, putative                               194   6e-56   Ricinus communis
gb|EYU21451.1|  hypothetical protein MIMGU_mgv1a005070mg                194   6e-56   Erythranthe guttata [common monkey flower]
gb|EYU27268.1|  hypothetical protein MIMGU_mgv1a019208mg                194   7e-56   Erythranthe guttata [common monkey flower]
ref|XP_010526433.1|  PREDICTED: hexokinase-1                            194   7e-56   Tarenaya hassleriana [spider flower]
ref|NP_194642.1|  hexokinase 1                                          194   8e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002867423.1|  ATHXK1                                             194   9e-56   Arabidopsis lyrata subsp. lyrata
ref|XP_010489125.1|  PREDICTED: hexokinase-2-like                       194   9e-56   Camelina sativa [gold-of-pleasure]
ref|XP_010467922.1|  PREDICTED: hexokinase-2 isoform X1                 194   1e-55   Camelina sativa [gold-of-pleasure]
gb|AHY84734.1|  hexokinase                                              194   1e-55   Manihot esculenta [manioc]
ref|XP_010915379.1|  PREDICTED: hexokinase-2-like                       194   1e-55   Elaeis guineensis
ref|XP_010416617.1|  PREDICTED: hexokinase-2-like                       194   1e-55   Camelina sativa [gold-of-pleasure]
ref|XP_006285258.1|  hypothetical protein CARUB_v10006629mg             193   1e-55   Capsella rubella
gb|KJB56835.1|  hypothetical protein B456_009G137700                    193   2e-55   Gossypium raimondii
ref|XP_010047252.1|  PREDICTED: hexokinase-2-like                       193   2e-55   Eucalyptus grandis [rose gum]
gb|AAT77514.1|  hexokinase 4                                            189   2e-55   Nicotiana sylvestris
ref|XP_010047667.1|  PREDICTED: hexokinase-1-like                       193   2e-55   Eucalyptus grandis [rose gum]
ref|XP_002886018.1|  ATHXK2                                             193   2e-55   Arabidopsis lyrata subsp. lyrata
ref|XP_011072439.1|  PREDICTED: hexokinase-1-like                       193   3e-55   Sesamum indicum [beniseed]
gb|KJB70380.1|  hypothetical protein B456_011G070700                    192   3e-55   Gossypium raimondii
gb|KHG28915.1|  Hexokinase-1                                            192   3e-55   Gossypium arboreum [tree cotton]
ref|XP_010438337.1|  PREDICTED: hexokinase-1-like                       192   4e-55   Camelina sativa [gold-of-pleasure]
ref|XP_010433133.1|  PREDICTED: hexokinase-1-like                       192   4e-55   Camelina sativa [gold-of-pleasure]
ref|XP_010447886.1|  PREDICTED: hexokinase-1                            192   5e-55   
gb|AAL60584.1|AF454962_1  hexokinase                                    191   9e-55   Brassica oleracea
gb|KDO51805.1|  hypothetical protein CISIN_1g0115051mg                  182   1e-54   Citrus sinensis [apfelsine]
ref|XP_009112637.1|  PREDICTED: hexokinase-1-like                       191   1e-54   Brassica rapa
gb|AAL60583.1|AF454961_1  hexokinase                                    191   1e-54   Brassica oleracea
ref|NP_179576.1|  hexokinase 2                                          191   1e-54   Arabidopsis thaliana [mouse-ear cress]
gb|AAO24584.1|  At2g19860                                               191   1e-54   Arabidopsis thaliana [mouse-ear cress]
emb|CDY48733.1|  BnaA09g10080D                                          191   2e-54   Brassica napus [oilseed rape]
emb|CDY03331.1|  BnaC09g10170D                                          191   2e-54   
ref|XP_009102132.1|  PREDICTED: hexokinase-1                            191   2e-54   Brassica rapa
gb|KFK40349.1|  hypothetical protein AALP_AA3G362600                    191   2e-54   Arabis alpina [alpine rockcress]
emb|CDY35895.1|  BnaA07g00920D                                          191   2e-54   Brassica napus [oilseed rape]
ref|XP_004503490.1|  PREDICTED: hexokinase-1-like isoform X1            191   2e-54   
pdb|4QS7|A  Chain A, Arabidopsis Hexokinase 1 (athxk1) Structure ...    189   3e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006585567.1|  PREDICTED: hexokinase-1-like isoform X4            187   3e-54   
pdb|4QS9|A  Chain A, Arabidopsis Hexokinase 1 (athxk1) Mutant S17...    189   3e-54   Arabidopsis thaliana [mouse-ear cress]
gb|AAT77515.1|  hexokinase 7                                            189   4e-54   Nicotiana tabacum [American tobacco]
gb|KFK29465.1|  hypothetical protein AALP_AA7G137600                    190   4e-54   Arabis alpina [alpine rockcress]
ref|XP_006343033.1|  PREDICTED: hexokinase-1-like                       189   4e-54   
ref|XP_006585566.1|  PREDICTED: hexokinase-1-like isoform X3            187   4e-54   
ref|XP_006585565.1|  PREDICTED: hexokinase-1-like isoform X2            187   5e-54   
ref|XP_003627048.1|  Hexokinase                                         189   8e-54   Medicago truncatula
sp|Q2KNB9.1|HXK2_ORYSJ  RecName: Full=Hexokinase-2; AltName: Full...    188   1e-53   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004135675.1|  PREDICTED: hexokinase-2-like                       187   2e-53   Cucumis sativus [cucumbers]
ref|NP_001233957.1|  hexokinase                                         187   3e-53   Solanum lycopersicum
ref|NP_001284452.1|  hexokinase-1-like                                  187   4e-53   Cucumis melo [Oriental melon]
ref|XP_003533038.1|  PREDICTED: hexokinase-1-like isoform X1            187   4e-53   Glycine max [soybeans]
gb|EAY98804.1|  hypothetical protein OsI_20748                          186   6e-53   Oryza sativa Indica Group [Indian rice]
ref|XP_006853711.1|  hypothetical protein AMTR_s00056p00151260          186   6e-53   Amborella trichopoda
gb|KCW79624.1|  hypothetical protein EUGRSUZ_C00983                     185   1e-52   Eucalyptus grandis [rose gum]
gb|AAT47078.1|  unknown protein                                         190   2e-52   Oryza sativa Japonica Group [Japonica rice]
gb|KDP40854.1|  hypothetical protein JCGZ_24853                         184   3e-52   Jatropha curcas
ref|XP_010047255.1|  PREDICTED: hexokinase-2-like                       178   3e-52   
ref|XP_008789199.1|  PREDICTED: hexokinase-2-like                       184   4e-52   
ref|XP_009394175.1|  PREDICTED: hexokinase-2-like                       184   4e-52   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAJ89593.1|  predicted protein                                      184   5e-52   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007135629.1|  hypothetical protein PHAVU_010G144900g             184   5e-52   Phaseolus vulgaris [French bean]
gb|KJB35042.1|  hypothetical protein B456_006G096800                    182   1e-51   Gossypium raimondii
gb|EMT07302.1|  Hexokinase-2                                            182   1e-51   
ref|XP_006426867.1|  hypothetical protein CICLE_v10025452mg             182   2e-51   Citrus clementina [clementine]
gb|KCW79126.1|  hypothetical protein EUGRSUZ_C005691                    178   2e-51   Eucalyptus grandis [rose gum]
gb|KJB35041.1|  hypothetical protein B456_006G096800                    182   3e-51   Gossypium raimondii
ref|XP_010232254.1|  PREDICTED: hexokinase-9-like isoform X2            181   4e-51   
ref|XP_003567061.1|  PREDICTED: hexokinase-9-like isoform X1            181   7e-51   Brachypodium distachyon [annual false brome]
ref|XP_010041948.1|  PREDICTED: hexokinase-1-like                       174   9e-51   
ref|XP_006465701.1|  PREDICTED: hexokinase-1-like                       179   3e-50   Citrus sinensis [apfelsine]
ref|XP_003568034.1|  PREDICTED: hexokinase-2 isoform X1                 178   1e-49   Brachypodium distachyon [annual false brome]
ref|XP_011080413.1|  PREDICTED: hexokinase-1-like                       177   1e-49   Sesamum indicum [beniseed]
ref|XP_004513053.1|  PREDICTED: hexokinase-1-like                       177   3e-49   Cicer arietinum [garbanzo]
ref|XP_002283574.1|  PREDICTED: hexokinase-2                            175   1e-48   Vitis vinifera
ref|XP_010665885.1|  PREDICTED: hexokinase-1-like isoform X1            174   3e-48   Beta vulgaris subsp. vulgaris [field beet]
emb|CAN74362.1|  hypothetical protein VITISV_016381                     174   4e-48   Vitis vinifera
dbj|BAP47497.1|  hexokinase                                             172   1e-47   Gentiana triflora
gb|KDO50431.1|  hypothetical protein CISIN_1g0104561mg                  164   7e-47   Citrus sinensis [apfelsine]
ref|XP_002988103.1|  hypothetical protein SELMODRAFT_269350             169   2e-46   Selaginella moellendorffii
ref|XP_002313358.2|  hexokinase family protein                          169   2e-46   Populus trichocarpa [western balsam poplar]
ref|XP_002972691.1|  hypothetical protein SELMODRAFT_441916             169   4e-46   Selaginella moellendorffii
ref|XP_010246625.1|  PREDICTED: hexokinase-3-like                       168   4e-46   Nelumbo nucifera [Indian lotus]
ref|XP_011045448.1|  PREDICTED: hexokinase-3-like                       167   6e-46   Populus euphratica
gb|KEH27216.1|  hexokinase                                              167   6e-46   Medicago truncatula
ref|XP_010673708.1|  PREDICTED: hexokinase-3-like isoform X1            167   7e-46   Beta vulgaris subsp. vulgaris [field beet]
gb|AHY84733.1|  hexokinase                                              167   9e-46   Manihot esculenta [manioc]
ref|XP_002298298.1|  hexokinase family protein                          167   2e-45   Populus trichocarpa [western balsam poplar]
gb|KHN09247.1|  Hexokinase-3                                            166   2e-45   Glycine soja [wild soybean]
ref|XP_003537744.1|  PREDICTED: hexokinase-3-like                       166   3e-45   Glycine max [soybeans]
ref|XP_011032066.1|  PREDICTED: hexokinase-3 isoform X1                 166   3e-45   Populus euphratica
tpg|DAA57818.1|  TPA: hypothetical protein ZEAMMB73_547897              163   4e-45   
ref|XP_007015149.1|  Hexokinase-like 1                                  166   4e-45   
tpg|DAA57819.1|  TPA: hypothetical protein ZEAMMB73_547897              163   6e-45   
gb|KDP22128.1|  hypothetical protein JCGZ_25959                         165   7e-45   Jatropha curcas
ref|XP_008800256.1|  PREDICTED: hexokinase-3-like isoform X2            158   1e-44   
ref|NP_001044102.1|  Os01g0722700                                       159   2e-44   
gb|KJB83525.1|  hypothetical protein B456_013G251900                    161   2e-44   Gossypium raimondii
gb|KJB83527.1|  hypothetical protein B456_013G251900                    161   2e-44   Gossypium raimondii
ref|XP_009405075.1|  PREDICTED: hexokinase-2-like                       164   2e-44   
gb|ACN29323.1|  unknown                                                 163   2e-44   Zea mays [maize]
ref|XP_006446203.1|  hypothetical protein CICLE_v10014962mg             164   3e-44   Citrus clementina [clementine]
ref|XP_006470700.1|  PREDICTED: hexokinase-3-like                       163   3e-44   Citrus sinensis [apfelsine]
ref|NP_001146056.1|  hypothetical protein                               163   3e-44   Zea mays [maize]
ref|XP_008450397.1|  PREDICTED: hexokinase-3-like                       163   3e-44   Cucumis melo [Oriental melon]
ref|XP_010273315.1|  PREDICTED: hexokinase-3-like                       162   7e-44   Nelumbo nucifera [Indian lotus]
ref|XP_003540378.1|  PREDICTED: hexokinase-3-like                       162   8e-44   Glycine max [soybeans]
gb|KHN25630.1|  Hexokinase-3                                            160   9e-44   Glycine soja [wild soybean]
ref|XP_008800255.1|  PREDICTED: hexokinase-3-like isoform X1            157   1e-43   
gb|EYU46224.1|  hypothetical protein MIMGU_mgv1a004779mg                161   1e-43   Erythranthe guttata [common monkey flower]
gb|KJB83523.1|  hypothetical protein B456_013G251900                    161   2e-43   Gossypium raimondii
gb|KJB83524.1|  hypothetical protein B456_013G251900                    161   2e-43   Gossypium raimondii
ref|XP_004154641.1|  PREDICTED: hexokinase-3-like                       161   2e-43   
ref|XP_009366073.1|  PREDICTED: hexokinase-3                            161   2e-43   Pyrus x bretschneideri [bai li]
ref|XP_004139044.1|  PREDICTED: hexokinase-3-like                       160   2e-43   Cucumis sativus [cucumbers]
gb|AHY84732.1|  hexokinase                                              160   3e-43   Manihot esculenta [manioc]
sp|Q2KNB7.1|HXK9_ORYSJ  RecName: Full=Hexokinase-9; AltName: Full...    160   4e-43   Oryza sativa Japonica Group [Japonica rice]
gb|KHG14450.1|  hypothetical protein F383_08688                         159   7e-43   Gossypium arboreum [tree cotton]
ref|XP_010921910.1|  PREDICTED: hexokinase-3-like isoform X1            159   9e-43   Elaeis guineensis
ref|XP_009414963.1|  PREDICTED: hexokinase-3-like                       159   1e-42   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAL16967.1|AF367451_1  hexokinase                                    152   1e-42   Prunus persica
gb|EAY75659.1|  hypothetical protein OsI_03566                          158   2e-42   Oryza sativa Indica Group [Indian rice]
emb|CDP09609.1|  unnamed protein product                                158   2e-42   Coffea canephora [robusta coffee]
ref|XP_004511503.1|  PREDICTED: hexokinase-3-like                       158   2e-42   Cicer arietinum [garbanzo]
ref|XP_006362320.1|  PREDICTED: hexokinase-3-like                       158   2e-42   Solanum tuberosum [potatoes]
ref|XP_003610965.1|  Hexokinase                                         158   3e-42   Medicago truncatula
gb|KHN35090.1|  Hexokinase-3                                            154   4e-42   Glycine soja [wild soybean]
gb|AEB00843.1|  hexokinase 7                                            150   4e-42   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004251354.1|  PREDICTED: hexokinase-3-like                       157   4e-42   Solanum lycopersicum
ref|XP_008363245.1|  PREDICTED: hexokinase-3                            157   5e-42   
gb|EMT31348.1|  Hexokinase-9                                            159   6e-42   
gb|EMT15586.1|  Hexokinase-7                                            155   7e-42   
ref|XP_008449690.1|  PREDICTED: hexokinase-3                            157   7e-42   Cucumis melo [Oriental melon]
emb|CDM84160.1|  unnamed protein product                                154   7e-42   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008775017.1|  PREDICTED: hexokinase-3-like isoform X2            156   1e-41   Phoenix dactylifera
ref|XP_008775016.1|  PREDICTED: hexokinase-3-like isoform X1            156   1e-41   Phoenix dactylifera
ref|XP_001754148.1|  hexokinase protein HXK7                            156   1e-41   
ref|XP_002513538.1|  hexokinase, putative                               156   1e-41   Ricinus communis
gb|KGN48114.1|  hypothetical protein Csa_6G434340                       155   2e-41   Cucumis sativus [cucumbers]
ref|XP_008466487.1|  PREDICTED: hexokinase-2, chloroplastic             155   2e-41   Cucumis melo [Oriental melon]
ref|XP_008385759.1|  PREDICTED: hexokinase-3-like                       155   2e-41   
ref|XP_009780796.1|  PREDICTED: hexokinase-2, chloroplastic             155   2e-41   Nicotiana sylvestris
ref|XP_006843448.1|  hypothetical protein AMTR_s00053p00173580          155   2e-41   Amborella trichopoda
ref|XP_007131563.1|  hypothetical protein PHAVU_011G023700g             155   3e-41   Phaseolus vulgaris [French bean]
emb|CBI27996.3|  unnamed protein product                                154   4e-41   Vitis vinifera
ref|XP_001752229.1|  hexokinase protein HXK8                            154   6e-41   
gb|AIT55904.1|  hexokinase                                              154   6e-41   Ipomoea batatas [batate]
ref|XP_003517518.1|  PREDICTED: hexokinase-3-like                       154   6e-41   Glycine max [soybeans]
ref|XP_004969912.1|  PREDICTED: hexokinase-6-like                       154   7e-41   Setaria italica
gb|ABR18277.1|  unknown                                                 154   8e-41   Picea sitchensis
gb|KGN60032.1|  hypothetical protein Csa_3G872140                       153   8e-41   Cucumis sativus [cucumbers]
ref|XP_006590474.1|  PREDICTED: hexokinase-3-like                       154   9e-41   Glycine max [soybeans]
sp|Q6Q8A5.1|HXK2_TOBAC  RecName: Full=Hexokinase-2, chloroplastic...    154   9e-41   Nicotiana tabacum [American tobacco]
ref|XP_004136385.1|  PREDICTED: hexokinase-2, chloroplastic-like        154   9e-41   Cucumis sativus [cucumbers]
gb|KDP36930.1|  hypothetical protein JCGZ_08221                         154   9e-41   Jatropha curcas
ref|XP_002974995.1|  hypothetical protein SELMODRAFT_150326             153   9e-41   
ref|XP_009626314.1|  PREDICTED: hexokinase-2, chloroplastic             154   9e-41   Nicotiana tomentosiformis
gb|AAL16968.1|AF367452_1  hexokinase                                    147   1e-40   Prunus persica
ref|XP_002977412.1|  hypothetical protein SELMODRAFT_232972             153   1e-40   
ref|XP_006393149.1|  hypothetical protein EUTSA_v10011415mg             153   1e-40   Eutrema salsugineum [saltwater cress]
ref|XP_009622479.1|  PREDICTED: hexokinase-3-like                       153   1e-40   Nicotiana tomentosiformis
gb|AAS60198.1|  hexokinase 6                                            153   1e-40   Nicotiana tabacum [American tobacco]
ref|XP_006383739.1|  hypothetical protein POPTR_0005s25980g             150   2e-40   
ref|XP_002458467.1|  hypothetical protein SORBIDRAFT_03g034230          153   2e-40   Sorghum bicolor [broomcorn]
ref|XP_006646274.1|  PREDICTED: LOW QUALITY PROTEIN: hexokinase-9...    152   2e-40   
ref|XP_009337028.1|  PREDICTED: hexokinase-3-like                       152   3e-40   Pyrus x bretschneideri [bai li]
ref|XP_002891576.1|  hypothetical protein ARALYDRAFT_474175             152   3e-40   
ref|XP_001784334.1|  hexokinase protein HXK3                            152   4e-40   
ref|XP_007156986.1|  hypothetical protein PHAVU_002G034000g             152   5e-40   
ref|XP_004961448.1|  PREDICTED: hexokinase-5-like                       152   5e-40   
ref|XP_002306924.2|  hypothetical protein POPTR_0005s25980g             149   5e-40   
ref|XP_002510526.1|  hexokinase, putative                               151   5e-40   
ref|XP_009343799.1|  PREDICTED: hexokinase-3-like                       152   6e-40   
ref|XP_008675068.1|  PREDICTED: hexokinase-6                            151   6e-40   
ref|NP_001234717.1|  plastidic hexokinase                               151   7e-40   
gb|AFW82531.1|  hypothetical protein ZEAMMB73_000101                    147   7e-40   
gb|AHY84730.1|  hexokinase                                              151   7e-40   
ref|XP_010031757.1|  PREDICTED: hexokinase-3 isoform X3                 151   7e-40   
ref|XP_010031755.1|  PREDICTED: hexokinase-3 isoform X1                 151   8e-40   
ref|XP_009382579.1|  PREDICTED: hexokinase-3-like isoform X2            150   8e-40   
gb|AFO84085.1|  hexokinase                                              151   9e-40   
ref|XP_002440104.1|  hypothetical protein SORBIDRAFT_09g026080          151   9e-40   
ref|XP_009382578.1|  PREDICTED: hexokinase-3-like isoform X1            151   1e-39   
ref|XP_006646311.1|  PREDICTED: hexokinase-6-like                       151   1e-39   
ref|XP_007017793.1|  Hexokinase 3                                       150   1e-39   
ref|XP_006643859.1|  PREDICTED: hexokinase-8-like                       150   1e-39   
ref|XP_009798645.1|  PREDICTED: hexokinase-3-like                       150   1e-39   
ref|XP_011090147.1|  PREDICTED: hexokinase-3-like                       150   1e-39   
ref|XP_010695425.1|  PREDICTED: hexokinase-2, chloroplastic             150   2e-39   
ref|XP_002984124.1|  hypothetical protein SELMODRAFT_234446             150   2e-39   
ref|XP_011045105.1|  PREDICTED: hexokinase-2, chloroplastic             150   2e-39   
ref|NP_001275315.1|  hexokinase-related protein 1                       150   2e-39   
ref|XP_002456268.1|  hypothetical protein SORBIDRAFT_03g033200          149   2e-39   
gb|EPS60819.1|  hexokinase                                              149   2e-39   
emb|CDP07402.1|  unnamed protein product                                150   2e-39   
ref|XP_006307314.1|  hypothetical protein CARUB_v10008936mg             150   2e-39   
gb|KHN41674.1|  Hexokinase-1                                            149   3e-39   
gb|EMT13168.1|  Hexokinase-8                                            149   3e-39   
dbj|BAJ93240.1|  predicted protein                                      149   3e-39   
ref|XP_003564653.1|  PREDICTED: hexokinase-8-like                       149   3e-39   
gb|AIU64847.1|  hexokinase-3                                            149   3e-39   
ref|XP_008227191.1|  PREDICTED: hexokinase-3 isoform X1                 149   4e-39   
ref|NP_175463.1|  hexokinase-like 1                                     149   4e-39   
ref|XP_007211826.1|  hypothetical protein PRUPE_ppa004471mg             149   4e-39   
ref|XP_004968460.1|  PREDICTED: hexokinase-8-like                       149   4e-39   
ref|XP_011080375.1|  PREDICTED: hexokinase-3 isoform X1                 149   5e-39   
ref|XP_010938649.1|  PREDICTED: hexokinase-3-like                       149   5e-39   
gb|KJB63530.1|  hypothetical protein B456_010G004700                    147   5e-39   
ref|XP_001784630.1|  hexokinase protein HXK2                            149   5e-39   
gb|ADN33926.1|  hexokinase                                              149   5e-39   
ref|XP_002274759.1|  PREDICTED: hexokinase-3 isoform X1                 149   5e-39   
gb|KHG14299.1|  Hexokinase-2, chloroplastic                             149   5e-39   
ref|XP_002972212.1|  hypothetical protein SELMODRAFT_231902             148   7e-39   
sp|O64390.1|HXK1_SOLTU  RecName: Full=Hexokinase-1; AltName: Full...    148   9e-39   
ref|XP_003568072.1|  PREDICTED: LOW QUALITY PROTEIN: hexokinase-5...    148   1e-38   
ref|XP_009405453.1|  PREDICTED: hexokinase-3-like                       148   1e-38   
gb|KJB63531.1|  hypothetical protein B456_010G004700                    147   1e-38   
ref|XP_004140206.1|  PREDICTED: hexokinase-3-like                       148   1e-38   
emb|CDY07303.1|  BnaC05g26650D                                          148   1e-38   
ref|XP_011080376.1|  PREDICTED: hexokinase-3 isoform X2                 148   1e-38   
ref|XP_008387945.1|  PREDICTED: hexokinase-2, chloroplastic             147   1e-38   
ref|NP_001123599.1|  hexokinase2                                        147   2e-38   
ref|XP_009335085.1|  PREDICTED: hexokinase-2, chloroplastic             147   2e-38   
gb|KFK35941.1|  hypothetical protein AALP_AA4G057200                    147   2e-38   
ref|XP_010461899.1|  PREDICTED: hexokinase-3-like                       147   2e-38   
gb|KHN27811.1|  Hexokinase-1                                            146   2e-38   
ref|XP_002894073.1|  hypothetical protein ARALYDRAFT_314227             147   2e-38   
gb|AHD25655.1|  hexokinase 2                                            147   2e-38   
gb|ACG44289.1|  hexokinase-2                                            147   2e-38   
gb|AFW78822.1|  hexokinase-2                                            147   2e-38   
gb|AFW82530.1|  hexokinase                                              147   3e-38   
gb|KJB63529.1|  hypothetical protein B456_010G004700                    147   3e-38   
ref|NP_001044214.1|  Os01g0742500                                       147   3e-38   
ref|NP_001056082.1|  Os05g0522500                                       147   3e-38   
gb|EPS64171.1|  hypothetical protein M569_10608                         147   3e-38   
ref|NP_001105529.1|  LOC542510                                          146   6e-38   
ref|XP_010461577.1|  PREDICTED: hexokinase-like 1 protein isoform X2    144   6e-38   
ref|XP_010487967.1|  PREDICTED: hexokinase-4                            146   6e-38   
ref|XP_010443879.1|  PREDICTED: hexokinase-3-like isoform X2            143   7e-38   
emb|CBI36049.3|  unnamed protein product                                145   7e-38   
ref|XP_006297494.1|  hypothetical protein CARUB_v10013513mg             145   7e-38   
ref|XP_010443756.1|  PREDICTED: hexokinase-3-like isoform X1            143   8e-38   
ref|XP_006473649.1|  PREDICTED: hexokinase-2, chloroplastic-like        145   9e-38   
gb|AAA60333.1|  hexokinase                                              144   1e-37   
ref|XP_010461576.1|  PREDICTED: hexokinase-like 1 protein isoform X1    144   1e-37   
dbj|BAD93730.1|  hexokinase                                             145   1e-37   
ref|XP_010508397.1|  PREDICTED: hexokinase-4-like                       145   2e-37   
ref|NP_188639.2|  hexokinase-4                                          145   2e-37   
ref|NP_001054835.1|  Os05g0187100                                       143   2e-37   
ref|XP_003568782.1|  PREDICTED: hexokinase-7                            144   2e-37   
ref|XP_010479505.1|  PREDICTED: hexokinase-3 isoform X1                 144   3e-37   
ref|XP_002883225.1|  hexokinase                                         144   3e-37   
gb|EMT04435.1|  Hexokinase-6                                            144   3e-37   
ref|XP_009144955.1|  PREDICTED: hexokinase-3-like                       144   4e-37   
gb|KDO84849.1|  hypothetical protein CISIN_1g011283mg                   143   5e-37   
sp|Q2KNB4.1|HXK3_ORYSJ  RecName: Full=Hexokinase-3; AltName: Full...    143   5e-37   
gb|EAY77169.1|  hypothetical protein OsI_05139                          143   5e-37   
gb|EEC78650.1|  hypothetical protein OsI_18744                          143   6e-37   
gb|AAZ93624.1|  hexokinase 7                                            142   7e-37   
sp|Q1WM16.2|HXK7_ORYSJ  RecName: Full=Hexokinase-7; AltName: Full...    142   7e-37   
gb|EEE55981.1|  hypothetical protein OsJ_04720                          144   1e-36   
gb|AEB00842.1|  hexokinase 6                                            139   1e-36   
ref|XP_010479187.1|  PREDICTED: hexokinase-like 1 protein isoform X1    142   1e-36   
ref|XP_006303965.1|  hypothetical protein CARUB_v10008846mg             142   2e-36   
ref|XP_003569773.1|  PREDICTED: hexokinase-6                            142   2e-36   
ref|XP_006435174.1|  hypothetical protein CICLE_v10000939mg             142   2e-36   
ref|XP_010268380.1|  PREDICTED: hexokinase-2, chloroplastic             142   2e-36   
gb|ACG43712.1|  hexokinase-1                                            141   2e-36   
ref|NP_001130970.1|  uncharacterized protein LOC100192075               141   2e-36   
ref|XP_008672063.1|  PREDICTED: uncharacterized protein LOC100192...    141   2e-36   
ref|XP_010061051.1|  PREDICTED: hexokinase-2, chloroplastic             141   3e-36   
ref|XP_002455027.1|  hypothetical protein SORBIDRAFT_03g003190          141   3e-36   
emb|CDY22797.1|  BnaA06g02800D                                          141   4e-36   
ref|XP_010500300.1|  PREDICTED: hexokinase-like 1 protein               140   4e-36   
emb|CDM84036.1|  unnamed protein product                                140   5e-36   
emb|CDY03607.1|  BnaC03g68660D                                          140   6e-36   
ref|XP_009107216.1|  PREDICTED: hexokinase-3-like                       140   7e-36   
dbj|BAJ85932.1|  predicted protein                                      140   7e-36   
ref|XP_009147837.1|  PREDICTED: hexokinase-3                            140   8e-36   
ref|XP_004960890.1|  PREDICTED: hexokinase-7-like isoform X1            139   1e-35   
ref|XP_006393517.1|  hypothetical protein EUTSA_v10011426mg             139   1e-35   
gb|AFW83996.1|  hypothetical protein ZEAMMB73_545591                    138   1e-35   
gb|ACG47843.1|  hexokinase-1                                            139   1e-35   
ref|XP_009382581.1|  PREDICTED: hexokinase-3-like isoform X4            138   1e-35   
gb|AEB00838.1|  hexokinase 2                                            139   2e-35   
ref|XP_006829458.1|  hypothetical protein AMTR_s00254p00018780          139   2e-35   
ref|XP_009382580.1|  PREDICTED: hexokinase-3-like isoform X3            138   2e-35   
dbj|BAK06520.1|  predicted protein                                      139   2e-35   
ref|XP_004971218.1|  PREDICTED: hexokinase-3-like                       139   3e-35   
ref|XP_008674565.1|  PREDICTED: hexokinase-3                            139   3e-35   
ref|XP_008656880.1|  PREDICTED: hexokinase-3-like                       138   3e-35   
ref|XP_008807593.1|  PREDICTED: hexokinase-4, chloroplastic-like ...    135   4e-35   
ref|XP_008807592.1|  PREDICTED: hexokinase-4, chloroplastic-like ...    135   4e-35   
ref|XP_008807594.1|  PREDICTED: hexokinase-4, chloroplastic-like ...    135   4e-35   
emb|CDY06724.1|  BnaA10g05030D                                          137   6e-35   
ref|XP_010920252.1|  PREDICTED: hexokinase-2, chloroplastic             137   6e-35   
ref|XP_004291365.1|  PREDICTED: hexokinase-2, chloroplastic             137   6e-35   
ref|XP_002440735.1|  hypothetical protein SORBIDRAFT_09g005840          137   6e-35   
ref|XP_010031756.1|  PREDICTED: hexokinase-3 isoform X2                 137   7e-35   
gb|EAY98739.1|  hypothetical protein OsI_20669                          137   8e-35   
ref|NP_175220.2|  hexokinase 3                                          137   9e-35   
emb|CDY45062.1|  BnaA08g02130D                                          137   9e-35   
ref|XP_003565048.1|  PREDICTED: hexokinase-3                            137   1e-34   
dbj|BAK01318.1|  predicted protein                                      137   1e-34   
ref|XP_001772444.1|  hexokinase protein HXK1                            137   1e-34   
ref|XP_009118944.1|  PREDICTED: hexokinase-like 1 protein               136   1e-34   
emb|CDY20902.1|  BnaC06g01220D                                          136   2e-34   
ref|XP_008221267.1|  PREDICTED: hexokinase-2, chloroplastic             136   2e-34   
ref|XP_010466178.1|  PREDICTED: hexokinase-4-like                       136   2e-34   
ref|NP_001059124.1|  Os07g0197100                                       135   3e-34   
gb|KFK39985.1|  hypothetical protein AALP_AA3G314900                    135   3e-34   
gb|EEC70091.1|  hypothetical protein OsI_00720                          135   3e-34   
ref|XP_006601348.1|  PREDICTED: hexokinase-2, chloroplastic-like ...    133   4e-34   
ref|XP_010941986.1|  PREDICTED: hexokinase-2-like                       135   5e-34   
ref|XP_001776765.1|  hexokinase protein HXK10                           135   5e-34   
ref|NP_001267834.1|  hexokinase                                         135   5e-34   
ref|XP_002459072.1|  hypothetical protein SORBIDRAFT_03g045420          135   5e-34   
ref|XP_004960891.1|  PREDICTED: hexokinase-7-like isoform X2            134   5e-34   
gb|AEJ95927.1|  HXK2                                                    135   6e-34   
gb|AAF99786.1|AC012463_3  T2E6.5                                        137   6e-34   
ref|XP_007222248.1|  hypothetical protein PRUPE_ppa004715mg             134   6e-34   
gb|AAQ72424.1|  hexokinase PpHxk1                                       134   8e-34   
gb|EAZ03118.1|  hypothetical protein OsI_25263                          134   1e-33   
dbj|BAD87613.1|  putative hexokinase                                    134   1e-33   
gb|KEH40228.1|  hexokinase                                              132   1e-33   
ref|XP_004499271.1|  PREDICTED: LOW QUALITY PROTEIN: hexokinase-2...    134   1e-33   
ref|XP_001766433.1|  hexokinase protein HXK5                            134   2e-33   
ref|XP_011083536.1|  PREDICTED: hexokinase-2, chloroplastic             133   2e-33   
gb|KFK39984.1|  hypothetical protein AALP_AA3G314800                    133   2e-33   
sp|Q1WM15.2|HXK8_ORYSJ  RecName: Full=Hexokinase-8; AltName: Full...    133   2e-33   
gb|EEE54030.1|  hypothetical protein OsJ_00699                          133   2e-33   
sp|Q2KNB5.1|HXK10_ORYSJ  RecName: Full=Hexokinase-10; AltName: Fu...    133   2e-33   
ref|NP_001042264.1|  Os01g0190400                                       133   2e-33   
gb|AFK45195.1|  unknown                                                 132   3e-33   
ref|XP_003589478.1|  Hexokinase I                                       132   4e-33   
ref|XP_001770177.1|  hexokinase protein HXK9                            132   5e-33   
ref|XP_003550424.1|  PREDICTED: hexokinase-2, chloroplastic-like ...    132   6e-33   
ref|XP_006406425.1|  hypothetical protein EUTSA_v10020562mg             132   7e-33   
ref|XP_006661182.1|  PREDICTED: hexokinase-1-like                       131   7e-33   
ref|XP_002983299.1|  hypothetical protein SELMODRAFT_117919             131   1e-32   
emb|CDY24565.1|  BnaC05g32490D                                          131   1e-32   
gb|KFK39983.1|  hypothetical protein AALP_AA3G314700                    130   2e-32   
emb|CDY25373.1|  BnaA05g19110D                                          130   3e-32   
ref|XP_009145689.1|  PREDICTED: hexokinase-4                            130   3e-32   
ref|XP_010104447.1|  Hexokinase-2                                       130   3e-32   
ref|NP_001150106.1|  hexokinase-1                                       129   4e-32   
ref|XP_003580531.1|  PREDICTED: hexokinase-4, chloroplastic             129   4e-32   
gb|AAZ93625.1|  hexokinase 8                                            129   6e-32   
gb|KHN39258.1|  Hexokinase-1                                            127   7e-32   
gb|EPS65982.1|  hypothetical protein M569_08795                         127   8e-32   
ref|XP_008787361.1|  PREDICTED: hexokinase-2-like                       129   8e-32   
gb|ACN25682.1|  unknown                                                 128   1e-31   
ref|XP_007160669.1|  hypothetical protein PHAVU_001G007000g             128   1e-31   
ref|XP_001762951.1|  hexokinase protein HXK6                            128   1e-31   
gb|ACN35115.1|  unknown                                                 127   2e-31   
ref|NP_001152293.1|  hexokinase-1                                       127   3e-31   
ref|XP_010271549.1|  PREDICTED: probable hexokinase-like 2 protein      127   4e-31   
gb|EMT08969.1|  Hexokinase-5                                            126   4e-31   
gb|ABG36927.1|  hexokinase 3                                            120   5e-31   
ref|XP_002987642.1|  hypothetical protein SELMODRAFT_269299             126   6e-31   
gb|AAT01343.1|  putative hexokinase                                     126   6e-31   
ref|XP_002441001.1|  hypothetical protein SORBIDRAFT_09g018720          125   9e-31   
gb|ABG36926.1|  hexokinase 2                                            119   2e-30   
ref|XP_006654666.1|  PREDICTED: hexokinase-5-like                       124   3e-30   
ref|XP_001779478.1|  hexokinase protein HXK11                           124   3e-30   
ref|XP_003545034.1|  PREDICTED: hexokinase-2, chloroplastic-like        124   3e-30   
ref|XP_004962258.1|  PREDICTED: hexokinase-10-like                      124   5e-30   
gb|EMS52197.1|  Hexokinase-8                                            123   5e-30   
gb|EMS55979.1|  Hexokinase-5                                            122   9e-30   
gb|KHN05494.1|  Hexokinase-3                                            122   1e-29   
ref|XP_006657535.1|  PREDICTED: hexokinase-4, chloroplastic-like        120   7e-29   
ref|XP_001760948.1|  hexokinase protein HXK4                            119   1e-28   
gb|ABG36925.1|  hexokinase 1                                            114   2e-28   
ref|XP_010921911.1|  PREDICTED: hexokinase-3-like isoform X2            119   2e-28   
gb|AAX84838.1|  hexokinase                                              114   4e-28   
emb|CBI23516.3|  unnamed protein product                                117   9e-28   
ref|XP_003635485.1|  PREDICTED: probable hexokinase-like 2 protein      117   1e-27   
gb|AHZ34665.1|  hexokinase 3 (chloroplast)                              117   1e-27   
gb|EMT24694.1|  Hexokinase-10                                           116   2e-27   
ref|XP_009375879.1|  PREDICTED: probable hexokinase-like 2 protein      113   3e-26   
ref|XP_009354634.1|  PREDICTED: probable hexokinase-like 2 protein      112   7e-26   
ref|XP_010536108.1|  PREDICTED: hexokinase-4-like isoform X2            111   1e-25   
ref|XP_010536107.1|  PREDICTED: hexokinase-4-like isoform X1            111   1e-25   
ref|XP_010536106.1|  PREDICTED: hexokinase-4-like                       110   2e-25   
ref|XP_008365574.1|  PREDICTED: probable hexokinase-like 2 protein      111   2e-25   
ref|XP_010665884.1|  PREDICTED: hexokinase-1-like                       110   4e-25   
ref|XP_006645311.1|  PREDICTED: hexokinase-3-like                       109   6e-25   



