BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002F09

Length=579
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009603108.1|  PREDICTED: signal recognition particle 54 kD...    211   1e-65   Nicotiana tomentosiformis
ref|XP_007217214.1|  hypothetical protein PRUPE_ppa004695mg             217   4e-64   Prunus persica
ref|XP_008228712.1|  PREDICTED: signal recognition particle 54 kD...    217   4e-64   Prunus mume [ume]
ref|XP_010097203.1|  Signal recognition particle 54 kDa protein 2       213   9e-64   
gb|ACU18718.1|  unknown                                                 206   1e-63   Glycine max [soybeans]
gb|KDO48631.1|  hypothetical protein CISIN_1g011010mg                   211   2e-63   Citrus sinensis [apfelsine]
ref|XP_008373986.1|  PREDICTED: signal recognition particle 54 kD...    215   2e-63   Malus domestica [apple tree]
ref|XP_009628300.1|  PREDICTED: signal recognition particle 54 kD...    215   2e-63   Nicotiana tomentosiformis
ref|XP_009764811.1|  PREDICTED: signal recognition particle 54 kD...    215   3e-63   Nicotiana sylvestris
ref|XP_004168204.1|  PREDICTED: signal recognition particle 54 kD...    211   4e-63   
ref|XP_008454178.1|  PREDICTED: signal recognition particle 54 kD...    214   5e-63   Cucumis melo [Oriental melon]
ref|XP_010279659.1|  PREDICTED: signal recognition particle 54 kD...    214   5e-63   Nelumbo nucifera [Indian lotus]
gb|KDO48630.1|  hypothetical protein CISIN_1g011010mg                   211   7e-63   Citrus sinensis [apfelsine]
ref|XP_010259930.1|  PREDICTED: signal recognition particle 54 kD...    213   7e-63   Nelumbo nucifera [Indian lotus]
ref|XP_006465307.1|  PREDICTED: signal recognition particle 54 kD...    213   1e-62   Citrus sinensis [apfelsine]
gb|AIL30491.1|  54 kDa signal recognition particle 2                    213   1e-62   Nicotiana tabacum [American tobacco]
ref|XP_009783199.1|  PREDICTED: signal recognition particle 54 kD...    213   1e-62   Nicotiana sylvestris
ref|XP_007023271.1|  Signal recognition particle, SRP54 subunit p...    213   2e-62   
ref|NP_001234428.1|  signal recognition particle 54 kDa protein 2       213   2e-62   Solanum lycopersicum
ref|XP_006346598.1|  PREDICTED: signal recognition particle 54 kD...    213   2e-62   Solanum tuberosum [potatoes]
ref|XP_004152178.1|  PREDICTED: signal recognition particle 54 kD...    212   3e-62   Cucumis sativus [cucumbers]
ref|XP_006427317.1|  hypothetical protein CICLE_v10025458mg             212   3e-62   Citrus clementina [clementine]
gb|KDO48628.1|  hypothetical protein CISIN_1g011010mg                   212   3e-62   Citrus sinensis [apfelsine]
gb|KDO48629.1|  hypothetical protein CISIN_1g011010mg                   212   3e-62   Citrus sinensis [apfelsine]
gb|KJB70636.1|  hypothetical protein B456_011G084700                    211   4e-62   Gossypium raimondii
gb|KDP37062.1|  hypothetical protein JCGZ_06118                         211   5e-62   Jatropha curcas
ref|XP_004290946.1|  PREDICTED: signal recognition particle 54 kD...    211   9e-62   Fragaria vesca subsp. vesca
ref|XP_011073411.1|  PREDICTED: signal recognition particle 54 kD...    210   2e-61   Sesamum indicum [beniseed]
ref|XP_002517663.1|  signal recognition particle 54 kD protein, p...    210   2e-61   Ricinus communis
ref|XP_004506954.1|  PREDICTED: signal recognition particle 54 kD...    209   2e-61   Cicer arietinum [garbanzo]
ref|XP_009412494.1|  PREDICTED: signal recognition particle 54 kD...    209   4e-61   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007150766.1|  hypothetical protein PHAVU_005G179000g             209   5e-61   Phaseolus vulgaris [French bean]
ref|XP_006373975.1|  hypothetical protein POPTR_0016s12030g             208   6e-61   Populus trichocarpa [western balsam poplar]
ref|XP_002322968.2|  Signal recognition particle 54 kDa protein 1       208   7e-61   
emb|CBI36349.3|  unnamed protein product                                207   7e-61   Vitis vinifera
ref|XP_007135764.1|  hypothetical protein PHAVU_010G156800g             208   8e-61   Phaseolus vulgaris [French bean]
emb|CDO98169.1|  unnamed protein product                                208   8e-61   Coffea canephora [robusta coffee]
gb|KHN37996.1|  Signal recognition particle 54 kDa protein 2            208   9e-61   Glycine soja [wild soybean]
ref|XP_003531722.1|  PREDICTED: signal recognition particle 54 kD...    208   1e-60   Glycine max [soybeans]
gb|AGV54516.1|  signal recognition particle 54 kDa protein 2            207   1e-60   Phaseolus vulgaris [French bean]
ref|XP_003528309.1|  PREDICTED: signal recognition particle 54 kD...    207   2e-60   Glycine max [soybeans]
ref|XP_004235947.1|  PREDICTED: signal recognition particle 54 kD...    206   3e-60   
ref|XP_006364228.1|  PREDICTED: signal recognition particle 54 kD...    206   3e-60   Solanum tuberosum [potatoes]
ref|XP_002264159.1|  PREDICTED: signal recognition particle 54 kD...    206   4e-60   Vitis vinifera
ref|XP_002299799.2|  Signal recognition particle 54 kDa protein 1       206   4e-60   
sp|P49971.1|SR541_SOLLC  RecName: Full=Signal recognition particl...    206   4e-60   Solanum lycopersicum
gb|ABK95819.1|  unknown                                                 206   4e-60   Populus trichocarpa [western balsam poplar]
ref|XP_003604367.1|  Signal recognition particle 54 kDa protein         206   4e-60   Medicago truncatula
ref|XP_004486653.1|  PREDICTED: signal recognition particle 54 kD...    206   5e-60   Cicer arietinum [garbanzo]
ref|XP_003543686.1|  PREDICTED: signal recognition particle 54 kD...    205   1e-59   Glycine max [soybeans]
ref|XP_003545781.1|  PREDICTED: signal recognition particle 54 kD...    205   1e-59   Glycine max [soybeans]
gb|KHN22433.1|  Signal recognition particle 54 kDa protein 2            205   1e-59   Glycine soja [wild soybean]
ref|XP_010909951.1|  PREDICTED: signal recognition particle 54 kD...    205   1e-59   Elaeis guineensis
ref|XP_008775107.1|  PREDICTED: signal recognition particle 54 kD...    205   2e-59   Phoenix dactylifera
ref|XP_010691102.1|  PREDICTED: signal recognition particle 54 kD...    204   2e-59   Beta vulgaris subsp. vulgaris [field beet]
gb|KHN44189.1|  Signal recognition particle 54 kDa protein 2            204   4e-59   Glycine soja [wild soybean]
ref|XP_008809106.1|  PREDICTED: signal recognition particle 54 kD...    202   9e-59   Phoenix dactylifera
ref|XP_010918260.1|  PREDICTED: signal recognition particle 54 kD...    202   1e-58   Elaeis guineensis
ref|XP_004301434.1|  PREDICTED: signal recognition particle 54 kD...    200   7e-58   Fragaria vesca subsp. vesca
ref|XP_010521537.1|  PREDICTED: signal recognition particle 54 kD...    199   2e-57   Tarenaya hassleriana [spider flower]
ref|XP_004970131.1|  PREDICTED: signal recognition particle 54 kD...    197   1e-56   Setaria italica
ref|NP_001142208.1|  hypothetical protein                               196   3e-56   Zea mays [maize]
sp|P49969.1|SR542_HORVU  RecName: Full=Signal recognition particl...    195   9e-56   Hordeum vulgare [barley]
gb|EMS65890.1|  Signal recognition particle 54 kDa protein 2            195   1e-55   Triticum urartu
tpg|DAA57410.1|  TPA: hypothetical protein ZEAMMB73_937725              194   1e-55   
ref|XP_003568147.1|  PREDICTED: signal recognition particle 54 kD...    194   1e-55   Brachypodium distachyon [annual false brome]
gb|EMT01441.1|  Signal recognition particle 54 kDa protein 2            194   1e-55   
ref|XP_004305069.1|  PREDICTED: signal recognition particle 54 kD...    194   1e-55   Fragaria vesca subsp. vesca
ref|XP_002456424.1|  hypothetical protein SORBIDRAFT_03g036030          194   2e-55   Sorghum bicolor [broomcorn]
ref|NP_001183903.1|  hypothetical protein                               194   2e-55   Zea mays [maize]
gb|EEC71559.1|  hypothetical protein OsI_03915                          193   4e-55   Oryza sativa Indica Group [Indian rice]
ref|NP_001044395.1|  Os01g0772800                                       193   4e-55   
ref|XP_006644784.1|  PREDICTED: signal recognition particle 54 kD...    192   7e-55   Oryza brachyantha
ref|XP_010063480.1|  PREDICTED: signal recognition particle 54 kD...    192   8e-55   Eucalyptus grandis [rose gum]
ref|XP_010063479.1|  PREDICTED: signal recognition particle 54 kD...    192   1e-54   
sp|P49968.1|SR541_HORVU  RecName: Full=Signal recognition particl...    191   2e-54   Hordeum vulgare [barley]
ref|XP_006844238.1|  hypothetical protein AMTR_s00006p00268250          191   4e-54   Amborella trichopoda
ref|XP_006857528.1|  hypothetical protein AMTR_s00061p00029690          191   4e-54   Amborella trichopoda
gb|EYU21664.1|  hypothetical protein MIMGU_mgv1a005153mg                190   4e-54   Erythranthe guttata [common monkey flower]
ref|XP_010479315.1|  PREDICTED: signal recognition particle 54 kD...    189   1e-53   Camelina sativa [gold-of-pleasure]
ref|XP_010500428.1|  PREDICTED: signal recognition particle 54 kD...    189   1e-53   
gb|EPS68116.1|  hypothetical protein M569_06658                         189   1e-53   Genlisea aurea
ref|XP_006307324.1|  hypothetical protein CARUB_v10008947mg             189   2e-53   Capsella rubella
gb|KFK43787.1|  hypothetical protein AALP_AA1G172500                    188   2e-53   Arabis alpina [alpine rockcress]
gb|EYU33587.1|  hypothetical protein MIMGU_mgv1a005138mg                188   2e-53   Erythranthe guttata [common monkey flower]
gb|KCW82796.1|  hypothetical protein EUGRSUZ_C04171                     185   4e-53   Eucalyptus grandis [rose gum]
ref|XP_006393333.1|  hypothetical protein EUTSA_v10011882mg             176   5e-53   
ref|XP_010041812.1|  PREDICTED: signal recognition particle 54 kD...    181   9e-53   
ref|XP_006280359.1|  hypothetical protein CARUB_v10026286mg             186   2e-52   Capsella rubella
ref|XP_010049962.1|  PREDICTED: signal recognition particle 54 kD...    186   2e-52   Eucalyptus grandis [rose gum]
ref|NP_001077690.1|  signal recognition particle subunit SRP54          184   2e-52   Arabidopsis thaliana [mouse-ear cress]
dbj|BAH56850.1|  AT1G48900                                              184   3e-52   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564535.1|  signal recognition particle subunit SRP54             184   7e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002894146.1|  signal recognition particle 54 kDa protein 3       184   8e-52   Arabidopsis lyrata subsp. lyrata
gb|AAG29734.1|AC084414_2  signal recognition particle 54 kDa prot...    184   1e-51   Arabidopsis thaliana [mouse-ear cress]
gb|AAA66200.1|  signal recognition particle 54 kDa subunit              184   1e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009148918.1|  PREDICTED: signal recognition particle 54 kD...    183   1e-51   Brassica rapa
ref|XP_002987279.1|  hypothetical protein SELMODRAFT_158663             184   1e-51   Selaginella moellendorffii
ref|XP_006393335.1|  hypothetical protein EUTSA_v10011425mg             184   1e-51   Eutrema salsugineum [saltwater cress]
emb|CDY36546.1|  BnaA06g09990D                                          183   2e-51   Brassica napus [oilseed rape]
ref|XP_010497009.1|  PREDICTED: signal recognition particle 54 kD...    182   6e-51   Camelina sativa [gold-of-pleasure]
ref|XP_010476615.1|  PREDICTED: signal recognition particle 54 kD...    181   1e-50   Camelina sativa [gold-of-pleasure]
ref|XP_009107330.1|  PREDICTED: signal recognition particle 54 kD...    180   3e-50   Brassica rapa
emb|CDY40616.1|  BnaC06g02320D                                          180   3e-50   Brassica napus [oilseed rape]
ref|NP_563970.1|  signal recognition particle protein SRP54A            179   4e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009147933.1|  PREDICTED: signal recognition particle 54 kD...    180   4e-50   Brassica rapa
emb|CDX77276.1|  BnaC08g03210D                                          179   6e-50   
ref|NP_199761.1|  Signal recognition particle SRP54 subunit protein     177   5e-49   Arabidopsis thaliana [mouse-ear cress]
emb|CDY39632.1|  BnaC05g11610D                                          176   6e-49   Brassica napus [oilseed rape]
gb|AAA66199.1|  signal recognition particle 54 kDa subunit              175   2e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006416923.1|  hypothetical protein EUTSA_v10009795mg             175   3e-48   
gb|AES68174.2|  signal recognition particle 54 kDa protein              174   5e-48   Medicago truncatula
ref|XP_003597923.1|  Signal recognition particle                        173   1e-47   
ref|NP_001056003.1|  Os05g0509500                                       172   2e-47   
gb|EAY98648.1|  hypothetical protein OsI_20572                          172   2e-47   Oryza sativa Indica Group [Indian rice]
ref|XP_003567163.1|  PREDICTED: signal recognition particle 54 kD...    172   4e-47   Brachypodium distachyon [annual false brome]
ref|XP_010440656.1|  PREDICTED: signal recognition particle 54 kD...    171   5e-47   Camelina sativa [gold-of-pleasure]
gb|EYU27665.1|  hypothetical protein MIMGU_mgv1a019132mg                170   1e-46   Erythranthe guttata [common monkey flower]
gb|KFK27972.1|  hypothetical protein AALP_AA8G455400                    170   1e-46   Arabis alpina [alpine rockcress]
gb|EYU26337.1|  hypothetical protein MIMGU_mgv1a026331mg                169   3e-46   Erythranthe guttata [common monkey flower]
ref|XP_008649844.1|  PREDICTED: signal recognition particle 54 kD...    167   2e-45   Zea mays [maize]
ref|XP_002441352.1|  hypothetical protein SORBIDRAFT_09g025050          167   2e-45   Sorghum bicolor [broomcorn]
gb|EMT07581.1|  Signal recognition particle 54 kDa protein 2            157   4e-45   
ref|XP_010482225.1|  PREDICTED: signal recognition particle 54 kD...    165   2e-44   Camelina sativa [gold-of-pleasure]
gb|EMT01442.1|  Signal recognition particle 54 kDa protein 3            164   3e-44   
gb|EMS67083.1|  Signal recognition particle 54 kDa protein 3            164   3e-44   Triticum urartu
gb|EMT27051.1|  Signal recognition particle 54 kDa protein 2            163   4e-44   
ref|XP_004961562.1|  PREDICTED: signal recognition particle 54 kD...    163   6e-44   Setaria italica
emb|CDJ26375.1|  unnamed protein product                                163   7e-44   Triticum aestivum [Canadian hard winter wheat]
gb|EMT28586.1|  Signal recognition particle 54 kDa protein 2            153   7e-44   
emb|CDY10656.1|  BnaA05g17060D                                          154   3e-43   Brassica napus [oilseed rape]
gb|EMS47723.1|  Signal recognition particle 54 kDa protein 2            142   2e-39   Triticum urartu
sp|P49970.1|SR543_HORVU  RecName: Full=Signal recognition particl...    150   2e-39   Hordeum vulgare [barley]
ref|XP_004986804.1|  PREDICTED: signal recognition particle 54 kD...    142   2e-36   Setaria italica
gb|AFG65368.1|  hypothetical protein UMN_2824_02                        132   3e-36   Pinus taeda
ref|XP_010051702.1|  PREDICTED: signal recognition particle 54 kD...    133   1e-34   
gb|EMT11251.1|  Signal recognition particle 54 kDa protein 2            126   1e-33   
ref|XP_002964266.1|  hypothetical protein SELMODRAFT_81201              130   2e-33   
ref|XP_002466776.1|  hypothetical protein SORBIDRAFT_01g014030          133   6e-33   Sorghum bicolor [broomcorn]
ref|XP_005841045.1|  hypothetical protein GUITHDRAFT_159167             130   5e-32   Guillardia theta CCMP2712
emb|CDY16473.1|  BnaA08g02940D                                          122   5e-32   Brassica napus [oilseed rape]
ref|XP_002964268.1|  hypothetical protein SELMODRAFT_82182              129   7e-32   Selaginella moellendorffii
ref|XP_780650.3|  PREDICTED: signal recognition particle 54 kDa p...    129   1e-31   Strongylocentrotus purpuratus [purple urchin]
ref|XP_002989541.1|  hypothetical protein SELMODRAFT_129975             129   2e-31   Selaginella moellendorffii
gb|EAW65893.1|  hCG2033479, isoform CRA_c                               122   4e-31   Homo sapiens [man]
ref|XP_002514106.1|  signal recognition particle 54 kD protein, p...    122   8e-31   
ref|XP_004314467.1|  PREDICTED: signal recognition particle 54 kD...    122   1e-30   
ref|NP_988977.1|  signal recognition particle 54kDa                     126   2e-30   Xenopus tropicalis [western clawed frog]
ref|XP_003987587.1|  PREDICTED: signal recognition particle 54 kD...    125   2e-30   Felis catus [cat]
ref|XP_002464203.1|  hypothetical protein SORBIDRAFT_01g014055          125   3e-30   