>ref|XP_007215964.1| hypothetical protein PRUPE_ppa011439mg [Prunus persica]
 gb|EMJ17163.1| hypothetical protein PRUPE_ppa011439mg [Prunus persica]
Length=210

 Score =   214 bits (545),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 98/124 (79%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            RH +RSSGRWA+  A++KELEEKCGTP GKLRQVADAMAVEMHAGLASEGGSKLKM+ISY
Sbjct  24   RHRIRSSGRWARATAIIKELEEKCGTPIGKLRQVADAMAVEMHAGLASEGGSKLKMIISY  83

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLP+G E+GLFYALDLGGTNFRV+RVQLGGK +G++++E  EVSIP +LMVG+S+ALF
Sbjct  84   VDNLPTGTEKGLFYALDLGGTNFRVLRVQLGGKGRGIISQEFTEVSIPENLMVGTSDALF  143

Query  494  DFIA  505
            D+IA
Sbjct  144  DYIA  147



>ref|XP_008387435.1| PREDICTED: hexokinase-2-like [Malus domestica]
Length=291

 Score =   215 bits (548),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 99/124 (80%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            RH MRSSGRWA+  A++KELEEKCGTP GKLRQVADAMAVEMHAGLASEGGSKLKM+ISY
Sbjct  24   RHRMRSSGRWARASAIIKELEEKCGTPTGKLRQVADAMAVEMHAGLASEGGSKLKMIISY  83

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLP+G+E+GLFYALDLGGTNFRV+RVQLGGK +G++++E  EVSIP +LMVG+S+ALF
Sbjct  84   VDNLPTGNEKGLFYALDLGGTNFRVLRVQLGGKGRGIISQEFTEVSIPENLMVGTSDALF  143

Query  494  DFIA  505
            D+IA
Sbjct  144  DYIA  147



>ref|XP_009338735.1| PREDICTED: hexokinase-1-like isoform X2 [Pyrus x bretschneideri]
Length=398

 Score =   218 bits (554),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 100/124 (81%), Positives = 117/124 (94%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            RHHMR+SGRWA+  A++KELEEKCGTP GKLRQVADAMAVEMHAGLASEGGSKLKM+ISY
Sbjct  24   RHHMRNSGRWARASAIIKELEEKCGTPTGKLRQVADAMAVEMHAGLASEGGSKLKMIISY  83

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLP+G+E+GLFYALDLGGTNFRVMRVQLGGK +G++++E  EVSIP +LMVG+S+ALF
Sbjct  84   VDNLPTGNEKGLFYALDLGGTNFRVMRVQLGGKGRGIISQEFTEVSIPENLMVGTSDALF  143

Query  494  DFIA  505
            D+IA
Sbjct  144  DYIA  147



>ref|XP_009338734.1| PREDICTED: hexokinase-1-like isoform X1 [Pyrus x bretschneideri]
Length=497

 Score =   219 bits (557),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 100/124 (81%), Positives = 117/124 (94%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            RHHMR+SGRWA+  A++KELEEKCGTP GKLRQVADAMAVEMHAGLASEGGSKLKM+ISY
Sbjct  24   RHHMRNSGRWARASAIIKELEEKCGTPTGKLRQVADAMAVEMHAGLASEGGSKLKMIISY  83

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLP+G+E+GLFYALDLGGTNFRVMRVQLGGK +G++++E  EVSIP +LMVG+S+ALF
Sbjct  84   VDNLPTGNEKGLFYALDLGGTNFRVMRVQLGGKGRGIISQEFTEVSIPENLMVGTSDALF  143

Query  494  DFIA  505
            D+IA
Sbjct  144  DYIA  147



>ref|XP_008458873.1| PREDICTED: hexokinase-1-like isoform X3 [Cucumis melo]
 ref|XP_008458879.1| PREDICTED: hexokinase-1-like isoform X3 [Cucumis melo]
 ref|XP_008458886.1| PREDICTED: hexokinase-1-like isoform X3 [Cucumis melo]
 ref|XP_008458893.1| PREDICTED: hexokinase-1-like isoform X3 [Cucumis melo]
 ref|XP_008458902.1| PREDICTED: hexokinase-1-like isoform X3 [Cucumis melo]
 ref|XP_008458909.1| PREDICTED: hexokinase-1-like isoform X3 [Cucumis melo]
 ref|XP_008458916.1| PREDICTED: hexokinase-1-like isoform X3 [Cucumis melo]
 ref|XP_008458922.1| PREDICTED: hexokinase-1-like isoform X3 [Cucumis melo]
 ref|XP_008458929.1| PREDICTED: hexokinase-1-like isoform X3 [Cucumis melo]
 ref|XP_008458934.1| PREDICTED: hexokinase-1-like isoform X3 [Cucumis melo]
 ref|XP_008458936.1| PREDICTED: hexokinase-1-like isoform X3 [Cucumis melo]
 ref|XP_008458939.1| PREDICTED: hexokinase-1-like isoform X3 [Cucumis melo]
Length=498

 Score =   219 bits (557),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            RH MR+SG+WA+ +A+L+E EEKCGTP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RHRMRNSGKWARAMAILREFEEKCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLP+GDE+GLFYALDLGGTNFRV+RVQLGGKE  VV +E +EVSIP HLMVGSSEALF
Sbjct  85   VDNLPTGDEKGLFYALDLGGTNFRVLRVQLGGKENRVVKQEFEEVSIPPHLMVGSSEALF  144

Query  494  DFIAH  508
            DFIA 
Sbjct  145  DFIAQ  149



>ref|XP_008458856.1| PREDICTED: hexokinase-1-like isoform X2 [Cucumis melo]
 ref|XP_008458864.1| PREDICTED: hexokinase-1-like isoform X2 [Cucumis melo]
Length=502

 Score =   219 bits (557),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            RH MR+SG+WA+ +A+L+E EEKCGTP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  29   RHRMRNSGKWARAMAILREFEEKCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  88

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLP+GDE+GLFYALDLGGTNFRV+RVQLGGKE  VV +E +EVSIP HLMVGSSEALF
Sbjct  89   VDNLPTGDEKGLFYALDLGGTNFRVLRVQLGGKENRVVKQEFEEVSIPPHLMVGSSEALF  148

Query  494  DFIAH  508
            DFIA 
Sbjct  149  DFIAQ  153



>gb|ACJ04704.1| hexokinase 1 [Cucumis melo]
Length=498

 Score =   218 bits (556),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            RH MR+SG+WA+ +A+L+E EEKCGTP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RHRMRNSGKWARAMAILREFEEKCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLP+GDE+GLFYALDLGGTNFRV+RVQLGGKE  VV +E +EVSIP HLMVGSSEALF
Sbjct  85   VDNLPTGDEKGLFYALDLGGTNFRVLRVQLGGKENRVVKQEFEEVSIPPHLMVGSSEALF  144

Query  494  DFIAH  508
            DFIA 
Sbjct  145  DFIAQ  149



>ref|XP_008387327.1| PREDICTED: hexokinase-1-like [Malus domestica]
Length=498

 Score =   218 bits (556),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 102/124 (82%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            RH M+SSGRWA+ +A+LKE E+KCGTP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RHRMKSSGRWARAMAILKEFEDKCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLP+GDE+GLFYALDLGGTNFRV+RVQLGGK+K VV +ES+EVSIP HLM G+SE LF
Sbjct  85   VDNLPTGDEKGLFYALDLGGTNFRVLRVQLGGKDKHVVKQESEEVSIPPHLMTGTSEGLF  144

Query  494  DFIA  505
            DFIA
Sbjct  145  DFIA  148



>ref|XP_008228416.1| PREDICTED: hexokinase-1-like [Prunus mume]
Length=497

 Score =   218 bits (554),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 100/124 (81%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            RHHMRSSGRWA+  A++KELEEKCGTP GKLRQVADAMAVEMHAGLASEGGSKLKM+ISY
Sbjct  24   RHHMRSSGRWARATAIVKELEEKCGTPIGKLRQVADAMAVEMHAGLASEGGSKLKMIISY  83

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLP+G E+GLFYALDLGGTNFRV+RVQLGGK +G++++E  EVSIP +LMVG+S+ALF
Sbjct  84   VDNLPTGTEKGLFYALDLGGTNFRVLRVQLGGKGRGIISQEFTEVSIPENLMVGTSDALF  143

Query  494  DFIA  505
            D+IA
Sbjct  144  DYIA  147



>ref|XP_004141023.1| PREDICTED: hexokinase-1-like [Cucumis sativus]
 ref|XP_004157890.1| PREDICTED: hexokinase-1-like [Cucumis sativus]
 gb|KGN60576.1| hypothetical protein Csa_2G000830 [Cucumis sativus]
Length=498

 Score =   217 bits (553),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            RH MR+SG+WA+ +A+L+E E+KCGTP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RHRMRNSGKWARAMAILREFEDKCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLP+GDE+GLFYALDLGGTNFRV+RVQLGGKE  VV +E +EVSIP HLMVGSSEALF
Sbjct  85   VDNLPTGDEKGLFYALDLGGTNFRVLRVQLGGKENRVVKQEFEEVSIPPHLMVGSSEALF  144

Query  494  DFIAH  508
            DFIA 
Sbjct  145  DFIAQ  149



>ref|XP_008458849.1| PREDICTED: hexokinase-1-like isoform X1 [Cucumis melo]
Length=583

 Score =   219 bits (558),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            RH MR+SG+WA+ +A+L+E EEKCGTP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  110  RHRMRNSGKWARAMAILREFEEKCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  169

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLP+GDE+GLFYALDLGGTNFRV+RVQLGGKE  VV +E +EVSIP HLMVGSSEALF
Sbjct  170  VDNLPTGDEKGLFYALDLGGTNFRVLRVQLGGKENRVVKQEFEEVSIPPHLMVGSSEALF  229

Query  494  DFIAH  508
            DFIA 
Sbjct  230  DFIAQ  234



>gb|AFO84084.1| hexokinase [Actinidia deliciosa]
Length=497

 Score =   217 bits (552),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 102/124 (82%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            RH MRSSGRWAK  A++KELEEKCGTP GKLRQVADAMAVEMHAGLASEGGSKLKM+IS+
Sbjct  25   RHRMRSSGRWAKAAAIVKELEEKCGTPIGKLRQVADAMAVEMHAGLASEGGSKLKMIISF  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLP+GDE+GLFYALDLGGTNFRV+RVQLGGK+  V  +E +EVSIP HLMVG+S+ALF
Sbjct  85   VDNLPTGDEKGLFYALDLGGTNFRVLRVQLGGKDNRVAKQEFEEVSIPPHLMVGTSDALF  144

Query  494  DFIA  505
            DFIA
Sbjct  145  DFIA  148



>ref|XP_002283608.1| PREDICTED: hexokinase-1-like [Vitis vinifera]
Length=497

 Score =   216 bits (550),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 101/124 (81%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            RH MRSSGRWA+ +A+L+E EEKCGTP  KLRQVADAM VEMHAGLASEGGSKLKM+ISY
Sbjct  25   RHRMRSSGRWARAMAILREFEEKCGTPIAKLRQVADAMTVEMHAGLASEGGSKLKMIISY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLP+GDE+GLFYALDLGGTNFRV+RVQLGGK+K VV +E +EVSIP HLMVGSS+ALF
Sbjct  85   VDNLPTGDEKGLFYALDLGGTNFRVLRVQLGGKDKRVVKQEFEEVSIPPHLMVGSSDALF  144

Query  494  DFIA  505
            D+IA
Sbjct  145  DYIA  148



>emb|CAN83149.1| hypothetical protein VITISV_024177 [Vitis vinifera]
Length=498

 Score =   216 bits (549),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 101/124 (81%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            RH MRSSGRWA+ +A+L+E EEKCGTP  KLRQVADAM VEMHAGLASEGGSKLKM+ISY
Sbjct  25   RHRMRSSGRWARAMAILREFEEKCGTPIAKLRQVADAMTVEMHAGLASEGGSKLKMIISY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLP+GDE+GLFYALDLGGTNFRV+RVQLGGK+K VV +E +EVSIP HLMVGSS+ALF
Sbjct  85   VDNLPTGDEKGLFYALDLGGTNFRVLRVQLGGKDKRVVKQEFEEVSIPPHLMVGSSDALF  144

Query  494  DFIA  505
            D+IA
Sbjct  145  DYIA  148



>gb|KCW82327.1| hypothetical protein EUGRSUZ_C03728 [Eucalyptus grandis]
Length=357

 Score =   212 bits (540),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            R  M+ SG+WA+ +A+LKE E+KCGTP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  26   RRQMKRSGKWARAMAILKEFEDKCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  85

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLP+G+E+GLFYALDLGGTNFRV+RVQLGGKEKGVV++E +EVSIP +LM+GSSEALF
Sbjct  86   VDNLPTGNEQGLFYALDLGGTNFRVLRVQLGGKEKGVVSQEFEEVSIPPYLMIGSSEALF  145

Query  494  DFIAH  508
            ++IA 
Sbjct  146  NYIAE  150



>gb|KCW82328.1| hypothetical protein EUGRSUZ_C03728 [Eucalyptus grandis]
Length=354

 Score =   211 bits (538),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            R  M+ SG+WA+ +A+LKE E+KCGTP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  26   RRQMKRSGKWARAMAILKEFEDKCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  85

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLP+G+E+GLFYALDLGGTNFRV+RVQLGGKEKGVV++E +EVSIP +LM+GSSEALF
Sbjct  86   VDNLPTGNEQGLFYALDLGGTNFRVLRVQLGGKEKGVVSQEFEEVSIPPYLMIGSSEALF  145

Query  494  DFIAH  508
            ++IA 
Sbjct  146  NYIAE  150



>ref|XP_009352555.1| PREDICTED: hexokinase-1 [Pyrus x bretschneideri]
Length=498

 Score =   215 bits (548),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 102/124 (82%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            RH M+SSGRWA+ +A+L+ELE+KCGTP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RHRMKSSGRWARAMAILRELEDKCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLP+GDE GLFYALDLGGTNFRV+RVQLGGKEK VV  E  EVSIP HLM G+SE LF
Sbjct  85   VDNLPTGDENGLFYALDLGGTNFRVLRVQLGGKEKHVVKHEFDEVSIPPHLMTGTSEGLF  144

Query  494  DFIA  505
            DFIA
Sbjct  145  DFIA  148



>ref|XP_008242483.1| PREDICTED: hexokinase-1 [Prunus mume]
Length=498

 Score =   214 bits (546),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 101/124 (81%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            RH M+SSGRWA+ +A+L+E E+KCGTP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RHRMKSSGRWARAMAILREFEDKCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLP+GDE+GLFYALDLGGTNFRV+RVQLGGKEK VV +E  EVSIP +LM G+SEALF
Sbjct  85   VDNLPTGDEQGLFYALDLGGTNFRVIRVQLGGKEKRVVKQEFDEVSIPPNLMTGTSEALF  144

Query  494  DFIA  505
            DFIA
Sbjct  145  DFIA  148



>gb|KDO66593.1| hypothetical protein CISIN_1g010895mg [Citrus sinensis]
Length=289

 Score =   209 bits (531),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 99/124 (80%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            R  M+S+GRWA+ VA+LKE+EEKCGTP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RRRMKSTGRWARAVAILKEMEEKCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLP+GDE+GLFYALDLGGTNFRV+RVQLGG+E  VV +E +EVSIP HLM GSS  LF
Sbjct  85   VDNLPTGDEKGLFYALDLGGTNFRVLRVQLGGREGRVVKQEFEEVSIPPHLMTGSSHELF  144

Query  494  DFIA  505
            D+IA
Sbjct  145  DYIA  148



>gb|KCW82326.1| hypothetical protein EUGRSUZ_C03728 [Eucalyptus grandis]
Length=417

 Score =   211 bits (538),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            R  M+ SG+WA+ +A+LKE E+KCGTP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  26   RRQMKRSGKWARAMAILKEFEDKCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  85

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLP+G+E+GLFYALDLGGTNFRV+RVQLGGKEKGVV++E +EVSIP +LM+GSSEALF
Sbjct  86   VDNLPTGNEQGLFYALDLGGTNFRVLRVQLGGKEKGVVSQEFEEVSIPPYLMIGSSEALF  145

Query  494  DFIAH  508
            ++IA 
Sbjct  146  NYIAE  150



>ref|XP_010915190.1| PREDICTED: hexokinase-2-like [Elaeis guineensis]
Length=500

 Score =   213 bits (542),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 103/124 (83%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            RH MRSSGRWA+ VA+LKELEEKC TP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RHRMRSSGRWARAVAILKELEEKCATPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLP+GDE GLFYALDLGGTNFRV+RVQLGGKE  VV +E +EVSIP +LMVG S  LF
Sbjct  85   VDNLPTGDETGLFYALDLGGTNFRVLRVQLGGKEGHVVKQEFEEVSIPPNLMVGRSSELF  144

Query  494  DFIA  505
            DFIA
Sbjct  145  DFIA  148



>ref|XP_006451308.1| hypothetical protein CICLE_v10008086mg [Citrus clementina]
 ref|XP_006451311.1| hypothetical protein CICLE_v10008086mg [Citrus clementina]
 gb|ESR64548.1| hypothetical protein CICLE_v10008086mg [Citrus clementina]
 gb|ESR64551.1| hypothetical protein CICLE_v10008086mg [Citrus clementina]
 gb|KDO66590.1| hypothetical protein CISIN_1g010895mg [Citrus sinensis]
 gb|KDO66591.1| hypothetical protein CISIN_1g010895mg [Citrus sinensis]
 gb|KDO66592.1| hypothetical protein CISIN_1g010895mg [Citrus sinensis]
Length=343

 Score =   209 bits (531),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 99/124 (80%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            R  M+S+GRWA+ VA+LKE+EEKCGTP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RRRMKSTGRWARAVAILKEMEEKCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLP+GDE+GLFYALDLGGTNFRV+RVQLGG+E  VV +E +EVSIP HLM GSS  LF
Sbjct  85   VDNLPTGDEKGLFYALDLGGTNFRVLRVQLGGREGRVVKQEFEEVSIPPHLMTGSSHELF  144

Query  494  DFIA  505
            D+IA
Sbjct  145  DYIA  148



>ref|XP_007203872.1| hypothetical protein PRUPE_ppa004637mg [Prunus persica]
 gb|EMJ05071.1| hypothetical protein PRUPE_ppa004637mg [Prunus persica]
Length=498

 Score =   213 bits (541),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 100/124 (81%), Positives = 112/124 (90%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            RH M+ SGRWA+ +A+L+E E+KCGTP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RHRMKCSGRWARAMAILREFEDKCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLP+GDE+GLFYALDLGGTNFRV+RVQLGGKEK VV +E  EVSIP +LM G+SEALF
Sbjct  85   VDNLPTGDEQGLFYALDLGGTNFRVIRVQLGGKEKRVVKQEFDEVSIPPNLMTGTSEALF  144

Query  494  DFIA  505
            DFIA
Sbjct  145  DFIA  148



>ref|XP_008337603.1| PREDICTED: hexokinase-1-like [Malus domestica]
Length=498

 Score =   212 bits (540),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 100/124 (81%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            RH M+SSGRWA+ +A+L+ELE+KCGTP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RHRMKSSGRWARAMAILRELEDKCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLP+GDE GLFYALDLGGTNFRV+RV+LGG EK VV +E  EVSIP HLM G+SE LF
Sbjct  85   VDNLPTGDENGLFYALDLGGTNFRVLRVRLGGNEKRVVKQEFDEVSIPPHLMTGTSEGLF  144

Query  494  DFIA  505
            DFIA
Sbjct  145  DFIA  148



>gb|AID50967.1| hexokinase 1 [Malus domestica]
Length=498

 Score =   212 bits (540),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 100/124 (81%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            RH M+SSGRWA+ +A+L+ELE+KCGTP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RHRMKSSGRWARAMAILRELEDKCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLP+GDE GLFYALDLGGTNFRV+RV+LGG EK VV +E  EVSIP HLM G+SE LF
Sbjct  85   VDNLPTGDENGLFYALDLGGTNFRVLRVRLGGNEKRVVKQEFDEVSIPPHLMTGTSEGLF  144

Query  494  DFIA  505
            DFIA
Sbjct  145  DFIA  148



>ref|XP_010049611.1| PREDICTED: hexokinase-1-like [Eucalyptus grandis]
 gb|KCW82325.1| hypothetical protein EUGRSUZ_C03728 [Eucalyptus grandis]
Length=500

 Score =   212 bits (540),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 98/124 (79%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            R  M+ SG+WA+ +A+LKE E+KCGTP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  26   RRQMKRSGKWARAMAILKEFEDKCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  85

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLP+G+E+GLFYALDLGGTNFRV+RVQLGGKEKGVV++E +EVSIP +LM+GSSEALF
Sbjct  86   VDNLPTGNEQGLFYALDLGGTNFRVLRVQLGGKEKGVVSQEFEEVSIPPYLMIGSSEALF  145

Query  494  DFIA  505
            ++IA
Sbjct  146  NYIA  149



>gb|KDO66588.1| hypothetical protein CISIN_1g010895mg [Citrus sinensis]
Length=356

 Score =   208 bits (530),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 99/124 (80%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            R  M+S+GRWA+ VA+LKE+EEKCGTP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RRRMKSTGRWARAVAILKEMEEKCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLP+GDE+GLFYALDLGGTNFRV+RVQLGG+E  VV +E +EVSIP HLM GSS  LF
Sbjct  85   VDNLPTGDEKGLFYALDLGGTNFRVLRVQLGGREGRVVKQEFEEVSIPPHLMTGSSHELF  144

Query  494  DFIA  505
            D+IA
Sbjct  145  DYIA  148



>ref|XP_007013021.1| Hexokinase 1 isoform 2 [Theobroma cacao]
 gb|EOY30640.1| Hexokinase 1 isoform 2 [Theobroma cacao]
Length=498

 Score =   211 bits (538),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/124 (79%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            RH ++SSG+WA+T+A+LKE EEKCGTP  KL+QVADAM VEMHAGLASEGGSKLKM+ISY
Sbjct  25   RHRIKSSGKWARTLAILKEFEEKCGTPISKLKQVADAMTVEMHAGLASEGGSKLKMIISY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLP+GDE+GLFYALDLGGTNFRV+RVQLGGKE  VV +E +EVSIP HLM GSS+ALF
Sbjct  85   VDNLPTGDEKGLFYALDLGGTNFRVLRVQLGGKESRVVKQEFEEVSIPPHLMTGSSDALF  144

Query  494  DFIA  505
            D+IA
Sbjct  145  DYIA  148



>gb|ADZ96378.1| hexokinase 1 [Eriobotrya japonica]
Length=497

 Score =   211 bits (538),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/124 (79%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            R  MRSSGRWA+  A++KELEEKCGTP GKLRQVADAMAVEMHAGLASEGGSKLKM+ISY
Sbjct  24   RRRMRSSGRWARASAIIKELEEKCGTPTGKLRQVADAMAVEMHAGLASEGGSKLKMIISY  83

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLP+G+E+GLFYALDLGGTNFRV+RVQLGGK +G++++E  EVSIP +LMVG+S+ALF
Sbjct  84   VDNLPTGNEKGLFYALDLGGTNFRVLRVQLGGKGRGIISQEFIEVSIPENLMVGTSDALF  143

Query  494  DFIA  505
            D+IA
Sbjct  144  DYIA  147



>emb|CDP03250.1| unnamed protein product [Coffea canephora]
Length=497

 Score =   211 bits (538),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 101/124 (81%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            R+ M+S G+WAK +A+LKE EE+CGTP  KLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RNRMKSLGKWAKVMAILKEFEEECGTPTAKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLP+GDE GLFYALDLGGTNFRV+RVQLGG EK VV RE QEVSIP HLMVGS+EALF
Sbjct  85   VDNLPTGDERGLFYALDLGGTNFRVLRVQLGGHEKRVVKREFQEVSIPPHLMVGSTEALF  144

Query  494  DFIA  505
            D+IA
Sbjct  145  DYIA  148



>gb|AEJ95926.1| HXK1 [Vitis vinifera]
Length=470

 Score =   211 bits (536),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 99/121 (82%), Positives = 112/121 (93%), Gaps = 0/121 (0%)
 Frame = +2

Query  143  MRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDN  322
            MRSSGRWA+ +A+L+E EEKCGTP  KLRQVADAM VEMHAGLASEGGSKLKM+ISYVDN
Sbjct  1    MRSSGRWARAMAILREFEEKCGTPIAKLRQVADAMTVEMHAGLASEGGSKLKMIISYVDN  60

Query  323  LPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFI  502
            LP+GDE+GLFYALDLGGTNFRV+RVQLGGK+K VV +E +EVSIP HLMVGSS+ALFD+I
Sbjct  61   LPTGDEKGLFYALDLGGTNFRVLRVQLGGKDKRVVKQEFEEVSIPPHLMVGSSDALFDYI  120

Query  503  A  505
            A
Sbjct  121  A  121



>ref|XP_008380854.1| PREDICTED: hexokinase-1-like isoform X2 [Malus domestica]
Length=398

 Score =   209 bits (531),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/124 (79%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            RH MRSSGRWA+  A++KELEEKCGTP  KLRQVADAMAVEMHAGLASEGGSKLKM+ISY
Sbjct  24   RHRMRSSGRWARASAIIKELEEKCGTPTEKLRQVADAMAVEMHAGLASEGGSKLKMIISY  83

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLP+G+E+GLFYALDLGGTNFRV+RV LGGK +G+V++E  EVSIP +LMVG+S+ALF
Sbjct  84   VDNLPTGNEKGLFYALDLGGTNFRVLRVHLGGKGRGIVSQEFIEVSIPENLMVGTSDALF  143

Query  494  DFIA  505
            D+IA
Sbjct  144  DYIA  147



>ref|XP_002514221.1| hexokinase, putative [Ricinus communis]
 gb|EEF48175.1| hexokinase, putative [Ricinus communis]
Length=498

 Score =   211 bits (536),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 99/124 (80%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            RH M+SSGRW + +A+L E EEKCGTP GKLRQVADAM VEMHAGLASEGGSKLKM+ISY
Sbjct  25   RHRMKSSGRWTRAMAILGEFEEKCGTPVGKLRQVADAMTVEMHAGLASEGGSKLKMIISY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLP+GDE+GLFYALDLGGTNFRV+RV LGGKE  VV +E +EVSIP HLM+GSS+ALF
Sbjct  85   VDNLPTGDEKGLFYALDLGGTNFRVLRVLLGGKEDRVVKQEFEEVSIPPHLMIGSSDALF  144

Query  494  DFIA  505
            DFIA
Sbjct  145  DFIA  148



>gb|KHN40379.1| Hexokinase-2 [Glycine soja]
Length=503

 Score =   211 bits (536),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 98/124 (79%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            RH MRSSG+W + VA++KE EE+CGTP GKLRQVADAM VEMH GLASEGGSKLKMLI+Y
Sbjct  23   RHRMRSSGKWGRAVAIVKEFEEQCGTPIGKLRQVADAMNVEMHEGLASEGGSKLKMLITY  82

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLPSGDE+G+FYALDLGGTNFR +RV LGGKEKGVVN ES++VSIP HLM GSS  LF
Sbjct  83   VDNLPSGDEKGVFYALDLGGTNFRTLRVHLGGKEKGVVNLESEKVSIPPHLMTGSSHELF  142

Query  494  DFIA  505
            DF+A
Sbjct  143  DFVA  146



>ref|XP_003516735.1| PREDICTED: hexokinase-1-like [Glycine max]
Length=496

 Score =   211 bits (536),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 100/124 (81%), Positives = 109/124 (88%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            RH MRSSG+W + VA++KE EE+C TP GKLRQVADAM VEMHAGLASEGGSKLKMLI+Y
Sbjct  25   RHRMRSSGKWGRVVAIVKEFEEQCRTPIGKLRQVADAMDVEMHAGLASEGGSKLKMLITY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLPSGDE+GLFYALDLGGTNFR +RV LGGKEKGVV  ES EVSIP HLM GSS+ LF
Sbjct  85   VDNLPSGDEKGLFYALDLGGTNFRTLRVHLGGKEKGVVKIESDEVSIPPHLMTGSSQELF  144

Query  494  DFIA  505
            DFIA
Sbjct  145  DFIA  148



>ref|XP_006451309.1| hypothetical protein CICLE_v10008086mg [Citrus clementina]
 gb|ESR64549.1| hypothetical protein CICLE_v10008086mg [Citrus clementina]
 gb|KDO66589.1| hypothetical protein CISIN_1g010895mg [Citrus sinensis]
Length=402

 Score =   208 bits (529),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 99/124 (80%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            R  M+S+GRWA+ VA+LKE+EEKCGTP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RRRMKSTGRWARAVAILKEMEEKCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLP+GDE+GLFYALDLGGTNFRV+RVQLGG+E  VV +E +EVSIP HLM GSS  LF
Sbjct  85   VDNLPTGDEKGLFYALDLGGTNFRVLRVQLGGREGRVVKQEFEEVSIPPHLMTGSSHELF  144

Query  494  DFIA  505
            D+IA
Sbjct  145  DYIA  148



>ref|XP_003516783.1| PREDICTED: hexokinase-1-like [Glycine max]
Length=496

 Score =   210 bits (535),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 98/124 (79%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            RH MRSSG+W + VA++KE EE+CGTP GKLRQVADAM VEMH GLASEGGSKLKMLI+Y
Sbjct  23   RHRMRSSGKWGRAVAIVKEFEEQCGTPIGKLRQVADAMNVEMHEGLASEGGSKLKMLITY  82

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLPSGDE+G+FYALDLGGTNFR +RV LGGKEKGVVN ES++VSIP HLM GSS  LF
Sbjct  83   VDNLPSGDEKGVFYALDLGGTNFRTLRVHLGGKEKGVVNLESEKVSIPPHLMTGSSHELF  142

Query  494  DFIA  505
            DF+A
Sbjct  143  DFVA  146



>gb|KDP33801.1| hypothetical protein JCGZ_07372 [Jatropha curcas]
Length=498

 Score =   211 bits (536),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 99/124 (80%), Positives = 112/124 (90%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            RH M+SSGRWA+ +A+L+E EEKCGTP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RHRMQSSGRWARAMAILREFEEKCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLP+GDE+GLFYALDLGGTNFRV+RV LGG+E  VV +E +EVSIP HLM GSS+ALF
Sbjct  85   VDNLPTGDEKGLFYALDLGGTNFRVIRVLLGGREDRVVKQEFEEVSIPPHLMTGSSDALF  144

Query  494  DFIA  505
            D+IA
Sbjct  145  DYIA  148



>gb|KDO66587.1| hypothetical protein CISIN_1g010895mg [Citrus sinensis]
Length=424

 Score =   208 bits (530),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 99/124 (80%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            R  M+S+GRWA+ VA+LKE+EEKCGTP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RRRMKSTGRWARAVAILKEMEEKCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLP+GDE+GLFYALDLGGTNFRV+RVQLGG+E  VV +E +EVSIP HLM GSS  LF
Sbjct  85   VDNLPTGDEKGLFYALDLGGTNFRVLRVQLGGREGRVVKQEFEEVSIPPHLMTGSSHELF  144

Query  494  DFIA  505
            D+IA
Sbjct  145  DYIA  148



>gb|KDO66582.1| hypothetical protein CISIN_1g010895mg [Citrus sinensis]
Length=465

 Score =   209 bits (532),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 99/124 (80%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            R  M+S+GRWA+ VA+LKE+EEKCGTP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RRRMKSTGRWARAVAILKEMEEKCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLP+GDE+GLFYALDLGGTNFRV+RVQLGG+E  VV +E +EVSIP HLM GSS  LF
Sbjct  85   VDNLPTGDEKGLFYALDLGGTNFRVLRVQLGGREGRVVKQEFEEVSIPPHLMTGSSHELF  144

Query  494  DFIA  505
            D+IA
Sbjct  145  DYIA  148



>ref|NP_001275786.1| hexokinase [Citrus sinensis]
 ref|XP_006451310.1| hypothetical protein CICLE_v10008086mg [Citrus clementina]
 gb|AAG28503.1|AF196966_1 hexokinase [Citrus sinensis]
 gb|ESR64550.1| hypothetical protein CICLE_v10008086mg [Citrus clementina]
 gb|KDO66583.1| hypothetical protein CISIN_1g010895mg [Citrus sinensis]
Length=498

 Score =   209 bits (532),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 99/124 (80%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            R  M+S+GRWA+ VA+LKE+EEKCGTP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RRRMKSTGRWARAVAILKEMEEKCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLP+GDE+GLFYALDLGGTNFRV+RVQLGG+E  VV +E +EVSIP HLM GSS  LF
Sbjct  85   VDNLPTGDEKGLFYALDLGGTNFRVLRVQLGGREGRVVKQEFEEVSIPPHLMTGSSHELF  144

Query  494  DFIA  505
            D+IA
Sbjct  145  DYIA  148



>gb|AHY84731.1| hexokinase [Manihot esculenta]
Length=498

 Score =   209 bits (531),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 97/124 (78%), Positives = 112/124 (90%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            RH MR SGRWA+ +A+L+E E+KCGTP GKLRQVADAM VEMHAGLASEGGSKLKML+SY
Sbjct  25   RHRMRCSGRWARAMAILREFEDKCGTPLGKLRQVADAMTVEMHAGLASEGGSKLKMLLSY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLP+GDE+GLFYALDLGGTNFRV+RV LGGK+  VV +E +EVSIP HLM+GSS+ALF
Sbjct  85   VDNLPTGDEKGLFYALDLGGTNFRVIRVVLGGKDDRVVKQEFEEVSIPPHLMIGSSDALF  144

Query  494  DFIA  505
            D+IA
Sbjct  145  DYIA  148



>ref|XP_007152969.1| hypothetical protein PHAVU_004G175500g [Phaseolus vulgaris]
 gb|ESW24963.1| hypothetical protein PHAVU_004G175500g [Phaseolus vulgaris]
Length=500

 Score =   209 bits (531),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 97/124 (78%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            RHHMRSSG+W + VA+++E E++CGTP  KLR VADA+ VEMHAGLASEGGSKLKMLI++
Sbjct  25   RHHMRSSGKWGRAVAIVREFEKQCGTPIAKLRLVADAIDVEMHAGLASEGGSKLKMLITF  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLPSGDE+GLFYALDLGGTNFR +RVQLGGKEKGVVN ES+EVSIP HLM G S  LF
Sbjct  85   VDNLPSGDEKGLFYALDLGGTNFRTLRVQLGGKEKGVVNLESEEVSIPPHLMTGCSHELF  144

Query  494  DFIA  505
            DFIA
Sbjct  145  DFIA  148



>ref|XP_011093636.1| PREDICTED: hexokinase-1 [Sesamum indicum]
Length=496

 Score =   208 bits (530),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 101/124 (81%), Positives = 111/124 (90%), Gaps = 1/124 (1%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            R  M+SSGRWAK  A+L+ELEEKCGTP  KLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RRQMKSSGRWAKAEAILRELEEKCGTPTAKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLP+GDE+GLFYALDLGGTNFRVMRVQLGGK+ G++ +E +EVSIP HLMVGSS  LF
Sbjct  85   VDNLPTGDEKGLFYALDLGGTNFRVMRVQLGGKD-GIMKQEFEEVSIPPHLMVGSSHELF  143

Query  494  DFIA  505
            DFIA
Sbjct  144  DFIA  147



>ref|NP_001280783.1| uncharacterized protein LOC103443741 [Malus domestica]
 gb|AFU56883.1| hexokinase [Malus domestica]
Length=497

 Score =   208 bits (529),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 97/124 (78%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            RH MRSSGRWA+  A++KELEEKCGTP  KLRQVADAMAVEMHAGLASEGGSKLK++ISY
Sbjct  24   RHRMRSSGRWARASAIIKELEEKCGTPTEKLRQVADAMAVEMHAGLASEGGSKLKVIISY  83

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLP+G+E+GLFYALDLGGTNFRV+RV+LGGK +G+V++E  EVSIP +LMVG+S+ALF
Sbjct  84   VDNLPTGNEKGLFYALDLGGTNFRVLRVRLGGKGRGIVSQEFIEVSIPENLMVGTSDALF  143

Query  494  DFIA  505
            D+IA
Sbjct  144  DYIA  147



>ref|XP_009406171.1| PREDICTED: hexokinase-2-like [Musa acuminata subsp. malaccensis]
Length=500

 Score =   208 bits (529),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 101/124 (81%), Positives = 109/124 (88%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            RH MRSSGR A+  ALLKELEE+C TP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RHRMRSSGRCARAAALLKELEERCATPLGKLRQVADAMMVEMHAGLASEGGSKLKMLISY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VD LP+GDE GLFYALDLGGTNFRV+RVQLGGKE+ VV +E +EVSIP HLMVG S+ LF
Sbjct  85   VDKLPTGDETGLFYALDLGGTNFRVLRVQLGGKEQRVVKKEPKEVSIPPHLMVGGSDELF  144

Query  494  DFIA  505
            DFIA
Sbjct  145  DFIA  148



>ref|XP_010110881.1| hypothetical protein L484_006996 [Morus notabilis]
 gb|EXC28700.1| hypothetical protein L484_006996 [Morus notabilis]
Length=386

 Score =   204 bits (520),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 99/124 (80%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            RH M+SSG+WA+ +A+LKE EEK  TP GKLRQVADAMAVEMHAGLASEGGSKLKMLISY
Sbjct  26   RHRMKSSGKWARAMAILKEFEEKGATPIGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  85

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLP+GDE+GL+YALDLGGTNFRV+RVQLGGKE  V  +E  EVSIP HLM GSS+ALF
Sbjct  86   VDNLPTGDEKGLYYALDLGGTNFRVLRVQLGGKEGRVDKQEFDEVSIPPHLMTGSSDALF  145

Query  494  DFIA  505
            DFIA
Sbjct  146  DFIA  149



>ref|XP_010249484.1| PREDICTED: hexokinase-1 [Nelumbo nucifera]
Length=498

 Score =   207 bits (527),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 98/124 (79%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            RH MR SGRWA+ +A+L+E EEKC TP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RHRMRCSGRWARAMAILREFEEKCATPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLP+G+E GLFYALDLGGTNFRV+RVQLGGK+  VVN+E  EVSIP HLM G SE LF
Sbjct  85   VDNLPTGNERGLFYALDLGGTNFRVLRVQLGGKDGRVVNQEFAEVSIPPHLMTGGSEELF  144

Query  494  DFIA  505
            D+IA
Sbjct  145  DYIA  148



>ref|XP_009601881.1| PREDICTED: hexokinase-2-like [Nicotiana tomentosiformis]
Length=498

 Score =   207 bits (526),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 99/125 (79%), Positives = 112/125 (90%), Gaps = 1/125 (1%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            RH M++SG+WAK + +LKE EEKC TP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RHKMKNSGKWAKAMDILKEFEEKCETPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVG-SSEAL  490
            VDNLP+GDE GLFYALDLGGTNFRVMRVQLGGKEK +V +E +EVSIP+++M G SS+AL
Sbjct  85   VDNLPTGDETGLFYALDLGGTNFRVMRVQLGGKEKRIVKQEVKEVSIPKNVMAGSSSDAL  144

Query  491  FDFIA  505
            FDFIA
Sbjct  145  FDFIA  149



>gb|KHN40378.1| Hexokinase-1 [Glycine soja]
Length=482

 Score =   206 bits (525),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 98/123 (80%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = +2

Query  137  HHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYV  316
            + MRSSG+W + VA++KE EE+C TP GKLRQVADAM VEMHAGLASEGGSKLKMLI+YV
Sbjct  12   YRMRSSGKWGRVVAIVKEFEEQCRTPIGKLRQVADAMDVEMHAGLASEGGSKLKMLITYV  71

Query  317  DNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFD  496
            DNLPSGDE+GLFYALDLGGTNFR +RV LGGKEKGVV  ES EVSIP HLM GSS+ LFD
Sbjct  72   DNLPSGDEKGLFYALDLGGTNFRTLRVHLGGKEKGVVKIESDEVSIPPHLMTGSSQELFD  131

Query  497  FIA  505
            FIA
Sbjct  132  FIA  134



>ref|XP_009795017.1| PREDICTED: hexokinase-2-like [Nicotiana sylvestris]
Length=498

 Score =   206 bits (525),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 99/125 (79%), Positives = 112/125 (90%), Gaps = 1/125 (1%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            RH M++SG+WAK + +LKE EEKC TP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RHKMKNSGKWAKAMDMLKEFEEKCETPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVG-SSEAL  490
            VDNLP+GDE GLFYALDLGGTNFRVMRVQLGGKEK +V +E +EVSIP+++M G SS+AL
Sbjct  85   VDNLPTGDETGLFYALDLGGTNFRVMRVQLGGKEKRIVKQEVKEVSIPKNVMAGSSSDAL  144

Query  491  FDFIA  505
            FDFIA
Sbjct  145  FDFIA  149



>ref|XP_010688341.1| PREDICTED: hexokinase-1 [Beta vulgaris subsp. vulgaris]
Length=498

 Score =   206 bits (525),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 98/124 (79%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            R  M+SS +WA+ +A+LKEL+EKC TP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RQRMKSSSKWARAMAILKELDEKCETPLGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLP+GDE GLFYALDLGGTNFRV+RV+LGGKEKGVV +E  EVSIP  LMVG+SE LF
Sbjct  85   VDNLPTGDEHGLFYALDLGGTNFRVLRVKLGGKEKGVVQQEFDEVSIPPELMVGTSEELF  144

Query  494  DFIA  505
            D+IA
Sbjct  145  DYIA  148



>ref|XP_011014418.1| PREDICTED: hexokinase-1-like [Populus euphratica]
Length=498

 Score =   206 bits (525),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 98/124 (79%), Positives = 109/124 (88%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            RH MR SGRWA+ +A+L+E EE CGTP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RHRMRCSGRWARAMAILREFEENCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLPSG+E GLFYALDLGGTNFRV+RV LGG++ GVV +E +EVSIP HLM GSS+ALF
Sbjct  85   VDNLPSGEENGLFYALDLGGTNFRVIRVLLGGRDGGVVKQEFEEVSIPPHLMTGSSDALF  144

Query  494  DFIA  505
             FIA
Sbjct  145  GFIA  148



>gb|AAS60195.1| hexokinase 4a [Nicotiana tabacum]
Length=498

 Score =   206 bits (525),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 99/125 (79%), Positives = 112/125 (90%), Gaps = 1/125 (1%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            RH M++SG+WAK + +LKE EEKC TP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RHKMKNSGKWAKAMDILKEFEEKCETPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVG-SSEAL  490
            VDNLP+GDE GLFYALDLGGTNFRVMRVQLGGKEK +V +E +EVSIP+++M G SS+AL
Sbjct  85   VDNLPTGDETGLFYALDLGGTNFRVMRVQLGGKEKRIVKQEVKEVSIPKNVMAGSSSDAL  144

Query  491  FDFIA  505
            FDFIA
Sbjct  145  FDFIA  149



>ref|XP_002325031.1| Hexokinase 1 family protein [Populus trichocarpa]
 gb|EEF03596.1| Hexokinase 1 family protein [Populus trichocarpa]
Length=498

 Score =   206 bits (525),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 98/124 (79%), Positives = 109/124 (88%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            RH MR SGRWA+ +A+L+E EE CGTP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RHRMRCSGRWARAMAILREFEENCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLPSG+E GLFYALDLGGTNFRV+RV LGG++ GVV +E +EVSIP HLM GSS+ALF
Sbjct  85   VDNLPSGEENGLFYALDLGGTNFRVIRVLLGGRDGGVVKQEFEEVSIPPHLMTGSSDALF  144

Query  494  DFIA  505
             FIA
Sbjct  145  GFIA  148



>ref|XP_009392524.1| PREDICTED: hexokinase-2-like [Musa acuminata subsp. malaccensis]
Length=500

 Score =   206 bits (525),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 99/124 (80%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            R+ MRSSGRWA+  ALLKELEE+C TP GKLRQVADAMAVEMHAGLASEGGSKLKMLISY
Sbjct  25   RYRMRSSGRWARVAALLKELEERCATPVGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            V+NLP+G+E GLFYALDLGGTNFRV+RVQLGGKE+ V+ +E +EVSIP  LMVG S+ LF
Sbjct  85   VNNLPTGEETGLFYALDLGGTNFRVLRVQLGGKERHVLKQEFEEVSIPPLLMVGGSDELF  144

Query  494  DFIA  505
            DFIA
Sbjct  145  DFIA  148



>ref|XP_011008120.1| PREDICTED: hexokinase-1-like [Populus euphratica]
Length=498

 Score =   206 bits (524),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 98/124 (79%), Positives = 109/124 (88%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            RH MR SGRWA+ +A+L+E EE CGTP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RHRMRCSGRWARAMAILREFEENCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLPSG+E GLFYALDLGGTNFRV+RV LGG++ GVV +E +EVSIP HLM GSS+ALF
Sbjct  85   VDNLPSGEENGLFYALDLGGTNFRVIRVLLGGRDGGVVKQEFEEVSIPPHLMTGSSDALF  144

Query  494  DFIA  505
             FIA
Sbjct  145  GFIA  148



>ref|XP_004287480.1| PREDICTED: hexokinase-1 [Fragaria vesca subsp. vesca]
Length=498

 Score =   206 bits (524),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 98/124 (79%), Positives = 109/124 (88%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            R  ++SS RWA+ +A+LKE EEKC TP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RRRLKSSRRWARAMAILKEFEEKCDTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLP+GDE+GLFYALDLGGTNFRV+RVQLGGKEK V+ +E  EVSIP HLM G+SE LF
Sbjct  85   VDNLPTGDEKGLFYALDLGGTNFRVLRVQLGGKEKRVIKQEFDEVSIPPHLMTGTSEGLF  144

Query  494  DFIA  505
            DFIA
Sbjct  145  DFIA  148



>gb|AAS60194.1| hexokinase 3 [Nicotiana tabacum]
Length=497

 Score =   206 bits (523),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            RH MR S +WA+  A+LKE EEKCGTP  KL+QVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RHRMRKSSKWARARAILKEFEEKCGTPDAKLKQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLP+GDEEG+FYALDLGGTNFRV+RVQLGGK+ G+V++E  E SIP +LMVG+SEALF
Sbjct  85   VDNLPTGDEEGVFYALDLGGTNFRVLRVQLGGKDGGIVHQEFTEASIPPNLMVGTSEALF  144

Query  494  DFIA  505
            D+IA
Sbjct  145  DYIA  148



>ref|XP_009777315.1| PREDICTED: hexokinase-2 [Nicotiana sylvestris]
Length=497

 Score =   206 bits (523),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            RH MR S +WA+  A+LKE EEKCGTP  KL+QVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RHRMRKSSKWARARAILKEFEEKCGTPDAKLKQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLP+GDEEG+FYALDLGGTNFRV+RVQLGGK+ G+V++E  E SIP +LMVG+SEALF
Sbjct  85   VDNLPTGDEEGVFYALDLGGTNFRVLRVQLGGKDGGIVHQEFTEASIPPNLMVGTSEALF  144

Query  494  DFIA  505
            D+IA
Sbjct  145  DYIA  148



>gb|KJB83118.1| hypothetical protein B456_013G230400 [Gossypium raimondii]
Length=364

 Score =   202 bits (513),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = +2

Query  137  HHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYV  316
            H M+SSG+WA+  ++LK+ EEKCGTP  KL+QVADAM VEMHAGLASEGGSKLKM+ISYV
Sbjct  26   HRMKSSGKWAQAQSILKDFEEKCGTPISKLKQVADAMTVEMHAGLASEGGSKLKMIISYV  85

Query  317  DNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFD  496
            DNLP+GDE+GLFYALDLGGTNFRV+RV LGGKE  VV +E +EVSIP HLM GSS+ALFD
Sbjct  86   DNLPTGDEKGLFYALDLGGTNFRVLRVHLGGKEHRVVKQEFEEVSIPPHLMTGSSDALFD  145

Query  497  FIA  505
            +IA
Sbjct  146  YIA  148



>gb|AAS60196.1| hexokinase 4b [Nicotiana tabacum]
Length=498

 Score =   205 bits (522),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 99/125 (79%), Positives = 111/125 (89%), Gaps = 1/125 (1%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            RH M +SG+WAK + +LKE EEKC TP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RHKMENSGKWAKAMDILKEFEEKCETPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVG-SSEAL  490
            VDNLP+GDE GLFYALDLGGTNFRVMRVQLGGKEK +V +E +EVSIP+++M G SS+AL
Sbjct  85   VDNLPTGDETGLFYALDLGGTNFRVMRVQLGGKEKRIVKQEVKEVSIPKNVMAGSSSDAL  144

Query  491  FDFIA  505
            FDFIA
Sbjct  145  FDFIA  149



>ref|XP_008795842.1| PREDICTED: hexokinase-2-like isoform X2 [Phoenix dactylifera]
Length=500

 Score =   205 bits (522),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 100/124 (81%), Positives = 109/124 (88%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            RH MRSSGRWA+ +A+LK+LEEKC TP GKLRQVADAM VEM AGLASEGGSKLKMLISY
Sbjct  25   RHRMRSSGRWARAMAILKDLEEKCATPIGKLRQVADAMTVEMLAGLASEGGSKLKMLISY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLP+GDE GLFYALDLGGTNFRV+RVQLGGK   VV +E +EVSIP +LMVGSS  LF
Sbjct  85   VDNLPTGDETGLFYALDLGGTNFRVLRVQLGGKGGYVVRQEFEEVSIPPNLMVGSSSELF  144

Query  494  DFIA  505
            DFIA
Sbjct  145  DFIA  148



>ref|XP_008795834.1| PREDICTED: hexokinase-2-like isoform X1 [Phoenix dactylifera]
Length=526

 Score =   205 bits (522),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 100/124 (81%), Positives = 109/124 (88%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            RH MRSSGRWA+ +A+LK+LEEKC TP GKLRQVADAM VEM AGLASEGGSKLKMLISY
Sbjct  25   RHRMRSSGRWARAMAILKDLEEKCATPIGKLRQVADAMTVEMLAGLASEGGSKLKMLISY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLP+GDE GLFYALDLGGTNFRV+RVQLGGK   VV +E +EVSIP +LMVGSS  LF
Sbjct  85   VDNLPTGDETGLFYALDLGGTNFRVLRVQLGGKGGYVVRQEFEEVSIPPNLMVGSSSELF  144

Query  494  DFIA  505
            DFIA
Sbjct  145  DFIA  148



>ref|XP_010098150.1| hypothetical protein L484_026284 [Morus notabilis]
 gb|EXB74587.1| hypothetical protein L484_026284 [Morus notabilis]
Length=499

 Score =   205 bits (521),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            RH MRSS RW + +A++ +L+E+CGTP  KLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RHRMRSSARWVRAMAIVADLDERCGTPLAKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLP+G+E+GLFYALDLGGTNFRV+RVQLGGK+ G+VN+E  EVSIP+ LMVGSS+ LF
Sbjct  85   VDNLPTGNEKGLFYALDLGGTNFRVLRVQLGGKDGGIVNQEFAEVSIPQDLMVGSSDTLF  144

Query  494  DFIA  505
            D+IA
Sbjct  145  DYIA  148



>ref|XP_009415191.1| PREDICTED: hexokinase-2-like [Musa acuminata subsp. malaccensis]
Length=498

 Score =   205 bits (521),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 98/124 (79%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            R+ MRSSG+WA   A++KELEE+C TP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  26   RNRMRSSGKWAPVSAVVKELEERCATPVGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  85

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLP+GDE GLFYALDLGGTNFRV+RVQLGGKE  V  +E +EVSIP HLMVG S+ LF
Sbjct  86   VDNLPTGDETGLFYALDLGGTNFRVLRVQLGGKEGRVAKQEFEEVSIPPHLMVGGSDELF  145

Query  494  DFIA  505
            DFIA
Sbjct  146  DFIA  149



>gb|AHG98487.1| hexokinase [Dimocarpus longan]
Length=496

 Score =   204 bits (520),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            RH M+SSG+WA+ +A+LK+LE+KCGTP GKLRQ+ADAM VEMHAGLASEGGSKLKMLIS+
Sbjct  25   RHRMQSSGKWARAMAILKDLEDKCGTPIGKLRQIADAMTVEMHAGLASEGGSKLKMLISF  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLP+GDE+GLFYALDLGG+NFRV+RV LGGKE  VV +E +EVSIP+HLMVGSS  LF
Sbjct  85   VDNLPTGDEKGLFYALDLGGSNFRVLRVLLGGKEGHVVKQEFKEVSIPQHLMVGSSHELF  144

Query  494  DFIA  505
            +FIA
Sbjct  145  NFIA  148



>gb|AHB32106.1| hexokinase [Camellia sinensis]
Length=495

 Score =   204 bits (519),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            RH M+ SGRW++ +A+LKE EEKCGTP  KLRQVADAM VEMHAGLASEGGSKLKM+ISY
Sbjct  25   RHRMKCSGRWSQAMAILKEFEEKCGTPLSKLRQVADAMTVEMHAGLASEGGSKLKMIISY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLP+GDE+GLFYALDLGGTNFRV+RVQLGG++  VV +E  EVSIP +LM+G+S+ LF
Sbjct  85   VDNLPTGDEKGLFYALDLGGTNFRVLRVQLGGRDNHVVKQEFDEVSIPPNLMIGTSDGLF  144

Query  494  DFIA  505
            DFIA
Sbjct  145  DFIA  148



>ref|XP_010267128.1| PREDICTED: hexokinase-1-like [Nelumbo nucifera]
Length=500

 Score =   204 bits (519),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            RH MR SGRWA+ +A+LKE EEKC TP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  27   RHRMRCSGRWARAMAILKEFEEKCATPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  86

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLP+GDE+GLFYALDLGGTNFRV+RVQLGG +  V+ +E  EVSIP HLM G S+ LF
Sbjct  87   VDNLPTGDEKGLFYALDLGGTNFRVLRVQLGGNDGQVLKQEFTEVSIPPHLMTGGSDELF  146

Query  494  DFIA  505
            D+IA
Sbjct  147  DYIA  150



>gb|AHD25654.1| hexokinase 1 (chloroplast) [Camellia sinensis]
Length=495

 Score =   204 bits (519),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            RH M+ SGRW++ +A+LKE EEKCGTP  KLRQVADAM VEMHAGLASEGGSKLKM+ISY
Sbjct  25   RHRMKCSGRWSQAMAILKEFEEKCGTPLSKLRQVADAMTVEMHAGLASEGGSKLKMIISY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLP+GDE+GLFYALDLGGTNFRV+RVQLGG++  VV +E  EVSIP +LM+G+S+ LF
Sbjct  85   VDNLPTGDEKGLFYALDLGGTNFRVLRVQLGGRDNHVVKQEFDEVSIPPNLMIGTSDGLF  144

Query  494  DFIA  505
            DFIA
Sbjct  145  DFIA  148



>ref|XP_004302852.1| PREDICTED: hexokinase-1-like [Fragaria vesca subsp. vesca]
Length=498