ref|XP_001363021.1|  PREDICTED: signal recognition particle 54 kD...    125   4e-30   Monodelphis domestica
ref|XP_006812603.1|  PREDICTED: signal recognition particle 54 kD...    125   4e-30   Saccoglossus kowalevskii
emb|CDP08251.1|  unnamed protein product                                124   4e-30   Coffea canephora [robusta coffee]
ref|XP_008480600.1|  PREDICTED: signal recognition particle 54 kD...    120   5e-30   
ref|XP_005989239.1|  PREDICTED: signal recognition particle 54 kD...    124   6e-30   Latimeria chalumnae
ref|NP_001080564.1|  signal recognition particle 54kDa                  124   8e-30   Xenopus laevis [clawed frog]
gb|EFZ22659.1|  hypothetical protein SINV_03515                         121   1e-29   
dbj|BAC41048.1|  unnamed protein product                                123   1e-29   Mus musculus [mouse]
ref|XP_005707608.1|  signal recognition particle subunit SRP54          123   1e-29   Galdieria sulphuraria
ref|XP_008209172.1|  PREDICTED: signal recognition particle 54 kD...    123   1e-29   
gb|EAW65895.1|  hCG2033479, isoform CRA_e                               121   2e-29   Homo sapiens [man]
gb|EAW65894.1|  hCG2033479, isoform CRA_d                               121   2e-29   Homo sapiens [man]
ref|XP_011452623.1|  PREDICTED: signal recognition particle 54 kD...    122   2e-29   Crassostrea gigas
ref|XP_005714472.1|  signal recognition particle recognition comp...    122   2e-29   Chondrus crispus [carageen]
ref|XP_011161944.1|  PREDICTED: signal recognition particle 54 kD...    120   3e-29   
tpg|DAA34489.1|  TPA: signal recognition particle subunit Srp54         117   3e-29   Amblyomma variegatum
gb|EFX73155.1|  hypothetical protein DAPPUDRAFT_325390                  122   3e-29   Daphnia pulex
ref|XP_009061606.1|  hypothetical protein LOTGIDRAFT_127402             122   3e-29   Lottia gigantea
ref|XP_002131641.1|  PREDICTED: signal recognition particle 54 kD...    122   3e-29   Ciona intestinalis [sea vase]
ref|XP_011055547.1|  PREDICTED: signal recognition particle 54 kD...    122   4e-29   Acromyrmex echinatior
ref|XP_004367866.1|  signal peptide binding domain containing pro...    122   4e-29   Acanthamoeba castellanii str. Neff
ref|XP_006985324.1|  PREDICTED: signal recognition particle 54 kD...    121   4e-29   
ref|XP_009970774.1|  PREDICTED: signal recognition particle 54 kD...    122   5e-29   Tyto alba [Schleiereule]
ref|XP_008546734.1|  PREDICTED: signal recognition particle 54 kD...    122   5e-29   Microplitis demolitor
gb|ERE72537.1|  signal recognition particle protein                     121   5e-29   Cricetulus griseus [Chinese hamsters]
ref|XP_001641637.1|  predicted protein                                  121   6e-29   Nematostella vectensis
ref|XP_007632101.1|  PREDICTED: signal recognition particle 54 kD...    121   6e-29   
ref|XP_006891639.1|  PREDICTED: signal recognition particle 54 kD...    121   6e-29   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_005268081.1|  PREDICTED: signal recognition particle 54 kD...    121   6e-29   Homo sapiens [man]
ref|XP_004649653.1|  PREDICTED: signal recognition particle 54 kD...    121   6e-29   Jaculus jaculus
ref|XP_006515381.1|  PREDICTED: signal recognition particle 54C i...    121   6e-29   Mus musculus [mouse]
gb|ERE72538.1|  signal recognition particle protein                     121   6e-29   Cricetulus griseus [Chinese hamsters]
ref|XP_006240159.1|  PREDICTED: signal recognition particle 54 kD...    121   7e-29   Rattus norvegicus [brown rat]
ref|XP_008828041.1|  PREDICTED: signal recognition particle 54 kD...    121   7e-29   
ref|NP_001093580.1|  signal recognition particle 54C                    121   7e-29   Mus musculus [mouse]
ref|XP_010114686.1|  PREDICTED: signal recognition particle 54 kD...    121   7e-29   Chlamydotis macqueenii
gb|KIY97276.1|  hypothetical protein MNEG_10689                         116   7e-29   Monoraphidium neglectum
ref|NP_036029.2|  signal recognition particle 54 kDa protein            121   7e-29   Mus musculus [mouse]
gb|AAH05543.1|  Srp54c protein                                          121   7e-29   Mus musculus [mouse]
emb|CAA34386.1|  unnamed protein product                                121   7e-29   Mus musculus [mouse]
ref|XP_006732286.1|  PREDICTED: signal recognition particle 54 kD...    121   7e-29   Leptonychotes weddellii
ref|XP_003511430.2|  PREDICTED: signal recognition particle 54 kD...    121   8e-29   Cricetulus griseus [Chinese hamsters]
ref|NP_446323.1|  signal recognition particle 54 kDa protein            121   8e-29   Rattus norvegicus [brown rat]
gb|KFP35422.1|  Signal recognition particle 54 kDa protein              121   8e-29   Chlamydotis macqueenii
ref|XP_008069648.1|  PREDICTED: signal recognition particle 54 kD...    121   8e-29   Carlito syrichta
ref|NP_003127.1|  signal recognition particle 54 kDa protein isof...    121   8e-29   Homo sapiens [man]
ref|XP_004055129.1|  PREDICTED: signal recognition particle 54 kD...    121   8e-29   
ref|XP_003987586.1|  PREDICTED: signal recognition particle 54 kD...    121   8e-29   Felis catus [cat]
ref|NP_001267455.1|  signal recognition particle 54 kDa protein         121   8e-29   Pan troglodytes
ref|XP_006258810.1|  PREDICTED: signal recognition particle 54 kD...    120   9e-29   
gb|ETE73017.1|  Signal recognition particle 54 kDa protein              120   1e-28   Ophiophagus hannah
ref|XP_002157121.2|  PREDICTED: signal recognition particle 54 kD...    119   1e-28   Hydra vulgaris
ref|XP_004376574.1|  PREDICTED: signal recognition particle 54 kD...    120   1e-28   Trichechus manatus latirostris
ref|XP_009288658.1|  PREDICTED: signal recognition particle 54 kD...    120   1e-28   Aptenodytes forsteri
ref|XP_009951795.1|  PREDICTED: signal recognition particle 54 kD...    120   1e-28   Leptosomus discolor
ref|XP_006015436.1|  PREDICTED: signal recognition particle 54 kD...    120   1e-28   
gb|EMC83844.1|  Signal recognition particle 54 kDa protein              120   1e-28   
ref|XP_009317642.1|  PREDICTED: signal recognition particle 54 kD...    120   1e-28   Pygoscelis adeliae
ref|XP_011337551.1|  PREDICTED: signal recognition particle 54 kD...    121   1e-28   Ooceraea biroi
ref|XP_011146525.1|  PREDICTED: signal recognition particle 54 kD...    120   1e-28   Harpegnathos saltator
ref|XP_011337552.1|  PREDICTED: signal recognition particle 54 kD...    120   1e-28   Ooceraea biroi
ref|XP_008503449.1|  PREDICTED: signal recognition particle 54 kD...    120   1e-28   Calypte anna
ref|XP_008101593.1|  PREDICTED: LOW QUALITY PROTEIN: signal recog...    120   1e-28   Anolis carolinensis [Carolina anole]
ref|XP_006117744.1|  PREDICTED: signal recognition particle 54 kD...    120   1e-28   Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_005285401.1|  PREDICTED: signal recognition particle 54 kD...    120   1e-28   Chrysemys picta bellii
ref|XP_624497.2|  PREDICTED: signal recognition particle 54 kDa p...    120   1e-28   Apis mellifera [bee]
ref|XP_011252983.1|  PREDICTED: signal recognition particle 54 kD...    120   1e-28   Camponotus floridanus
ref|XP_010159752.1|  PREDICTED: signal recognition particle 54 kD...    120   1e-28   Eurypyga helias
ref|XP_421238.1|  PREDICTED: signal recognition particle 54 kDa p...    120   1e-28   Gallus gallus [bantam]
ref|XP_007436853.1|  PREDICTED: signal recognition particle 54 kD...    120   1e-28   Python bivittatus
ref|XP_005444184.1|  PREDICTED: signal recognition particle 54 kD...    120   1e-28   Falco cherrug
ref|XP_004082449.2|  PREDICTED: signal recognition particle 54 kD...    120   2e-28   
ref|XP_008267717.1|  PREDICTED: signal recognition particle 54 kD...    121   2e-28   Oryctolagus cuniculus [domestic rabbit]
gb|KDR16155.1|  Signal recognition particle 54 kDa protein              120   2e-28   Zootermopsis nevadensis
ref|XP_011314020.1|  PREDICTED: signal recognition particle 54 kD...    120   2e-28   Fopius arisanus
ref|XP_002786558.1|  signal recognition particle 54 kDa protein 2       120   2e-28   Perkinsus marinus ATCC 50983
ref|XP_008312533.1|  PREDICTED: signal recognition particle 54 kD...    120   2e-28   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_010754152.1|  PREDICTED: signal recognition particle 54 kD...    120   2e-28   Larimichthys crocea [croceine croaker]
ref|XP_005806889.1|  PREDICTED: signal recognition particle 54 kD...    120   3e-28   
ref|NP_001279235.1|  signal recognition particle 54kDa                  120   3e-28   Callorhinchus milii [Australian ghost shark]
ref|XP_006632217.1|  PREDICTED: signal recognition particle 54 kD...    120   3e-28   Lepisosteus oculatus
ref|XP_003457248.1|  PREDICTED: signal recognition particle 54 kD...    120   3e-28   
ref|XP_008294896.1|  PREDICTED: signal recognition particle 54 kD...    120   3e-28   Stegastes partitus
ref|XP_007936778.1|  PREDICTED: signal recognition particle 54 kD...    120   3e-28   Orycteropus afer afer
gb|AIC62032.1|  SRP54                                                   119   3e-28   synthetic construct
ref|XP_003962842.1|  PREDICTED: signal recognition particle 54 kD...    119   3e-28   Takifugu rubripes [tiger puffer]
ref|NP_957282.1|  signal recognition particle 54 kDa protein            119   3e-28   Danio rerio [leopard danio]
ref|XP_006835414.1|  PREDICTED: LOW QUALITY PROTEIN: signal recog...    119   4e-28   Chrysochloris asiatica
ref|XP_010581946.1|  PREDICTED: signal recognition particle 54 kD...    120   4e-28   Haliaeetus leucocephalus
ref|XP_007574970.1|  PREDICTED: signal recognition particle 54 kD...    119   5e-28   
gb|KFM74977.1|  Signal recognition particle protein                     119   5e-28   Stegodyphus mimosarum
emb|CAF89626.1|  unnamed protein product                                119   5e-28   Tetraodon nigroviridis
ref|XP_002117863.1|  signal recognition particle 54                     119   5e-28   Trichoplax adhaerens
ref|XP_004348635.1|  signal recognition particle                        119   5e-28   Capsaspora owczarzaki ATCC 30864
ref|XP_007240540.1|  PREDICTED: signal recognition particle 54 kD...    119   5e-28   Astyanax mexicanus [blind cave fish]
ref|XP_010891266.1|  PREDICTED: signal recognition particle 54 kD...    119   6e-28   Esox lucius
ref|XP_003384056.1|  PREDICTED: signal recognition particle 54 kD...    119   6e-28   Amphimedon queenslandica
gb|ACI33196.1|  Signal recognition particle 54 kDa protein              119   7e-28   Salmo salar
ref|XP_967889.1|  PREDICTED: signal recognition particle 54 kDa p...    119   7e-28   Tribolium castaneum [rust-red flour beetle]
gb|EHJ78449.1|  putative signal recognition particle 54 kDa protein     118   7e-28   
ref|XP_002410011.1|  signal recognition particle 54 kD protein, p...    114   8e-28   Ixodes scapularis [blacklegged tick]
gb|ELU04185.1|  hypothetical protein CAPTEDRAFT_160274                  118   1e-27   Capitella teleta
gb|ACH70723.1|  signal recognition particle 54                          118   1e-27   Salmo salar
ref|XP_002784438.1|  signal recognition particle 54 kDa protein 2       118   1e-27   Perkinsus marinus ATCC 50983
gb|EUB59451.1|  Signal recognition particle protein                     121   1e-27   Echinococcus granulosus
emb|CDS21241.1|  signal recognition particle 54 kda protein             118   1e-27   Echinococcus granulosus
ref|XP_003471895.1|  PREDICTED: LOW QUALITY PROTEIN: signal recog...    118   1e-27   Cavia porcellus [guinea pig]
emb|CDI97826.1|  signal recognition particle 54 kda protein             118   1e-27   Echinococcus multilocularis
emb|CDQ62701.1|  unnamed protein product                                117   1e-27   Oncorhynchus mykiss
gb|EMP30750.1|  Signal recognition particle 54 kDa protein              119   1e-27   Chelonia mydas [green seaturtle]
prf||1512311A  SRP protein 54kD                                         117   1e-27
ref|XP_003699385.1|  PREDICTED: signal recognition particle 54 kD...    117   1e-27   Megachile rotundata
ref|NP_001091776.1|  putative signal recognition particle 54 kDa ...    117   1e-27   Bombyx mori [silk moth]
gb|EMS63250.1|  Signal recognition particle 54 kDa protein 1            114   2e-27   Triticum urartu
ref|XP_001652739.1|  AAEL007400-PA                                      116   2e-27   
ref|XP_003698068.1|  PREDICTED: uncharacterized protein LOC100872792    119   3e-27   
ref|XP_003493597.1|  PREDICTED: signal recognition particle 54 kD...    117   3e-27   Bombus impatiens
gb|EPZ32142.1|  Signal recognition particle 54 kDa protein              117   3e-27   Rozella allomycis CSF55
ref|XP_003399441.1|  PREDICTED: signal recognition particle 54 kD...    117   3e-27   Bombus terrestris [large earth bumblebee]
emb|CDW53781.1|  signal recognition particle 54 kDa protein             116   5e-27   Trichuris trichiura
ref|XP_005189749.1|  PREDICTED: signal recognition particle 54 kD...    116   5e-27   Musca domestica
gb|AAX26359.2|  SJCHGC03967 protein                                     113   6e-27   Schistosoma japonicum
ref|XP_011497431.1|  PREDICTED: signal recognition particle 54 kD...    115   8e-27   Ceratosolen solmsi marchali
ref|XP_004997545.1|  signal recognition particle protein                115   8e-27   Salpingoeca rosetta
ref|XP_011200190.1|  PREDICTED: signal recognition particle 54 kD...    115   1e-26   Bactrocera dorsalis [papaya fruit fly]
gb|KGB31667.1|  hypothetical protein MS3_11443                          111   1e-26   Schistosoma haematobium
gb|KFB46282.1|  AGAP004610-PA-like protein                              115   1e-26   Anopheles sinensis
ref|XP_011179577.1|  PREDICTED: signal recognition particle 54 kD...    115   1e-26   Zeugodacus cucurbitae [melon fruit fly]
gb|ETN65735.1|  signal recognition particle 54 kda protein              115   1e-26   Anopheles darlingi [American malaria mosquito]
ref|XP_315212.2|  AGAP004610-PA                                         115   2e-26   
emb|CDS25863.1|  expressed protein                                      115   2e-26   
ref|XP_004525208.1|  PREDICTED: signal recognition particle 54 kD...    114   2e-26   
ref|XP_001850971.1|  signal recognition particle 54 kda protein         114   2e-26   
gb|ACO13001.1|  Signal recognition particle 54 kDa protein              114   3e-26   
gb|KFW08005.1|  Signal recognition particle 54 kDa protein              114   3e-26   
ref|XP_005787078.1|  hypothetical protein EMIHUDRAFT_455543             114   3e-26   
ref|XP_002504359.1|  type II secretory pathway family                   113   5e-26   
gb|AEE61463.1|  unknown                                                 113   6e-26   
emb|CAX82402.1|  Signal recognition particle 54 kDa protein             112   9e-26   
gb|AFJ22033.1|  signal recognition particle protein 54k                 112   1e-25   
ref|XP_002093779.1|  GE21487                                            112   1e-25   
ref|XP_001971975.1|  GG15264                                            112   1e-25   
ref|NP_523931.1|  signal recognition particle protein 54k               112   1e-25   
ref|XP_002035428.1|  GM14699                                            112   1e-25   
ref|XP_002083715.1|  GD13881                                            112   1e-25   
emb|CAX82469.1|  Signal recognition particle 54 kDa protein             112   1e-25   
gb|KHJ89188.1|  putative signal recognition particle protein SRP54      110   1e-25   
ref|XP_003381288.1|  signal recognition protein                         112   1e-25   
ref|XP_005846072.1|  hypothetical protein CHLNCDRAFT_31879              112   1e-25   
ref|XP_007510184.1|  predicted protein                                  112   2e-25   
gb|ACO10935.1|  Signal recognition particle 54 kDa protein              112   2e-25   
ref|XP_001951515.1|  PREDICTED: signal recognition particle 54 kD...    112   2e-25   
gb|KHJ89203.1|  ribonucleoprotein homol                                 110   2e-25   
gb|EPY28434.1|  signal recognition particle subunit SRP54               112   2e-25   
ref|XP_002068627.1|  GK20323                                            112   2e-25   
gb|AAM11013.1|  AT23778p                                                112   2e-25   
gb|ESA21942.1|  hypothetical protein GLOINDRAFT_117267                  110   2e-25   
ref|XP_001957554.1|  GF23972                                            111   3e-25   
emb|CCC95150.1|  unnamed protein product                                111   3e-25   
gb|AFJ22034.1|  signal recognition particle protein 54k                 110   3e-25   
ref|XP_009029351.1|  hypothetical protein HELRODRAFT_189679             111   3e-25   
ref|XP_001354282.1|  GA18336                                            111   4e-25   
gb|KIH51172.1|  signal recognition particle protein SRP54               110   4e-25   
ref|XP_006677008.1|  hypothetical protein BATDEDRAFT_86146              111   4e-25   
emb|CDJ89055.1|  Signal recognition particle domain containing pr...    110   5e-25   
ref|XP_003142374.1|  signal recognition particle protein                110   9e-25   
gb|ERG86519.1|  signal recognition particle 54 kda protein              110   9e-25   
gb|EFA81136.1|  signal recognition particle 54 kDa subunit              110   9e-25   
gb|AFJ22031.1|  signal recognition particle protein 54k                 109   1e-24   
gb|EXX62132.1|  Srp54p                                                  110   1e-24   
ref|XP_643640.1|  signal recognition particle 54 kDa subunit            110   1e-24   
gb|KFM02425.1|  Signal recognition particle 54 kDa protein              109   1e-24   
ref|XP_009171598.1|  hypothetical protein T265_07735                    109   1e-24   
dbj|GAA50175.1|  signal recognition particle subunit SRP54              109   2e-24   
emb|CBY41387.1|  unnamed protein product                                109   2e-24   
emb|CBY11581.1|  unnamed protein product                                109   2e-24   
gb|AFJ22007.1|  signal recognition particle protein 54k                 108   2e-24   
emb|CCD80749.1|  putative signal recognition particle 54 kD protein     109   2e-24   
gb|EFO21698.2|  signal recognition particle protein                     108   2e-24   
gb|AFJ22116.1|  signal recognition particle protein 54k                 108   3e-24   
ref|XP_003748101.1|  PREDICTED: uncharacterized protein LOC100903576    111   3e-24   
ref|XP_001895013.1|  signal recognition particle 54 kDa protein (...    108   3e-24   
gb|AFJ22120.1|  signal recognition particle protein 54k                 108   3e-24   
gb|AFJ22003.1|  signal recognition particle protein 54k                 108   3e-24   
gb|AFJ21995.1|  signal recognition particle protein 54k                 108   3e-24   
gb|EJW83036.1|  signal recognition particle protein SRP54               108   3e-24   
gb|AFJ21997.1|  signal recognition particle protein 54k                 107   5e-24   
ref|XP_003289436.1|  signal recognition particle 54 kDa subunit         108   6e-24   
gb|AFJ22243.1|  signal recognition particle protein 54k                 107   7e-24   
gb|AFJ22127.1|  signal recognition particle protein 54k                 107   7e-24   
ref|XP_828615.1|  signal recognition particle 54 kDa                    107   8e-24   
gb|AFJ22008.1|  signal recognition particle protein 54k                 107   8e-24   
gb|AFJ22208.1|  signal recognition particle protein 54k                 107   8e-24   
ref|XP_004360859.1|  signal recognition particle 54 kDa subunit         107   8e-24   
gb|EPY25476.1|  signal recognition particle subunit SRP54               107   9e-24   
ref|XP_002008146.1|  GI13333                                            107   1e-23   
gb|EYC42964.1|  hypothetical protein Y032_0509g2725                     107   1e-23   
ref|XP_002046943.1|  GJ13160                                            107   1e-23   
ref|XP_001983965.1|  GH16182                                            107   1e-23   
gb|AFJ22209.1|  signal recognition particle protein 54k                 106   1e-23   
ref|XP_002174820.1|  signal recognition particle subunit Srp54          107   1e-23   
gb|EPY39310.1|  signal recognition particle subunit SRP54               107   1e-23   
gb|AFJ22210.1|  signal recognition particle protein 54k                 106   1e-23   
gb|AFJ21998.1|  signal recognition particle protein 54k                 106   1e-23   
gb|AFJ22241.1|  signal recognition particle protein 54k                 106   2e-23   
gb|AFJ22020.1|  signal recognition particle protein 54k                 106   2e-23   
gb|AFJ22032.1|  signal recognition particle protein 54k                 106   2e-23   
gb|AFJ22029.1|  signal recognition particle protein 54k                 106   2e-23   
gb|EYC42965.1|  hypothetical protein Y032_0509g2725                     107   2e-23   
gb|AFJ22213.1|  signal recognition particle protein 54k                 105   2e-23   
gb|AFJ22212.1|  signal recognition particle protein 54k                 105   2e-23   
gb|AFJ22211.1|  signal recognition particle protein 54k                 105   2e-23   
gb|AFJ22000.1|  signal recognition particle protein 54k                 105   3e-23   
gb|AFJ22030.1|  signal recognition particle protein 54k                 105   3e-23   
gb|AFJ22129.1|  signal recognition particle protein 54k                 105   3e-23   
gb|AFJ22036.1|  signal recognition particle protein 54k                 105   3e-23   
gb|AFJ22146.1|  signal recognition particle protein 54k                 105   3e-23   
gb|AFJ22123.1|  signal recognition particle protein 54k                 105   4e-23   
gb|AFJ22113.1|  signal recognition particle protein 54k                 105   4e-23   
gb|AAN12396.1|  signal recognition particle 54 kDa                      105   4e-23   
gb|AFJ22242.1|  signal recognition particle protein 54k                 105   4e-23   
gb|AFJ22215.1|  signal recognition particle protein 54k                 105   4e-23   
gb|KFD57328.1|  hypothetical protein M513_01839                         105   4e-23   
gb|AFJ22306.1|  signal recognition particle protein 54k                 105   4e-23   
gb|AFJ22119.1|  signal recognition particle protein 54k                 105   4e-23   
gb|AFJ22001.1|  signal recognition particle protein 54k                 105   4e-23   
gb|AFJ21999.1|  signal recognition particle protein 54k                 105   4e-23   
gb|KHJ46364.1|  hypothetical protein D918_03417                         105   5e-23   
gb|AFJ22167.1|  signal recognition particle protein 54k                 104   5e-23   
ref|XP_005537555.1|  signal recognition particle recognition comp...    105   5e-23   
gb|AFJ22245.1|  signal recognition particle protein 54k                 104   6e-23   
gb|AFJ22114.1|  signal recognition particle protein 54k                 104   6e-23   
gb|AFJ22169.1|  signal recognition particle protein 54k                 104   6e-23   
gb|AFJ22206.1|  signal recognition particle protein 54k                 104   6e-23   
gb|AFJ22170.1|  signal recognition particle protein 54k                 104   6e-23   
gb|KEQ75038.1|  signal recognition particle protein                     105   7e-23   
gb|AFJ22019.1|  signal recognition particle protein 54k                 104   7e-23   
gb|AFJ22147.1|  signal recognition particle protein 54k                 104   7e-23   
ref|XP_001465902.1|  putative signal recognition particle               105   7e-23   
gb|AHK06012.1|  signal recognition particle protein 54k                 104   7e-23   
gb|AFJ22216.1|  signal recognition particle protein 54k                 104   7e-23   
gb|AFJ22097.1|  signal recognition particle protein 54k                 104   7e-23   
gb|AFJ22301.1|  signal recognition particle protein 54k                 104   7e-23   
ref|XP_003875885.1|  putative signal recognition particle               105   8e-23   
ref|XP_009314319.1|  signal recognition particle                        104   8e-23   
gb|AHK06011.1|  signal recognition particle protein 54k                 104   8e-23   
gb|AFJ22299.1|  signal recognition particle protein 54k                 104   9e-23   
gb|AFJ22182.1|  signal recognition particle protein 54k                 104   9e-23   
gb|AHK06010.1|  signal recognition particle protein 54k                 104   9e-23   
gb|AFJ22144.1|  signal recognition particle protein 54k                 103   1e-22   
gb|AFJ22165.1|  signal recognition particle protein 54k                 103   1e-22   
gb|AFJ22148.1|  signal recognition particle protein 54k                 103   1e-22   
gb|AFJ22061.1|  signal recognition particle protein 54k                 103   1e-22   
gb|AFJ22145.1|  signal recognition particle protein 54k                 103   1e-22   
gb|AFJ22105.1|  signal recognition particle protein 54k                 103   1e-22   
gb|AFJ22140.1|  signal recognition particle protein 54k                 103   1e-22   
gb|AFJ22201.1|  signal recognition particle protein 54k                 103   1e-22   
gb|AFJ22143.1|  signal recognition particle protein 54k                 103   1e-22   
gb|AFJ22130.1|  signal recognition particle protein 54k                 103   1e-22   
gb|AFJ21996.1|  signal recognition particle protein 54k                 103   1e-22   
ref|XP_011118701.1|  hypothetical protein AOL_s00007g498                104   1e-22   
gb|AFJ22166.1|  signal recognition particle protein 54k                 103   1e-22   
gb|AFJ22091.1|  signal recognition particle protein 54k                 103   1e-22   
gb|AFJ22062.1|  signal recognition particle protein 54k                 103   1e-22   
gb|AFJ22300.1|  signal recognition particle protein 54k                 103   1e-22   
gb|AFJ22096.1|  signal recognition particle protein 54k                 103   1e-22   
ref|XP_002425377.1|  Signal recognition particle 54 kDa protein, ...    104   1e-22   
gb|AFJ22149.1|  signal recognition particle protein 54k                 103   1e-22   
gb|AFJ22135.1|  signal recognition particle protein 54k                 103   1e-22   
gb|AFJ22202.1|  signal recognition particle protein 54k                 103   1e-22   
gb|AFJ22150.1|  signal recognition particle protein 54k                 103   1e-22   
gb|AFJ22139.1|  signal recognition particle protein 54k                 103   1e-22   
ref|NP_501507.1|  Protein F21D5.7                                       103   1e-22   
gb|AFJ22164.1|  signal recognition particle protein 54k                 103   1e-22   
gb|AFJ22137.1|  signal recognition particle protein 54k                 103   1e-22   
gb|AFJ22104.1|  signal recognition particle protein 54k                 103   1e-22   
gb|AFJ22125.1|  signal recognition particle protein 54k                 103   2e-22   
gb|AFJ22171.1|  signal recognition particle protein 54k                 103   2e-22   
ref|XP_002313219.2|  hypothetical protein POPTR_0009s05260g             102   2e-22   
sp|Q8MZJ6.1|SRP54_GEOCY  RecName: Full=Signal recognition particl...    103   2e-22   
gb|AFJ22107.1|  signal recognition particle protein 54k                 103   2e-22   
gb|AFJ22307.1|  signal recognition particle protein 54k                 103   2e-22   
gb|AFJ22134.1|  signal recognition particle protein 54k                 103   2e-22   
gb|AFJ22025.1|  signal recognition particle protein 54k                 103   2e-22   
gb|AFJ22053.1|  signal recognition particle protein 54k                 103   2e-22   
gb|AFJ22052.1|  signal recognition particle protein 54k                 103   2e-22   
gb|AFJ22098.1|  signal recognition particle protein 54k                 103   2e-22   
gb|AFJ22095.1|  signal recognition particle protein 54k                 103   2e-22   
gb|AFJ22015.1|  signal recognition particle protein 54k                 103   2e-22   
gb|AFJ22108.1|  signal recognition particle protein 54k                 103   2e-22   
gb|AFJ22294.1|  signal recognition particle protein 54k                 103   2e-22   
gb|AFJ22238.1|  signal recognition particle protein 54k                 103   2e-22   
gb|AFJ22039.1|  signal recognition particle protein 54k                 103   2e-22   
gb|EYU26336.1|  hypothetical protein MIMGU_mgv1a022577mg                102   2e-22   
gb|AFJ22124.1|  signal recognition particle protein 54k                 103   2e-22   
gb|AFJ22011.1|  signal recognition particle protein 54k                 103   2e-22   
gb|AFJ22005.1|  signal recognition particle protein 54k                 103   2e-22   
gb|AFJ22038.1|  signal recognition particle protein 54k                 102   2e-22   
gb|AFJ22181.1|  signal recognition particle protein 54k                 103   2e-22   
gb|AFJ22207.1|  signal recognition particle protein 54k                 102   2e-22   
gb|AFJ22240.1|  signal recognition particle protein 54k                 103   2e-22   
gb|AFJ22228.1|  signal recognition particle protein 54k                 103   2e-22   
gb|AFJ22109.1|  signal recognition particle protein 54k                 102   3e-22   
gb|AFJ22102.1|  signal recognition particle protein 54k                 102   3e-22   
emb|CAP34405.2|  Protein CBG16436                                       103   3e-22   
ref|XP_003758970.1|  PREDICTED: signal recognition particle 54 kD...  98.6    3e-22   
gb|AFJ22101.1|  signal recognition particle protein 54k                 102   3e-22   
ref|XP_002647138.1|  Hypothetical protein CBG16436                      103   3e-22   
gb|AFJ22111.1|  signal recognition particle protein 54k                 102   3e-22   
gb|AFJ22151.1|  signal recognition particle protein 54k                 102   3e-22   
gb|AAL55410.1|  SRP54-like protein                                      103   3e-22   
gb|AFJ22292.1|  signal recognition particle protein 54k                 102   3e-22   
gb|AFJ22012.1|  signal recognition particle protein 54k                 102   3e-22   
gb|AFJ22308.1|  signal recognition particle protein 54k                 102   3e-22   
gb|AFJ22293.1|  signal recognition particle protein 54k                 102   3e-22   
gb|AFJ22112.1|  signal recognition particle protein 54k                 102   3e-22   
gb|AHK06009.1|  signal recognition particle protein 54k                 102   3e-22   
gb|AFJ22009.1|  signal recognition particle protein 54k                 102   3e-22   
ref|XP_003093593.1|  hypothetical protein CRE_02627                     103   3e-22   
ref|XP_004258994.1|  signal recognition particle 54 kDa protein, ...    102   3e-22   
ref|XP_002892859.1|  predicted protein                                  102   3e-22   
gb|AFJ22285.1|  signal recognition particle protein 54k                 102   4e-22   
gb|AFJ22121.1|  signal recognition particle protein 54k                 102   4e-22   
gb|AFJ22168.1|  signal recognition particle protein 54k                 102   4e-22   
gb|AFJ22155.1|  signal recognition particle protein 54k                 102   4e-22   
gb|AFJ22136.1|  signal recognition particle protein 54k                 102   4e-22   
gb|AFJ22024.1|  signal recognition particle protein 54k                 102   4e-22   
gb|AFJ22093.1|  signal recognition particle protein 54k                 102   4e-22   
gb|AFJ22289.1|  signal recognition particle protein 54k                 102   4e-22   
ref|XP_001683588.1|  putative signal recognition particle               103   4e-22   
gb|AFJ22305.1|  signal recognition particle protein 54k                 102   4e-22   
gb|AFJ22287.1|  signal recognition particle protein 54k                 102   4e-22   
gb|AFJ22163.1|  signal recognition particle protein 54k                 102   4e-22   
gb|AFJ22132.1|  signal recognition particle protein 54k                 102   4e-22   
gb|AFJ22237.1|  signal recognition particle protein 54k                 102   5e-22   
gb|AFJ22133.1|  signal recognition particle protein 54k                 102   5e-22   
emb|CCW62509.1|  unnamed protein product                                102   5e-22   
gb|AFJ22141.1|  signal recognition particle protein 54k                 102   5e-22   
gb|AFJ22142.1|  signal recognition particle protein 54k                 102   5e-22   
gb|AFJ22276.1|  signal recognition particle protein 54k                 102   5e-22   
gb|AFJ22254.1|  signal recognition particle protein 54k                 102   5e-22   
ref|NP_588209.1|  signal recognition particle subunit Srp54             102   5e-22   
gb|AFJ22152.1|  signal recognition particle protein 54k                 102   5e-22   
gb|AFJ22252.1|  signal recognition particle protein 54k                 102   5e-22   
gb|KFH71363.1|  signal recognition particle subunit SRP54               102   5e-22   
prf||1604366A  signal recognition particle 54kD protein                 102   5e-22
gb|AFJ22153.1|  signal recognition particle protein 54k                 102   5e-22   
gb|AFJ22298.1|  signal recognition particle protein 54k                 102   6e-22   
gb|AFJ22231.1|  signal recognition particle protein 54k                 102   6e-22   
gb|AFJ22230.1|  signal recognition particle protein 54k                 102   6e-22   