 Score =   204 bits (519),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            R  MR  G W+K  A++KELEEKCGTP  KLRQVADAM VEMHAGLASEGGSKLKM+ISY
Sbjct  24   RQRMRCCGEWSKATAIVKELEEKCGTPIAKLRQVADAMTVEMHAGLASEGGSKLKMIISY  83

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLP+G+E+GLFYALDLGGTNFRV+RVQLGGK +G+VN+E  EVSIP  LMVG++E LF
Sbjct  84   VDNLPTGNEKGLFYALDLGGTNFRVLRVQLGGKGRGLVNQEFTEVSIPEGLMVGTTETLF  143

Query  494  DFIA  505
            DFIA
Sbjct  144  DFIA  147



>gb|AAT77511.1| hexokinase [Nicotiana sylvestris]
Length=383

 Score =   201 bits (510),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = +2

Query  137  HHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYV  316
            H MR S +WA+ +A+L+E EEKCGTP  KL+QVADAM VEMHAGLASEGGSKLKMLI+YV
Sbjct  26   HRMRKSSKWARAMAILREFEEKCGTPDAKLKQVADAMTVEMHAGLASEGGSKLKMLITYV  85

Query  317  DNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFD  496
            DNLP+GDE G+FYALDLGGTNFRV+RVQLGGK+ G+V++E  E SIP +LMVG+SEALFD
Sbjct  86   DNLPTGDEAGVFYALDLGGTNFRVLRVQLGGKDGGIVHQEFAEASIPPNLMVGTSEALFD  145

Query  497  FIA  505
            +IA
Sbjct  146  YIA  148



>ref|XP_009622660.1| PREDICTED: hexokinase-2 [Nicotiana tomentosiformis]
Length=497

 Score =   203 bits (517),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            RH MR S +WA+ +A+LKE EEKC TP  KL+QVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RHRMRKSSKWARAMAILKEFEEKCRTPDAKLKQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLP+GDEEG+FYALDLGGTNFRV+RVQLGGK+ G+V++E  E SIP +LMVG+SEALF
Sbjct  85   VDNLPTGDEEGVFYALDLGGTNFRVLRVQLGGKDGGIVHQEFAEASIPPNLMVGTSEALF  144

Query  494  DFIA  505
            D+IA
Sbjct  145  DYIA  148



>ref|XP_004503491.1| PREDICTED: hexokinase-1-like isoform X2 [Cicer arietinum]
Length=498

 Score =   203 bits (517),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            RH M +S +W++ ++++KE EEKCGTP GKLRQ+ DAM VEMHAGLASEGGSKL MLISY
Sbjct  25   RHRMINSRKWSRALSIVKEFEEKCGTPIGKLRQLGDAMDVEMHAGLASEGGSKLSMLISY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLP+GDEEGLFYALDLGGTNFRV+RV LGGKEKGV+ +E  EVSIP HLM GSSE LF
Sbjct  85   VDNLPTGDEEGLFYALDLGGTNFRVLRVHLGGKEKGVIGQEFDEVSIPPHLMTGSSEGLF  144

Query  494  DFIA  505
            DFIA
Sbjct  145  DFIA  148



>gb|KHG25517.1| Hexokinase-1 -like protein [Gossypium arboreum]
Length=498

 Score =   203 bits (516),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            RH ++SSG+WA+ +++L E EEKCGTP+ KL+QVADAM VEMHAGLASEGGSKLKM+ISY
Sbjct  25   RHRIKSSGKWARALSILTEFEEKCGTPSSKLKQVADAMTVEMHAGLASEGGSKLKMIISY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLP+GDE+GLFYALDLGGTNFRV+RV LGGKE  VV +E +EVSIP HLM GSS+ LF
Sbjct  85   VDNLPTGDEKGLFYALDLGGTNFRVLRVHLGGKESRVVKQEFEEVSIPPHLMTGSSDELF  144

Query  494  DFIA  505
            D+IA
Sbjct  145  DYIA  148



>ref|XP_003529000.1| PREDICTED: hexokinase-1-like [Glycine max]
Length=498

 Score =   202 bits (515),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 106/124 (85%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            RH  RSSG+W +  A+ KELEE+C TP  KLRQVADA+ VEMHAGLASEGG KLKMLI+Y
Sbjct  25   RHRTRSSGKWGRATAIAKELEEQCWTPISKLRQVADALDVEMHAGLASEGGCKLKMLITY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLPSGDE+GLFYALDLGGTNFR +RV LGGKEKGVV  ES+EVSIP HLM GSS+ LF
Sbjct  85   VDNLPSGDEKGLFYALDLGGTNFRTLRVHLGGKEKGVVKIESEEVSIPPHLMTGSSQELF  144

Query  494  DFIA  505
            DFIA
Sbjct  145  DFIA  148



>gb|KEH21333.1| hexokinase [Medicago truncatula]
Length=363

 Score =   199 bits (506),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            RH M SS +W ++V++LKE  EKC TP GKLRQ+ADAM VEMHAGLASEGGSKL MLISY
Sbjct  25   RHRMISSRKWTRSVSILKEFGEKCETPIGKLRQLADAMDVEMHAGLASEGGSKLSMLISY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLP+GDEEGL+YALDLGGTNFRV+RV LGGKEKGV+++E  EVSIP  LM GSSE LF
Sbjct  85   VDNLPTGDEEGLYYALDLGGTNFRVLRVHLGGKEKGVISQEFDEVSIPPQLMTGSSEGLF  144

Query  494  DFIA  505
            DFIA
Sbjct  145  DFIA  148



>gb|KJB83117.1| hypothetical protein B456_013G230400 [Gossypium raimondii]
Length=498

 Score =   202 bits (515),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = +2

Query  137  HHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYV  316
            H M+SSG+WA+  ++LK+ EEKCGTP  KL+QVADAM VEMHAGLASEGGSKLKM+ISYV
Sbjct  26   HRMKSSGKWAQAQSILKDFEEKCGTPISKLKQVADAMTVEMHAGLASEGGSKLKMIISYV  85

Query  317  DNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFD  496
            DNLP+GDE+GLFYALDLGGTNFRV+RV LGGKE  VV +E +EVSIP HLM GSS+ALFD
Sbjct  86   DNLPTGDEKGLFYALDLGGTNFRVLRVHLGGKEHRVVKQEFEEVSIPPHLMTGSSDALFD  145

Query  497  FIA  505
            +IA
Sbjct  146  YIA  148



>ref|XP_010924444.1| PREDICTED: hexokinase-2-like isoform X2 [Elaeis guineensis]
Length=500

 Score =   202 bits (513),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 99/124 (80%), Positives = 106/124 (85%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            RH MRSSGRWA+ + +LKELEE C TP GKLRQVADAM VEM AGLASEGGSKLKMLISY
Sbjct  25   RHRMRSSGRWARAMEILKELEENCATPIGKLRQVADAMTVEMLAGLASEGGSKLKMLISY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLP GDE GLFYALDLGGTNFRV+RVQLGGK   VV +E +EVSIP +LMVGSS  LF
Sbjct  85   VDNLPKGDETGLFYALDLGGTNFRVLRVQLGGKGGRVVKQEFEEVSIPPNLMVGSSSELF  144

Query  494  DFIA  505
            DFIA
Sbjct  145  DFIA  148



>gb|EYU45835.1| hypothetical protein MIMGU_mgv1a005054mg [Erythranthe guttata]
Length=498

 Score =   202 bits (513),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 109/124 (88%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            R  M+SSGRWA+ VA++KE EEKCGTP  KL Q+ADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RQRMKSSGRWARAVAIVKEFEEKCGTPEAKLVQIADAMTVEMHAGLASEGGSKLKMLISY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLP+G+EEG+FYALDLGGTNFRV+RVQLGGKE G+V++E  E SIP  LM G+S+ALF
Sbjct  85   VDNLPTGEEEGVFYALDLGGTNFRVLRVQLGGKEGGIVHQEFAEASIPPALMCGTSDALF  144

Query  494  DFIA  505
            D+IA
Sbjct  145  DYIA  148



>ref|XP_010924442.1| PREDICTED: hexokinase-2-like isoform X1 [Elaeis guineensis]
Length=526

 Score =   202 bits (514),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 99/124 (80%), Positives = 106/124 (85%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            RH MRSSGRWA+ + +LKELEE C TP GKLRQVADAM VEM AGLASEGGSKLKMLISY
Sbjct  25   RHRMRSSGRWARAMEILKELEENCATPIGKLRQVADAMTVEMLAGLASEGGSKLKMLISY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLP GDE GLFYALDLGGTNFRV+RVQLGGK   VV +E +EVSIP +LMVGSS  LF
Sbjct  85   VDNLPKGDETGLFYALDLGGTNFRVLRVQLGGKGGRVVKQEFEEVSIPPNLMVGSSSELF  144

Query  494  DFIA  505
            DFIA
Sbjct  145  DFIA  148



>gb|KHG22031.1| Hexokinase-1 [Gossypium arboreum]
Length=529

 Score =   202 bits (514),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = +2

Query  137  HHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYV  316
            H M+SSG+WA+  ++LK+ EEKCGTP  KL+QVADAM VEMHAGLASEGGSKLKM+ISYV
Sbjct  57   HRMKSSGKWAQAQSILKDFEEKCGTPISKLKQVADAMTVEMHAGLASEGGSKLKMIISYV  116

Query  317  DNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFD  496
            DNLP+GDE+GLFYALDLGGTNFRV+RV LGGKE  VV +E +EVSIP HLM GSS+ALFD
Sbjct  117  DNLPTGDEKGLFYALDLGGTNFRVLRVHLGGKEHRVVKQEFEEVSIPPHLMTGSSDALFD  176

Query  497  FIA  505
            +IA
Sbjct  177  YIA  179



>ref|XP_011000949.1| PREDICTED: hexokinase-1-like [Populus euphratica]
Length=494

 Score =   201 bits (512),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            +  M+   RWAK + ++KE++EKCGTP GKL+QVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  26   KRKMKRDRRWAKAMEMVKEMQEKCGTPIGKLKQVADAMVVEMHAGLASEGGSKLKMLISY  85

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLPSGDE+GLFYALDLGGTNFRV+RVQLGGK+ G+VN+E  EVSIP +LM+G+S+ALF
Sbjct  86   VDNLPSGDEKGLFYALDLGGTNFRVLRVQLGGKDGGLVNQEFTEVSIPPNLMIGTSDALF  145

Query  494  DFIA  505
            D+IA
Sbjct  146  DYIA  149



>gb|KJB65034.1| hypothetical protein B456_010G077400 [Gossypium raimondii]
 gb|KJB65035.1| hypothetical protein B456_010G077400 [Gossypium raimondii]
 gb|KJB65036.1| hypothetical protein B456_010G077400 [Gossypium raimondii]
Length=498

 Score =   201 bits (512),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 109/124 (88%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            RH M+SSG+WA+ +++LKE EEKCGTP+  L+QVADAM VEMHAGLASEGGSKLKM+ISY
Sbjct  25   RHRMKSSGKWARALSILKEFEEKCGTPSSNLKQVADAMTVEMHAGLASEGGSKLKMIISY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            V NLP+GDE+GLFYALDLGGTNFRV+RV LGGKE  VV +E +EVSIP HLM GSS+ LF
Sbjct  85   VHNLPTGDEKGLFYALDLGGTNFRVLRVHLGGKESRVVKQEFEEVSIPAHLMTGSSDELF  144

Query  494  DFIA  505
            D+IA
Sbjct  145  DYIA  148



>ref|XP_002299739.1| hypothetical protein POPTR_0001s19130g [Populus trichocarpa]
 gb|EEE84544.1| hypothetical protein POPTR_0001s19130g [Populus trichocarpa]
Length=494

 Score =   201 bits (512),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            +  M+   RWAK + ++KE++EKCGTP GKL+QVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  26   KRKMKRDRRWAKAMEMVKEMQEKCGTPIGKLKQVADAMVVEMHAGLASEGGSKLKMLISY  85

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLPSGDE+GLFYALDLGGTNFRV+RVQLGGK+ G+VN+E  EVSIP +LM+G+S+ALF
Sbjct  86   VDNLPSGDEKGLFYALDLGGTNFRVLRVQLGGKDGGLVNQEFTEVSIPPNLMIGTSDALF  145

Query  494  DFIA  505
            D+IA
Sbjct  146  DYIA  149



>ref|XP_003525287.1| PREDICTED: hexokinase-1-like [Glycine max]
Length=498

 Score =   201 bits (511),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            RH M SS +W++ +A+LKE E+KCGTP  KLRQVADAM VEMHAGLASEGGSKL MLIS+
Sbjct  25   RHRMISSRKWSRAMAILKEFEDKCGTPIVKLRQVADAMDVEMHAGLASEGGSKLNMLISF  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLP+GDEEGL+YALDLGGTNFRV+RV LGGK+KGV+ +E +EVSIP +LM GSSEALF
Sbjct  85   VDNLPTGDEEGLYYALDLGGTNFRVLRVHLGGKDKGVIGQEFEEVSIPPNLMTGSSEALF  144

Query  494  DFIA  505
            DFIA
Sbjct  145  DFIA  148



>ref|XP_003530493.1| PREDICTED: hexokinase-1-like [Glycine max]
 gb|KHN16646.1| Hexokinase-1 [Glycine soja]
Length=498

 Score =   201 bits (511),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            RH M SS +W++ +A+LKE EEKCGTP  KLRQVADAM VEMHAGLASEGGSKL MLIS+
Sbjct  25   RHRMISSRKWSRAMAILKEFEEKCGTPIVKLRQVADAMDVEMHAGLASEGGSKLNMLISF  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLP+GDEEGL+YALDLGGTNFRV+RV LGGK+KGV+ +E +EVSIP +LM GSS+ALF
Sbjct  85   VDNLPTGDEEGLYYALDLGGTNFRVLRVHLGGKDKGVIGQEFEEVSIPPNLMTGSSDALF  144

Query  494  DFIA  505
            DFIA
Sbjct  145  DFIA  148



>ref|XP_009803252.1| PREDICTED: hexokinase-1 [Nicotiana sylvestris]
 gb|AAS60192.1| hexokinase 1a [Nicotiana tabacum]
Length=497

 Score =   201 bits (510),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = +2

Query  137  HHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYV  316
            H MR S +WA+ +A+L+E EEKCGTP  KL+QVADAM VEMHAGLASEGGSKLKMLI+YV
Sbjct  26   HRMRKSSKWARAMAILREFEEKCGTPDAKLKQVADAMTVEMHAGLASEGGSKLKMLITYV  85

Query  317  DNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFD  496
            DNLP+GDE G+FYALDLGGTNFRV+RVQLGGK+ G+V++E  E SIP +LMVG+SEALFD
Sbjct  86   DNLPTGDEAGVFYALDLGGTNFRVLRVQLGGKDGGIVHQEFAEASIPPNLMVGTSEALFD  145

Query  497  FIA  505
            +IA
Sbjct  146  YIA  148



>ref|XP_009606563.1| PREDICTED: hexokinase-1 [Nicotiana tomentosiformis]
Length=497

 Score =   201 bits (510),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = +2

Query  137  HHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYV  316
            H MR S +WA+ +A+L+E EEKCGTP  KL+QVADAM VEMHAGLASEGGSKLKMLI+YV
Sbjct  26   HRMRKSSKWARAMAILREFEEKCGTPDAKLKQVADAMTVEMHAGLASEGGSKLKMLITYV  85

Query  317  DNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFD  496
            DNLP+GDE G+FYALDLGGTNFRV+RVQLGGK+ G+V++E  E SIP +LMVG+SEALFD
Sbjct  86   DNLPTGDEAGVFYALDLGGTNFRVLRVQLGGKDGGIVHQEFAEASIPPNLMVGTSEALFD  145

Query  497  FIA  505
            +IA
Sbjct  146  YIA  148



>sp|Q9SEK2.1|HXK1_TOBAC RecName: Full=Hexokinase-1; AltName: Full=NtHxK1 [Nicotiana tabacum]
 gb|AAF18585.1|AF118133_1 chloroplast outer envelope hexokinase 1 [Nicotiana tabacum]
Length=497

 Score =   201 bits (510),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = +2

Query  137  HHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYV  316
            H MR S +WA+ +A+L+E EEKCGTP  KL+QVADAM VEMHAGLASEGGSKLKMLI+YV
Sbjct  26   HRMRKSSKWARAMAILREFEEKCGTPDAKLKQVADAMTVEMHAGLASEGGSKLKMLITYV  85

Query  317  DNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFD  496
            DNLP+GDE G+FYALDLGGTNFRV+RVQLGGK+ G+V++E  E SIP +LMVG+SEALFD
Sbjct  86   DNLPTGDEAGVFYALDLGGTNFRVLRVQLGGKDGGIVHQEFAEASIPPNLMVGTSEALFD  145

Query  497  FIA  505
            +IA
Sbjct  146  YIA  148



>ref|XP_007013022.1| Hexokinase 2 isoform 3 [Theobroma cacao]
 gb|EOY30641.1| Hexokinase 2 isoform 3 [Theobroma cacao]
Length=437

 Score =   199 bits (505),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            RH ++SSG+WA+T+A+LKE EEKCGTP  KL+QVADAM VEMHAGLASEGGSKLKM+ISY
Sbjct  25   RHRIKSSGKWARTLAILKEFEEKCGTPISKLKQVADAMTVEMHAGLASEGGSKLKMIISY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLP+GDE+GLFYALDLGGTNFRV+RVQLGGKE  VV +E +EVSIP HLM GSS+   
Sbjct  85   VDNLPTGDEKGLFYALDLGGTNFRVLRVQLGGKESRVVKQEFEEVSIPPHLMTGSSDVGQ  144

Query  494  DFI  502
            D +
Sbjct  145  DVV  147



>sp|Q9SEK3.1|HXK1_SPIOL RecName: Full=Hexokinase-1; AltName: Full=SoHxK1 [Spinacia oleracea]
 gb|AAF18584.1|AF118132_1 chloroplast outer envelope hexokinase 1 [Spinacia oleracea]
Length=498

 Score =   199 bits (507),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            R  M+SS +W + +A+LKEL++ CGTP GKLRQVADAM VEMHAGLASEG SKLKMLISY
Sbjct  25   RQRMKSSSKWGRVMAILKELDDNCGTPLGKLRQVADAMTVEMHAGLASEGASKLKMLISY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLP+GDE GLFYALDLGGTNFRV+RV+LGGKEK VV +E  EVSIP  LMVG+SE LF
Sbjct  85   VDNLPTGDEHGLFYALDLGGTNFRVLRVKLGGKEKRVVEQEFDEVSIPPELMVGTSEQLF  144

Query  494  DFIA  505
            D+IA
Sbjct  145  DYIA  148



>emb|CDO97969.1| unnamed protein product [Coffea canephora]
Length=495

 Score =   199 bits (506),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            RH MR S RWA+ +A+++ELEEKCG+P  KL+QVADAM VEMHAGLASEGGSKLKMLIS+
Sbjct  25   RHRMRCSSRWARAMAIVRELEEKCGSPEAKLKQVADAMTVEMHAGLASEGGSKLKMLISH  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLP+GDEEG++YALDLGGTNFRV+RV+LGGK  G+V++E  E SIP  LMVG+SEALF
Sbjct  85   VDNLPTGDEEGVYYALDLGGTNFRVLRVELGGKTGGIVSQEFAEASIPPELMVGTSEALF  144

Query  494  DFIA  505
            D+IA
Sbjct  145  DYIA  148



>ref|XP_006353497.1| PREDICTED: hexokinase-1-like isoform X2 [Solanum tuberosum]
Length=466

 Score =   199 bits (505),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 96/125 (77%), Positives = 107/125 (86%), Gaps = 1/125 (1%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            +  M++SG W K  ALLK+ EEKC TP GKL+QVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  26   KRRMKNSGEWGKVEALLKDFEEKCATPMGKLKQVADAMTVEMHAGLASEGGSKLKMLISY  85

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVG-SSEAL  490
            VDNLP+GDEEGLFYALDLGGTNFRVMRVQLGG EK +V  E +EVSIP+++M G SSE L
Sbjct  86   VDNLPTGDEEGLFYALDLGGTNFRVMRVQLGGNEKRIVKHEVKEVSIPQNVMAGSSSEVL  145

Query  491  FDFIA  505
            FDFIA
Sbjct  146  FDFIA  150



>gb|AET05183.2| hexokinase [Medicago truncatula]
Length=498

 Score =   199 bits (506),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            RH M SS +W ++V++LKE  EKC TP GKLRQ+ADAM VEMHAGLASEGGSKL MLISY
Sbjct  25   RHRMISSRKWTRSVSILKEFGEKCETPIGKLRQLADAMDVEMHAGLASEGGSKLSMLISY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLP+GDEEGL+YALDLGGTNFRV+RV LGGKEKGV+++E  EVSIP  LM GSSE LF
Sbjct  85   VDNLPTGDEEGLYYALDLGGTNFRVLRVHLGGKEKGVISQEFDEVSIPPQLMTGSSEGLF  144

Query  494  DFIA  505
            DFIA
Sbjct  145  DFIA  148



>ref|XP_007160283.1| hypothetical protein PHAVU_002G308400g [Phaseolus vulgaris]
 gb|ESW32277.1| hypothetical protein PHAVU_002G308400g [Phaseolus vulgaris]
Length=498

 Score =   199 bits (505),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            RH M SS +W++ +A+LKE EEK GTP  KLRQVADAM VEMHAGLASEGGSKL MLIS+
Sbjct  25   RHRMISSRKWSRAIAILKEFEEKSGTPLAKLRQVADAMDVEMHAGLASEGGSKLNMLISF  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLP+GDEEGL+YALDLGGTNFRV+RV LGGK+KGV+ +E  EVSIP  LM G+SEALF
Sbjct  85   VDNLPTGDEEGLYYALDLGGTNFRVLRVHLGGKDKGVIGQEFAEVSIPPQLMTGTSEALF  144

Query  494  DFIA  505
            DFIA
Sbjct  145  DFIA  148



>gb|ABA01010.1| hexokinase [Solanum chacoense]
Length=496

 Score =   199 bits (505),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            RH M  S +WA+  A+LKE EEKC TP GKL+QVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RHRMGKSSKWARARAILKEFEEKCATPDGKLKQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLP+GDE G+FYALDLGGTNFRV+RVQLGGK+ G++++E  E SIP +LMVG+SEALF
Sbjct  85   VDNLPTGDEGGVFYALDLGGTNFRVLRVQLGGKDGGIIHQEFAEASIPPNLMVGTSEALF  144

Query  494  DFIA  505
            D+IA
Sbjct  145  DYIA  148



>ref|NP_001274841.1| hexokinase-2 [Solanum tuberosum]
 sp|Q9SQ76.1|HXK2_SOLTU RecName: Full=Hexokinase-2; AltName: Full=StHK2 [Solanum tuberosum]
 gb|AAF14186.1| hexokinase 2 [Solanum tuberosum]
Length=496

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            RH M  S +WA+  A+LKE EEKC TP GKL+QVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RHRMGKSSKWARARAILKEFEEKCATPDGKLKQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLP+GDE G+FYALDLGGTNFRV+RVQLGGK+ G++++E  E SIP +LMVG+SEALF
Sbjct  85   VDNLPTGDEGGVFYALDLGGTNFRVLRVQLGGKDGGIIHQEFAEASIPPNLMVGTSEALF  144

Query  494  DFIA  505
            D+IA
Sbjct  145  DYIA  148



>gb|AAT77513.1| hexokinase 3 [Nicotiana sylvestris]
Length=496

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            RH M  S +WA+  A+LKE EEKC TP GKL+QVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RHRMGKSSKWARARAILKEFEEKCATPDGKLKQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLP+GDE G+FYALDLGGTNFRV+RVQLGGK+ G++++E  E SIP +LMVG+SEALF
Sbjct  85   VDNLPTGDEGGVFYALDLGGTNFRVLRVQLGGKDGGIIHQEFAEASIPPNLMVGTSEALF  144

Query  494  DFIA  505
            D+IA
Sbjct  145  DYIA  148



>ref|XP_006353496.1| PREDICTED: hexokinase-1-like isoform X1 [Solanum tuberosum]
Length=499

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 96/125 (77%), Positives = 107/125 (86%), Gaps = 1/125 (1%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            +  M++SG W K  ALLK+ EEKC TP GKL+QVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  26   KRRMKNSGEWGKVEALLKDFEEKCATPMGKLKQVADAMTVEMHAGLASEGGSKLKMLISY  85

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVG-SSEAL  490
            VDNLP+GDEEGLFYALDLGGTNFRVMRVQLGG EK +V  E +EVSIP+++M G SSE L
Sbjct  86   VDNLPTGDEEGLFYALDLGGTNFRVMRVQLGGNEKRIVKHEVKEVSIPQNVMAGSSSEVL  145

Query  491  FDFIA  505
            FDFIA
Sbjct  146  FDFIA  150



>gb|AAS60197.1| hexokinase 5 [Nicotiana tabacum]
Length=499

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 96/125 (77%), Positives = 107/125 (86%), Gaps = 1/125 (1%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            +  M++SG W K  ALLK+ EEKC TP GKL+QVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  26   KRRMKNSGEWGKVEALLKDFEEKCATPMGKLKQVADAMTVEMHAGLASEGGSKLKMLISY  85

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVG-SSEAL  490
            VDNLP+GDEEGLFYALDLGGTNFRVMRVQLGG EK +V  E +EVSIP+++M G SSE L
Sbjct  86   VDNLPTGDEEGLFYALDLGGTNFRVMRVQLGGNEKRIVKHEVKEVSIPQNVMAGSSSEVL  145

Query  491  FDFIA  505
            FDFIA
Sbjct  146  FDFIA  150



>ref|XP_007024321.1| Hexokinase 2 [Theobroma cacao]
 gb|EOY26943.1| Hexokinase 2 [Theobroma cacao]
Length=498

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/121 (76%), Positives = 107/121 (88%), Gaps = 0/121 (0%)
 Frame = +2

Query  143  MRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDN  322
            M+ SGRW K + ++KE EEKCGTP  KLRQVADAM VEMHAGLASEGGSKLKMLISYVDN
Sbjct  28   MKKSGRWVKAMEIVKEFEEKCGTPIWKLRQVADAMTVEMHAGLASEGGSKLKMLISYVDN  87

Query  323  LPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFI  502
            LP+G+E+GLFYALDLGGTNFRV+RVQLGGK  G+VN++ +EVSIP  LM G+S+ALFD+I
Sbjct  88   LPTGNEKGLFYALDLGGTNFRVLRVQLGGKGSGIVNQQFKEVSIPPSLMTGTSDALFDYI  147

Query  503  A  505
            A
Sbjct  148  A  148



>gb|AIX02984.1| hexokinase [Morella rubra]
Length=497

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            RH MRSSG+WA+   +LK+ EEKC TP GKLR VADAM VEMHAGLASEGGSKLK+LIS+
Sbjct  25   RHRMRSSGKWARVTEILKDFEEKCATPDGKLRHVADAMTVEMHAGLASEGGSKLKILISF  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLP+GDE+GLFYALDLGGTNFRV+RVQLGG ++ V+ +E QEVSIP HLM  +SEALF
Sbjct  85   VDNLPTGDEKGLFYALDLGGTNFRVLRVQLGGXDQRVIKQEFQEVSIPPHLMTETSEALF  144

Query  494  DFIA  505
            D IA
Sbjct  145  DNIA  148



>gb|AAP40021.1| hexokinase [Nicotiana benthamiana]
Length=497

 Score =   198 bits (503),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = +2

Query  137  HHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYV  316
            H MR S +WA+ +A+L+E EEKCGTP  KL+QVADAM VEMHAGLASEGGSKLKMLI+YV
Sbjct  26   HRMRKSSKWARAMAILREFEEKCGTPDAKLKQVADAMTVEMHAGLASEGGSKLKMLITYV  85

Query  317  DNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFD  496
            DNLP+GDE G+FYALDLGGTNFRV+RVQLGGK+ G++++E  E SIP +LMVG+SE LFD
Sbjct  86   DNLPTGDEAGVFYALDLGGTNFRVLRVQLGGKDGGIIHQEFAEASIPPNLMVGTSEELFD  145

Query  497  FIA  505
            +IA
Sbjct  146  YIA  148



>ref|XP_003630707.1| Hexokinase [Medicago truncatula]
Length=610

 Score =   200 bits (508),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            RH M SS +W ++V++LKE  EKC TP GKLRQ+ADAM VEMHAGLASEGGSKL MLISY
Sbjct  25   RHRMISSRKWTRSVSILKEFGEKCETPIGKLRQLADAMDVEMHAGLASEGGSKLSMLISY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLP+GDEEGL+YALDLGGTNFRV+RV LGGKEKGV+++E  EVSIP  LM GSSE LF
Sbjct  85   VDNLPTGDEEGLYYALDLGGTNFRVLRVHLGGKEKGVISQEFDEVSIPPQLMTGSSEGLF  144

Query  494  DFIA  505
            DFIA
Sbjct  145  DFIA  148



>ref|XP_007013020.1| Hexokinase 1 isoform 1 [Theobroma cacao]
 gb|EOY30639.1| Hexokinase 1 isoform 1 [Theobroma cacao]
Length=521

 Score =   198 bits (503),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 98/147 (67%), Positives = 113/147 (77%), Gaps = 23/147 (16%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            RH ++SSG+WA+T+A+LKE EEKCGTP  KL+QVADAM VEMHAGLASEGGSKLKM+ISY
Sbjct  25   RHRIKSSGKWARTLAILKEFEEKCGTPISKLKQVADAMTVEMHAGLASEGGSKLKMIISY  84

Query  314  VDNLPSG-----------------------DEEGLFYALDLGGTNFRVMRVQLGGKEKGV  424
            VDNLP+G                       DE+GLFYALDLGGTNFRV+RVQLGGKE  V
Sbjct  85   VDNLPTGWDVSVVEHCHILISELFVLGIKHDEKGLFYALDLGGTNFRVLRVQLGGKESRV  144

Query  425  VNRESQEVSIPRHLMVGSSEALFDFIA  505
            V +E +EVSIP HLM GSS+ALFD+IA
Sbjct  145  VKQEFEEVSIPPHLMTGSSDALFDYIA  171



>gb|AFO84083.1| hexokinase [Actinidia chinensis]
Length=497

 Score =   197 bits (501),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 94/120 (78%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = +2

Query  146  RSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNL  325
            RSSGRW K  A+L+EL++KC TP GKLRQVAD MA EMHAGLASEGGS LKM+ISYVDNL
Sbjct  29   RSSGRWDKAAAILRELKDKCRTPIGKLRQVADDMAFEMHAGLASEGGSNLKMIISYVDNL  88

Query  326  PSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIA  505
            P+GDE+GLFYALDLGGTNFRV+RVQLGGK+K V  +E +EVSIP HLMVG+S ALFDFIA
Sbjct  89   PTGDEKGLFYALDLGGTNFRVLRVQLGGKDKYVAKQEFEEVSIPPHLMVGTSVALFDFIA  148



>ref|XP_010540986.1| PREDICTED: hexokinase-1-like [Tarenaya hassleriana]
Length=499

 Score =   197 bits (500),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 105/124 (85%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            R  MRSSG+WA+ +A+L+  EE C TP  KLRQVADA+ VEMHAGLASEGGSKLKMLISY
Sbjct  26   RRRMRSSGKWARAMAILRAFEEDCATPIAKLRQVADALTVEMHAGLASEGGSKLKMLISY  85