>ref|XP_009603108.1| PREDICTED: signal recognition particle 54 kDa protein 2-like 
[Nicotiana tomentosiformis]
Length=166

 Score =   211 bits (537),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 102/107 (95%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDM TNIK+IV
Sbjct  1    MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMSTNIKKIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NLDDLAAGHNKR+IIQ+AVF+ELCKILDPGKPSFTPKKGKPSVVMFV
Sbjct  61   NLDDLAAGHNKRRIIQKAVFDELCKILDPGKPSFTPKKGKPSVVMFV  107



>ref|XP_007217214.1| hypothetical protein PRUPE_ppa004695mg [Prunus persica]
 gb|EMJ18413.1| hypothetical protein PRUPE_ppa004695mg [Prunus persica]
Length=495

 Score =   217 bits (552),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 103/107 (96%), Positives = 107/107 (100%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLAQLGGSISRALQQMSNAT+IDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIK+IV
Sbjct  1    MVLAQLGGSISRALQQMSNATVIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKKIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NLDDLAAGHNKRKIIQQA+FNELCK+LDPGKPSFTPKKGKPSVVMFV
Sbjct  61   NLDDLAAGHNKRKIIQQAIFNELCKMLDPGKPSFTPKKGKPSVVMFV  107



>ref|XP_008228712.1| PREDICTED: signal recognition particle 54 kDa protein 2 [Prunus 
mume]
Length=495

 Score =   217 bits (552),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 103/107 (96%), Positives = 107/107 (100%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLAQLGGSISRALQQMSNAT+IDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIK+IV
Sbjct  1    MVLAQLGGSISRALQQMSNATVIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKKIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NLDDLAAGHNKRKIIQQA+FNELCK+LDPGKPSFTPKKGKPSVVMFV
Sbjct  61   NLDDLAAGHNKRKIIQQAIFNELCKMLDPGKPSFTPKKGKPSVVMFV  107



>ref|XP_010097203.1| Signal recognition particle 54 kDa protein 2 [Morus notabilis]
 gb|EXB67270.1| Signal recognition particle 54 kDa protein 2 [Morus notabilis]
Length=388

 Score =   213 bits (542),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 102/107 (95%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLAQLGGSISRALQQMSNAT+IDEKVLNECLNEITRALLQ+DVQFKLVRDMQTNIK+IV
Sbjct  1    MVLAQLGGSISRALQQMSNATVIDEKVLNECLNEITRALLQADVQFKLVRDMQTNIKKIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NLDDLAAGHNKRKIIQQA+FNELCKILDPGKPSFTPKKGK SVVMFV
Sbjct  61   NLDDLAAGHNKRKIIQQAIFNELCKILDPGKPSFTPKKGKTSVVMFV  107



>gb|ACU18718.1| unknown [Glycine max]
Length=175

 Score =   206 bits (524),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 100/107 (93%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA+LGGSISRALQQMSNATIIDEKVLN+CLN+ITRALLQSDVQFKLVRDMQTNIK IV
Sbjct  1    MVLAELGGSISRALQQMSNATIIDEKVLNDCLNDITRALLQSDVQFKLVRDMQTNIKNIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NL+DLAAGHNKR+IIQQAVFNELCKILDPGKPSFTPKKGK SVVMFV
Sbjct  61   NLEDLAAGHNKRRIIQQAVFNELCKILDPGKPSFTPKKGKTSVVMFV  107



>gb|KDO48631.1| hypothetical protein CISIN_1g011010mg [Citrus sinensis]
Length=344

 Score =   211 bits (537),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 99/107 (93%), Positives = 107/107 (100%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLAQLGGSISRA+QQMSNATIIDEKVLNECLNEITRALLQ+DVQFKLVR+MQTNIK+IV
Sbjct  1    MVLAQLGGSISRAIQQMSNATIIDEKVLNECLNEITRALLQADVQFKLVREMQTNIKKIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NLDDLAAGHNKR+IIQQA+FNELCK+LDPGKPSFTPKKGKPSV+MFV
Sbjct  61   NLDDLAAGHNKRRIIQQAIFNELCKMLDPGKPSFTPKKGKPSVIMFV  107



>ref|XP_008373986.1| PREDICTED: signal recognition particle 54 kDa protein 2 [Malus 
domestica]
Length=495

 Score =   215 bits (547),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 102/107 (95%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLAQLGGSISRALQQMSNAT+IDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIK+IV
Sbjct  1    MVLAQLGGSISRALQQMSNATVIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKKIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NLDDLAAGHNKRKIIQQA+FNELCK+LDPGKPSF PKKGKPSVVMFV
Sbjct  61   NLDDLAAGHNKRKIIQQAIFNELCKMLDPGKPSFAPKKGKPSVVMFV  107



>ref|XP_009628300.1| PREDICTED: signal recognition particle 54 kDa protein 2 [Nicotiana 
tomentosiformis]
Length=502

 Score =   215 bits (547),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/107 (96%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQ+DVQFKLVRDM TNIK+IV
Sbjct  1    MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQADVQFKLVRDMTTNIKKIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NLDDLAAGHNKR+IIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV
Sbjct  61   NLDDLAAGHNKRRIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  107



>ref|XP_009764811.1| PREDICTED: signal recognition particle 54 kDa protein 2 [Nicotiana 
sylvestris]
Length=501

 Score =   215 bits (547),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 103/107 (96%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQ+DVQFKLVRDM TNIK+IV
Sbjct  1    MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQADVQFKLVRDMTTNIKKIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NLDDLAAGHNKR+IIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV
Sbjct  61   NLDDLAAGHNKRRIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  107



>ref|XP_004168204.1| PREDICTED: signal recognition particle 54 kDa protein 2-like 
[Cucumis sativus]
Length=392

 Score =   211 bits (538),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 102/107 (95%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLAQLGGSISRALQQMS+AT+IDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIK+IV
Sbjct  1    MVLAQLGGSISRALQQMSSATVIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKKIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NLDDLAAGHNKRKIIQQAVFNELCK+LDPGKPSFTPKKGK SVVMFV
Sbjct  61   NLDDLAAGHNKRKIIQQAVFNELCKMLDPGKPSFTPKKGKTSVVMFV  107



>ref|XP_008454178.1| PREDICTED: signal recognition particle 54 kDa protein 2 [Cucumis 
melo]
Length=495

 Score =   214 bits (545),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 103/107 (96%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLAQLGGSISRALQQMSNAT+IDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIK+IV
Sbjct  1    MVLAQLGGSISRALQQMSNATVIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKKIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NLDDLAAGHNKRKIIQQAVFNELCK+LDPGKPSFTPKKGK SVVMFV
Sbjct  61   NLDDLAAGHNKRKIIQQAVFNELCKMLDPGKPSFTPKKGKTSVVMFV  107



>ref|XP_010279659.1| PREDICTED: signal recognition particle 54 kDa protein 2 [Nelumbo 
nucifera]
Length=495

 Score =   214 bits (545),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 103/107 (96%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIK+IV
Sbjct  1    MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKKIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NLDDLAAGHNKRKIIQQAVFNELCK+LDPGKPSFTPKKGK SV+MFV
Sbjct  61   NLDDLAAGHNKRKIIQQAVFNELCKMLDPGKPSFTPKKGKASVIMFV  107



>gb|KDO48630.1| hypothetical protein CISIN_1g011010mg [Citrus sinensis]
Length=411

 Score =   211 bits (538),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 99/107 (93%), Positives = 107/107 (100%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLAQLGGSISRA+QQMSNATIIDEKVLNECLNEITRALLQ+DVQFKLVR+MQTNIK+IV
Sbjct  1    MVLAQLGGSISRAIQQMSNATIIDEKVLNECLNEITRALLQADVQFKLVREMQTNIKKIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NLDDLAAGHNKR+IIQQA+FNELCK+LDPGKPSFTPKKGKPSV+MFV
Sbjct  61   NLDDLAAGHNKRRIIQQAIFNELCKMLDPGKPSFTPKKGKPSVIMFV  107



>ref|XP_010259930.1| PREDICTED: signal recognition particle 54 kDa protein 2-like 
[Nelumbo nucifera]
Length=495

 Score =   213 bits (543),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 103/107 (96%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIK+IV
Sbjct  1    MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKKIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NLDDLAAGHNKRKIIQQAVFNELCK+LDPGKPSFTPKKGK SV+MFV
Sbjct  61   NLDDLAAGHNKRKIIQQAVFNELCKMLDPGKPSFTPKKGKTSVIMFV  107



>ref|XP_006465307.1| PREDICTED: signal recognition particle 54 kDa protein 2-like 
[Citrus sinensis]
Length=494

 Score =   213 bits (542),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 100/107 (93%), Positives = 107/107 (100%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLAQLGGSISRA+QQMSNATIIDEKVLNECLNEITRALLQ+DVQFKLVR+MQTNIK+IV
Sbjct  1    MVLAQLGGSISRAIQQMSNATIIDEKVLNECLNEITRALLQADVQFKLVREMQTNIKKIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NLDDLAAGHNKR+IIQQA+FNELCKILDPGKPSFTPKKGKPSV+MFV
Sbjct  61   NLDDLAAGHNKRRIIQQAIFNELCKILDPGKPSFTPKKGKPSVIMFV  107



>gb|AIL30491.1| 54 kDa signal recognition particle 2 [Nicotiana tabacum]
Length=501

 Score =   213 bits (542),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 102/107 (95%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDM TNIK+IV
Sbjct  1    MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMSTNIKKIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NLDDLAAGHNKR+IIQ+AVF+ELCKILDPGKPSFTPKKGKPSVVMFV
Sbjct  61   NLDDLAAGHNKRRIIQKAVFDELCKILDPGKPSFTPKKGKPSVVMFV  107



>ref|XP_009783199.1| PREDICTED: signal recognition particle 54 kDa protein 1 [Nicotiana 
sylvestris]
Length=494

 Score =   213 bits (541),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 102/107 (95%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDM TNIK+IV
Sbjct  1    MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMSTNIKKIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NLDDLAAGHNKR+IIQ+AVF+ELCKILDPGKPSFTPKKGKPSVVMFV
Sbjct  61   NLDDLAAGHNKRRIIQKAVFDELCKILDPGKPSFTPKKGKPSVVMFV  107



>ref|XP_007023271.1| Signal recognition particle, SRP54 subunit protein [Theobroma 
cacao]
 gb|EOY25893.1| Signal recognition particle, SRP54 subunit protein [Theobroma 
cacao]
Length=494

 Score =   213 bits (541),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 102/107 (95%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLAQLGGSISRA+QQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIK+IV
Sbjct  1    MVLAQLGGSISRAIQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKKIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NLDDLAAGHNKRKIIQQA+FNELCK+LDPGKPSFTPKKGK SVVMFV
Sbjct  61   NLDDLAAGHNKRKIIQQAIFNELCKMLDPGKPSFTPKKGKTSVVMFV  107



>ref|NP_001234428.1| signal recognition particle 54 kDa protein 2 [Solanum lycopersicum]
 sp|P49972.1|SR542_SOLLC RecName: Full=Signal recognition particle 54 kDa protein 2; Short=SRP54 
[Solanum lycopersicum]
 emb|CAA84288.1| 54-kD signal recognition particle (SRP) specific protein [Solanum 
lycopersicum]
Length=499

 Score =   213 bits (541),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 101/107 (94%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA+LGGSISRALQQMSNATIIDEKVLNECLNEITRALLQ+DVQFKLVRDM TNIK+IV
Sbjct  1    MVLAELGGSISRALQQMSNATIIDEKVLNECLNEITRALLQADVQFKLVRDMTTNIKKIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NLDDLAAGHNKR+IIQQAVFNELCKILDPGKPSFTPKKGKPS+VMFV
Sbjct  61   NLDDLAAGHNKRRIIQQAVFNELCKILDPGKPSFTPKKGKPSIVMFV  107