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLP+GDE+GLFYALDLGGTNFRVMRV LGGKE  VV +E +EVSIP HLM G S+ LF
Sbjct  86   VDNLPTGDEKGLFYALDLGGTNFRVMRVLLGGKEGRVVKQEFEEVSIPPHLMTGGSDELF  145

Query  494  DFIA  505
            DFIA
Sbjct  146  DFIA  149



>ref|NP_001234406.1| hexokinase [Solanum lycopersicum]
 gb|AAG35735.1|AF208543_1 hexokinase [Solanum lycopersicum]
Length=496

 Score =   196 bits (499),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            RH M  S +WA+  A+LKE EEKC TP  KL+QVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RHRMGKSSKWARARAILKEFEEKCATPDAKLKQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLP+GDE G+FYALDLGGTNFRV+RVQLGGK+ G++++E  E SIP +LMVG+SEALF
Sbjct  85   VDNLPTGDEAGVFYALDLGGTNFRVLRVQLGGKDGGIMHQEFAEASIPPNLMVGTSEALF  144

Query  494  DFIA  505
            D+IA
Sbjct  145  DYIA  148



>gb|EPS70676.1| hexokinase 1a, partial [Genlisea aurea]
Length=490

 Score =   196 bits (499),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            R  M+SSGRWA+  ++LKE EE+C TP GKL+Q+ADAM VEMHAGL SEGGSKLKMLISY
Sbjct  25   RQRMKSSGRWARVSSILKEFEERCDTPEGKLKQIADAMTVEMHAGLVSEGGSKLKMLISY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLP+GDEEG+FYALDLGGTNFRV+RVQLGGK+ G+V++E  E SIP  LM  +S++LF
Sbjct  85   VDNLPTGDEEGVFYALDLGGTNFRVLRVQLGGKDGGIVHQEFAEASIPPPLMSATSDSLF  144

Query  494  DFIAH  508
            DFIA 
Sbjct  145  DFIAE  149



>ref|XP_010322313.1| PREDICTED: hexokinase isoform X1 [Solanum lycopersicum]
Length=496

 Score =   196 bits (499),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            RH M  S +WA+  A+LKE EEKC TP  KL+QVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RHRMGKSSKWARARAILKEFEEKCATPDAKLKQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLP+GDE G+FYALDLGGTNFRV+RVQLGGK+ G++++E  E SIP +LMVG+SEALF
Sbjct  85   VDNLPTGDEAGVFYALDLGGTNFRVLRVQLGGKDGGIMHQEFAEASIPPNLMVGTSEALF  144

Query  494  DFIA  505
            D+IA
Sbjct  145  DYIA  148



>ref|XP_006299465.1| hypothetical protein CARUB_v10015630mg [Capsella rubella]
 gb|EOA32363.1| hypothetical protein CARUB_v10015630mg [Capsella rubella]
Length=504

 Score =   195 bits (496),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 101/125 (81%), Gaps = 0/125 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            R  M+SSG+WA+ + +LK  EE C TP  KLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RRRMQSSGKWARVIEILKAFEEDCATPIAKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLPSGDE G FYALDLGGTNFRVMRV LGGK+  VV RE +E SIP HLM G S+ LF
Sbjct  85   VDNLPSGDETGFFYALDLGGTNFRVMRVLLGGKQDRVVKREFKEESIPPHLMTGKSDELF  144

Query  494  DFIAH  508
            DFIA 
Sbjct  145  DFIAE  149



>ref|XP_004510315.1| PREDICTED: hexokinase-1-like [Cicer arietinum]
Length=495

 Score =   195 bits (495),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            + HM+ S RW K +++LKE EEKC TP  KL+QVADAM VEMHAGLASEGGSKLKMLIS+
Sbjct  25   QRHMKKSRRWGKAMSILKEFEEKCATPTWKLKQVADAMTVEMHAGLASEGGSKLKMLISF  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            V NLP+G+EEGLFYALDLGGTNFRV+R+QLGGK+ G+++RE  EVSIP +LMVG+S ALF
Sbjct  85   VHNLPTGNEEGLFYALDLGGTNFRVLRMQLGGKDGGIISREFTEVSIPPNLMVGTSTALF  144

Query  494  DFIA  505
            D+IA
Sbjct  145  DYIA  148



>ref|NP_001234710.1| hexokinase [Solanum lycopersicum]
 gb|AAY60841.1| hexokinase [Solanum lycopersicum]
Length=499

 Score =   195 bits (495),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 107/125 (86%), Gaps = 1/125 (1%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            +H +++SG W K  ALLK+ EEKC TP  KL+QVADAM VEM AGLASEGGSKLKMLISY
Sbjct  26   KHRVKNSGEWGKVEALLKDFEEKCATPVEKLKQVADAMTVEMQAGLASEGGSKLKMLISY  85

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVG-SSEAL  490
            VDNLP+GDE+GLFYALDLGGTNFRVMRVQLGGKEK +V  E +EVSIP+++M G SSE L
Sbjct  86   VDNLPTGDEKGLFYALDLGGTNFRVMRVQLGGKEKRIVKHEVKEVSIPQNVMTGSSSEVL  145

Query  491  FDFIA  505
            FDFIA
Sbjct  146  FDFIA  150



>gb|ABI18156.1| hexokinase [Helianthus annuus]
Length=498

 Score =   194 bits (494),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 107/124 (86%), Gaps = 2/124 (2%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            RH M++SG+WAK + +LKE E+KCGTP  KLRQVADAM VEMHAGLAS+GGSKLKMLISY
Sbjct  25   RHRMKNSGKWAKAMEILKEFEDKCGTPVSKLRQVADAMTVEMHAGLASDGGSKLKMLISY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLP+GDE G+FYALDLGGTNFRV+RV+LGG   G V +E +EVSIP +LM+G SE LF
Sbjct  85   VDNLPTGDETGIFYALDLGGTNFRVLRVKLGG--VGNVKKEFKEVSIPPNLMIGKSEDLF  142

Query  494  DFIA  505
            DFIA
Sbjct  143  DFIA  146



>ref|XP_006408903.1| hypothetical protein EUTSA_v10001968mg [Eutrema salsugineum]
 gb|ESQ50356.1| hypothetical protein EUTSA_v10001968mg [Eutrema salsugineum]
Length=499

 Score =   194 bits (494),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 103/124 (83%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            R  M+SSG+WA+ + +LK LEE C TP  KLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RRRMQSSGKWARVIEILKVLEEDCATPIAKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLPSGDE G FYALDLGGTNFRVMRV LGGK+  VV +E +EVSIP HLM G S+ LF
Sbjct  85   VDNLPSGDEHGFFYALDLGGTNFRVMRVLLGGKQDRVVKQEFEEVSIPPHLMTGGSDELF  144

Query  494  DFIA  505
            +FIA
Sbjct  145  NFIA  148



>ref|XP_002515958.1| hexokinase, putative [Ricinus communis]
 gb|EEF46378.1| hexokinase, putative [Ricinus communis]
Length=494

 Score =   194 bits (493),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 106/124 (85%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            R  M+  G+WA+ + ++KELEEKC TP GKL+QVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  26   RQKMKKDGKWARVMEIVKELEEKCATPIGKLKQVADAMVVEMHAGLASEGGSKLKMLISY  85

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLP+GDE G +YALDLGGTNFRV+RV LGGK+ G++N+E  EV IP +LM G+S+ALF
Sbjct  86   VDNLPTGDENGYYYALDLGGTNFRVLRVHLGGKDGGLINQEFAEVPIPPNLMTGTSDALF  145

Query  494  DFIA  505
            D+IA
Sbjct  146  DYIA  149



>gb|EYU21451.1| hypothetical protein MIMGU_mgv1a005070mg [Erythranthe guttata]
Length=498

 Score =   194 bits (494),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            R  M++SGRWA+ + ++KE EEKCGTP GKL+QVADA+ VEMHAGLASEGGSKLKMLISY
Sbjct  29   RQRMKTSGRWARAMGIVKEFEEKCGTPEGKLKQVADALTVEMHAGLASEGGSKLKMLISY  88

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VD+LP+G+E+G+FYALDLGGTNFRV+RV+LGG+E+G++++E  E SIP  LM G+S+ALF
Sbjct  89   VDSLPTGNEKGVFYALDLGGTNFRVLRVELGGREEGIIHQEFAEASIPPALMCGNSDALF  148

Query  494  DFIAH  508
            D+IA 
Sbjct  149  DYIAE  153



>gb|EYU27268.1| hypothetical protein MIMGU_mgv1a019208mg [Erythranthe guttata]
Length=489

 Score =   194 bits (493),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 105/124 (85%), Gaps = 4/124 (3%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            R  M+SSG WAK  A+ +ELE+KCGTP  KLRQVADAMAVEMHAG+AS+GGSKLKMLIS+
Sbjct  25   RRQMKSSGEWAKAEAIFRELEDKCGTPTAKLRQVADAMAVEMHAGVASDGGSKLKMLISF  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLP+GDE+GLFYALDLGGTNFRVMRVQLG    G + +E ++VSIP H MVGSS  LF
Sbjct  85   VDNLPTGDEKGLFYALDLGGTNFRVMRVQLG----GTIKQECEQVSIPPHFMVGSSHELF  140

Query  494  DFIA  505
            DFIA
Sbjct  141  DFIA  144



>ref|XP_010526433.1| PREDICTED: hexokinase-1 [Tarenaya hassleriana]
Length=499

 Score =   194 bits (493),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 104/124 (84%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            R  MRSSG+WA+ +A+L+  EE C TP  KLRQVADA+ VEMHAGLASEGGSKLKMLISY
Sbjct  26   RRRMRSSGKWARAMAILRAFEEDCATPIAKLRQVADALTVEMHAGLASEGGSKLKMLISY  85

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLP+GDE+GLFYALDLGGTNFRVMRV LGGKE  VV +E +EVSIP HLM G S+ LF
Sbjct  86   VDNLPTGDEKGLFYALDLGGTNFRVMRVLLGGKEGRVVKQEFEEVSIPPHLMTGGSDELF  145

Query  494  DFIA  505
             FIA
Sbjct  146  SFIA  149



>ref|NP_194642.1| hexokinase 1 [Arabidopsis thaliana]
 sp|Q42525.2|HXK1_ARATH RecName: Full=Hexokinase-1; AltName: Full=Protein GLUCOSE INSENSITIVE 
2 [Arabidopsis thaliana]
 gb|AAB49908.1| hexokinase 1 [Arabidopsis thaliana]
 emb|CAB43927.1| hexokinase [Arabidopsis thaliana]
 emb|CAB79671.1| hexokinase [Arabidopsis thaliana]
 gb|AAL77665.1| AT4g29130/F19B15_160 [Arabidopsis thaliana]
 gb|AAM70518.1| AT4g29130/F19B15_160 [Arabidopsis thaliana]
 dbj|BAF02067.1| hexokinase [Arabidopsis thaliana]
 gb|AEE85590.1| hexokinase 1 [Arabidopsis thaliana]
Length=496

 Score =   194 bits (493),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 105/124 (85%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            R  M+SSG+W + +A+LK  EE C TP  KLRQVADAM VEMHAGLAS+GGSKLKMLISY
Sbjct  25   RRRMQSSGKWGRVLAILKAFEEDCATPISKLRQVADAMTVEMHAGLASDGGSKLKMLISY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLPSGDE+GLFYALDLGGTNFRVMRV LGGK++ VV +E +EVSIP HLM G S+ LF
Sbjct  85   VDNLPSGDEKGLFYALDLGGTNFRVMRVLLGGKQERVVKQEFEEVSIPPHLMTGGSDELF  144

Query  494  DFIA  505
            +FIA
Sbjct  145  NFIA  148



>ref|XP_002867423.1| ATHXK1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43682.1| ATHXK1 [Arabidopsis lyrata subsp. lyrata]
Length=496

 Score =   194 bits (493),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 105/124 (85%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            R  M+SSG+W + +A+LK  EE C TP  KLRQVADAM VEMHAGLAS+GGSKLKMLISY
Sbjct  25   RRRMQSSGKWGRVLAILKAFEEDCATPISKLRQVADAMTVEMHAGLASDGGSKLKMLISY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLPSGDE+GLFYALDLGGTNFRVMRV LGGK++ VV +E +EVSIP HLM G S+ LF
Sbjct  85   VDNLPSGDEKGLFYALDLGGTNFRVMRVLLGGKQERVVKQEFEEVSIPPHLMTGGSDELF  144

Query  494  DFIA  505
            +FIA
Sbjct  145  NFIA  148



>ref|XP_010489125.1| PREDICTED: hexokinase-2-like [Camelina sativa]
Length=502

 Score =   194 bits (493),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 100/125 (80%), Gaps = 0/125 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            R  M+SSG+WA+ + +LK  EE C TP  KLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RRRMQSSGKWARVIEILKAFEEDCATPVAKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLPSGDE G FYALDLGGTNFRVMRV LGGK+  VV RE +E SIP HLM G S+ LF
Sbjct  85   VDNLPSGDETGFFYALDLGGTNFRVMRVLLGGKQDRVVKREFKEESIPPHLMTGKSDELF  144

Query  494  DFIAH  508
            DFI  
Sbjct  145  DFIVE  149



>ref|XP_010467922.1| PREDICTED: hexokinase-2 isoform X1 [Camelina sativa]
Length=502

 Score =   194 bits (492),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 100/123 (81%), Gaps = 0/123 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            R  M+SSG+WA+ + +LK  EE C TP  KLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RRRMQSSGKWARVIEILKAFEEDCATPVAKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLPSGDE G FYALDLGGTNFRVMRV LGGK+  VV RE +E SIP HLM G S+ LF
Sbjct  85   VDNLPSGDETGFFYALDLGGTNFRVMRVLLGGKQDRVVKREFKEESIPPHLMTGKSDELF  144

Query  494  DFI  502
            DFI
Sbjct  145  DFI  147



>gb|AHY84734.1| hexokinase [Manihot esculenta]
Length=494

 Score =   194 bits (492),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 106/124 (85%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            +  MR+  +WAK + ++K++EEKC TP GKL+Q+ADAM VEMHAGLASEGGSKLKMLISY
Sbjct  26   KRKMRTGDKWAKAIEIVKDMEEKCATPIGKLKQIADAMVVEMHAGLASEGGSKLKMLISY  85

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLP+GDE GLFYALDLGGTNFRV+RVQLGGK+  +VN+E  EV IP +LM G+SE LF
Sbjct  86   VDNLPTGDENGLFYALDLGGTNFRVLRVQLGGKDGRLVNQEFAEVPIPPNLMTGTSEVLF  145

Query  494  DFIA  505
            D+IA
Sbjct  146  DYIA  149



>ref|XP_010915379.1| PREDICTED: hexokinase-2-like [Elaeis guineensis]
Length=507

 Score =   194 bits (492),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            R  ++S  RWA+ V ++KELEE+C TP G L+QVA+AMA+EM AGLASEG SKLKMLISY
Sbjct  25   RRRIQSVVRWARAVEIVKELEERCATPIGLLKQVANAMAMEMQAGLASEGDSKLKMLISY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLPSGDE+GLFYALDLGGTNFRV+RVQLGGKE+ VV +ES EVSIP+HLMVGSS  LF
Sbjct  85   VDNLPSGDEKGLFYALDLGGTNFRVLRVQLGGKERHVVKQESTEVSIPQHLMVGSSAELF  144

Query  494  DFIA  505
            +FIA
Sbjct  145  EFIA  148



>ref|XP_010416617.1| PREDICTED: hexokinase-2-like [Camelina sativa]
Length=502

 Score =   194 bits (492),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 100/123 (81%), Gaps = 0/123 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            R  M+SSG+WA+ + +LK  EE C TP  KLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RRRMQSSGKWARVIEILKAFEEDCATPVAKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLPSGDE G FYALDLGGTNFRVMRV LGGK+  VV RE +E SIP HLM G S+ LF
Sbjct  85   VDNLPSGDETGFFYALDLGGTNFRVMRVLLGGKQDRVVKREFKEESIPPHLMTGKSDELF  144

Query  494  DFI  502
            DFI
Sbjct  145  DFI  147



>ref|XP_006285258.1| hypothetical protein CARUB_v10006629mg [Capsella rubella]
 gb|EOA18156.1| hypothetical protein CARUB_v10006629mg [Capsella rubella]
Length=496

 Score =   193 bits (491),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 104/124 (84%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            R  M+SSG+W + +A+LK  EE C TP  KLRQVADAM VEMHAGLAS+GGSKLKMLISY
Sbjct  25   RRRMQSSGKWGRVLAILKAFEEDCATPISKLRQVADAMTVEMHAGLASDGGSKLKMLISY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLPSGDE+GLFYALDLGGTNFRVMRV LGGKE+ V  +E +EVSIP HLM G S+ LF
Sbjct  85   VDNLPSGDEKGLFYALDLGGTNFRVMRVLLGGKEERVAKQEFEEVSIPPHLMTGGSDELF  144

Query  494  DFIA  505
            +FIA
Sbjct  145  NFIA  148



>gb|KJB56835.1| hypothetical protein B456_009G137700 [Gossypium raimondii]
Length=498

 Score =   193 bits (491),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = +2

Query  146  RSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNL  325
            + SGRW K + +LKE EEKCGTP  KL+QVADAM VEMHAGLASEGGSKLKMLISYVD+L
Sbjct  29   KKSGRWVKAMEILKEFEEKCGTPIPKLKQVADAMIVEMHAGLASEGGSKLKMLISYVDHL  88

Query  326  PSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIA  505
            P+G E+GLFYALDLGGTNFRV+RVQLGGK +G+VN++ +EVSIP  LM GSS+ALFD+IA
Sbjct  89   PTGREKGLFYALDLGGTNFRVLRVQLGGKGRGIVNQQFEEVSIPPSLMTGSSDALFDYIA  148



>ref|XP_010047252.1| PREDICTED: hexokinase-2-like [Eucalyptus grandis]
 gb|KCW79118.1| hypothetical protein EUGRSUZ_C00559 [Eucalyptus grandis]
Length=508

 Score =   193 bits (491),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/119 (75%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = +2

Query  149  SSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLP  328
            S G+W +   ++KELEEKCGTP  KLRQVA+AM VEMHAGLAS+GGSKLKMLISYVD+LP
Sbjct  43   SDGKWERAAEMVKELEEKCGTPVWKLRQVAEAMVVEMHAGLASDGGSKLKMLISYVDSLP  102

Query  329  SGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIA  505
            +GDE+GL+YALDLGGTNFR++RV LGGKEKG++ RE +EVSIP HLM GSS  LFDFIA
Sbjct  103  TGDEKGLYYALDLGGTNFRILRVHLGGKEKGIIKREYEEVSIPPHLMTGSSNELFDFIA  161



>gb|AAT77514.1| hexokinase 4 [Nicotiana sylvestris]
Length=355

 Score =   189 bits (481),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 87/123 (71%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = +2

Query  137  HHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYV  316
            H MR S +W + +A+L+E EEKC T   KL+QVADAM VEMHAGLASEGGSKLKMLI+YV
Sbjct  26   HRMRKSSKWGRAMAILREFEEKCKTQDAKLKQVADAMTVEMHAGLASEGGSKLKMLITYV  85

Query  317  DNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFD  496
            DNLP+GDE G+FYALDLGGTNFRV+RVQLGGK+ G++++E  E SIP  LMVG+S+ALFD
Sbjct  86   DNLPTGDEAGVFYALDLGGTNFRVLRVQLGGKDGGIIHQEFAEASIPPSLMVGTSDALFD  145

Query  497  FIA  505
            +IA
Sbjct  146  YIA  148



>ref|XP_010047667.1| PREDICTED: hexokinase-1-like [Eucalyptus grandis]
Length=510

 Score =   193 bits (490),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/119 (75%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = +2

Query  149  SSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLP  328
            S G+W +   ++KELEEKCGTP  KLRQVA+AM VEMHAGLAS+GGSKLKMLISYVD+LP
Sbjct  45   SDGKWERAAEMVKELEEKCGTPVWKLRQVAEAMVVEMHAGLASDGGSKLKMLISYVDSLP  104

Query  329  SGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIA  505
            +GDE+GL+YALDLGGTNFR++RV LGGKEKG++ RE +EVSIP HLM GSS  LFDFIA
Sbjct  105  TGDEKGLYYALDLGGTNFRILRVHLGGKEKGIIKREYEEVSIPPHLMTGSSNELFDFIA  163



>ref|XP_002886018.1| ATHXK2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62277.1| ATHXK2 [Arabidopsis lyrata subsp. lyrata]
Length=502

 Score =   193 bits (490),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 99/123 (80%), Gaps = 0/123 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            R  M+SSG+WA+ + +LK  EE C TP  KLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RRRMKSSGKWARVIEILKAFEEDCATPIAKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLPSGDE G FYALDLGGTNFRVMRV LGGK+  VV RE +E SIP HLM G S  LF
Sbjct  85   VDNLPSGDETGFFYALDLGGTNFRVMRVLLGGKQDRVVKREFKEESIPPHLMTGKSHELF  144

Query  494  DFI  502
            DFI
Sbjct  145  DFI  147



>ref|XP_011072439.1| PREDICTED: hexokinase-1-like [Sesamum indicum]
Length=514

 Score =   193 bits (490),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 106/123 (86%), Gaps = 0/123 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            R  M++S RWA+ +A+LKE EEKC TP  KLRQVADA+ VEMHAGLASEGGSKLKMLISY
Sbjct  29   RQRMKNSSRWARAMAILKEFEEKCATPEAKLRQVADALTVEMHAGLASEGGSKLKMLISY  88

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VD+LP+G+EEG FYALDLGGTNFRV+RVQLGGK  G+V++E  EVSIP  LM G+S+ALF
Sbjct  89   VDSLPTGNEEGAFYALDLGGTNFRVLRVQLGGKTGGIVHQEFAEVSIPPALMSGTSDALF  148

Query  494  DFI  502
            D+I
Sbjct  149  DYI  151



>gb|KJB70380.1| hypothetical protein B456_011G070700 [Gossypium raimondii]
Length=497

 Score =   192 bits (489),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 88/120 (73%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = +2

Query  143  MRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDN  322
            M+ SG+W K + ++KE EEKC TP  KLRQVADAM VEMHAGLASEGGSKLKMLISYVDN
Sbjct  28   MKKSGKWEKAMEIVKEFEEKCATPISKLRQVADAMLVEMHAGLASEGGSKLKMLISYVDN  87

Query  323  LPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFI  502
            LP+G+E+GLFYALDLGGTNFRV+R+ LGGK +G+V+++ +EVSIPR LM G+S+ALFDFI
Sbjct  88   LPTGNEKGLFYALDLGGTNFRVLRLHLGGKGRGIVSKQFEEVSIPRSLMTGTSDALFDFI  147



>gb|KHG28915.1| Hexokinase-1 [Gossypium arboreum]
Length=497

 Score =   192 bits (489),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 88/120 (73%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = +2

Query  143  MRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDN  322
            M+ SG+W K + ++KE EEKC TP  KLRQVADAM VEMHAGLASEGGSKLKMLISYVDN
Sbjct  28   MKKSGKWEKAMEIVKEFEEKCATPISKLRQVADAMLVEMHAGLASEGGSKLKMLISYVDN  87

Query  323  LPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFI  502
            LP+G+E+GLFYALDLGGTNFRV+R+ LGGK +G+V+++ +EVSIPR LM G+S+ALFDFI
Sbjct  88   LPTGNEKGLFYALDLGGTNFRVLRLHLGGKGRGIVSKQFEEVSIPRSLMTGTSDALFDFI  147



>ref|XP_010438337.1| PREDICTED: hexokinase-1-like [Camelina sativa]
Length=499

 Score =   192 bits (488),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 103/124 (83%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            R  M+SSG+W +  A+LK  EE C TP  KLRQVADAMAVEMHAGLAS+GGSKLKMLISY
Sbjct  25   RRRMQSSGKWGRVSAILKAFEEDCATPISKLRQVADAMAVEMHAGLASDGGSKLKMLISY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLPSGDE+GLFYALDLGGTNFRVMRV LGGK+  V  +E +EVSIP HLM G S+ LF
Sbjct  85   VDNLPSGDEKGLFYALDLGGTNFRVMRVLLGGKQDRVAKQEFEEVSIPPHLMTGGSDELF  144

Query  494  DFIA  505
            +FIA
Sbjct  145  NFIA  148



>ref|XP_010433133.1| PREDICTED: hexokinase-1-like [Camelina sativa]
 ref|XP_010433134.1| PREDICTED: hexokinase-1-like [Camelina sativa]
Length=499

 Score =   192 bits (488),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 103/124 (83%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            R  M+SSG+W +  A+LK  EE C TP  KLRQVADAMAVEMHAGLAS+GGSKLKMLISY
Sbjct  25   RRRMQSSGKWGRVSAILKAFEEDCATPISKLRQVADAMAVEMHAGLASDGGSKLKMLISY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLPSGDE+GLFYALDLGGTNFRVMRV LGGK+  V  +E +EVSIP HLM G S+ LF
Sbjct  85   VDNLPSGDEKGLFYALDLGGTNFRVMRVLLGGKQDRVAKQEFEEVSIPPHLMTGGSDELF  144

Query  494  DFIA  505
            +FIA
Sbjct  145  NFIA  148



>ref|XP_010447886.1| PREDICTED: hexokinase-1 [Camelina sativa]
 ref|XP_010447887.1| PREDICTED: hexokinase-1 [Camelina sativa]
 ref|XP_010447888.1| PREDICTED: hexokinase-1 [Camelina sativa]
Length=496

 Score =   192 bits (488),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 103/124 (83%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            R  M+SSG+W +  A+LK  EE C TP  KLRQVADAMAVEMHAGLAS+GGSKLKMLISY
Sbjct  25   RRRMQSSGKWGRVSAILKAFEEDCATPISKLRQVADAMAVEMHAGLASDGGSKLKMLISY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLPSGDE+GLFYALDLGGTNFRVMRV LGGK+  V  +E +EVSIP HLM G S+ LF
Sbjct  85   VDNLPSGDEKGLFYALDLGGTNFRVMRVLLGGKQDRVAKQEFEEVSIPPHLMTGGSDELF  144

Query  494  DFIA  505
            +FIA
Sbjct  145  NFIA  148



>gb|AAL60584.1|AF454962_1 hexokinase [Brassica oleracea]
 emb|CDX82746.1| BnaC07g01200D [Brassica napus]
Length=499

 Score =   191 bits (486),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 104/124 (84%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            R  M+SSG+WA+ + +L+ LEE C TP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RRRMQSSGKWARVIEILRVLEEDCATPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLPSG+E G FYALDLGGTNFRVMRV LGGK+  VV +E++EVSIP HLM   S+ LF
Sbjct  85   VDNLPSGEEHGFFYALDLGGTNFRVMRVLLGGKQGRVVKQEAKEVSIPPHLMTSGSDELF  144

Query  494  DFIA  505
            +FIA
Sbjct  145  NFIA  148



>gb|KDO51805.1| hypothetical protein CISIN_1g0115051mg, partial [Citrus sinensis]
Length=190

 Score =   182 bits (463),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 85/121 (70%), Positives = 102/121 (84%), Gaps = 0/121 (0%)
 Frame = +2

Query  143  MRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDN  322
            ++  G+  K   ++KE EEKC TPA KL+QVADAM VEMHAGLASEGGSKLKM+ISYVDN
Sbjct  28   VKRGGKCGKANGIMKEFEEKCRTPAAKLKQVADAMTVEMHAGLASEGGSKLKMIISYVDN  87

Query  323  LPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFI  502
            LP+GDE+G +YALDLGGTNFRV+RV LGGK  G++N+E  EVSIP HLM G+S+ALFD+I
Sbjct  88   LPTGDEKGTYYALDLGGTNFRVLRVHLGGKGVGLINQEFAEVSIPPHLMTGTSDALFDYI  147

Query  503  A  505
            A
Sbjct  148  A  148



>ref|XP_009112637.1| PREDICTED: hexokinase-1-like [Brassica rapa]
Length=499

 Score =   191 bits (485),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 102/125 (82%), Gaps = 0/125 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            R  M+S G+W + + +LK  EE C TP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RRRMKSCGKWGRVIEILKVFEEDCATPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLPSGDE+G FYALDLGGTNFRVMRV LGGK+  VV +E +EVSIP  LM G+S+ LF
Sbjct  85   VDNLPSGDEQGFFYALDLGGTNFRVMRVLLGGKQDRVVKQEFEEVSIPPPLMTGASDELF  144

Query  494  DFIAH  508
            +FIA 
Sbjct  145  NFIAE  149



>gb|AAL60583.1|AF454961_1 hexokinase [Brassica oleracea]
Length=499

 Score =   191 bits (485),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 102/125 (82%), Gaps = 0/125 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            R  M+S G+W + + +LK  EE C TP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RRRMKSCGKWGRVIEILKVFEEDCATPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLPSGDE+G FYALDLGGTNFRVMRV LGGK+  VV +E +EVSIP  LM G+S+ LF
Sbjct  85   VDNLPSGDEQGFFYALDLGGTNFRVMRVLLGGKQDRVVKQEFEEVSIPPPLMTGASDELF  144

Query  494  DFIAH  508
            +FIA 
Sbjct  145  NFIAE  149



>ref|NP_179576.1| hexokinase 2 [Arabidopsis thaliana]
 sp|P93834.1|HXK2_ARATH RecName: Full=Hexokinase-2 [Arabidopsis thaliana]
 gb|AAB49911.1| hexokinase 2 [Arabidopsis thaliana]
 gb|AAC62130.1| hexokinase (ATHXK2) [Arabidopsis thaliana]
 gb|AEC06934.1| hexokinase 2 [Arabidopsis thaliana]
Length=502

 Score =   191 bits (484),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 98/123 (80%), Gaps = 0/123 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            R  M+S+G+WA+ + +LK  EE C TP  KLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RRRMKSAGKWARVIEILKAFEEDCATPIAKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLPSGDE G FYALDLGGTNFRVMRV LGGK   VV RE +E SIP HLM G S  LF
Sbjct  85   VDNLPSGDETGFFYALDLGGTNFRVMRVLLGGKHDRVVKREFKEESIPPHLMTGKSHELF  144

Query  494  DFI  502
            DFI
Sbjct  145  DFI  147



>gb|AAO24584.1| At2g19860 [Arabidopsis thaliana]
 dbj|BAE99655.1| hexokinase [Arabidopsis thaliana]
Length=502

 Score =   191 bits (484),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 98/123 (80%), Gaps = 0/123 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            R  M+S+G+WA+ + +LK  EE C TP  KLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RRRMKSAGKWARVIEILKAFEEDCATPIAKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLPSGDE G FYALDLGGTNFRVMRV LGGK   VV RE +E SIP HLM G S  LF
Sbjct  85   VDNLPSGDETGFFYALDLGGTNFRVMRVLLGGKHDRVVKREFKEESIPPHLMTGKSHELF  144

Query  494  DFI  502
            DFI
Sbjct  145  DFI  147



>emb|CDY48733.1| BnaA09g10080D [Brassica napus]
Length=499

 Score =   191 bits (484),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 102/125 (82%), Gaps = 0/125 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            R  M+S G+W + + +LK  EE C TP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RRRMKSCGKWGRVIEILKVFEEDCATPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLPSGDE+G FYALDLGGTNFRVMRV LGGK+  VV +E +EVSIP  LM G+S+ LF
Sbjct  85   VDNLPSGDEQGFFYALDLGGTNFRVMRVLLGGKQDRVVKQEFEEVSIPPPLMTGASDELF  144