>ref|XP_006346598.1| PREDICTED: signal recognition particle 54 kDa protein 2-like 
[Solanum tuberosum]
Length=499

 Score =   213 bits (541),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 101/107 (94%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA+LGGSISRALQQMSNATIIDEKVLNECLNEITRALLQ+DVQFKLVRDM TNIK+IV
Sbjct  1    MVLAELGGSISRALQQMSNATIIDEKVLNECLNEITRALLQADVQFKLVRDMTTNIKKIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NLDDLAAGHNKR+IIQQAVFNELCKILDPGKPSFTPKKGKPS+VMFV
Sbjct  61   NLDDLAAGHNKRRIIQQAVFNELCKILDPGKPSFTPKKGKPSIVMFV  107



>ref|XP_004152178.1| PREDICTED: signal recognition particle 54 kDa protein 2-like 
[Cucumis sativus]
 gb|KGN52936.1| hypothetical protein Csa_4G006430 [Cucumis sativus]
Length=495

 Score =   212 bits (540),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 102/107 (95%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLAQLGGSISRALQQMS+AT+IDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIK+IV
Sbjct  1    MVLAQLGGSISRALQQMSSATVIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKKIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NLDDLAAGHNKRKIIQQAVFNELCK+LDPGKPSFTPKKGK SVVMFV
Sbjct  61   NLDDLAAGHNKRKIIQQAVFNELCKMLDPGKPSFTPKKGKTSVVMFV  107



>ref|XP_006427317.1| hypothetical protein CICLE_v10025458mg [Citrus clementina]
 gb|ESR40557.1| hypothetical protein CICLE_v10025458mg [Citrus clementina]
Length=494

 Score =   212 bits (539),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 99/107 (93%), Positives = 107/107 (100%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLAQLGGSISRA+QQMSNATIIDEKVLNECLNEITRALLQ+DVQFKLVR+MQTNIK+IV
Sbjct  1    MVLAQLGGSISRAIQQMSNATIIDEKVLNECLNEITRALLQADVQFKLVREMQTNIKKIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NLDDLAAGHNKR+IIQQA+FNELCK+LDPGKPSFTPKKGKPSV+MFV
Sbjct  61   NLDDLAAGHNKRRIIQQAIFNELCKMLDPGKPSFTPKKGKPSVIMFV  107



>gb|KDO48628.1| hypothetical protein CISIN_1g011010mg [Citrus sinensis]
Length=495

 Score =   212 bits (539),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 99/107 (93%), Positives = 107/107 (100%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLAQLGGSISRA+QQMSNATIIDEKVLNECLNEITRALLQ+DVQFKLVR+MQTNIK+IV
Sbjct  1    MVLAQLGGSISRAIQQMSNATIIDEKVLNECLNEITRALLQADVQFKLVREMQTNIKKIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NLDDLAAGHNKR+IIQQA+FNELCK+LDPGKPSFTPKKGKPSV+MFV
Sbjct  61   NLDDLAAGHNKRRIIQQAIFNELCKMLDPGKPSFTPKKGKPSVIMFV  107



>gb|KDO48629.1| hypothetical protein CISIN_1g011010mg [Citrus sinensis]
Length=494

 Score =   212 bits (539),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 99/107 (93%), Positives = 107/107 (100%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLAQLGGSISRA+QQMSNATIIDEKVLNECLNEITRALLQ+DVQFKLVR+MQTNIK+IV
Sbjct  1    MVLAQLGGSISRAIQQMSNATIIDEKVLNECLNEITRALLQADVQFKLVREMQTNIKKIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NLDDLAAGHNKR+IIQQA+FNELCK+LDPGKPSFTPKKGKPSV+MFV
Sbjct  61   NLDDLAAGHNKRRIIQQAIFNELCKMLDPGKPSFTPKKGKPSVIMFV  107



>gb|KJB70636.1| hypothetical protein B456_011G084700 [Gossypium raimondii]
Length=496

 Score =   211 bits (538),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 101/107 (94%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLAQLGGSISRA+QQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIK+IV
Sbjct  1    MVLAQLGGSISRAIQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKKIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NLDDLAAGHNKRKIIQQA+FNELCK+LDPGKP+FTPKKGK SVVMFV
Sbjct  61   NLDDLAAGHNKRKIIQQAIFNELCKMLDPGKPAFTPKKGKTSVVMFV  107



>gb|KDP37062.1| hypothetical protein JCGZ_06118 [Jatropha curcas]
Length=495

 Score =   211 bits (537),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 101/107 (94%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLAQLGGSISRA+QQMSNATIIDEKVLN+CLNEITRALLQSDVQFKLVRDMQTNIK+IV
Sbjct  1    MVLAQLGGSISRAIQQMSNATIIDEKVLNDCLNEITRALLQSDVQFKLVRDMQTNIKKIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NLDDLAAGHNKRKIIQQA+FNELCK+LDPGKPSFTPKKGK SVVMFV
Sbjct  61   NLDDLAAGHNKRKIIQQAIFNELCKMLDPGKPSFTPKKGKTSVVMFV  107



>ref|XP_004290946.1| PREDICTED: signal recognition particle 54 kDa protein 2 [Fragaria 
vesca subsp. vesca]
Length=500

 Score =   211 bits (536),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 99/107 (93%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA+LGGSISRALQQMSNAT+IDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIK+IV
Sbjct  1    MVLAELGGSISRALQQMSNATVIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKKIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NL+DLAAGHNKR+IIQ A+FNELCK+LDPGKPSFTPKKGKPSVVMFV
Sbjct  61   NLEDLAAGHNKRRIIQNAIFNELCKMLDPGKPSFTPKKGKPSVVMFV  107



>ref|XP_011073411.1| PREDICTED: signal recognition particle 54 kDa protein 2 [Sesamum 
indicum]
Length=495

 Score =   210 bits (534),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 101/107 (94%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLAQLGGSISRALQQMSNATIIDEKVLN+CLNEITRALLQ+DVQFKLVRDMQ NIK+IV
Sbjct  1    MVLAQLGGSISRALQQMSNATIIDEKVLNDCLNEITRALLQADVQFKLVRDMQANIKKIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NLDDLAAGHNKRKIIQQA+FNELCKILDPGKPSFTPKKGK SVVMFV
Sbjct  61   NLDDLAAGHNKRKIIQQAIFNELCKILDPGKPSFTPKKGKTSVVMFV  107



>ref|XP_002517663.1| signal recognition particle 54 kD protein, putative [Ricinus 
communis]
 gb|EEF44827.1| signal recognition particle 54 kD protein, putative [Ricinus 
communis]
Length=497

 Score =   210 bits (534),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 100/107 (93%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLAQLGGSISRA+QQMSNATIIDEK LN+CLNEITRALLQSDVQFKLVRDMQTNIK+IV
Sbjct  1    MVLAQLGGSISRAIQQMSNATIIDEKALNDCLNEITRALLQSDVQFKLVRDMQTNIKKIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NLDDLAAGHNKRKIIQQA+FNELCK+LDPGKPSFTPKKGK SVVMFV
Sbjct  61   NLDDLAAGHNKRKIIQQAIFNELCKMLDPGKPSFTPKKGKTSVVMFV  107



>ref|XP_004506954.1| PREDICTED: signal recognition particle 54 kDa protein 2-like 
[Cicer arietinum]
Length=496

 Score =   209 bits (533),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 101/107 (94%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLAQLGGSISRALQQMSNATIIDEKVLN+CLNEITRALLQSDVQFKLVRDMQTNIK+IV
Sbjct  1    MVLAQLGGSISRALQQMSNATIIDEKVLNDCLNEITRALLQSDVQFKLVRDMQTNIKKIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NLDDLAAGHNKR+IIQQAVFNELCKILDPGKP+F PKKGK SVVMFV
Sbjct  61   NLDDLAAGHNKRRIIQQAVFNELCKILDPGKPAFAPKKGKASVVMFV  107



>ref|XP_009412494.1| PREDICTED: signal recognition particle 54 kDa protein 2 [Musa 
acuminata subsp. malaccensis]
Length=497

 Score =   209 bits (532),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 100/107 (93%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLAQLGGSI+RALQQMSNATIIDEKVL+ECLNEI+RALLQSDVQFKLVRDMQ NIKRIV
Sbjct  1    MVLAQLGGSIARALQQMSNATIIDEKVLSECLNEISRALLQSDVQFKLVRDMQANIKRIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NLDDLAAGHNKR+IIQQAVFNELCK+LDPGKPSFTPKKGK SVVMFV
Sbjct  61   NLDDLAAGHNKRRIIQQAVFNELCKMLDPGKPSFTPKKGKTSVVMFV  107



>ref|XP_007150766.1| hypothetical protein PHAVU_005G179000g [Phaseolus vulgaris]
 gb|ESW22760.1| hypothetical protein PHAVU_005G179000g [Phaseolus vulgaris]
Length=498

 Score =   209 bits (531),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 100/107 (93%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA+LGGSISRALQQMSNAT+IDEKVLN+CLN+ITRALLQSDVQFKLVRDMQTNIK IV
Sbjct  1    MVLAELGGSISRALQQMSNATVIDEKVLNDCLNDITRALLQSDVQFKLVRDMQTNIKNIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NLDDLAAGHNKR+IIQQAVFNELCKILDPGKPSFTPKKGK SVVMFV
Sbjct  61   NLDDLAAGHNKRRIIQQAVFNELCKILDPGKPSFTPKKGKTSVVMFV  107



>ref|XP_006373975.1| hypothetical protein POPTR_0016s12030g [Populus trichocarpa]
 ref|XP_011047423.1| PREDICTED: signal recognition particle 54 kDa protein 2 [Populus 
euphratica]
 gb|ERP51772.1| hypothetical protein POPTR_0016s12030g [Populus trichocarpa]
Length=495

 Score =   208 bits (530),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 99/107 (93%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA+LGGSISRA+QQMSNATIIDEK LN+CLNEITRALLQSDVQFKLVRDMQTNIK+IV
Sbjct  1    MVLAELGGSISRAIQQMSNATIIDEKALNDCLNEITRALLQSDVQFKLVRDMQTNIKKIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NLDDLAAGHNKRKIIQQA+FNELCK+LDPGKPSFTPKKGK SVVMFV
Sbjct  61   NLDDLAAGHNKRKIIQQAIFNELCKMLDPGKPSFTPKKGKTSVVMFV  107



>ref|XP_002322968.2| Signal recognition particle 54 kDa protein 1 [Populus trichocarpa]
 gb|EEF04729.2| Signal recognition particle 54 kDa protein 1 [Populus trichocarpa]
Length=493

 Score =   208 bits (530),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 99/107 (93%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA+LGGSISRA+QQMSNATIIDEK LN+CLNEITRALLQSDVQFKLVRDMQTNIK+IV
Sbjct  1    MVLAELGGSISRAIQQMSNATIIDEKALNDCLNEITRALLQSDVQFKLVRDMQTNIKKIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NLDDLAAGHNKRKIIQQA+FNELCK+LDPGKPSFTPKKGK SVVMFV
Sbjct  61   NLDDLAAGHNKRKIIQQAIFNELCKMLDPGKPSFTPKKGKTSVVMFV  107



>emb|CBI36349.3| unnamed protein product [Vitis vinifera]
Length=431

 Score =   207 bits (526),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 98/107 (92%), Positives = 104/107 (97%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVL++LGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIK++V
Sbjct  1    MVLSELGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKKLV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            N DDLAAGHNKRKIIQQA+F ELCK+LDPGKPSFTPKKGK SVVMFV
Sbjct  61   NFDDLAAGHNKRKIIQQAIFQELCKMLDPGKPSFTPKKGKTSVVMFV  107



>ref|XP_007135764.1| hypothetical protein PHAVU_010G156800g [Phaseolus vulgaris]
 gb|ESW07758.1| hypothetical protein PHAVU_010G156800g [Phaseolus vulgaris]
Length=495

 Score =   208 bits (530),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 100/107 (93%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA+LGGSISRALQQMSNATIIDEKVLN+CLN+ITRALLQSDVQFKLVR+MQTNIK IV
Sbjct  1    MVLAELGGSISRALQQMSNATIIDEKVLNDCLNDITRALLQSDVQFKLVREMQTNIKSIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NLDDLAAGHNKR+IIQQAVFNELCKILDPGKPSFTPKK KPSVVMFV
Sbjct  61   NLDDLAAGHNKRRIIQQAVFNELCKILDPGKPSFTPKKAKPSVVMFV  107



>emb|CDO98169.1| unnamed protein product [Coffea canephora]
Length=498

 Score =   208 bits (530),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 99/107 (93%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLAQLG SISRALQQMSNATIIDEKVLNECLNEITRALLQ+DVQFKLVRDMQTNIK+IV
Sbjct  1    MVLAQLGSSISRALQQMSNATIIDEKVLNECLNEITRALLQADVQFKLVRDMQTNIKKIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NLDDLAAGHNKR+IIQQA+FNELCK+LDPGKPSFTPKKGK S+VMFV
Sbjct  61   NLDDLAAGHNKRRIIQQAIFNELCKMLDPGKPSFTPKKGKTSIVMFV  107



>gb|KHN37996.1| Signal recognition particle 54 kDa protein 2 [Glycine soja]
Length=495

 Score =   208 bits (529),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 101/107 (94%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA+LGGSISRALQQMSNATIIDEKVLN+CLN+ITRALLQSDVQFKLVRDMQTNIK IV
Sbjct  1    MVLAELGGSISRALQQMSNATIIDEKVLNDCLNDITRALLQSDVQFKLVRDMQTNIKNIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NLDDLAAGHNKR+IIQQAVFNELCKILDPGKPSFT KKGKPSVVMFV
Sbjct  61   NLDDLAAGHNKRRIIQQAVFNELCKILDPGKPSFTLKKGKPSVVMFV  107



>ref|XP_003531722.1| PREDICTED: signal recognition particle 54 kDa protein 2-like 
isoform 1 [Glycine max]
Length=495

 Score =   208 bits (529),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 101/107 (94%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA+LGGSISRALQQMSNATIIDEKVLN+CLN+ITRALLQSDVQFKLVRDMQTNIK IV
Sbjct  1    MVLAELGGSISRALQQMSNATIIDEKVLNDCLNDITRALLQSDVQFKLVRDMQTNIKSIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NLDDLAAGHNKR+IIQQAVFNELCKILDPGKPSFT KKGKPSVVMFV
Sbjct  61   NLDDLAAGHNKRRIIQQAVFNELCKILDPGKPSFTLKKGKPSVVMFV  107



>gb|AGV54516.1| signal recognition particle 54 kDa protein 2 [Phaseolus vulgaris]
Length=496

 Score =   207 bits (528),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 100/107 (93%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA+LGGSISRALQQMSNAT+IDEKVLN+CLN+ITRALLQSDVQFKLVRDMQTNIK IV
Sbjct  1    MVLAELGGSISRALQQMSNATVIDEKVLNDCLNDITRALLQSDVQFKLVRDMQTNIKNIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NLDDLAAGHNKR+IIQQAVFNELCKILDPGKPSFTPKKGK SVVMFV
Sbjct  61   NLDDLAAGHNKRRIIQQAVFNELCKILDPGKPSFTPKKGKTSVVMFV  107



>ref|XP_003528309.1| PREDICTED: signal recognition particle 54 kDa protein 2 [Glycine 
max]
 gb|KHN01320.1| Signal recognition particle 54 kDa protein 2 [Glycine soja]
Length=495

 Score =   207 bits (527),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 100/107 (93%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA+LGGSISRALQQMSNATIIDEKVLN+CLN+ITRALLQSDVQFKLVRDMQTNIK IV
Sbjct  1    MVLAELGGSISRALQQMSNATIIDEKVLNDCLNDITRALLQSDVQFKLVRDMQTNIKNIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NL+DLAAGHNKR+IIQQAVFNELCKILDPGKPSFTPKKGK SVVMFV
Sbjct  61   NLEDLAAGHNKRRIIQQAVFNELCKILDPGKPSFTPKKGKTSVVMFV  107



>ref|XP_004235947.1| PREDICTED: signal recognition particle 54 kDa protein 1 [Solanum 
lycopersicum]
Length=496

 Score =   206 bits (525),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 99/107 (93%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQ+DVQFKLVRDM TNIK+IV
Sbjct  1    MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQADVQFKLVRDMSTNIKKIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NL+DLAAGHNKR+IIQQAV+NELCKILDPGKP+FT KKGKPSVVMFV
Sbjct  61   NLEDLAAGHNKRRIIQQAVYNELCKILDPGKPAFTLKKGKPSVVMFV  107



>ref|XP_006364228.1| PREDICTED: signal recognition particle 54 kDa protein 1-like 
[Solanum tuberosum]
Length=497

 Score =   206 bits (525),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 99/107 (93%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQ+DVQFKLVRDM TNIK+IV
Sbjct  1    MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQADVQFKLVRDMSTNIKKIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NL+DLAAGHNKR+IIQQAV+NELCKILDPGKP+FT KKGKPSVVMFV
Sbjct  61   NLEDLAAGHNKRRIIQQAVYNELCKILDPGKPAFTLKKGKPSVVMFV  107



>ref|XP_002264159.1| PREDICTED: signal recognition particle 54 kDa protein 2 [Vitis 
vinifera]
Length=495

 Score =   206 bits (525),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 98/107 (92%), Positives = 104/107 (97%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVL++LGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIK++V
Sbjct  1    MVLSELGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKKLV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            N DDLAAGHNKRKIIQQA+F ELCK+LDPGKPSFTPKKGK SVVMFV
Sbjct  61   NFDDLAAGHNKRKIIQQAIFQELCKMLDPGKPSFTPKKGKTSVVMFV  107



>ref|XP_002299799.2| Signal recognition particle 54 kDa protein 1 [Populus trichocarpa]
 gb|EEE84604.2| Signal recognition particle 54 kDa protein 1 [Populus trichocarpa]
Length=495

 Score =   206 bits (525),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 99/107 (93%), Positives = 104/107 (97%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLAQLGGSISRA+QQMSNATIIDEK LN+CLNEITRALLQSDVQFKLVRDMQTNIK+IV
Sbjct  1    MVLAQLGGSISRAIQQMSNATIIDEKALNDCLNEITRALLQSDVQFKLVRDMQTNIKKIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NLDDLAAGHNKR+IIQQA+FNELCKILDPGK SFTPKKGK SVVMFV
Sbjct  61   NLDDLAAGHNKRRIIQQAIFNELCKILDPGKSSFTPKKGKTSVVMFV  107



>sp|P49971.1|SR541_SOLLC RecName: Full=Signal recognition particle 54 kDa protein 1; Short=SRP54 
[Solanum lycopersicum]
 emb|CAA84275.1| 54-kD signal recognition particle (SRP) specific protein [Solanum 
lycopersicum]
Length=496

 Score =   206 bits (525),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 99/107 (93%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQ+DVQFKLVRDM TNIK+IV
Sbjct  1    MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQADVQFKLVRDMSTNIKKIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NL+DLAAGHNKR+IIQQAV+NELCKILDPGKP+FT KKGKPSVVMFV
Sbjct  61   NLEDLAAGHNKRRIIQQAVYNELCKILDPGKPAFTLKKGKPSVVMFV  107



>gb|ABK95819.1| unknown [Populus trichocarpa]
Length=495

 Score =   206 bits (525),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 99/107 (93%), Positives = 104/107 (97%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLAQLGGSISRA+QQMSNATIIDEK LN+CLNEITRALLQSDVQFKLVRDMQTNIK+IV
Sbjct  1    MVLAQLGGSISRAIQQMSNATIIDEKALNDCLNEITRALLQSDVQFKLVRDMQTNIKKIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NLDDLAAGHNKR+IIQQA+FNELCKILDPGK SFTPKKGK SVVMFV
Sbjct  61   NLDDLAAGHNKRRIIQQAIFNELCKILDPGKSSFTPKKGKTSVVMFV  107



>ref|XP_003604367.1| Signal recognition particle 54 kDa protein [Medicago truncatula]
 gb|AES86564.1| signal recognition particle 54 kDa protein [Medicago truncatula]
Length=496

 Score =   206 bits (524),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 99/107 (93%), Positives = 104/107 (97%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LGGSI+RAL+QMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIK+IV
Sbjct  1    MVLADLGGSITRALKQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKKIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NLDDLAAGHNKR+IIQQAVFNELC ILDPGKP+FTPKKGK SVVMFV
Sbjct  61   NLDDLAAGHNKRRIIQQAVFNELCNILDPGKPAFTPKKGKASVVMFV  107



>ref|XP_004486653.1| PREDICTED: signal recognition particle 54 kDa protein 2-like 
[Cicer arietinum]
Length=495

 Score =   206 bits (524),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 100/107 (93%), Positives = 104/107 (97%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLAQLG SISRALQQMSNATIIDEKVLN+CLNEITRALLQSDVQFKLVRDMQTNIK+IV
Sbjct  1    MVLAQLGESISRALQQMSNATIIDEKVLNDCLNEITRALLQSDVQFKLVRDMQTNIKKIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NLDDLAAGHNKRKIIQQAVFNELCK+LDPGKP+F PKKGK SVVMFV
Sbjct  61   NLDDLAAGHNKRKIIQQAVFNELCKMLDPGKPAFVPKKGKASVVMFV  107



>ref|XP_003543686.1| PREDICTED: signal recognition particle 54 kDa protein 2-like 
[Glycine max]
Length=500

 Score =   205 bits (521),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/107 (93%), Positives = 104/107 (97%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA+LGGSISRALQ MSNAT+IDEKVLN+CLN+ITRALLQSDVQFKLVRDMQTNIK IV
Sbjct  1    MVLAELGGSISRALQLMSNATVIDEKVLNDCLNDITRALLQSDVQFKLVRDMQTNIKNIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NLDDLAAGHNKR+IIQQAVFNELCKILDPGKPSFTPKKGK SVVMFV
Sbjct  61   NLDDLAAGHNKRRIIQQAVFNELCKILDPGKPSFTPKKGKTSVVMFV  107



>ref|XP_003545781.1| PREDICTED: signal recognition particle 54 kDa protein 2-like 
[Glycine max]
Length=499

 Score =   205 bits (521),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/107 (93%), Positives = 104/107 (97%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA+LGGSISRALQQMSNAT+IDEKVLN+CLN ITRALLQSDVQFKLVRD+QTNIK IV
Sbjct  1    MVLAELGGSISRALQQMSNATVIDEKVLNDCLNVITRALLQSDVQFKLVRDLQTNIKNIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NLDDLAAGHNKR+IIQQAVFNELCKILDPGKPSFTPKKGK SVVMFV
Sbjct  61   NLDDLAAGHNKRRIIQQAVFNELCKILDPGKPSFTPKKGKTSVVMFV  107



>gb|KHN22433.1| Signal recognition particle 54 kDa protein 2 [Glycine soja]
Length=500

 Score =   205 bits (521),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/107 (93%), Positives = 104/107 (97%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA+LGGSISRALQQMSNAT+IDEKVLN+CLN ITRALLQSDVQFKLVRD+QTNIK IV
Sbjct  1    MVLAELGGSISRALQQMSNATVIDEKVLNDCLNVITRALLQSDVQFKLVRDLQTNIKNIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NLDDLAAGHNKR+IIQQAVFNELCKILDPGKPSFTPKKGK SVVMFV
Sbjct  61   NLDDLAAGHNKRRIIQQAVFNELCKILDPGKPSFTPKKGKTSVVMFV  107



>ref|XP_010909951.1| PREDICTED: signal recognition particle 54 kDa protein 2 [Elaeis 
guineensis]
Length=494

 Score =   205 bits (521),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 96/107 (90%), Positives = 104/107 (97%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLAQLGGSISRALQ MSNATIIDEKVL+ECLNEI+RALLQ+DVQFK+VRDMQ NIKRIV
Sbjct  1    MVLAQLGGSISRALQHMSNATIIDEKVLSECLNEISRALLQADVQFKMVRDMQANIKRIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NLDDLAAGHNKR+IIQQA+FNELCK+LDPGKPSFTPKKGK SV+MFV
Sbjct  61   NLDDLAAGHNKRRIIQQAIFNELCKMLDPGKPSFTPKKGKTSVIMFV  107



>ref|XP_008775107.1| PREDICTED: signal recognition particle 54 kDa protein 2 [Phoenix 
dactylifera]
Length=494

 Score =   205 bits (521),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 96/107 (90%), Positives = 104/107 (97%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLAQLGGSISRALQ MSNATIIDEKVL+ECLNEI+RALLQ+DVQFK+VRDMQ NIKRIV
Sbjct  1    MVLAQLGGSISRALQHMSNATIIDEKVLSECLNEISRALLQADVQFKMVRDMQANIKRIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NLDDLAAGHNKR+IIQQA+FNELCK+LDPGKPSFTPKKGK SV+MFV
Sbjct  61   NLDDLAAGHNKRRIIQQAIFNELCKMLDPGKPSFTPKKGKTSVIMFV  107



>ref|XP_010691102.1| PREDICTED: signal recognition particle 54 kDa protein 2 [Beta 
vulgaris subsp. vulgaris]
Length=501

 Score =   204 bits (520),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 98/107 (92%), Positives = 104/107 (97%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQ+DVQFKLVRDM TNIK+IV
Sbjct  1    MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQADVQFKLVRDMTTNIKKIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NLDDLAAGHNKR+IIQQA+FNELCK+LD GKPSFT KKGKPSV+MFV
Sbjct  61   NLDDLAAGHNKRRIIQQAIFNELCKMLDAGKPSFTLKKGKPSVIMFV  107



>gb|KHN44189.1| Signal recognition particle 54 kDa protein 2 [Glycine soja]
Length=500

 Score =   204 bits (518),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 98/107 (92%), Positives = 104/107 (97%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA+LGGSI+RALQ MSNAT+IDEKVLN+CLN+ITRALLQSDVQFKLVRDMQTNIK IV
Sbjct  1    MVLAELGGSIARALQLMSNATVIDEKVLNDCLNDITRALLQSDVQFKLVRDMQTNIKNIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NLDDLAAGHNKR+IIQQAVFNELCKILDPGKPSFTPKKGK SVVMFV
Sbjct  61   NLDDLAAGHNKRRIIQQAVFNELCKILDPGKPSFTPKKGKTSVVMFV  107



>ref|XP_008809106.1| PREDICTED: signal recognition particle 54 kDa protein 2-like 
[Phoenix dactylifera]
Length=494

 Score =   202 bits (515),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 94/107 (88%), Positives = 104/107 (97%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            M LAQLGGSI+RAL+QMSNATIIDEKVL+ECLNEI+RALLQ+DVQFK+VRDMQTNIKRIV
Sbjct  1    MALAQLGGSIARALRQMSNATIIDEKVLSECLNEISRALLQADVQFKMVRDMQTNIKRIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            N DDLAAGHNKR+IIQQA+FNELCK+LDPGKPSFTPKKGK SV+MFV
Sbjct  61   NFDDLAAGHNKRRIIQQAIFNELCKMLDPGKPSFTPKKGKTSVIMFV  107



>ref|XP_010918260.1| PREDICTED: signal recognition particle 54 kDa protein 2-like 
[Elaeis guineensis]
Length=494

 Score =   202 bits (515),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 94/107 (88%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            M LAQLGGSI+RAL+QMSNATIIDEKVL+ECLNEI+RALLQ+DVQFK+VRDMQTNIKRIV
Sbjct  1    MALAQLGGSIARALRQMSNATIIDEKVLSECLNEISRALLQADVQFKMVRDMQTNIKRIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NL+DLAAGHNKR+IIQQA+FNELCK+LDPGKPSFTPKKGK SV+MFV
Sbjct  61   NLEDLAAGHNKRRIIQQAIFNELCKMLDPGKPSFTPKKGKTSVIMFV  107



>ref|XP_004301434.1| PREDICTED: signal recognition particle 54 kDa protein 2-like 
[Fragaria vesca subsp. vesca]
Length=493

 Score =   200 bits (509),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 102/107 (95%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA+LGGSIS ALQQMSNAT+IDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIK+IV
Sbjct  1    MVLAELGGSISLALQQMSNATVIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKKIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NL+ LAAGHNKR+IIQ A+FNELCK+LDPGKPSFTP KG PSVVMFV
Sbjct  61   NLEHLAAGHNKRRIIQNAIFNELCKMLDPGKPSFTPNKGNPSVVMFV  107



>ref|XP_010521537.1| PREDICTED: signal recognition particle 54 kDa protein 3 [Tarenaya 
hassleriana]
Length=495

 Score =   199 bits (507),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/107 (86%), Positives = 103/107 (96%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA+LGG I+RA+QQMSNATIIDEKVLNECLNEITRALLQSDV F LV++MQTNIK+IV
Sbjct  1    MVLAELGGRITRAIQQMSNATIIDEKVLNECLNEITRALLQSDVSFPLVKEMQTNIKKIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NLDDLAAGHNKR+IIQQA+FNELCK+LDPGKP+F PKKGKPS+VMFV
Sbjct  61   NLDDLAAGHNKRRIIQQAIFNELCKMLDPGKPAFAPKKGKPSIVMFV  107



>ref|XP_004970131.1| PREDICTED: signal recognition particle 54 kDa protein 2-like 
[Setaria italica]
Length=496

 Score =   197 bits (501),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 94/107 (88%), Positives = 102/107 (95%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLAQLGGSISRAL QMSNAT+IDEKVLN+CLNEI+RALLQSDVQFK+VRDMQTNIKRIV
Sbjct  1    MVLAQLGGSISRALAQMSNATVIDEKVLNDCLNEISRALLQSDVQFKMVRDMQTNIKRIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NL+ LAAG NKR+I+QQAVF ELC +LDPGKPSFTPKKGKPSVVMFV
Sbjct  61   NLEALAAGTNKRRIMQQAVFTELCNMLDPGKPSFTPKKGKPSVVMFV  107



>ref|NP_001142208.1| hypothetical protein [Zea mays]
 gb|ACF85227.1| unknown [Zea mays]
 gb|ACF87884.1| unknown [Zea mays]
 gb|AFW84938.1| hypothetical protein ZEAMMB73_989437 [Zea mays]
Length=496

 Score =   196 bits (498),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 93/107 (87%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLAQLGGSISRAL QMSNAT+IDEKVLNECLNEI+RALLQ+DVQFK+VRDMQ NIKRIV
Sbjct  1    MVLAQLGGSISRALAQMSNATVIDEKVLNECLNEISRALLQADVQFKMVRDMQANIKRIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NL+ LAAG NKR+I+QQAVF ELC +LDPGKPSFTPKKGKPSVVMFV
Sbjct  61   NLEALAAGTNKRRIMQQAVFTELCTMLDPGKPSFTPKKGKPSVVMFV  107



>sp|P49969.1|SR542_HORVU RecName: Full=Signal recognition particle 54 kDa protein 2; Short=SRP54 
[Hordeum vulgare]
 gb|AAA79355.1| signal recognition particle 54 kDa subunit [Hordeum vulgare]
 dbj|BAJ87255.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=497

 Score =   195 bits (495),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 92/107 (86%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLAQLGGSISRAL QMSNAT+IDEKVL ECLNEI+RALLQSDVQFK+VRDMQTNI++IV
Sbjct  1    MVLAQLGGSISRALAQMSNATVIDEKVLGECLNEISRALLQSDVQFKMVRDMQTNIRKIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NL+ LAAG NKR+IIQQAVF ELC +LDPGKP+FTPKKGKPSVVMFV
Sbjct  61   NLETLAAGTNKRRIIQQAVFTELCNMLDPGKPAFTPKKGKPSVVMFV  107



>gb|EMS65890.1| Signal recognition particle 54 kDa protein 2 [Triticum urartu]
Length=497