Query  494  DFIAH  508
            +FIA 
Sbjct  145  NFIAE  149



>emb|CDY03331.1| BnaC09g10170D [Brassica napus]
Length=499

 Score =   191 bits (484),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 102/125 (82%), Gaps = 0/125 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            R  M+S G+W + + +LK  EE C TP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RRRMKSCGKWGRVIEILKVFEEDCATPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLPSGDE+G FYALDLGGTNFRVMRV LGGK+  VV +E +EVSIP  LM G+S+ LF
Sbjct  85   VDNLPSGDEQGFFYALDLGGTNFRVMRVLLGGKQDRVVKQEFEEVSIPPPLMTGASDELF  144

Query  494  DFIAH  508
            +FIA 
Sbjct  145  NFIAE  149



>ref|XP_009102132.1| PREDICTED: hexokinase-1 [Brassica rapa]
Length=500

 Score =   191 bits (484),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 103/124 (83%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            R  M+SSG+WA+ + +L+ LEE C TP  KLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RRRMQSSGKWARVIEILRVLEEDCATPIAKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLPSG+E G FYALDLGGTNFRVMRV LGGKE  VV +E++EVSIP HLM   S+ LF
Sbjct  85   VDNLPSGEEHGFFYALDLGGTNFRVMRVLLGGKEGRVVKQEAKEVSIPPHLMTSGSDELF  144

Query  494  DFIA  505
            +FIA
Sbjct  145  NFIA  148



>gb|KFK40349.1| hypothetical protein AALP_AA3G362600 [Arabis alpina]
Length=500

 Score =   191 bits (484),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 102/124 (82%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            R  M S+G+W + + +LK LEE C TP GKLRQVADAM VEMHAGLASEGGSKLKMLIS+
Sbjct  25   RRRMHSTGKWGRVIEILKVLEEDCATPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISF  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLPSG E+G FYALDLGGTNFRVMRV LGGK+  VV +E +EVSIP HLM G S+ LF
Sbjct  85   VDNLPSGHEKGFFYALDLGGTNFRVMRVLLGGKQDRVVKQEFEEVSIPPHLMTGGSDELF  144

Query  494  DFIA  505
            DFIA
Sbjct  145  DFIA  148



>emb|CDY35895.1| BnaA07g00920D [Brassica napus]
Length=500

 Score =   191 bits (484),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 103/124 (83%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            R  M+SSG+WA+ + +L+ LEE C TP  KLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RRRMQSSGKWARVIEILRVLEEDCATPIAKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLPSG+E G FYALDLGGTNFRVMRV LGGKE  VV +E++EVSIP HLM   S+ LF
Sbjct  85   VDNLPSGEEHGFFYALDLGGTNFRVMRVLLGGKEGRVVKQEAKEVSIPPHLMTSGSDELF  144

Query  494  DFIA  505
            +FIA
Sbjct  145  NFIA  148



>ref|XP_004503490.1| PREDICTED: hexokinase-1-like isoform X1 [Cicer arietinum]
Length=526

 Score =   191 bits (484),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/118 (75%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            RH M +S +W++ ++++KE EEKCGTP GKLRQ+ DAM VEMHAGLASEGGSKL MLISY
Sbjct  25   RHRMINSRKWSRALSIVKEFEEKCGTPIGKLRQLGDAMDVEMHAGLASEGGSKLSMLISY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEA  487
            VDNLP+GDEEGLFYALDLGGTNFRV+RV LGGKEKGV+ +E  EVSIP HLM GSSE 
Sbjct  85   VDNLPTGDEEGLFYALDLGGTNFRVLRVHLGGKEKGVIGQEFDEVSIPPHLMTGSSEV  142



>pdb|4QS7|A Chain A, Arabidopsis Hexokinase 1 (athxk1) Structure In Glucose-bound 
Form
 pdb|4QS8|A Chain A, Arabidopsis Hexokinase 1 (athxk1) Structure In Ligand-free 
Form
Length=474

 Score =   189 bits (481),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 90/119 (76%), Positives = 102/119 (86%), Gaps = 0/119 (0%)
 Frame = +2

Query  149  SSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLP  328
            SSG+W + +A+LK  EE C TP  KLRQVADAM VEMHAGLAS+GGSKLKMLISYVDNLP
Sbjct  8    SSGKWGRVLAILKAFEEDCATPISKLRQVADAMTVEMHAGLASDGGSKLKMLISYVDNLP  67

Query  329  SGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIA  505
            SGDE+GLFYALDLGGTNFRVMRV LGGK++ VV +E +EVSIP HLM G S+ LF+FIA
Sbjct  68   SGDEKGLFYALDLGGTNFRVMRVLLGGKQERVVKQEFEEVSIPPHLMTGGSDELFNFIA  126



>ref|XP_006585567.1| PREDICTED: hexokinase-1-like isoform X4 [Glycine max]
Length=360

 Score =   187 bits (474),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 87/123 (71%), Positives = 104/123 (85%), Gaps = 0/123 (0%)
 Frame = +2

Query  137  HHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYV  316
             + R   RWAK + +LKELEEKC TP  KL+ VADAM VEMHAGLASEGGSKLKMLI+YV
Sbjct  23   RYARKCRRWAKAIEILKELEEKCATPTWKLKLVADAMNVEMHAGLASEGGSKLKMLITYV  82

Query  317  DNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFD  496
            D LP+G+EEGL+YALDLGGTNFRV+RVQLGGK  G++++E  EVSIP +LMVG+S+ LFD
Sbjct  83   DKLPTGNEEGLYYALDLGGTNFRVLRVQLGGKYGGIISQEFTEVSIPPNLMVGTSDELFD  142

Query  497  FIA  505
            +IA
Sbjct  143  YIA  145



>pdb|4QS9|A Chain A, Arabidopsis Hexokinase 1 (athxk1) Mutant S177a Structure 
In Glucose- Bound Form
Length=474

 Score =   189 bits (481),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 90/119 (76%), Positives = 102/119 (86%), Gaps = 0/119 (0%)
 Frame = +2

Query  149  SSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLP  328
            SSG+W + +A+LK  EE C TP  KLRQVADAM VEMHAGLAS+GGSKLKMLISYVDNLP
Sbjct  8    SSGKWGRVLAILKAFEEDCATPISKLRQVADAMTVEMHAGLASDGGSKLKMLISYVDNLP  67

Query  329  SGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIA  505
            SGDE+GLFYALDLGGTNFRVMRV LGGK++ VV +E +EVSIP HLM G S+ LF+FIA
Sbjct  68   SGDEKGLFYALDLGGTNFRVMRVLLGGKQERVVKQEFEEVSIPPHLMTGGSDELFNFIA  126



>gb|AAT77515.1| hexokinase 7 [Nicotiana tabacum]
Length=497

 Score =   189 bits (481),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 87/123 (71%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = +2

Query  137  HHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYV  316
            H MR S +W + +A+L+E EEKC T   KL+QVADAM VEMHAGLASEGGSKLKMLI+YV
Sbjct  26   HRMRKSSKWGRAMAILREFEEKCKTQDAKLKQVADAMTVEMHAGLASEGGSKLKMLITYV  85

Query  317  DNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFD  496
            DNLP+GDE G+FYALDLGGTNFRV+RVQLGGK+ G++++E  E SIP  LMVG+S+ALFD
Sbjct  86   DNLPTGDEAGVFYALDLGGTNFRVLRVQLGGKDGGIIHQEFAEASIPPSLMVGTSDALFD  145

Query  497  FIA  505
            +IA
Sbjct  146  YIA  148



>gb|KFK29465.1| hypothetical protein AALP_AA7G137600 [Arabis alpina]
Length=498

 Score =   190 bits (482),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 103/124 (83%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            R  M+SSG+W + +A+LK  EE C TP  KL+QVADAM VEMHAGLAS+GGSKLKMLISY
Sbjct  25   RRRMQSSGKWGRVLAILKAFEEDCATPISKLKQVADAMTVEMHAGLASDGGSKLKMLISY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLPSGDE+GLFYALDLGGTNFRVMRV LGGK+  VV +E +EVSIP HLM   S+ LF
Sbjct  85   VDNLPSGDEKGLFYALDLGGTNFRVMRVLLGGKQDRVVKQEFEEVSIPPHLMTSGSDELF  144

Query  494  DFIA  505
            +FIA
Sbjct  145  NFIA  148



>ref|XP_006343033.1| PREDICTED: hexokinase-1-like [Solanum tuberosum]
Length=497

 Score =   189 bits (481),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 87/123 (71%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = +2

Query  137  HHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYV  316
            H MR S +W + +A+L+E EEKC T   KL+QVADAM VEMHAGLASEGGSKLKMLI+YV
Sbjct  26   HRMRKSSKWGRAMAILREFEEKCKTQDAKLKQVADAMTVEMHAGLASEGGSKLKMLITYV  85

Query  317  DNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFD  496
            DNLP+GDE G+FYALDLGGTNFRV+RVQLGGK+ G++++E  E SIP  LMVG+S+ALFD
Sbjct  86   DNLPTGDEAGVFYALDLGGTNFRVLRVQLGGKDGGIIHQEFAEASIPPSLMVGTSDALFD  145

Query  497  FIA  505
            +IA
Sbjct  146  YIA  148



>ref|XP_006585566.1| PREDICTED: hexokinase-1-like isoform X3 [Glycine max]
Length=375

 Score =   187 bits (474),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 87/122 (71%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = +2

Query  140  HMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVD  319
            + R   RWAK + +LKELEEKC TP  KL+ VADAM VEMHAGLASEGGSKLKMLI+YVD
Sbjct  24   YARKCRRWAKAIEILKELEEKCATPTWKLKLVADAMNVEMHAGLASEGGSKLKMLITYVD  83

Query  320  NLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDF  499
             LP+G+EEGL+YALDLGGTNFRV+RVQLGGK  G++++E  EVSIP +LMVG+S+ LFD+
Sbjct  84   KLPTGNEEGLYYALDLGGTNFRVLRVQLGGKYGGIISQEFTEVSIPPNLMVGTSDELFDY  143

Query  500  IA  505
            IA
Sbjct  144  IA  145



>ref|XP_006585565.1| PREDICTED: hexokinase-1-like isoform X2 [Glycine max]
Length=381

 Score =   187 bits (474),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 87/122 (71%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = +2

Query  140  HMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVD  319
            + R   RWAK + +LKELEEKC TP  KL+ VADAM VEMHAGLASEGGSKLKMLI+YVD
Sbjct  24   YARKCRRWAKAIEILKELEEKCATPTWKLKLVADAMNVEMHAGLASEGGSKLKMLITYVD  83

Query  320  NLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDF  499
             LP+G+EEGL+YALDLGGTNFRV+RVQLGGK  G++++E  EVSIP +LMVG+S+ LFD+
Sbjct  84   KLPTGNEEGLYYALDLGGTNFRVLRVQLGGKYGGIISQEFTEVSIPPNLMVGTSDELFDY  143

Query  500  IA  505
            IA
Sbjct  144  IA  145



>ref|XP_003627048.1| Hexokinase [Medicago truncatula]
 gb|AET01524.1| hexokinase [Medicago truncatula]
Length=494

 Score =   189 bits (479),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 90/122 (74%), Positives = 106/122 (87%), Gaps = 1/122 (1%)
 Frame = +2

Query  140  HMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVD  319
            +++ S RW K +A+LKE EEKC TP  KL+QVADAM VEMHAGLAS+GGSKLKMLIS+VD
Sbjct  27   YVKKSKRWGKAIAILKEFEEKCATPTLKLKQVADAMTVEMHAGLASDGGSKLKMLISFVD  86

Query  320  NLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDF  499
            NLP+G+EEGLFYALDLGGTNFRV+RVQLGGK+ GVV +E  EVSIP +LMVG+S  LFD+
Sbjct  87   NLPTGNEEGLFYALDLGGTNFRVLRVQLGGKD-GVVGQEFTEVSIPPNLMVGTSHELFDY  145

Query  500  IA  505
            IA
Sbjct  146  IA  147



>sp|Q2KNB9.1|HXK2_ORYSJ RecName: Full=Hexokinase-2; AltName: Full=Hexokinase-3 [Oryza 
sativa Japonica Group]
 gb|AAX68419.1| hexokinase 3 [Oryza sativa Japonica Group]
 gb|AAZ93619.1| hexokinase 2 [Oryza sativa Japonica Group]
 gb|EEE64471.1| hypothetical protein OsJ_19321 [Oryza sativa Japonica Group]
Length=494

 Score =   188 bits (477),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 103/124 (83%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            R  +R + RW +  A+L+ELEE+C  P G+LRQVADAMAVEMHAGLASEGGSKLKM+ISY
Sbjct  22   RRQLREAKRWGRADAVLRELEERCAAPPGRLRQVADAMAVEMHAGLASEGGSKLKMIISY  81

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VD LPSG+E+G+FYALDLGGTNFRV+RVQLGGKE  V+ +E  E+SIP HLM G S  LF
Sbjct  82   VDALPSGEEKGVFYALDLGGTNFRVLRVQLGGKEGRVIKQEHDEISIPPHLMTGGSNELF  141

Query  494  DFIA  505
            DFIA
Sbjct  142  DFIA  145



>ref|XP_004135675.1| PREDICTED: hexokinase-2-like [Cucumis sativus]
 ref|XP_004157285.1| PREDICTED: hexokinase-2-like [Cucumis sativus]
 gb|KGN66181.1| hypothetical protein Csa_1G574970 [Cucumis sativus]
Length=498

 Score =   187 bits (476),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 105/124 (85%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            RH M++ G+W+K + +LKE E+KC T   K++Q+A+AMAVEMHAGLASEGGSKLKMLISY
Sbjct  25   RHRMKNCGKWSKAMGILKEFEDKCRTSTEKMKQLAEAMAVEMHAGLASEGGSKLKMLISY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLP+GDE+GLFYALDLGGTNFRV+RVQLGGK+  V  +E  EVSIP HLM GSSE LF
Sbjct  85   VDNLPTGDEKGLFYALDLGGTNFRVLRVQLGGKDDRVARQEFVEVSIPPHLMTGSSEDLF  144

Query  494  DFIA  505
             FIA
Sbjct  145  GFIA  148



>ref|NP_001233957.1| hexokinase [Solanum lycopersicum]
 emb|CAC81350.1| hexokinase [Solanum lycopersicum]
Length=498

 Score =   187 bits (476),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 86/123 (70%), Positives = 104/123 (85%), Gaps = 0/123 (0%)
 Frame = +2

Query  137  HHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYV  316
            H MR S +W + +A+L+E EEKC T   KL+QVADAM VEMHAGLASEGGSKLKMLI+YV
Sbjct  26   HRMRKSSKWGRAMAILREFEEKCKTQDAKLKQVADAMTVEMHAGLASEGGSKLKMLITYV  85

Query  317  DNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFD  496
            DNLP+GDE G+FYALDLGGTNFRV+RVQLGGK+ G++++E  E SIP  LMVG+S+ LFD
Sbjct  86   DNLPTGDEAGVFYALDLGGTNFRVLRVQLGGKDGGIIHQEFAEASIPPSLMVGTSDELFD  145

Query  497  FIA  505
            +IA
Sbjct  146  YIA  148



>ref|NP_001284452.1| hexokinase-1-like [Cucumis melo]
 ref|XP_008450786.1| PREDICTED: hexokinase-1-like [Cucumis melo]
 gb|ACJ04705.1| hexokinase 2 [Cucumis melo]
Length=498

 Score =   187 bits (474),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 105/124 (85%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            RH M++ G+W+K + +LKE EEKC T   K++Q+A+AMAVEMHAGLASEGGSKLKMLISY
Sbjct  25   RHRMKNCGKWSKAMGILKEFEEKCRTSTEKMKQLAEAMAVEMHAGLASEGGSKLKMLISY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLP+GDE+GLFYALDLGGTNFRV+RVQLGGK+  V  +E  EVSIP H+M G+SE LF
Sbjct  85   VDNLPTGDEKGLFYALDLGGTNFRVLRVQLGGKDDRVARQEFVEVSIPPHVMTGTSEELF  144

Query  494  DFIA  505
             FIA
Sbjct  145  GFIA  148



>ref|XP_003533038.1| PREDICTED: hexokinase-1-like isoform X1 [Glycine max]
 gb|KHN05328.1| Hexokinase-1 [Glycine soja]
Length=492

 Score =   187 bits (474),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 87/122 (71%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = +2

Query  140  HMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVD  319
            + R   RWAK + +LKELEEKC TP  KL+ VADAM VEMHAGLASEGGSKLKMLI+YVD
Sbjct  24   YARKCRRWAKAIEILKELEEKCATPTWKLKLVADAMNVEMHAGLASEGGSKLKMLITYVD  83

Query  320  NLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDF  499
             LP+G+EEGL+YALDLGGTNFRV+RVQLGGK  G++++E  EVSIP +LMVG+S+ LFD+
Sbjct  84   KLPTGNEEGLYYALDLGGTNFRVLRVQLGGKYGGIISQEFTEVSIPPNLMVGTSDELFDY  143

Query  500  IA  505
            IA
Sbjct  144  IA  145



>gb|EAY98804.1| hypothetical protein OsI_20748 [Oryza sativa Indica Group]
Length=494

 Score =   186 bits (473),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 102/124 (82%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            R  +R + RW +  A+L+ELEE+C  P  +LRQVADAMAVEMHAGLASEGGSKLKM+ISY
Sbjct  22   RRQLREAKRWGRADAVLRELEERCAAPPARLRQVADAMAVEMHAGLASEGGSKLKMIISY  81

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VD LPSG+E+G+FYALDLGGTNFRV+RVQLGGKE  V+ +E  E+SIP HLM G S  LF
Sbjct  82   VDALPSGEEKGVFYALDLGGTNFRVLRVQLGGKEGRVIKQEHDEISIPPHLMTGGSNELF  141

Query  494  DFIA  505
            DFIA
Sbjct  142  DFIA  145



>ref|XP_006853711.1| hypothetical protein AMTR_s00056p00151260 [Amborella trichopoda]
 gb|ERN15178.1| hypothetical protein AMTR_s00056p00151260 [Amborella trichopoda]
Length=500

 Score =   186 bits (473),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 105/124 (85%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            RH ++SS +W +  A+LKE E++C TP  KLRQVADAM VEMHAGLASEGGSKLKM++SY
Sbjct  25   RHRLKSSRQWGRVSAILKETEDQCATPIQKLRQVADAMHVEMHAGLASEGGSKLKMILSY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLP+G+E+GLFYALDLGGTNFRV+RVQLGGKE  V  +E  EVSIP +LMVG+S  LF
Sbjct  85   VDNLPTGNEKGLFYALDLGGTNFRVLRVQLGGKEGRVAKQEFTEVSIPPNLMVGTSYELF  144

Query  494  DFIA  505
            D+IA
Sbjct  145  DYIA  148



>gb|KCW79624.1| hypothetical protein EUGRSUZ_C00983 [Eucalyptus grandis]
Length=456

 Score =   185 bits (469),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/109 (79%), Positives = 99/109 (91%), Gaps = 0/109 (0%)
 Frame = +2

Query  179  LLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLPSGDEEGLFYA  358
            ++KELEEKCGTP  KLRQVA+AM VEMHAGLAS+GGSKLKMLISYVD+LP+GDE+GL+YA
Sbjct  1    MVKELEEKCGTPVWKLRQVAEAMVVEMHAGLASDGGSKLKMLISYVDSLPTGDEKGLYYA  60

Query  359  LDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIA  505
            LDLGGTNFR++RV LGGKEKG++ RE +EVSIP HLM GSS  LFDFIA
Sbjct  61   LDLGGTNFRILRVHLGGKEKGIIKREYEEVSIPPHLMTGSSNELFDFIA  109



>gb|AAT47078.1| unknown protein [Oryza sativa Japonica Group]
Length=1142

 Score =   190 bits (483),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 103/124 (83%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            R  +R + RW +  A+L+ELEE+C  P G+LRQVADAMAVEMHAGLASEGGSKLKM+ISY
Sbjct  22   RRQLREAKRWGRADAVLRELEERCAAPPGRLRQVADAMAVEMHAGLASEGGSKLKMIISY  81

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VD LPSG+E+G+FYALDLGGTNFRV+RVQLGGKE  V+ +E  E+SIP HLM G S  LF
Sbjct  82   VDALPSGEEKGVFYALDLGGTNFRVLRVQLGGKEGRVIKQEHDEISIPPHLMTGGSNELF  141

Query  494  DFIA  505
            DFIA
Sbjct  142  DFIA  145



>gb|KDP40854.1| hypothetical protein JCGZ_24853 [Jatropha curcas]
Length=501

 Score =   184 bits (468),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 103/124 (83%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            R  MR  G+ AK + ++KEL+E+C TP  KL+QV DAM VEMHAGLASEGGSKLKMLISY
Sbjct  26   RRKMRRDGKLAKAMEIVKELKEQCATPIAKLKQVGDAMVVEMHAGLASEGGSKLKMLISY  85

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLP+GDE GLFYALDLGGTNFRV+RV LGGK+  +VN+E  EV IP +LM G+S+ALF
Sbjct  86   VDNLPTGDENGLFYALDLGGTNFRVLRVHLGGKDGRLVNQEFAEVPIPPNLMTGTSDALF  145

Query  494  DFIA  505
            D+IA
Sbjct  146  DYIA  149



>ref|XP_010047255.1| PREDICTED: hexokinase-2-like [Eucalyptus grandis]
Length=244

 Score =   178 bits (451),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 84/119 (71%), Positives = 98/119 (82%), Gaps = 0/119 (0%)
 Frame = +2

Query  149  SSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLP  328
            + G+W +   ++KELEEKCGTP  KLRQVADAM VEMHAGLA +GGSKLKMLISYVD+LP
Sbjct  42   TDGKWERAAEMVKELEEKCGTPVWKLRQVADAMVVEMHAGLAYDGGSKLKMLISYVDSLP  101

Query  329  SGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIA  505
            +GDE+GL+YALDLGGT+F V+ V L  KEKG+V RE +EVS P HLM GSS  LFDFIA
Sbjct  102  TGDEKGLYYALDLGGTDFCVLHVHLSRKEKGIVKREFEEVSTPPHLMTGSSNELFDFIA  160



>ref|XP_008789199.1| PREDICTED: hexokinase-2-like [Phoenix dactylifera]
Length=493

 Score =   184 bits (467),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 106/124 (85%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            R  +RS  R A+ V +++ELEE+C TP G L++VA+AMA+EM AGLASEG SKLKML+SY
Sbjct  21   RRRLRSVARSARAVEMVRELEERCATPIGLLKEVANAMAMEMQAGLASEGDSKLKMLLSY  80

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VD+LPSGDE+GLFYALDLGGTNFRV+RVQLGGKE+ VV RES EVSIP HLMVG+S  LF
Sbjct  81   VDSLPSGDEKGLFYALDLGGTNFRVLRVQLGGKERHVVKRESTEVSIPPHLMVGNSAELF  140

Query  494  DFIA  505
            +FIA
Sbjct  141  EFIA  144



>ref|XP_009394175.1| PREDICTED: hexokinase-2-like [Musa acuminata subsp. malaccensis]
Length=493

 Score =   184 bits (467),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 102/124 (82%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            RH MRS+ RWA+  A+L+ELEEKC TP  KL +VADAM  EMHAGL SE  SKLKM+ISY
Sbjct  25   RHRMRSAERWARAAAVLRELEEKCATPVEKLWEVADAMTKEMHAGLESEDVSKLKMIISY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VD LP+GDE GLFYALDLGGTNFRV+RVQLGG+E  VV +E++EVSIP  LMVG S+ LF
Sbjct  85   VDKLPTGDERGLFYALDLGGTNFRVLRVQLGGREGRVVRQEAKEVSIPHDLMVGRSDELF  144

Query  494  DFIA  505
            DFIA
Sbjct  145  DFIA  148



>dbj|BAJ89593.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87024.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=495

 Score =   184 bits (467),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 103/124 (83%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            R  MR + RW +  A+L+ L+E+C  P  +LRQVADA+AVEMHAGLASEGGSKL M+ISY
Sbjct  24   RRQMREAKRWGRADAVLRGLDERCAAPPARLRQVADAVAVEMHAGLASEGGSKLGMIISY  83

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VD+LPSG E+GLFYALDLGGTNFRV+RVQLGGKE  VV +E +E+SIP HLM G+S+ LF
Sbjct  84   VDSLPSGQEKGLFYALDLGGTNFRVLRVQLGGKEGRVVKQECEEISIPAHLMTGTSQELF  143

Query  494  DFIA  505
            DFIA
Sbjct  144  DFIA  147



>ref|XP_007135629.1| hypothetical protein PHAVU_010G144900g [Phaseolus vulgaris]
 gb|ESW07623.1| hypothetical protein PHAVU_010G144900g [Phaseolus vulgaris]
Length=495

 Score =   184 bits (466),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 84/122 (69%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = +2

Query  140  HMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVD  319
            ++R   RW +   +L+ELEEKC TP+ KL+++ADAM VEMHAGLASEGGSKLKMLI+YVD
Sbjct  27   YVRKCRRWGRVTEILQELEEKCATPSWKLKRIADAMNVEMHAGLASEGGSKLKMLITYVD  86

Query  320  NLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDF  499
             LP+G EEGL+YALDLGGTNFRV+RVQLGGK+ G++++ES EVSIP +LMVG+S  LFD+
Sbjct  87   KLPTGYEEGLYYALDLGGTNFRVLRVQLGGKDGGIISQESTEVSIPPNLMVGTSAELFDY  146

Query  500  IA  505
            IA
Sbjct  147  IA  148



>gb|KJB35042.1| hypothetical protein B456_006G096800 [Gossypium raimondii]
Length=430

 Score =   182 bits (461),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/121 (69%), Positives = 103/121 (85%), Gaps = 0/121 (0%)
 Frame = +2

Query  143  MRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDN  322
            M+ SG+W K + ++KE EE C TP  KL+QVADAM VEMHAGLASEGGSKLKMLI+YVD+
Sbjct  28   MKKSGKWVKAMEIVKEFEESCRTPISKLKQVADAMTVEMHAGLASEGGSKLKMLITYVDS  87

Query  323  LPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFI  502
            LP+GDE+GLFYALDLGGTNFRV+RV LGGK+ G++ ++ +EVSIP + M GSS ALFD+I
Sbjct  88   LPTGDEKGLFYALDLGGTNFRVLRVLLGGKDGGILKQQFKEVSIPPNKMTGSSAALFDYI  147

Query  503  A  505
            A
Sbjct  148  A  148



>gb|EMT07302.1| Hexokinase-2 [Aegilops tauschii]
Length=446

 Score =   182 bits (462),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 101/124 (81%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            R  MR + RW +  A+L+ LEE+   P  +LRQVADAMAVEMHAGLASEGGSKL M+ISY
Sbjct  22   RRQMREAKRWGRADAVLRGLEERSAAPPARLRQVADAMAVEMHAGLASEGGSKLGMIISY  81

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VD+LPSG E+GLFYALDLGGTNFRV+RVQLGGKE  VV +E  E+SIP HLM G+S+ LF
Sbjct  82   VDSLPSGQEKGLFYALDLGGTNFRVLRVQLGGKEGRVVKQECDEISIPAHLMTGTSQELF  141

Query  494  DFIA  505
            DFIA
Sbjct  142  DFIA  145



>ref|XP_006426867.1| hypothetical protein CICLE_v10025452mg [Citrus clementina]
 gb|ESR40107.1| hypothetical protein CICLE_v10025452mg [Citrus clementina]
Length=496

 Score =   182 bits (462),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/121 (70%), Positives = 102/121 (84%), Gaps = 0/121 (0%)
 Frame = +2

Query  143  MRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDN  322
            ++  G+  K   ++KE EEKC TPA KL+QVADAM VEMHAGLASEGGSKLKM+ISYVDN
Sbjct  28   VKRGGKCGKANGIMKEFEEKCRTPAAKLKQVADAMTVEMHAGLASEGGSKLKMIISYVDN  87

Query  323  LPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFI  502
            LP+GDE+G +YALDLGGTNFRV+RV LGGK  G++N+E  EVSIP HLM G+S+ALFD+I
Sbjct  88   LPTGDEKGTYYALDLGGTNFRVLRVHLGGKGVGLINQEFAEVSIPPHLMTGTSDALFDYI  147

Query  503  A  505
            A
Sbjct  148  A  148



>gb|KCW79126.1| hypothetical protein EUGRSUZ_C005691, partial [Eucalyptus grandis]
Length=320

 Score =   178 bits (451),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/119 (71%), Positives = 98/119 (82%), Gaps = 0/119 (0%)
 Frame = +2

Query  149  SSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLP  328
            + G+W +   ++KELEEKCGTP  KLRQVADAM VEMHAGLA +GGSKLKMLISYVD+LP
Sbjct  42   TDGKWERAAEMVKELEEKCGTPVWKLRQVADAMVVEMHAGLAYDGGSKLKMLISYVDSLP  101

Query  329  SGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIA  505
            +GDE+GL+YALDLGGT+F V+ V L  KEKG+V RE +EVS P HLM GSS  LFDFIA
Sbjct  102  TGDEKGLYYALDLGGTDFCVLHVHLSRKEKGIVKREFEEVSTPPHLMTGSSNELFDFIA  160



>gb|KJB35041.1| hypothetical protein B456_006G096800 [Gossypium raimondii]
Length=496

 Score =   182 bits (461),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 84/121 (69%), Positives = 103/121 (85%), Gaps = 0/121 (0%)
 Frame = +2

Query  143  MRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDN  322
            M+ SG+W K + ++KE EE C TP  KL+QVADAM VEMHAGLASEGGSKLKMLI+YVD+
Sbjct  28   MKKSGKWVKAMEIVKEFEESCRTPISKLKQVADAMTVEMHAGLASEGGSKLKMLITYVDS  87

Query  323  LPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFI  502
            LP+GDE+GLFYALDLGGTNFRV+RV LGGK+ G++ ++ +EVSIP + M GSS ALFD+I
Sbjct  88   LPTGDEKGLFYALDLGGTNFRVLRVLLGGKDGGILKQQFKEVSIPPNKMTGSSAALFDYI  147

Query  503  A  505
            A
Sbjct  148  A  148



>ref|XP_010232254.1| PREDICTED: hexokinase-9-like isoform X2 [Brachypodium distachyon]
Length=471

 Score =   181 bits (459),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 85/124 (69%), Positives = 102/124 (82%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            R  +R + RWA+  A+L +L+E+C  PA +LR VADAM VEM AGLASE GSKLKML++Y
Sbjct  22   RQRLREAKRWARAAAVLCDLQERCAAPAARLRMVADAMDVEMRAGLASEDGSKLKMLVTY  81

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VD+LPSGDE+GLFYALDLGGTNFRV+RVQLGGKE+ V+ +ES  VSIP+HLM GS   LF
Sbjct  82   VDSLPSGDEKGLFYALDLGGTNFRVLRVQLGGKEQRVIKQESVGVSIPQHLMSGSPHELF  141