 Score =   195 bits (495),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/107 (86%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLAQLGGSISRAL QMSNAT+IDEKVL ECLNEI+RALLQSDVQFK+VRDMQTNI++IV
Sbjct  1    MVLAQLGGSISRALAQMSNATVIDEKVLGECLNEISRALLQSDVQFKMVRDMQTNIRKIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NL+ LAAG NKR+IIQQAVF ELC +LDPGKP+FTPKKGKPSVVMFV
Sbjct  61   NLETLAAGTNKRRIIQQAVFTELCNMLDPGKPAFTPKKGKPSVVMFV  107



>tpg|DAA57410.1| TPA: hypothetical protein ZEAMMB73_937725 [Zea mays]
Length=472

 Score =   194 bits (493),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/107 (86%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLAQLGGSISRAL QMSNAT+IDEKVLN+CLNEI+RALLQ+DVQFK+VRDMQ NIKRIV
Sbjct  1    MVLAQLGGSISRALAQMSNATVIDEKVLNDCLNEISRALLQADVQFKMVRDMQANIKRIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NL+ LAAG NKR+I+QQAVF ELC +LDPGKPSFTPKKGKPSVVMFV
Sbjct  61   NLEALAAGTNKRRIMQQAVFTELCNMLDPGKPSFTPKKGKPSVVMFV  107



>ref|XP_003568147.1| PREDICTED: signal recognition particle 54 kDa protein 2 [Brachypodium 
distachyon]
Length=498

 Score =   194 bits (494),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/107 (86%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLAQLGGSISRALQQMSNAT+IDEKVL ECLNEI+RALLQSDVQFK+VRDMQ NI++IV
Sbjct  1    MVLAQLGGSISRALQQMSNATVIDEKVLGECLNEISRALLQSDVQFKMVRDMQANIRKIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NL+ LAAG NKR+IIQQAVFNELC +LDPGKP+F PKKGKPSVVMFV
Sbjct  61   NLEALAAGTNKRRIIQQAVFNELCNMLDPGKPAFIPKKGKPSVVMFV  107



>gb|EMT01441.1| Signal recognition particle 54 kDa protein 2 [Aegilops tauschii]
Length=497

 Score =   194 bits (494),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/107 (86%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLAQLGGSISRAL QMSNAT+IDEKVL ECLNEI+RALLQSDVQFK+VRDMQTNI++IV
Sbjct  1    MVLAQLGGSISRALAQMSNATVIDEKVLGECLNEISRALLQSDVQFKMVRDMQTNIRKIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NL+ LAAG NKR+IIQQAVF ELC +LDPGKP+FTPKKGKPSVVMFV
Sbjct  61   NLETLAAGTNKRRIIQQAVFTELCNMLDPGKPAFTPKKGKPSVVMFV  107



>ref|XP_004305069.1| PREDICTED: signal recognition particle 54 kDa protein 2-like 
[Fragaria vesca subsp. vesca]
Length=483

 Score =   194 bits (493),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/107 (85%), Positives = 102/107 (95%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA+L G ISRALQQMSNAT+IDEKVLN+CLNEITRALLQSDVQFKLVRDMQTNIK+IV
Sbjct  1    MVLAELQGRISRALQQMSNATVIDEKVLNDCLNEITRALLQSDVQFKLVRDMQTNIKKIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NL+D+AAGHNKR+IIQ A+ NELC++LDPGKPSFTP KGKP+VVMFV
Sbjct  61   NLEDVAAGHNKRRIIQNAISNELCRMLDPGKPSFTPNKGKPNVVMFV  107



>ref|XP_002456424.1| hypothetical protein SORBIDRAFT_03g036030 [Sorghum bicolor]
 gb|EES01544.1| hypothetical protein SORBIDRAFT_03g036030 [Sorghum bicolor]
Length=496

 Score =   194 bits (493),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/107 (86%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLAQLGGSISRAL QMSNAT+IDEKVLN+CLNEI+RALLQ+DVQFK+VRDMQ NIKRIV
Sbjct  1    MVLAQLGGSISRALAQMSNATVIDEKVLNDCLNEISRALLQADVQFKMVRDMQANIKRIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NL+ LAAG NKR+I+QQAVF ELC +LDPGKPSFTPKKGKPSVVMFV
Sbjct  61   NLEALAAGTNKRRIMQQAVFTELCNMLDPGKPSFTPKKGKPSVVMFV  107



>ref|NP_001183903.1| hypothetical protein [Zea mays]
 gb|ACR38713.1| unknown [Zea mays]
 tpg|DAA57411.1| TPA: hypothetical protein ZEAMMB73_937725 [Zea mays]
Length=494

 Score =   194 bits (493),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/107 (86%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLAQLGGSISRAL QMSNAT+IDEKVLN+CLNEI+RALLQ+DVQFK+VRDMQ NIKRIV
Sbjct  1    MVLAQLGGSISRALAQMSNATVIDEKVLNDCLNEISRALLQADVQFKMVRDMQANIKRIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NL+ LAAG NKR+I+QQAVF ELC +LDPGKPSFTPKKGKPSVVMFV
Sbjct  61   NLEALAAGTNKRRIMQQAVFTELCNMLDPGKPSFTPKKGKPSVVMFV  107



>gb|EEC71559.1| hypothetical protein OsI_03915 [Oryza sativa Indica Group]
Length=496

 Score =   193 bits (490),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 92/107 (86%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLAQLGGSISRAL QMSNAT+IDEKVL++CLNEI+RALLQSDVQFK+VRDMQ+NIKRIV
Sbjct  1    MVLAQLGGSISRALAQMSNATVIDEKVLSDCLNEISRALLQSDVQFKMVRDMQSNIKRIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NL+ LAAG NKR+IIQQAVF ELC +LDPGKPSFTPKKGKP VVMFV
Sbjct  61   NLETLAAGTNKRRIIQQAVFTELCNMLDPGKPSFTPKKGKPCVVMFV  107



>ref|NP_001044395.1| Os01g0772800 [Oryza sativa Japonica Group]
 dbj|BAB89854.1| putative signal recognition particle 54kD protein [Oryza sativa 
Japonica Group]
 dbj|BAC03250.1| putative signal recognition particle 54kD protein [Oryza sativa 
Japonica Group]
 dbj|BAC79360.1| signal recognition particle 54kDa subunit [Oryza sativa Japonica 
Group]
 dbj|BAF06309.1| Os01g0772800 [Oryza sativa Japonica Group]
 dbj|BAH00208.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE55463.1| hypothetical protein OsJ_03626 [Oryza sativa Japonica Group]
Length=496

 Score =   193 bits (490),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 92/107 (86%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLAQLGGSISRAL QMSNAT+IDEKVL++CLNEI+RALLQSDVQFK+VRDMQ+NIKRIV
Sbjct  1    MVLAQLGGSISRALAQMSNATVIDEKVLSDCLNEISRALLQSDVQFKMVRDMQSNIKRIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NL+ LAAG NKR+IIQQAVF ELC +LDPGKPSFTPKKGKP VVMFV
Sbjct  61   NLETLAAGTNKRRIIQQAVFTELCNMLDPGKPSFTPKKGKPCVVMFV  107



>ref|XP_006644784.1| PREDICTED: signal recognition particle 54 kDa protein 2-like 
[Oryza brachyantha]
Length=496

 Score =   192 bits (489),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 92/107 (86%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLAQLGGSISRAL QMSNAT+IDEKVL++CLNEI+RALLQSDVQFK+VRDMQ NIKRIV
Sbjct  1    MVLAQLGGSISRALAQMSNATVIDEKVLSDCLNEISRALLQSDVQFKMVRDMQANIKRIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NL+ LAAG NKR+IIQQAVF ELC +LDPGKPSFTPKKGKP VVMFV
Sbjct  61   NLETLAAGTNKRRIIQQAVFTELCNMLDPGKPSFTPKKGKPCVVMFV  107



>ref|XP_010063480.1| PREDICTED: signal recognition particle 54 kDa protein 2 isoform 
X2 [Eucalyptus grandis]
 gb|KCW70720.1| hypothetical protein EUGRSUZ_F03884 [Eucalyptus grandis]
Length=495

 Score =   192 bits (488),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 88/107 (82%), Positives = 102/107 (95%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLAQLGG+I+RA+QQMSNATIIDEKVLNECLNEI RALL +DVQF+LVR+MQ NIKRIV
Sbjct  1    MVLAQLGGTITRAIQQMSNATIIDEKVLNECLNEINRALLNADVQFQLVRNMQNNIKRIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            N++DLAAGHNKR+IIQQA+FNELC +LDPGKP+FTPKKGK S++MFV
Sbjct  61   NIEDLAAGHNKRRIIQQAIFNELCNMLDPGKPAFTPKKGKTSIIMFV  107



>ref|XP_010063479.1| PREDICTED: signal recognition particle 54 kDa protein 2 isoform 
X1 [Eucalyptus grandis]
Length=499

 Score =   192 bits (488),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/107 (82%), Positives = 102/107 (95%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLAQLGG+I+RA+QQMSNATIIDEKVLNECLNEI RALL +DVQF+LVR+MQ NIKRIV
Sbjct  1    MVLAQLGGTITRAIQQMSNATIIDEKVLNECLNEINRALLNADVQFQLVRNMQNNIKRIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            N++DLAAGHNKR+IIQQA+FNELC +LDPGKP+FTPKKGK S++MFV
Sbjct  61   NIEDLAAGHNKRRIIQQAIFNELCNMLDPGKPAFTPKKGKTSIIMFV  107



>sp|P49968.1|SR541_HORVU RecName: Full=Signal recognition particle 54 kDa protein 1; Short=SRP54 
[Hordeum vulgare]
 gb|AAA79354.1| signal recognition particle 54 kDa subunit [Hordeum vulgare]
Length=497

 Score =   191 bits (486),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/107 (85%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLAQLGGSISRAL QMSNAT+IDEKVL ECLNEI+RALLQSDVQFK+VRDMQTNI++IV
Sbjct  1    MVLAQLGGSISRALAQMSNATVIDEKVLGECLNEISRALLQSDVQFKMVRDMQTNIRKIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NL+ LAAG NKR+IIQQAVF ELC +LDPGKP+FT KKGKPSVVMFV
Sbjct  61   NLETLAAGTNKRRIIQQAVFTELCNMLDPGKPAFTTKKGKPSVVMFV  107



>ref|XP_006844238.1| hypothetical protein AMTR_s00006p00268250 [Amborella trichopoda]
 gb|ERN05913.1| hypothetical protein AMTR_s00006p00268250 [Amborella trichopoda]
Length=495

 Score =   191 bits (484),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 88/107 (82%), Positives = 103/107 (96%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLAQLGGSI+RALQQMSNATIIDEKVL++CLNEI+RALLQ+DVQFK+VR+MQ NIKRIV
Sbjct  1    MVLAQLGGSIARALQQMSNATIIDEKVLSDCLNEISRALLQADVQFKMVREMQLNIKRIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            + D+LAAGHNKR+IIQ+A+F+ELC +LDPGKPS+TPKKGK SVVMFV
Sbjct  61   SFDELAAGHNKRRIIQKAIFDELCNMLDPGKPSYTPKKGKTSVVMFV  107



>ref|XP_006857528.1| hypothetical protein AMTR_s00061p00029690 [Amborella trichopoda]
 gb|ERN18995.1| hypothetical protein AMTR_s00061p00029690 [Amborella trichopoda]
Length=495

 Score =   191 bits (484),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 88/107 (82%), Positives = 103/107 (96%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLAQLGGSI+RALQQMSNATIIDEKVL++CLNEI+RALLQ+DVQFK+VR+MQ NIKRIV
Sbjct  1    MVLAQLGGSIARALQQMSNATIIDEKVLSDCLNEISRALLQADVQFKMVREMQLNIKRIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            + D+LAAGHNKR+IIQ+A+F+ELC +LDPGKPS+TPKKGK SVVMFV
Sbjct  61   SFDELAAGHNKRRIIQKAIFDELCNMLDPGKPSYTPKKGKTSVVMFV  107



>gb|EYU21664.1| hypothetical protein MIMGU_mgv1a005153mg [Erythranthe guttata]
Length=495

 Score =   190 bits (483),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 102/107 (95%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA+LGGSISRALQQMSNATIIDEKVLN+CLNEITRALLQ+DVQF LVRDM+ NIK+IV
Sbjct  1    MVLAELGGSISRALQQMSNATIIDEKVLNDCLNEITRALLQADVQFMLVRDMKNNIKKIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NL++LAAGHNKR+IIQ+A++NELCKILDPGKPSF  KKGK S+VMFV
Sbjct  61   NLEELAAGHNKRRIIQEAIYNELCKILDPGKPSFALKKGKTSIVMFV  107



>ref|XP_010479315.1| PREDICTED: signal recognition particle 54 kDa protein 3-like 
[Camelina sativa]
Length=495

 Score =   189 bits (481),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/107 (81%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA+LGG I+RA+QQMSN TIIDEK LNECLNEITRALLQSDV F LV++MQTNIK+IV
Sbjct  1    MVLAELGGRITRAIQQMSNVTIIDEKALNECLNEITRALLQSDVSFPLVKEMQTNIKKIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NL+DLAAGHNKR+II+QA+F+ELCK+LDPGKP+F PKK KPSVVMFV
Sbjct  61   NLEDLAAGHNKRRIIEQAIFSELCKMLDPGKPAFAPKKAKPSVVMFV  107



>ref|XP_010500428.1| PREDICTED: signal recognition particle 54 kDa protein 3 [Camelina 
sativa]
 ref|XP_010461733.1| PREDICTED: signal recognition particle 54 kDa protein 3 [Camelina 
sativa]
Length=495

 Score =   189 bits (481),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/107 (81%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA+LGG I+RA+QQMSN TIIDEK LNECLNEITRALLQSDV F LV++MQTNIK+IV
Sbjct  1    MVLAELGGRITRAIQQMSNVTIIDEKALNECLNEITRALLQSDVSFPLVKEMQTNIKKIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NL+DLAAGHNKR+II+QA+F+ELCK+LDPGKP+F PKK KPSVVMFV
Sbjct  61   NLEDLAAGHNKRRIIEQAIFSELCKMLDPGKPAFAPKKAKPSVVMFV  107



>gb|EPS68116.1| hypothetical protein M569_06658, partial [Genlisea aurea]
Length=491

 Score =   189 bits (479),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA+LGGSI+RALQQMSNATIIDEKVLN+CLN+I+RALL +DV FKL+ DM+ NIK+IV
Sbjct  1    MVLAELGGSITRALQQMSNATIIDEKVLNDCLNDISRALLTADVNFKLLADMRANIKKIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NLDDLAAGHNKRKIIQQAVFNELC+ILD GKP+FTPKKGK S+VMFV
Sbjct  61   NLDDLAAGHNKRKIIQQAVFNELCRILDAGKPAFTPKKGKTSIVMFV  107



>ref|XP_006307324.1| hypothetical protein CARUB_v10008947mg [Capsella rubella]
 gb|EOA40222.1| hypothetical protein CARUB_v10008947mg [Capsella rubella]
Length=495

 Score =   189 bits (479),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 86/107 (80%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA+LGG I+RA+QQMSN TIIDEK LNECLNEITRALLQSDV F LV++MQTNIK+IV
Sbjct  1    MVLAELGGRITRAIQQMSNVTIIDEKALNECLNEITRALLQSDVSFPLVKEMQTNIKKIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NL+DLAAGHNKR+II+QA+F+ELCK+LDPGKP+F PKK KPS+VMFV
Sbjct  61   NLEDLAAGHNKRRIIEQAIFSELCKMLDPGKPAFAPKKAKPSIVMFV  107



>gb|KFK43787.1| hypothetical protein AALP_AA1G172500 [Arabis alpina]
Length=495

 Score =   188 bits (478),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 86/107 (80%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA+LGG I+RALQQM+N TIIDEK LNECLNEITRALLQSDV F LV++MQTNIK+IV
Sbjct  1    MVLAELGGRITRALQQMANVTIIDEKALNECLNEITRALLQSDVSFPLVKEMQTNIKKIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NL+DLAAGHNKR+II+QA+F+ELCK+LDPGKP+F PKK KPS+VMFV
Sbjct  61   NLEDLAAGHNKRRIIEQAIFSELCKMLDPGKPAFAPKKAKPSIVMFV  107