Query  494  DFIA  505
            DFIA
Sbjct  142  DFIA  145



>ref|XP_003567061.1| PREDICTED: hexokinase-9-like isoform X1 [Brachypodium distachyon]
Length=496

 Score =   181 bits (459),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 85/124 (69%), Positives = 102/124 (82%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            R  +R + RWA+  A+L +L+E+C  PA +LR VADAM VEM AGLASE GSKLKML++Y
Sbjct  22   RQRLREAKRWARAAAVLCDLQERCAAPAARLRMVADAMDVEMRAGLASEDGSKLKMLVTY  81

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VD+LPSGDE+GLFYALDLGGTNFRV+RVQLGGKE+ V+ +ES  VSIP+HLM GS   LF
Sbjct  82   VDSLPSGDEKGLFYALDLGGTNFRVLRVQLGGKEQRVIKQESVGVSIPQHLMSGSPHELF  141

Query  494  DFIA  505
            DFIA
Sbjct  142  DFIA  145



>ref|XP_010041948.1| PREDICTED: hexokinase-1-like [Eucalyptus grandis]
Length=232

 Score =   174 bits (440),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 81/119 (68%), Positives = 97/119 (82%), Gaps = 0/119 (0%)
 Frame = +2

Query  149  SSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLP  328
            + G+W +   ++KELEEKCGTP  K RQVA+AM V+MHAGL  +GGSKLKMLISYVD+LP
Sbjct  43   TDGKWERAAEMVKELEEKCGTPVWKPRQVAEAMVVKMHAGLTYDGGSKLKMLISYVDSLP  102

Query  329  SGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIA  505
            +GDE+GL+YALDLGGTNF ++RV L  KEKG+V RE +EVSIP HLM GS   LFDFIA
Sbjct  103  TGDEKGLYYALDLGGTNFCILRVHLSRKEKGIVKREFEEVSIPPHLMTGSLNELFDFIA  161



>ref|XP_006465701.1| PREDICTED: hexokinase-1-like [Citrus sinensis]
Length=496

 Score =   179 bits (455),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 84/121 (69%), Positives = 101/121 (83%), Gaps = 0/121 (0%)
 Frame = +2

Query  143  MRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDN  322
            ++  G+  K   ++KE EEKC TPA KL+ VADAM VEMHAGLASEGGSKLKM+ISYVDN
Sbjct  28   VKRGGKCGKANGIMKEFEEKCRTPAAKLKLVADAMTVEMHAGLASEGGSKLKMIISYVDN  87

Query  323  LPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFI  502
            LP+GDE+G +YALDLGGTNFRV+RV LGGK  G++N+E  EVSIP HLM G+S+ALFD+I
Sbjct  88   LPTGDEKGTYYALDLGGTNFRVLRVHLGGKGVGLINQEFAEVSIPPHLMTGTSDALFDYI  147

Query  503  A  505
            A
Sbjct  148  A  148



>ref|XP_003568034.1| PREDICTED: hexokinase-2 isoform X1 [Brachypodium distachyon]
Length=494

 Score =   178 bits (451),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/124 (68%), Positives = 103/124 (83%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            R  +R + RWA+  A+L+ELEE+C     +LRQVADA+AVEMHAGLASEGGSKL M+IS+
Sbjct  22   RRQIREAKRWARAAAVLRELEERCAATPARLRQVADAVAVEMHAGLASEGGSKLGMIISH  81

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            V++LPSG E+GLFYALDLGGTNFRV+RVQLGGKE  VV +E +E+SIP +LM G+S  LF
Sbjct  82   VESLPSGQEKGLFYALDLGGTNFRVLRVQLGGKEGRVVKQECEEISIPTNLMTGNSHDLF  141

Query  494  DFIA  505
            DFIA
Sbjct  142  DFIA  145



>ref|XP_011080413.1| PREDICTED: hexokinase-1-like [Sesamum indicum]
Length=489

 Score =   177 bits (450),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 85/124 (69%), Positives = 103/124 (83%), Gaps = 1/124 (1%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            R  M+  G+WA+ +ALLKE EEKC TP  KL+QVADA+ VEMHAGLASEGGSKLKMLIS+
Sbjct  25   RQRMKRCGKWARAMALLKEFEEKCATPEAKLKQVADALTVEMHAGLASEGGSKLKMLISF  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            + NLP+GDE+G+FYALDLGGTNFRV+RVQL G+  GVV++E  EVSIP  L  G+S+ LF
Sbjct  85   IANLPTGDEDGIFYALDLGGTNFRVLRVQLRGR-GGVVHQEIAEVSIPPALTGGTSDELF  143

Query  494  DFIA  505
            D+IA
Sbjct  144  DYIA  147



>ref|XP_004513053.1| PREDICTED: hexokinase-1-like [Cicer arietinum]
Length=499

 Score =   177 bits (448),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 84/119 (71%), Positives = 99/119 (83%), Gaps = 0/119 (0%)
 Frame = +2

Query  149  SSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLP  328
            SSG+W     ++K   E+CGTP  KL++VA+AM  EM+ GLASEGGSKLKMLIS+VDNLP
Sbjct  31   SSGKWGMAEDIVKRFGEECGTPIEKLKKVAEAMVFEMNKGLASEGGSKLKMLISFVDNLP  90

Query  329  SGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIA  505
            SG+E+G+FYALDLGGTNFR +RVQLGGKEKGV N ES+EVSIP HLM GS+  LFDFIA
Sbjct  91   SGNEKGMFYALDLGGTNFRALRVQLGGKEKGVANVESEEVSIPPHLMTGSAHELFDFIA  149



>ref|XP_002283574.1| PREDICTED: hexokinase-2 [Vitis vinifera]
Length=498

 Score =   175 bits (444),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 84/124 (68%), Positives = 101/124 (81%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            R  MR +    K + ++K+ EE C T   KL+ VADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RRRMRCANGRVKAMEIVKDFEEDCATSYSKLKHVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLP+GDE+GLFYALDLGGTNFRV+RVQLGG++  +VN+E  EVSIP +LMV S++ALF
Sbjct  85   VDNLPTGDEKGLFYALDLGGTNFRVLRVQLGGRDGRIVNQEFVEVSIPPNLMVKSTDALF  144

Query  494  DFIA  505
            D+IA
Sbjct  145  DYIA  148



>ref|XP_010665885.1| PREDICTED: hexokinase-1-like isoform X1 [Beta vulgaris subsp. 
vulgaris]
Length=513

 Score =   174 bits (441),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 79/121 (65%), Positives = 101/121 (83%), Gaps = 0/121 (0%)
 Frame = +2

Query  143  MRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDN  322
            M++   W +T+ +L++ EEKCGTP  KL+QVADAM +EMHAGLAS+ GS +KMLISYVDN
Sbjct  28   MKNGANWRRTMEILRDFEEKCGTPIEKLKQVADAMVMEMHAGLASDDGSSIKMLISYVDN  87

Query  323  LPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFI  502
            LP+GDE+GLFYALDLGGTNFRV+RVQLGGK+ G+ ++E  EV IP  LM+G+S+ LF +I
Sbjct  88   LPTGDEDGLFYALDLGGTNFRVLRVQLGGKDGGIKHQEFAEVPIPVELMIGTSDDLFGYI  147

Query  503  A  505
            A
Sbjct  148  A  148



>emb|CAN74362.1| hypothetical protein VITISV_016381 [Vitis vinifera]
Length=533

 Score =   174 bits (441),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 84/124 (68%), Positives = 101/124 (81%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            R  MR +    K + ++K+ EE C T   KL+ VADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RRRMRCANGRVKAMEIVKDFEEDCATSYSKLKHVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLP+GDE+GLFYALDLGGTNFRV+RVQLGG++  +VN+E  EVSIP +LMV S++ALF
Sbjct  85   VDNLPTGDEKGLFYALDLGGTNFRVLRVQLGGRDGHIVNQEFVEVSIPPNLMVKSTDALF  144

Query  494  DFIA  505
            D+IA
Sbjct  145  DYIA  148



>dbj|BAP47497.1| hexokinase [Gentiana triflora]
Length=497

 Score =   172 bits (436),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 103/124 (83%), Gaps = 1/124 (1%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            RHHM++S +W K + +L+ELEE C T   KL+Q+ADAM VEMHAGLASEGGSKLKMLI+Y
Sbjct  25   RHHMKNSAKWGKALEILEELEENCATSTWKLKQIADAMTVEMHAGLASEGGSKLKMLITY  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VDNLP+G+E+G+FYALDLGGTNFRVMRV  G  E+ +VN E    SIP HLMVG+S+ALF
Sbjct  85   VDNLPTGEEKGVFYALDLGGTNFRVMRVHFGEAEEQIVNEEVH-TSIPLHLMVGTSDALF  143

Query  494  DFIA  505
            DFIA
Sbjct  144  DFIA  147



>gb|KDO50431.1| hypothetical protein CISIN_1g0104561mg, partial [Citrus sinensis]
 gb|KDO50432.1| hypothetical protein CISIN_1g0104561mg, partial [Citrus sinensis]
Length=229

 Score =   164 bits (414),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 74/123 (60%), Positives = 97/123 (79%), Gaps = 0/123 (0%)
 Frame = +2

Query  137  HHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYV  316
              ++S  +W + + +L+ELEE C T   +LRQV DAMAVEMHAGLASEGGSKLKML+++V
Sbjct  28   KRVKSRRKWKRVMGVLRELEEGCETTVSRLRQVVDAMAVEMHAGLASEGGSKLKMLLTFV  87

Query  317  DNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFD  496
            DNLP+G E+G++YALDLGGTNFRV+RVQLGG+   +++ + +   IP  LM G+SE LFD
Sbjct  88   DNLPTGSEKGIYYALDLGGTNFRVLRVQLGGQRSSILSSDVERQPIPPELMTGTSEDLFD  147

Query  497  FIA  505
            FIA
Sbjct  148  FIA  150



>ref|XP_002988103.1| hypothetical protein SELMODRAFT_269350 [Selaginella moellendorffii]
 gb|EFJ10895.1| hypothetical protein SELMODRAFT_269350 [Selaginella moellendorffii]
Length=513

 Score =   169 bits (429),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/123 (63%), Positives = 96/123 (78%), Gaps = 0/123 (0%)
 Frame = +2

Query  137  HHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYV  316
              +R    W +   ++ E    C TP  +LRQ+ D M VEMHAGLA +GGSKLKM++SYV
Sbjct  28   RRLRQRTSWKRAQCIVDEFRGGCSTPLSRLRQIVDNMVVEMHAGLAIDGGSKLKMVLSYV  87

Query  317  DNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFD  496
            DNLP+G+EEGLFYALDLGGTNFRV+RVQLGGKEK ++N+E +EVSIP  +MVGS+E LFD
Sbjct  88   DNLPTGNEEGLFYALDLGGTNFRVLRVQLGGKEKRIMNQEYKEVSIPPKVMVGSNEDLFD  147

Query  497  FIA  505
            FIA
Sbjct  148  FIA  150



>ref|XP_002313358.2| hexokinase family protein [Populus trichocarpa]
 gb|EEE87313.2| hexokinase family protein [Populus trichocarpa]
Length=508

 Score =   169 bits (428),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/116 (66%), Positives = 96/116 (83%), Gaps = 0/116 (0%)
 Frame = +2

Query  158  RWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLPSGD  337
            +W + V +L+ELEE C TP G+LRQV DAMAVEMHAGLASEGGSKLKML+++VD+LP+G 
Sbjct  33   KWKRVVGVLRELEEACETPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTFVDHLPTGS  92

Query  338  EEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIA  505
            E G +YALDLGGTNFRV+RVQLGG+   +++++ +   IPRHLM  +SE LFDFIA
Sbjct  93   EIGTYYALDLGGTNFRVLRVQLGGRRSSILSQDVERRPIPRHLMTSTSEDLFDFIA  148



>ref|XP_002972691.1| hypothetical protein SELMODRAFT_441916 [Selaginella moellendorffii]
 gb|EFJ25912.1| hypothetical protein SELMODRAFT_441916 [Selaginella moellendorffii]
Length=513

 Score =   169 bits (427),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 77/123 (63%), Positives = 96/123 (78%), Gaps = 0/123 (0%)
 Frame = +2

Query  137  HHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYV  316
              +R    W +   ++ E    C TP  +LRQ+ D M VEMHAGLA +GGSKLKM++SYV
Sbjct  28   RRLRQRTSWKRAQCIVDEFRGGCSTPLSRLRQIVDNMVVEMHAGLAIDGGSKLKMVLSYV  87

Query  317  DNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFD  496
            DNLP+G+EEGLFYALDLGGTNFRV+RVQ+GGKEK ++N+E +EVSIP  +MVGS+E LFD
Sbjct  88   DNLPTGNEEGLFYALDLGGTNFRVLRVQMGGKEKRIMNQEYKEVSIPPKVMVGSNEDLFD  147

Query  497  FIA  505
            FIA
Sbjct  148  FIA  150



>ref|XP_010246625.1| PREDICTED: hexokinase-3-like [Nelumbo nucifera]
Length=511

 Score =   168 bits (426),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 78/123 (63%), Positives = 97/123 (79%), Gaps = 0/123 (0%)
 Frame = +2

Query  137  HHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYV  316
              ++S  +W + V +L+ELEE C T  G+LRQV DAMAVEMHAGLASEGGSKLKML+++V
Sbjct  26   RRVKSRRKWNRVVGVLRELEEGCSTSIGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTFV  85

Query  317  DNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFD  496
            DNLP+G+E+G +YALDLGGTNFRV+RVQLGGK   ++  E +   IP HLM  +SE LFD
Sbjct  86   DNLPNGNEKGTYYALDLGGTNFRVLRVQLGGKNSLILGHEVERQPIPEHLMTSTSEDLFD  145

Query  497  FIA  505
            FIA
Sbjct  146  FIA  148



>ref|XP_011045448.1| PREDICTED: hexokinase-3-like [Populus euphratica]
Length=488

 Score =   167 bits (424),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 74/116 (64%), Positives = 97/116 (84%), Gaps = 0/116 (0%)
 Frame = +2

Query  158  RWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLPSGD  337
            +W + V++LKELEE C TP G+LRQV DAMAVEMHAGLASEGGSKLKML+++VD+LP+G 
Sbjct  33   KWKRVVSVLKELEEACETPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTFVDHLPTGS  92

Query  338  EEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIA  505
            E G +YALDLGGTNFRV+R+QLGG+   +++++ +   IP+HL+  +SE LFDFIA
Sbjct  93   EIGTYYALDLGGTNFRVLRIQLGGRRSSILSQDVERQPIPQHLLTSTSEDLFDFIA  148



>gb|KEH27216.1| hexokinase [Medicago truncatula]
Length=496

 Score =   167 bits (424),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 96/125 (77%), Gaps = 3/125 (2%)
 Frame = +2

Query  140  HMRSSG---RWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLIS  310
              RS G   +W K   +LK   E+C T   KL+ VA+AM VEMH GL +EGGS LKMLIS
Sbjct  22   QQRSKGGCEKWEKVEEILKVFGEECETSIEKLKSVAEAMVVEMHNGLENEGGSMLKMLIS  81

Query  311  YVDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEAL  490
            +VDNLPSGDE+GLFYALDLGGTNFR +R+QLGGKEKGVV  E++EVSIP HLM GSS  L
Sbjct  82   FVDNLPSGDEKGLFYALDLGGTNFRALRIQLGGKEKGVVKVETEEVSIPPHLMTGSSHEL  141

Query  491  FDFIA  505
            FDFIA
Sbjct  142  FDFIA  146



>ref|XP_010673708.1| PREDICTED: hexokinase-3-like isoform X1 [Beta vulgaris subsp. 
vulgaris]
Length=509

 Score =   167 bits (424),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 77/121 (64%), Positives = 97/121 (80%), Gaps = 0/121 (0%)
 Frame = +2

Query  143  MRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDN  322
            ++S  +W + V +LKELEE CGT   +L+QV DAMAVEMHAGLASEGGSKLKML+++VD 
Sbjct  28   VKSRRKWQRVVGVLKELEECCGTHVSRLKQVVDAMAVEMHAGLASEGGSKLKMLLTFVDK  87

Query  323  LPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFI  502
            LP+G E+G++YALDLGGTNFRV+RVQLGG+  G+V  + +   IP HLM  +SE LFDFI
Sbjct  88   LPNGSEKGIYYALDLGGTNFRVLRVQLGGRRSGIVRHDVERKPIPEHLMTSTSEDLFDFI  147

Query  503  A  505
            A
Sbjct  148  A  148



>gb|AHY84733.1| hexokinase [Manihot esculenta]
Length=506

 Score =   167 bits (424),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 75/116 (65%), Positives = 96/116 (83%), Gaps = 0/116 (0%)
 Frame = +2

Query  158  RWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLPSGD  337
            +W++ V LL+ELEE C TP G+LRQV DAMAVEMHAGLASEGGSKLKML+++VD+LP+G 
Sbjct  33   KWSRVVGLLRELEESCETPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTFVDHLPTGS  92

Query  338  EEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIA  505
            E G +YALDLGGTNFRV+RVQLGG+   +++++ +   IP+HLM  + E LFDFIA
Sbjct  93   EVGTYYALDLGGTNFRVIRVQLGGRRSSILSKDVELQPIPQHLMTSTREDLFDFIA  148



>ref|XP_002298298.1| hexokinase family protein [Populus trichocarpa]
 gb|EEE83103.1| hexokinase family protein [Populus trichocarpa]
Length=508

 Score =   167 bits (422),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 74/116 (64%), Positives = 96/116 (83%), Gaps = 0/116 (0%)
 Frame = +2

Query  158  RWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLPSGD  337
            +W + V +L+ELEE C TP G+LRQV DAMAVEMHAGLASEGGSKLKML+++VD+LP+G 
Sbjct  33   KWKRVVRVLEELEEACETPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTFVDHLPTGS  92

Query  338  EEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIA  505
            E G +YALDLGGTNFRV+R+QLGG+   +++++ +   IP+HLM  +SE LFDFIA
Sbjct  93   EIGTYYALDLGGTNFRVLRIQLGGRRSSILSQDVERQPIPQHLMTSTSEDLFDFIA  148



>gb|KHN09247.1| Hexokinase-3 [Glycine soja]
Length=477

 Score =   166 bits (420),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/121 (64%), Positives = 96/121 (79%), Gaps = 0/121 (0%)
 Frame = +2

Query  143  MRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDN  322
            MRS G+W + V +L+E+EE C T  G+LRQV DAMAVEMHAGLASEGGSKLKMLI++V N
Sbjct  1    MRSRGKWKRVVRVLREVEEGCETSVGRLRQVVDAMAVEMHAGLASEGGSKLKMLITFVHN  60

Query  323  LPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFI  502
            LP+G E+G +YALDLGGTNFRV+RV L G++  V+  E +   IP+HLM  +SE LFDFI
Sbjct  61   LPNGTEKGTYYALDLGGTNFRVLRVHLHGQQSSVLEHEVERQPIPQHLMTSTSEDLFDFI  120

Query  503  A  505
            A
Sbjct  121  A  121



>ref|XP_003537744.1| PREDICTED: hexokinase-3-like [Glycine max]
Length=504

 Score =   166 bits (420),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 78/121 (64%), Positives = 96/121 (79%), Gaps = 0/121 (0%)
 Frame = +2

Query  143  MRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDN  322
            MRS G+W + V +L+E+EE C T  G+LRQV DAMAVEMHAGLASEGGSKLKMLI++V N
Sbjct  28   MRSRGKWKRVVRVLREVEEGCETSVGRLRQVVDAMAVEMHAGLASEGGSKLKMLITFVHN  87

Query  323  LPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFI  502
            LP+G E+G +YALDLGGTNFRV+RV L G++  V+  E +   IP+HLM  +SE LFDFI
Sbjct  88   LPNGTEKGTYYALDLGGTNFRVLRVHLHGQQSSVLEHEVERQPIPQHLMTSTSEDLFDFI  147

Query  503  A  505
            A
Sbjct  148  A  148



>ref|XP_011032066.1| PREDICTED: hexokinase-3 isoform X1 [Populus euphratica]
 ref|XP_011032067.1| PREDICTED: hexokinase-3 isoform X2 [Populus euphratica]
Length=508

 Score =   166 bits (420),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 74/116 (64%), Positives = 95/116 (82%), Gaps = 0/116 (0%)
 Frame = +2

Query  158  RWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLPSGD  337
            +W + V +L+ELEE C TP G+LRQV DAMAVEMHAGLASEGGSKLKML+++VD+LP G 
Sbjct  33   KWKRVVGVLRELEEACETPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTFVDHLPRGS  92

Query  338  EEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIA  505
            E G +YALDLGGTNFRV+R+QLGG+   +++++ +   IP+HLM  +SE LFDFIA
Sbjct  93   EIGTYYALDLGGTNFRVLRIQLGGRRSSILSQDVERQPIPQHLMTSTSEDLFDFIA  148



>tpg|DAA57818.1| TPA: hypothetical protein ZEAMMB73_547897 [Zea mays]
Length=371

 Score =   163 bits (413),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 80/131 (61%), Positives = 100/131 (76%), Gaps = 7/131 (5%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLAS---EGGSK----  292
            R  +R + RWA+  A+L++L+E+C  P  +LRQVADAM  EM AGLAS   EG S     
Sbjct  25   RQRLREARRWARAGAVLRDLQERCAAPVERLRQVADAMVAEMRAGLASNDSEGDSGSSVL  84

Query  293  LKMLISYVDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMV  472
            LKML++YVD+LPSGDE+GLFYALDLGGTNFRV+R+Q GGKE+ +V +ES+ VSIP+HLM 
Sbjct  85   LKMLVTYVDSLPSGDEKGLFYALDLGGTNFRVLRIQFGGKEQRIVKQESKTVSIPQHLMS  144

Query  473  GSSEALFDFIA  505
              S  LFDFIA
Sbjct  145  RGSNELFDFIA  155



>ref|XP_007015149.1| Hexokinase-like 1 [Theobroma cacao]
 gb|EOY32768.1| Hexokinase-like 1 [Theobroma cacao]
Length=506

 Score =   166 bits (419),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 77/123 (63%), Positives = 97/123 (79%), Gaps = 0/123 (0%)
 Frame = +2

Query  137  HHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYV  316
              ++S  +W + V +LKELEE C T  G+LRQV DAMAVEMHAGLASEGGSKLKML+++V
Sbjct  26   RRVKSRRKWKRVVGVLKELEESCETTVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTFV  85

Query  317  DNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFD  496
            DNLPSG E+G +YALDLGGTNFRV+RV+LGG+   V++++ +   IP+ LM G SE L D
Sbjct  86   DNLPSGSEKGTYYALDLGGTNFRVLRVELGGQRSSVLDQDVERQPIPQQLMSGRSEDLLD  145

Query  497  FIA  505
            FIA
Sbjct  146  FIA  148



>tpg|DAA57819.1| TPA: hypothetical protein ZEAMMB73_547897 [Zea mays]
Length=400

 Score =   163 bits (413),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 80/131 (61%), Positives = 100/131 (76%), Gaps = 7/131 (5%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLAS---EGGSK----  292
            R  +R + RWA+  A+L++L+E+C  P  +LRQVADAM  EM AGLAS   EG S     
Sbjct  25   RQRLREARRWARAGAVLRDLQERCAAPVERLRQVADAMVAEMRAGLASNDSEGDSGSSVL  84

Query  293  LKMLISYVDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMV  472
            LKML++YVD+LPSGDE+GLFYALDLGGTNFRV+R+Q GGKE+ +V +ES+ VSIP+HLM 
Sbjct  85   LKMLVTYVDSLPSGDEKGLFYALDLGGTNFRVLRIQFGGKEQRIVKQESKTVSIPQHLMS  144

Query  473  GSSEALFDFIA  505
              S  LFDFIA
Sbjct  145  RGSNELFDFIA  155



>gb|KDP22128.1| hypothetical protein JCGZ_25959 [Jatropha curcas]
Length=499

 Score =   165 bits (417),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 97/119 (82%), Gaps = 0/119 (0%)
 Frame = +2

Query  149  SSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLP  328
            S  +W + + +LKELEE C T  G+LRQV DAMAVEMHAGLASEGGSKLKML++YVD+LP
Sbjct  30   SRKKWRRVLGVLKELEESCETTIGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDHLP  89

Query  329  SGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIA  505
            +G E G +YALDLG TNFRV+RVQLGG+E  +++++ ++  IP+HLM  SSE LFDFIA
Sbjct  90   TGSEIGTYYALDLGDTNFRVLRVQLGGRESLMLSKDVEQQPIPQHLMTSSSEDLFDFIA  148



>ref|XP_008800256.1| PREDICTED: hexokinase-3-like isoform X2 [Phoenix dactylifera]
Length=227

 Score =   158 bits (399),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 96/123 (78%), Gaps = 0/123 (0%)
 Frame = +2

Query  137  HHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYV  316
               RS  +W + V +L+E E+ C T  G+L+QV DAMAVEMHAGLAS+GGSKLKML+S++
Sbjct  26   RRARSQRKWRRAVEVLREFEDGCATSIGRLKQVVDAMAVEMHAGLASDGGSKLKMLLSFI  85

Query  317  DNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFD  496
            D+LP+G+E G +YALDLGGTNFRV+RV+LGGK   + + + +  +IPR LM G+SE LFD
Sbjct  86   DSLPNGNEIGTYYALDLGGTNFRVLRVRLGGKGSMISSPQVERQAIPRELMSGTSEDLFD  145

Query  497  FIA  505
            FIA
Sbjct  146  FIA  148



>ref|NP_001044102.1| Os01g0722700 [Oryza sativa Japonica Group]
 dbj|BAF06016.1| Os01g0722700 [Oryza sativa Japonica Group]
 dbj|BAG91675.1| unnamed protein product [Oryza sativa Japonica Group]
Length=294

 Score =   159 bits (403),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 72/109 (66%), Positives = 93/109 (85%), Gaps = 0/109 (0%)
 Frame = +2

Query  179  LLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLPSGDEEGLFYA  358
            LL++L+E+C  P   LRQVADAMA EM AGLA+EGGS L+ML++YVD+LPSG E+G+FYA
Sbjct  42   LLRDLQERCAAPVELLRQVADAMAAEMRAGLAAEGGSDLQMLVTYVDSLPSGGEKGMFYA  101

Query  359  LDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIA  505
            LDLGGTNFRV+RVQLGGKE+ ++ ++S+ +SIP+HLM  SS  LFDF+A
Sbjct  102  LDLGGTNFRVLRVQLGGKERRIIKQDSEGISIPQHLMSSSSHELFDFVA  150



>gb|KJB83525.1| hypothetical protein B456_013G251900 [Gossypium raimondii]
 gb|KJB83526.1| hypothetical protein B456_013G251900 [Gossypium raimondii]
Length=355

 Score =   161 bits (407),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/116 (65%), Positives = 95/116 (82%), Gaps = 1/116 (1%)
 Frame = +2

Query  158  RWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLPSGD  337
            +W + V +LKE+EE C T  G+L+QV DAMAVEMHAGLASEGGSKLKML+++VDNLPSG 
Sbjct  33   KWKRVVGVLKEMEESCETTVGRLKQVVDAMAVEMHAGLASEGGSKLKMLLTFVDNLPSGS  92

Query  338  EEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIA  505
            E+G+FYALDLGGTNFRV+RV+LGG ++  ++ + ++  IP  LM G SE LFDFIA
Sbjct  93   EKGIFYALDLGGTNFRVLRVELGG-QRSDLDPDVEQQPIPEQLMTGRSEDLFDFIA  147



>gb|KJB83527.1| hypothetical protein B456_013G251900 [Gossypium raimondii]
Length=361

 Score =   161 bits (407),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/116 (65%), Positives = 95/116 (82%), Gaps = 1/116 (1%)
 Frame = +2

Query  158  RWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLPSGD  337
            +W + V +LKE+EE C T  G+L+QV DAMAVEMHAGLASEGGSKLKML+++VDNLPSG 
Sbjct  33   KWKRVVGVLKEMEESCETTVGRLKQVVDAMAVEMHAGLASEGGSKLKMLLTFVDNLPSGS  92

Query  338  EEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIA  505
            E+G+FYALDLGGTNFRV+RV+LGG ++  ++ + ++  IP  LM G SE LFDFIA
Sbjct  93   EKGIFYALDLGGTNFRVLRVELGG-QRSDLDPDVEQQPIPEQLMTGRSEDLFDFIA  147



>ref|XP_009405075.1| PREDICTED: hexokinase-2-like [Musa acuminata subsp. malaccensis]
Length=534

 Score =   164 bits (415),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/111 (69%), Positives = 93/111 (84%), Gaps = 2/111 (2%)
 Frame = +2

Query  179  LLKELEEKCGTPAGKLRQVADAMAVEMHAGL--ASEGGSKLKMLISYVDNLPSGDEEGLF  352
            ++++LEE C TP  +L+QVA AMA EMHAGL  A  GGSKL+ML S+VD LP+GDEEGLF
Sbjct  35   IVRQLEEACATPTERLKQVAQAMAAEMHAGLLAADAGGSKLRMLPSFVDKLPTGDEEGLF  94

Query  353  YALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIA  505
            Y LDLGGTNFRV+RVQLGGKE+G++ +ES+EV IP HLM GSS+ LFDFIA
Sbjct  95   YGLDLGGTNFRVLRVQLGGKERGIIEQESKEVPIPPHLMFGSSDELFDFIA  145



>gb|ACN29323.1| unknown [Zea mays]
Length=482

 Score =   163 bits (413),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 80/131 (61%), Positives = 100/131 (76%), Gaps = 7/131 (5%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLAS---EGGSK----  292
            R  +R + RWA+  A+L++L+E+C  P  +LRQVADAM  EM AGLAS   EG S     
Sbjct  3    RQRLREARRWARAGAVLRDLQERCAAPVERLRQVADAMVAEMRAGLASNDSEGDSGSSVL  62

Query  293  LKMLISYVDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMV  472
            LKML++YVD+LPSGDE+GLFYALDLGGTNFRV+R+Q GGKE+ +V +ES+ VSIP+HLM 
Sbjct  63   LKMLVTYVDSLPSGDEKGLFYALDLGGTNFRVLRIQFGGKEQRIVKQESKTVSIPQHLMS  122

Query  473  GSSEALFDFIA  505
              S  LFDFIA
Sbjct  123  RGSNELFDFIA  133



>ref|XP_006446203.1| hypothetical protein CICLE_v10014962mg [Citrus clementina]
 gb|ESR59443.1| hypothetical protein CICLE_v10014962mg [Citrus clementina]
Length=510

 Score =   164 bits (414),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 97/122 (80%), Gaps = 0/122 (0%)
 Frame = +2

Query  140  HMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVD  319
             ++S  +W + + +L+ELEE C T   +LRQV DAMAVEMHAGLASEGGSKLKML+++VD
Sbjct  29   RVKSRRKWKRVMGVLRELEEGCETTVSRLRQVVDAMAVEMHAGLASEGGSKLKMLLTFVD  88

Query  320  NLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDF  499
            NLP+G E+G++YALDLGGTNFRV+RVQLGG+   +++ + +   IP  LM G+SE LFDF
Sbjct  89   NLPTGSEKGIYYALDLGGTNFRVLRVQLGGQRSSILSSDVERQPIPPELMTGTSEDLFDF  148

Query  500  IA  505
            IA
Sbjct  149  IA  150



>ref|XP_006470700.1| PREDICTED: hexokinase-3-like [Citrus sinensis]
Length=510

 Score =   163 bits (413),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 97/122 (80%), Gaps = 0/122 (0%)
 Frame = +2

Query  140  HMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVD  319
             ++S  +W + + +L+ELEE C T   +LRQV DAMAVEMHAGLASEGGSKLKML+++VD
Sbjct  29   RVKSRRKWKRVMGVLRELEEGCETTVSRLRQVVDAMAVEMHAGLASEGGSKLKMLLTFVD  88

Query  320  NLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDF  499
            NLP+G E+G++YALDLGGTNFRV+RVQLGG+   +++ + +   IP  LM G+SE LFDF
Sbjct  89   NLPTGSEKGIYYALDLGGTNFRVLRVQLGGQRSSILSSDVERQPIPPELMTGTSEDLFDF  148

Query  500  IA  505
            IA
Sbjct  149  IA  150



>ref|NP_001146056.1| hypothetical protein [Zea mays]
 gb|ACL53123.1| unknown [Zea mays]
 tpg|DAA57820.1| TPA: hypothetical protein ZEAMMB73_547897 [Zea mays]
Length=504

 Score =   163 bits (413),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 80/131 (61%), Positives = 100/131 (76%), Gaps = 7/131 (5%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLAS---EGGSK----  292
            R  +R + RWA+  A+L++L+E+C  P  +LRQVADAM  EM AGLAS   EG S     
Sbjct  25   RQRLREARRWARAGAVLRDLQERCAAPVERLRQVADAMVAEMRAGLASNDSEGDSGSSVL  84

Query  293  LKMLISYVDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMV  472
            LKML++YVD+LPSGDE+GLFYALDLGGTNFRV+R+Q GGKE+ +V +ES+ VSIP+HLM 
Sbjct  85   LKMLVTYVDSLPSGDEKGLFYALDLGGTNFRVLRIQFGGKEQRIVKQESKTVSIPQHLMS  144

Query  473  GSSEALFDFIA  505
              S  LFDFIA
Sbjct  145  RGSNELFDFIA  155



>ref|XP_008450397.1| PREDICTED: hexokinase-3-like [Cucumis melo]
Length=507

 Score =   163 bits (413),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 94/123 (76%), Gaps = 0/123 (0%)
 Frame = +2

Query  137  HHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYV  316
              ++S  +W + V +L+ELE  C TP  +LRQV DAMAVEMHAGLASEGGSKLKML++YV
Sbjct  27   RRVKSRSKWKRVVGVLEELEATCDTPVRRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYV  86

Query  317  DNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFD  496
            DNLP+G E+G FYALDLGGTNFRV+RV LGG+    +  + +   IP++LM G+ E LFD
Sbjct  87   DNLPNGSEKGTFYALDLGGTNFRVLRVHLGGQRSLTLKHDVERQPIPQNLMTGTREGLFD  146

Query  497  FIA  505
            FIA
Sbjct  147  FIA  149



>ref|XP_010273315.1| PREDICTED: hexokinase-3-like [Nelumbo nucifera]
Length=513

 Score =   162 bits (411),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 95/123 (77%), Gaps = 0/123 (0%)
 Frame = +2

Query  137  HHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYV  316
              ++S  +W++ V +LKELEE C T  G+L+QV DAMAVEMHAGLASEGGSKLKML+++V
Sbjct  26   RRVKSRRKWSRVVGVLKELEEGCSTSIGRLKQVVDAMAVEMHAGLASEGGSKLKMLLTFV  85

Query  317  DNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFD  496
            DNLP G+E+G +YAL LGGTNFRV+RVQLGG+   ++  E     IP+HLM  +SE LFD
Sbjct  86   DNLPDGNEKGTYYALHLGGTNFRVLRVQLGGENSLILGHEVDRQPIPQHLMTSTSEGLFD  145

Query  497  FIA  505
            FI 
Sbjct  146  FIV  148



>ref|XP_003540378.1| PREDICTED: hexokinase-3-like [Glycine max]
Length=504

 Score =   162 bits (410),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 77/123 (63%), Positives = 94/123 (76%), Gaps = 0/123 (0%)
 Frame = +2

Query  137  HHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYV  316
              MRS G W +   +LKE+EE C T  G+LRQV DAMAVEMHAGLASEGGSKLKML++YV
Sbjct  26   QRMRSRGNWKRVARVLKEVEEGCETSVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYV  85

Query  317  DNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFD  496
             NLP+G E+G +YALDLGGTNFRV+RV L G++  V+  E +   IP++LM  +SE LFD
Sbjct  86   HNLPNGTEKGTYYALDLGGTNFRVLRVHLHGQQSSVLEHEVERQPIPQNLMTSTSEDLFD  145

Query  497  FIA  505
            FIA
Sbjct  146  FIA  148



>gb|KHN25630.1| Hexokinase-3 [Glycine soja]
Length=387

 Score =   160 bits (404),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 75/122 (61%), Positives = 91/122 (75%), Gaps = 0/122 (0%)
 Frame = +2

Query  140  HMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVD  319
            H RS  +W K   +++ELEE C T  G+LRQV DAMAVEMHAGLASEGGSKLKML+++VD
Sbjct  33   HKRSRRKWKKVANVVRELEEGCATRVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTFVD  92

Query  320  NLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDF  499
            NLP+G E G +YAL LGGTNFRV+RVQL G+       E +   IP+H+M  +SE LFDF
Sbjct  93   NLPNGTERGTYYALHLGGTNFRVLRVQLNGQPSSDFEHEVERQPIPQHVMTSTSEDLFDF  152

Query  500  IA  505
            IA
Sbjct  153  IA  154



>ref|XP_008800255.1| PREDICTED: hexokinase-3-like isoform X1 [Phoenix dactylifera]
Length=295

 Score =   157 bits (397),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 96/120 (80%), Gaps = 0/120 (0%)
 Frame = +2

Query  146  RSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNL  325
            RS  +W + V +L+E E+ C T  G+L+QV DAMAVEMHAGLAS+GGSKLKML+S++D+L
Sbjct  29   RSQRKWRRAVEVLREFEDGCATSIGRLKQVVDAMAVEMHAGLASDGGSKLKMLLSFIDSL  88

Query  326  PSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIA  505
            P+G+E G +YALDLGGTNFRV+RV+LGGK   + + + +  +IPR LM G+SE LFDFIA
Sbjct  89   PNGNEIGTYYALDLGGTNFRVLRVRLGGKGSMISSPQVERQAIPRELMSGTSEDLFDFIA  148



>gb|EYU46224.1| hypothetical protein MIMGU_mgv1a004779mg [Erythranthe guttata]
Length=510

 Score =   161 bits (408),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 75/124 (60%), Positives = 97/124 (78%), Gaps = 1/124 (1%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            R   R SG W + + +L+ELEE C TP G+LRQV DAMAVEMHAGLASEGGSKLKML+++
Sbjct  26   RTVRRRSG-WRRVLRVLEELEEGCATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTF  84

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            + NLP+G+E+G++YALDLGGTNFRV+RV+LGG+   +   +     IP+HLM  ++E LF
Sbjct  85   IHNLPTGNEKGIYYALDLGGTNFRVLRVKLGGERSSITELDVDRKPIPQHLMTSTTEELF  144

Query  494  DFIA  505
            DFIA
Sbjct  145  DFIA  148



>gb|KJB83523.1| hypothetical protein B456_013G251900 [Gossypium raimondii]
Length=504

 Score =   161 bits (407),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/116 (65%), Positives = 95/116 (82%), Gaps = 1/116 (1%)
 Frame = +2

Query  158  RWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLPSGD  337
            +W + V +LKE+EE C T  G+L+QV DAMAVEMHAGLASEGGSKLKML+++VDNLPSG 
Sbjct  33   KWKRVVGVLKEMEESCETTVGRLKQVVDAMAVEMHAGLASEGGSKLKMLLTFVDNLPSGS  92

Query  338  EEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIA  505
            E+G+FYALDLGGTNFRV+RV+LGG ++  ++ + ++  IP  LM G SE LFDFIA
Sbjct  93   EKGIFYALDLGGTNFRVLRVELGG-QRSDLDPDVEQQPIPEQLMTGRSEDLFDFIA  147



>gb|KJB83524.1| hypothetical protein B456_013G251900 [Gossypium raimondii]
Length=505

 Score =   161 bits (407),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/116 (65%), Positives = 95/116 (82%), Gaps = 1/116 (1%)
 Frame = +2

Query  158  RWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLPSGD  337
            +W + V +LKE+EE C T  G+L+QV DAMAVEMHAGLASEGGSKLKML+++VDNLPSG 
Sbjct  33   KWKRVVGVLKEMEESCETTVGRLKQVVDAMAVEMHAGLASEGGSKLKMLLTFVDNLPSGS  92

Query  338  EEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIA  505
            E+G+FYALDLGGTNFRV+RV+LGG ++  ++ + ++  IP  LM G SE LFDFIA
Sbjct  93   EKGIFYALDLGGTNFRVLRVELGG-QRSDLDPDVEQQPIPEQLMTGRSEDLFDFIA  147



>ref|XP_004154641.1| PREDICTED: hexokinase-3-like [Cucumis sativus]
Length=507

 Score =   161 bits (407),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 93/123 (76%), Gaps = 0/123 (0%)
 Frame = +2

Query  137  HHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYV  316
              ++S  +W + V +L+ELE  C TP  +LRQV DAMAVEMHAGLASEGGSKLKML++YV
Sbjct  27   RRVKSRSKWKRVVGVLEELEATCDTPLRRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYV  86

Query  317  DNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFD  496
            DNLP+G E G FYALDLGGTNFRV+RV LGG+    +  + +   IP++LM G+ E LFD
Sbjct  87   DNLPNGSEIGTFYALDLGGTNFRVLRVHLGGQRSLTLKHDVERQPIPQNLMTGTREGLFD  146

Query  497  FIA  505
            FIA
Sbjct  147  FIA  149



>ref|XP_009366073.1| PREDICTED: hexokinase-3 [Pyrus x bretschneideri]
 ref|XP_009375355.1| PREDICTED: hexokinase-3-like [Pyrus x bretschneideri]
Length=508

 Score =   161 bits (407),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/123 (60%), Positives = 95/123 (77%), Gaps = 0/123 (0%)
 Frame = +2

Query  137  HHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYV  316
              +RS  +W++ V +LK+LE+ C T  G+LRQV DAMAVEMHAGLAS+GGSKLKML+++V
Sbjct  26   RRIRSRRKWSRVVGVLKDLEQSCETTVGRLRQVVDAMAVEMHAGLASDGGSKLKMLLTFV  85

Query  317  DNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFD  496
            D LPSG E+G +YALDLGGTNFRV+RV+LGG     +  +    +IP+ LM G+SE LFD
Sbjct  86   DKLPSGSEKGTYYALDLGGTNFRVLRVKLGGTRSSTLEHDVCRQAIPQDLMTGTSEDLFD  145

Query  497  FIA  505
            FIA
Sbjct  146  FIA  148



>ref|XP_004139044.1| PREDICTED: hexokinase-3-like [Cucumis sativus]
 gb|KGN66504.1| hypothetical protein Csa_1G615730 [Cucumis sativus]
Length=507

 Score =   160 bits (406),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 93/123 (76%), Gaps = 0/123 (0%)
 Frame = +2

Query  137  HHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYV  316
              ++S  +W + V +L+ELE  C TP  +LRQV DAMAVEMHAGLASEGGSKLKML++YV
Sbjct  27   RRVKSRSKWKRVVGVLEELEATCDTPLRRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYV  86

Query  317  DNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFD  496
            DNLP+G E G FYALDLGGTNFRV+RV LGG+    +  + +   IP++LM G+ E LFD
Sbjct  87   DNLPNGSEIGTFYALDLGGTNFRVLRVPLGGQRSLTLKHDVERQPIPQNLMTGTREGLFD  146

Query  497  FIA  505
            FIA
Sbjct  147  FIA  149



>gb|AHY84732.1| hexokinase [Manihot esculenta]
Length=508

 Score =   160 bits (406),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 95/116 (82%), Gaps = 0/116 (0%)
 Frame = +2

Query  158  RWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLPSGD  337
            +W + V +L+ELEE C T  G+L+QV DAMAVEMHAGLASEGGSKLKML+++VD+LP+G 
Sbjct  33   KWGRVVGVLRELEESCETTVGRLKQVVDAMAVEMHAGLASEGGSKLKMLLTFVDHLPTGS  92

Query  338  EEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIA  505
            E G +YALDLGGTNFRV+RVQLGG+   +++++ +   IP+HLM  +SE LFDFIA
Sbjct  93   EVGTYYALDLGGTNFRVLRVQLGGRLSSILSKDVELQPIPQHLMRSTSEDLFDFIA  148



>sp|Q2KNB7.1|HXK9_ORYSJ RecName: Full=Hexokinase-9; AltName: Full=Hexokinase-5 [Oryza 
sativa Japonica Group]
 gb|AAX68421.1| hexokinase 5 [Oryza sativa Japonica Group]
 gb|AAZ93626.1| hexokinase 9 [Oryza sativa Japonica Group]
 gb|EAZ13381.1| hypothetical protein OsJ_03300 [Oryza sativa Japonica Group]
Length=502

 Score =   160 bits (405),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 72/109 (66%), Positives = 93/109 (85%), Gaps = 0/109 (0%)
 Frame = +2

Query  179  LLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLPSGDEEGLFYA  358
            LL++L+E+C  P   LRQVADAMA EM AGLA+EGGS L+ML++YVD+LPSG E+G+FYA
Sbjct  42   LLRDLQERCAAPVELLRQVADAMAAEMRAGLAAEGGSDLQMLVTYVDSLPSGGEKGMFYA  101

Query  359  LDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIA  505
            LDLGGTNFRV+RVQLGGKE+ ++ ++S+ +SIP+HLM  SS  LFDF+A
Sbjct  102  LDLGGTNFRVLRVQLGGKERRIIKQDSEGISIPQHLMSSSSHELFDFVA  150



>gb|KHG14450.1| hypothetical protein F383_08688 [Gossypium arboreum]
Length=504

 Score =   159 bits (403),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 75/116 (65%), Positives = 95/116 (82%), Gaps = 1/116 (1%)
 Frame = +2

Query  158  RWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLPSGD  337
            +W + V +LKELEE C T  G+L+QV DAMAVEMHAGLASEGGSKLKML+++VD+LPSG 
Sbjct  33   KWKRVVGVLKELEESCETTVGRLKQVVDAMAVEMHAGLASEGGSKLKMLLTFVDSLPSGS  92

Query  338  EEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIA  505
            E+G+FYALDLGGTNFRV+RV+LGG ++  ++ + ++  IP  LM G SE LFDFIA
Sbjct  93   EKGIFYALDLGGTNFRVLRVELGG-QRSDLDPDVEQQPIPEQLMTGRSEDLFDFIA  147



>ref|XP_010921910.1| PREDICTED: hexokinase-3-like isoform X1 [Elaeis guineensis]
Length=498

 Score =   159 bits (402),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 73/121 (60%), Positives = 97/121 (80%), Gaps = 0/121 (0%)
 Frame = +2

Query  143  MRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDN  322
            ++S  +W + V +L+E EE C T  G+LRQV DAMAVEMHAGLAS+GGSKL+ML+++VDN
Sbjct  28   VQSRRKWRRAVEMLQEFEEGCATSIGRLRQVVDAMAVEMHAGLASDGGSKLRMLLTFVDN  87

Query  323  LPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFI  502
            LP G+E+G +YALDLGGTNFRV+RVQLGG+   +++ + +   IP+ LM G+SE LFDFI
Sbjct  88   LPDGNEKGTYYALDLGGTNFRVLRVQLGGRGSMILSHQVKHHPIPQELMSGTSEDLFDFI  147

Query  503  A  505
            A
Sbjct  148  A  148



>ref|XP_009414963.1| PREDICTED: hexokinase-3-like [Musa acuminata subsp. malaccensis]
Length=499

 Score =   159 bits (402),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 92/113 (81%), Gaps = 0/113 (0%)
 Frame = +2

Query  167  KTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLPSGDEEG  346
            + VAL++ELE  C TP G+LRQV DAMAVEMHAGLAS+GGSKLKML++++DNLP G EEG
Sbjct  36   QAVALVRELEVACDTPVGRLRQVVDAMAVEMHAGLASDGGSKLKMLLTFIDNLPDGTEEG  95

Query  347  LFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIA  505
             +YALDLGGTNFRV+RVQLGGK   +++ + +   IP+ LM G+SE LF FIA
Sbjct  96   TYYALDLGGTNFRVLRVQLGGKGSMILSHKVESQPIPQELMTGTSEELFTFIA  148



>gb|AAL16967.1|AF367451_1 hexokinase [Prunus persica]
Length=224

 Score =   152 bits (385),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 74/87 (85%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = +2

Query  245  MAVEMHAGLASEGGSKLKMLISYVDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGV  424
            M VEMHAGLASEGGSKLKMLISYVDNLP+GDE+GLFYALDLGGTNFRV+RVQLGGKEK V
Sbjct  1    MTVEMHAGLASEGGSKLKMLISYVDNLPTGDEQGLFYALDLGGTNFRVIRVQLGGKEKRV  60

Query  425  VNRESQEVSIPRHLMVGSSEALFDFIA  505
            V +E  EVSIP +LM G+SEALFDFIA
Sbjct  61   VKQEFDEVSIPPNLMTGTSEALFDFIA  87



>gb|EAY75659.1| hypothetical protein OsI_03566 [Oryza sativa Indica Group]
Length=502

 Score =   158 bits (400),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 71/109 (65%), Positives = 93/109 (85%), Gaps = 0/109 (0%)
 Frame = +2

Query  179  LLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLPSGDEEGLFYA  358
            LL++L+++C  P   LRQVADAMA EM AGLA+EGGS L+ML++YVD+LPSG E+G+FYA
Sbjct  42   LLRDLQKRCAAPVELLRQVADAMAAEMRAGLAAEGGSDLQMLVTYVDSLPSGGEKGMFYA  101

Query  359  LDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIA  505
            LDLGGTNFRV+RVQLGGKE+ ++ ++S+ +SIP+HLM  SS  LFDF+A
Sbjct  102  LDLGGTNFRVLRVQLGGKERRIIKQDSEGISIPQHLMSSSSHELFDFVA  150



>emb|CDP09609.1| unnamed protein product [Coffea canephora]
Length=509

 Score =   158 bits (400),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 93/123 (76%), Gaps = 1/123 (1%)
 Frame = +2

Query  140  HMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVD  319
             ++S  RW K V +L+E EE C TP  KLRQV DAMAVEMHAGLASEGGSKLKML+++V 
Sbjct  28   RVKSRRRWTKVVKVLEEFEEGCATPVEKLRQVVDAMAVEMHAGLASEGGSKLKMLLTFVQ  87

Query  320  NLPSGD-EEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFD  496
            NLP+G  E+G++Y LDLGGTNFRV+RVQLGG+   ++    +   IP HLM  +SE LFD
Sbjct  88   NLPTGYVEKGVYYGLDLGGTNFRVLRVQLGGQRSAILEPGVERQPIPEHLMTSTSEELFD  147

Query  497  FIA  505
            FIA
Sbjct  148  FIA  150



>ref|XP_004511503.1| PREDICTED: hexokinase-3-like [Cicer arietinum]
Length=498

 Score =   158 bits (400),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 77/120 (64%), Positives = 90/120 (75%), Gaps = 0/120 (0%)
 Frame = +2

Query  146  RSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNL  325
            +S  +W K   +LKELEE C T  G+LRQV DAMAVEMHAGLASEGGSKLKML++YVDNL
Sbjct  29   KSRRKWRKVANVLKELEEGCDTSVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDNL  88

Query  326  PSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIA  505
            P+G E+G +YAL LGGTNFRV RV L G+   V+  E +   IP HLM  +SE LFDFIA
Sbjct  89   PNGTEKGPYYALHLGGTNFRVTRVHLTGQPSPVLEHEVERQPIPPHLMTSTSEDLFDFIA  148



>ref|XP_006362320.1| PREDICTED: hexokinase-3-like [Solanum tuberosum]
Length=512

 Score =   158 bits (400),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 91/116 (78%), Gaps = 0/116 (0%)
 Frame = +2

Query  158  RWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLPSGD  337
            +W K V +L+ELEE C T   +L+QV DAMAVEMHAGLASEGGSKLKML++YVD LP+G 
Sbjct  33   KWLKMVKVLEELEESCDTTVFRLKQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGS  92

Query  338  EEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIA  505
            EEG +YALDLGGTNFRV+RV LG +   ++ ++ +   IP+HLM  +SE LFDFIA
Sbjct  93   EEGTYYALDLGGTNFRVLRVHLGDQRSAILGQDIERQPIPQHLMTSTSEDLFDFIA  148



>ref|XP_003610965.1| Hexokinase [Medicago truncatula]
 gb|AES93923.1| hexokinase [Medicago truncatula]
Length=496

 Score =   158 bits (399),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 76/120 (63%), Positives = 90/120 (75%), Gaps = 0/120 (0%)
 Frame = +2

Query  146  RSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNL  325
            +S  +W K   +LKE EE C T  G+LRQV DAMAVEMHAGLASEGGSKLKML++YVDNL
Sbjct  29   KSRRKWKKVANVLKEFEEGCDTSVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDNL  88

Query  326  PSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIA  505
            P+G E+G +YAL LGGTNFRV RV L G+   V+  E +   IP HLM G+S+ LFDFIA
Sbjct  89   PNGTEKGPYYALHLGGTNFRVTRVHLSGQPSPVLEHEVERQPIPPHLMTGTSKDLFDFIA  148



>gb|KHN35090.1| Hexokinase-3 [Glycine soja]
Length=316

 Score =   154 bits (389),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 72/116 (62%), Positives = 88/116 (76%), Gaps = 0/116 (0%)
 Frame = +2

Query  158  RWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLPSGD  337
            +W K   +++ELEE C T  G+LRQV DAMAVEMHAGLASEGGSKLKML+++VDNLP+G 
Sbjct  33   KWKKVANVVRELEEGCDTRVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTFVDNLPNGT  92

Query  338  EEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIA  505
            E G +YAL LGGTNFRV+RVQL G+       E +   IP+H+M  +SE LFDFIA
Sbjct  93   ERGTYYALHLGGTNFRVLRVQLNGQPSSDFEHEVERQPIPQHVMTSTSEDLFDFIA  148



>gb|AEB00843.1| hexokinase 7 [Hordeum vulgare subsp. vulgare]
Length=186

 Score =   150 bits (379),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 73/109 (67%), Positives = 87/109 (80%), Gaps = 0/109 (0%)
 Frame = +2

Query  179  LLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLPSGDEEGLFYA  358
            L+ +L EKC TP   LR VA AMA EM AGL  EGGS++KML+SYVD LP+G E+GLFY 
Sbjct  5    LVADLREKCDTPVSLLRDVAAAMADEMCAGLEKEGGSRVKMLLSYVDKLPTGREDGLFYG  64

Query  359  LDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIA  505
            LDLGGTNFRV++VQLGG +K V++RES+EV+IP HLM GSS  LF FIA
Sbjct  65   LDLGGTNFRVLKVQLGGNDKHVISRESREVAIPPHLMSGSSSELFAFIA  113



>ref|XP_004251354.1| PREDICTED: hexokinase-3-like [Solanum lycopersicum]
 ref|XP_010313255.1| PREDICTED: hexokinase-3-like [Solanum lycopersicum]
Length=511

 Score =   157 bits (398),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 91/116 (78%), Gaps = 0/116 (0%)
 Frame = +2

Query  158  RWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLPSGD  337
            +W K V +L+ELEE C T   +L+QV DAMAVEMHAGLASEGGSKLKML++YVD LP+G 
Sbjct  33   KWLKMVKVLEELEESCDTTVFRLKQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGR  92

Query  338  EEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIA  505
            EEG +YALDLGGTNFRV+RV LG +   ++ ++ +   IP+HLM  +SE LFDFIA
Sbjct  93   EEGTYYALDLGGTNFRVLRVHLGDQRSAILGQDIERQPIPQHLMTSTSEDLFDFIA  148



>ref|XP_008363245.1| PREDICTED: hexokinase-3 [Malus domestica]
Length=509

 Score =   157 bits (397),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 72/121 (60%), Positives = 92/121 (76%), Gaps = 0/121 (0%)
 Frame = +2

Query  143  MRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDN  322
            +RS  +W +   +LK+LE  C T  G+LRQV DAMAVEMHAGLAS+GGSKLKML+++VD 
Sbjct  28   IRSRRKWGRVFGVLKDLELSCETTVGRLRQVVDAMAVEMHAGLASDGGSKLKMLLTFVDK  87

Query  323  LPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFI  502
            LP G E+G +YALDLGGTNFRV+RV+LGG     +  +  +  IP++LM G+SE LFDFI
Sbjct  88   LPDGSEKGTYYALDLGGTNFRVLRVKLGGTRSSTLEHDVHQQDIPQNLMTGTSEVLFDFI  147

Query  503  A  505
            A
Sbjct  148  A  148



>gb|EMT31348.1| Hexokinase-9 [Aegilops tauschii]
Length=732

 Score =   159 bits (401),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 78/124 (63%), Positives = 95/124 (77%), Gaps = 13/124 (10%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            R  +R + RWA+  A+L +L+E+C  PA +L QV+DAM VEM AGLASE GSKLKML++Y
Sbjct  22   RQRLREAKRWARVAAVLSDLQERCAAPAAQLLQVSDAMDVEMRAGLASEDGSKLKMLVTY  81

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VD+LPSGDE+GLFYALDLGGTNFRV+RVQLGGKE+GV+ +ES          VG    LF
Sbjct  82   VDSLPSGDEKGLFYALDLGGTNFRVLRVQLGGKEQGVIKQES----------VGE---LF  128

Query  494  DFIA  505
            DFIA
Sbjct  129  DFIA  132



>gb|EMT15586.1| Hexokinase-7 [Aegilops tauschii]
Length=430

 Score =   155 bits (393),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 76/109 (70%), Positives = 88/109 (81%), Gaps = 0/109 (0%)
 Frame = +2

Query  179  LLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLPSGDEEGLFYA  358
            ++ +L E+C TPA +L  VA AM  EM AGL  EGGSK+KM+ISYVDNLP+G EEGLFYA
Sbjct  12   VVAQLREECATPATRLDGVATAMEEEMRAGLHQEGGSKIKMIISYVDNLPNGSEEGLFYA  71

Query  359  LDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIA  505
            LDLGGTNFRV+RVQL GK+K VV RES+EVSIP HLM GS+  LF FIA
Sbjct  72   LDLGGTNFRVLRVQLAGKDKRVVKRESREVSIPPHLMSGSAAELFGFIA  120



>ref|XP_008449690.1| PREDICTED: hexokinase-3 [Cucumis melo]
Length=501

 Score =   157 bits (396),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 71/121 (59%), Positives = 92/121 (76%), Gaps = 0/121 (0%)
 Frame = +2

Query  143  MRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDN  322
            +++ G+W + V +LKELEE C T  G+L+QV DAMAVEMHAGLASEGGSKLKML++YVDN
Sbjct  28   VQNRGKWRRVVRVLKELEEACETSVGRLKQVVDAMAVEMHAGLASEGGSKLKMLLTYVDN  87

Query  323  LPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFI  502
            LP G+E G  YALDLGGTNFRV+ +QL G    ++  + + + +P+HLM  +   LFDFI
Sbjct  88   LPDGNEMGTHYALDLGGTNFRVLSIQLQGNRSSILEHDVERLPVPQHLMTSTGNDLFDFI  147

Query  503  A  505
            A
Sbjct  148  A  148



>emb|CDM84160.1| unnamed protein product [Triticum aestivum]
Length=358

 Score =   154 bits (389),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 77/124 (62%), Positives = 94/124 (76%), Gaps = 13/124 (10%)
 Frame = +2

Query  134  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  313
            R  +R + RWA+  A+L +L+E+C  PA +L QV+DAM VEM AGLASE GSKLKML++Y
Sbjct  22   RQRLREAKRWARVAAVLSDLQERCVAPAARLLQVSDAMDVEMRAGLASEDGSKLKMLVTY  81

Query  314  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  493
            VD+LPSGDE+GLFYALDLGGTNFRV+RVQLGGKE+ V+ +ES          VG    LF
Sbjct  82   VDSLPSGDEKGLFYALDLGGTNFRVLRVQLGGKEQRVIKQES----------VGE---LF  128

Query  494  DFIA  505
            DFIA
Sbjct  129  DFIA  132



>ref|XP_008775017.1| PREDICTED: hexokinase-3-like isoform X2 [Phoenix dactylifera]
Length=498

 Score =   156 bits (395),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 93/116 (80%), Gaps = 0/116 (0%)
 Frame = +2

Query  158  RWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLPSGD  337
            +W + V +L+E EE C T  G+L QV DAMAVEMHAGLAS+GGSKLKML++++DNLP G+
Sbjct  33   KWRRAVEVLREFEEGCATSIGRLGQVVDAMAVEMHAGLASDGGSKLKMLLTFIDNLPDGN  92

Query  338  EEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIA  505
            E+G +YALDLGGTNFRV+RVQLGGK   +++ + +   IP+ LM G+SE LFD+IA
Sbjct  93   EKGTYYALDLGGTNFRVLRVQLGGKGSMIISHQVEYHPIPQELMSGTSEDLFDYIA  148



>ref|XP_008775016.1| PREDICTED: hexokinase-3-like isoform X1 [Phoenix dactylifera]
Length=499

 Score =   156 bits (395),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 93/116 (80%), Gaps = 0/116 (0%)
 Frame = +2

Query  158  RWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLPSGD  337
            +W + V +L+E EE C T  G+L QV DAMAVEMHAGLAS+GGSKLKML++++DNLP G+
Sbjct  33   KWRRAVEVLREFEEGCATSIGRLGQVVDAMAVEMHAGLASDGGSKLKMLLTFIDNLPDGN  92

Query  338  EEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIA  505
            E+G +YALDLGGTNFRV+RVQLGGK   +++ + +   IP+ LM G+SE LFD+IA
Sbjct  93   EKGTYYALDLGGTNFRVLRVQLGGKGSMIISHQVEYHPIPQELMSGTSEDLFDYIA  148



>ref|XP_001754148.1| hexokinase protein HXK7 [Physcomitrella patens]
 gb|EDQ81049.1| hexokinase protein HXK7 [Physcomitrella patens]
Length=521

 Score =   156 bits (395),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/109 (68%), Positives = 88/109 (81%), Gaps = 0/109 (0%)
 Frame = +2

Query  179  LLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLPSGDEEGLFYA  358
            +L E +E C TP  +LRQV DAMAVEMHAGL SEGGSKLKML +Y+D LP G E GL+YA
Sbjct  42   ILLEFQEACYTPLARLRQVVDAMAVEMHAGLVSEGGSKLKMLPTYIDRLPDGHERGLYYA  101

Query  359  LDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIA  505
            +DLGGTNFRV+RVQLGG E  V+ +E +EV+IP  LM+G+SE LFDFIA
Sbjct  102  VDLGGTNFRVLRVQLGGLEGRVIKQEYEEVAIPPELMLGTSEQLFDFIA  150



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 559877061510