>gb|EYU33587.1| hypothetical protein MIMGU_mgv1a005138mg [Erythranthe guttata]
Length=495

 Score =   188 bits (478),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLAQLGGSISRA+QQM+NATIIDEKVLN+CLNEITRALLQ+DVQF LVR+MQTNIK+IV
Sbjct  1    MVLAQLGGSISRAIQQMNNATIIDEKVLNDCLNEITRALLQADVQFTLVRNMQTNIKKIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            + D LAAGHNKR II+QA+  ELCKILDPGKPSF PKKGK SVVMFV
Sbjct  61   DFDALAAGHNKRNIIKQAILKELCKILDPGKPSFAPKKGKTSVVMFV  107



>gb|KCW82796.1| hypothetical protein EUGRSUZ_C04171 [Eucalyptus grandis]
Length=386

 Score =   185 bits (470),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 84/107 (79%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLAQLGG+I+RA++QM+NATI+D+KVLNECLNEI RALL +DV+F+LVRDM  N+KRIV
Sbjct  1    MVLAQLGGTITRAIRQMNNATIVDQKVLNECLNEINRALLNADVRFQLVRDMHNNVKRIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            N DDLAAGHNKR IIQQA+FNELC +LDPGKPSFTP+KGK SV+MFV
Sbjct  61   NFDDLAAGHNKRTIIQQAIFNELCNMLDPGKPSFTPQKGKTSVIMFV  107



>ref|XP_006393333.1| hypothetical protein EUTSA_v10011882mg [Eutrema salsugineum]
 gb|ESQ30619.1| hypothetical protein EUTSA_v10011882mg [Eutrema salsugineum]
Length=111

 Score =   176 bits (447),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVL +L G I+RALQQMSN TIIDEK LN+CLNEITRALLQSDV F LVR+MQ+NIK+IV
Sbjct  1    MVLGELCGQITRALQQMSNVTIIDEKALNDCLNEITRALLQSDVSFALVREMQSNIKKIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NL++LA GHNKR+II+QA+F ELCK+LDPGKP+F PKK K SVVMFV
Sbjct  61   NLEELATGHNKRRIIEQAIFTELCKMLDPGKPAFAPKKAKASVVMFV  107



>ref|XP_010041812.1| PREDICTED: signal recognition particle 54 kDa protein 2-like 
[Eucalyptus grandis]
Length=271

 Score =   181 bits (459),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 81/107 (76%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLAQLGG+I+RA++QMSNAT++D+KVLNECLNEI  ALL +DV+F+LVRDM  N+KRIV
Sbjct  1    MVLAQLGGTITRAIRQMSNATVVDQKVLNECLNEINWALLNADVRFQLVRDMHNNVKRIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            N DDLAAGHNKR+IIQQA+FNELC +LDP  PSFTP+KGK SV+MFV
Sbjct  61   NFDDLAAGHNKRRIIQQAIFNELCNVLDPRTPSFTPQKGKTSVIMFV  107



>ref|XP_006280359.1| hypothetical protein CARUB_v10026286mg [Capsella rubella]
 gb|EOA13257.1| hypothetical protein CARUB_v10026286mg [Capsella rubella]
Length=494

 Score =   186 bits (472),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/107 (79%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA+LGG ISRA+QQM+N TIIDEK LN+CLNEITRALLQSDV F LV+DMQTNIK+IV
Sbjct  1    MVLAELGGRISRAIQQMNNVTIIDEKALNDCLNEITRALLQSDVSFPLVKDMQTNIKKIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NL++LA+GHNKR+II+QA+FNELCK+LDPGKP+F+PKK KP VVMFV
Sbjct  61   NLEELASGHNKRRIIEQAIFNELCKMLDPGKPAFSPKKAKPCVVMFV  107



>ref|XP_010049962.1| PREDICTED: signal recognition particle 54 kDa protein 2-like 
[Eucalyptus grandis]
 gb|KCW82795.1| hypothetical protein EUGRSUZ_C04171 [Eucalyptus grandis]
Length=479

 Score =   186 bits (471),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/107 (79%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLAQLGG+I+RA++QM+NATI+D+KVLNECLNEI RALL +DV+F+LVRDM  N+KRIV
Sbjct  1    MVLAQLGGTITRAIRQMNNATIVDQKVLNECLNEINRALLNADVRFQLVRDMHNNVKRIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            N DDLAAGHNKR IIQQA+FNELC +LDPGKPSFTP+KGK SV+MFV
Sbjct  61   NFDDLAAGHNKRTIIQQAIFNELCNMLDPGKPSFTPQKGKTSVIMFV  107



>ref|NP_001077690.1| signal recognition particle subunit SRP54  [Arabidopsis thaliana]
 gb|AEE32364.1| signal recognition particle subunit SRP54 [Arabidopsis thaliana]
Length=431

 Score =   184 bits (468),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/107 (79%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA+LGG I+RA+QQMSN TIIDEK LNECLNEITRALLQSDV F LV++MQ+NIK+IV
Sbjct  1    MVLAELGGRITRAIQQMSNVTIIDEKALNECLNEITRALLQSDVSFPLVKEMQSNIKKIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NL+DLAAGHNKR+II+QA+F+ELCK+LDPGKP+F PKK K SVVMFV
Sbjct  61   NLEDLAAGHNKRRIIEQAIFSELCKMLDPGKPAFAPKKAKASVVMFV  107



>dbj|BAH56850.1| AT1G48900 [Arabidopsis thaliana]
Length=450

 Score =   184 bits (468),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 85/107 (79%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA+LGG I+RA+QQMSN TIIDEK LNECLNEITRALLQSDV F LV++MQ+NIK+IV
Sbjct  1    MVLAELGGRITRAIQQMSNVTIIDEKALNECLNEITRALLQSDVSFPLVKEMQSNIKKIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NL+DLAAGHNKR+II+QA+F+ELCK+LDPGKP+F PKK K SVVMFV
Sbjct  61   NLEDLAAGHNKRRIIEQAIFSELCKMLDPGKPAFAPKKAKASVVMFV  107



>ref|NP_564535.1| signal recognition particle subunit SRP54  [Arabidopsis thaliana]
 sp|P49967.2|SR543_ARATH RecName: Full=Signal recognition particle 54 kDa protein 3; Short=SRP54 
[Arabidopsis thaliana]
 gb|AAL38597.1|AF446864_1 At1g48900/F27K7_8 [Arabidopsis thaliana]
 gb|AAK96524.1| At1g48900/F27K7_8 [Arabidopsis thaliana]
 gb|AAL06932.1| At1g48900/F27K7_8 [Arabidopsis thaliana]
 gb|AEE32363.1| signal recognition particle subunit SRP54 [Arabidopsis thaliana]
Length=495

 Score =   184 bits (468),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 85/107 (79%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA+LGG I+RA+QQMSN TIIDEK LNECLNEITRALLQSDV F LV++MQ+NIK+IV
Sbjct  1    MVLAELGGRITRAIQQMSNVTIIDEKALNECLNEITRALLQSDVSFPLVKEMQSNIKKIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NL+DLAAGHNKR+II+QA+F+ELCK+LDPGKP+F PKK K SVVMFV
Sbjct  61   NLEDLAAGHNKRRIIEQAIFSELCKMLDPGKPAFAPKKAKASVVMFV  107



>ref|XP_002894146.1| signal recognition particle 54 kDa protein 3 [Arabidopsis lyrata 
subsp. lyrata]
 ref|XP_002894147.1| signal recognition particle 54 kDa protein 3 [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH70405.1| signal recognition particle 54 kDa protein 3 [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH70406.1| signal recognition particle 54 kDa protein 3 [Arabidopsis lyrata 
subsp. lyrata]
Length=496

 Score =   184 bits (468),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 85/107 (79%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA+LGG I+RA+QQMSN TIIDEK LNECLNEITRALLQSDV F LV++MQ+NIK+IV
Sbjct  1    MVLAELGGRITRAIQQMSNVTIIDEKALNECLNEITRALLQSDVSFPLVKEMQSNIKKIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NL+DLAAGHNKR+II+QA+F+ELCK+LDPGKP+F PKK K SVVMFV
Sbjct  61   NLEDLAAGHNKRRIIEQAIFSELCKMLDPGKPAFAPKKAKASVVMFV  107



>gb|AAG29734.1|AC084414_2 signal recognition particle 54 kDa protein 2 (SRP54), putative 
[Arabidopsis thaliana]
Length=522

 Score =   184 bits (468),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/107 (79%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA+LGG I+RA+QQMSN TIIDEK LNECLNEITRALLQSDV F LV++MQ+NIK+IV
Sbjct  1    MVLAELGGRITRAIQQMSNVTIIDEKALNECLNEITRALLQSDVSFPLVKEMQSNIKKIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NL+DLAAGHNKR+II+QA+F+ELCK+LDPGKP+F PKK K SVVMFV
Sbjct  61   NLEDLAAGHNKRRIIEQAIFSELCKMLDPGKPAFAPKKAKASVVMFV  107



>gb|AAA66200.1| signal recognition particle 54 kDa subunit [Arabidopsis thaliana]
Length=495

 Score =   184 bits (466),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/107 (79%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA+LGG I+RA+QQMSN TIIDEK LNECLNEITRALLQSDV F LV++MQ+NIK+IV
Sbjct  1    MVLAELGGGITRAIQQMSNVTIIDEKALNECLNEITRALLQSDVSFPLVKEMQSNIKKIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NL+DLAAGHNKR+II+QA+F+ELCK+LDPGKP+F PKK K SVVMFV
Sbjct  61   NLEDLAAGHNKRRIIEQAIFSELCKMLDPGKPAFAPKKRKASVVMFV  107



>ref|XP_009148918.1| PREDICTED: signal recognition particle 54 kDa protein 3-like 
[Brassica rapa]
Length=479

 Score =   183 bits (465),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 83/107 (78%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA+LGG I+ A+ QM NATIIDEK LNECLNEITRALLQSDV F LV++MQTNIK+IV
Sbjct  1    MVLAELGGRITHAIHQMRNATIIDEKALNECLNEITRALLQSDVSFSLVKEMQTNIKKIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NL DL+AGHNKR+II+QA+F+ELCK+LDPGKP+F+PKK KPS+VMFV
Sbjct  61   NLQDLSAGHNKRRIIEQAIFSELCKMLDPGKPAFSPKKTKPSIVMFV  107



>ref|XP_002987279.1| hypothetical protein SELMODRAFT_158663 [Selaginella moellendorffii]
 ref|XP_002989204.1| hypothetical protein SELMODRAFT_272046 [Selaginella moellendorffii]
 gb|EFJ09798.1| hypothetical protein SELMODRAFT_272046 [Selaginella moellendorffii]
 gb|EFJ11594.1| hypothetical protein SELMODRAFT_158663 [Selaginella moellendorffii]
Length=491

 Score =   184 bits (466),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/107 (79%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA+LGG ISRALQ+M+NAT+IDEKVL  CLNEI+RAL Q+DVQ K+V+ M TNIK+IV
Sbjct  1    MVLAELGGRISRALQEMTNATVIDEKVLTACLNEISRALFQADVQLKMVQTMCTNIKKIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NL+DLAAGHNKR+IIQQAVFNELC +LDPGKPSF+P+KGKPSV+MFV
Sbjct  61   NLEDLAAGHNKRRIIQQAVFNELCSMLDPGKPSFSPQKGKPSVIMFV  107



>ref|XP_006393335.1| hypothetical protein EUTSA_v10011425mg [Eutrema salsugineum]
 gb|ESQ30621.1| hypothetical protein EUTSA_v10011425mg [Eutrema salsugineum]
Length=495

 Score =   184 bits (466),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/107 (79%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVL +LGG I+RALQQMSN TIIDEK LNECLNEITRALLQSDV F LVR+MQ+NIK+IV
Sbjct  1    MVLGELGGRITRALQQMSNVTIIDEKALNECLNEITRALLQSDVSFALVREMQSNIKKIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NL++LAAGHNKR+II+QA+F ELCK+LDPGKP+F PKK K SVVMFV
Sbjct  61   NLEELAAGHNKRRIIEQAIFTELCKMLDPGKPAFAPKKAKASVVMFV  107



>emb|CDY36546.1| BnaA06g09990D [Brassica napus]
Length=479

 Score =   183 bits (464),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/107 (79%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA+LGG I+ A+ QM N TIIDEK LNECLNEITRALLQSDV F LV++MQTNIK+IV
Sbjct  1    MVLAELGGRITHAIHQMRNVTIIDEKALNECLNEITRALLQSDVSFALVKEMQTNIKKIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NL DLAAGHNKR+II+QA+F ELCK+LDPGKP+F PKK KPSVVMFV
Sbjct  61   NLQDLAAGHNKRRIIEQAIFGELCKMLDPGKPAFAPKKAKPSVVMFV  107



>ref|XP_010497009.1| PREDICTED: signal recognition particle 54 kDa protein 1 isoform 
X1 [Camelina sativa]
Length=479

 Score =   182 bits (461),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 84/107 (79%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA+LG  I+ A+QQM+N TIIDEK LN+CLNEITRALLQSDV F LV++MQTNIK+IV
Sbjct  1    MVLAELGSRITHAIQQMNNVTIIDEKALNDCLNEITRALLQSDVSFPLVKEMQTNIKKIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NL DLAAGHNKR+II+QA+FNELCK+LDPGKP+F PKK KPSVVMFV
Sbjct  61   NLRDLAAGHNKRRIIEQAIFNELCKMLDPGKPAFAPKKAKPSVVMFV  107



>ref|XP_010476615.1| PREDICTED: signal recognition particle 54 kDa protein 1-like 
[Camelina sativa]
Length=479

 Score =   181 bits (459),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 83/107 (78%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA+LG  I++A+QQM+N TIIDEK LN+CLNEITRALLQSDV F LV++MQTNIK+IV
Sbjct  1    MVLAELGSRITQAIQQMNNVTIIDEKALNDCLNEITRALLQSDVSFPLVKEMQTNIKKIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NL DLAAGHNKR+II+QA+FNELCK+LDPGKP+F+PKK KP VVMFV
Sbjct  61   NLRDLAAGHNKRRIIEQAIFNELCKMLDPGKPAFSPKKAKPGVVMFV  107



>ref|XP_009107330.1| PREDICTED: signal recognition particle 54 kDa protein 3-like 
[Brassica rapa]
Length=496

 Score =   180 bits (457),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 83/107 (78%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA+LGG I+ ALQ+MSN TIIDEK LNECL EITRALL SDV F LVR+MQ NIK+IV
Sbjct  1    MVLAELGGQIASALQKMSNVTIIDEKALNECLKEITRALLHSDVSFPLVREMQNNIKKIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NL++LAAGHNKR+II+QA+F+ELCK+LDPGKP+F+PKK KPSVVMFV
Sbjct  61   NLEELAAGHNKRRIIEQAIFSELCKMLDPGKPAFSPKKAKPSVVMFV  107



>emb|CDY40616.1| BnaC06g02320D [Brassica napus]
 emb|CDX93702.1| BnaA06g03460D [Brassica napus]
Length=495

 Score =   180 bits (457),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 83/107 (78%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA+LGG I+ ALQ+MSN TIIDEK LNECL EITRALL SDV F LVR+MQ NIK+IV
Sbjct  1    MVLAELGGQIASALQKMSNVTIIDEKALNECLKEITRALLHSDVSFPLVREMQNNIKKIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NL++LAAGHNKR+II+QA+F+ELCK+LDPGKP+F+PKK KPSVVMFV
Sbjct  61   NLEELAAGHNKRRIIEQAIFSELCKMLDPGKPAFSPKKAKPSVVMFV  107



>ref|NP_563970.1| signal recognition particle protein SRP54A [Arabidopsis thaliana]
 sp|P37106.1|SR541_ARATH RecName: Full=Signal recognition particle 54 kDa protein 1; Short=SRP54 
[Arabidopsis thaliana]
 gb|AAD39659.1|AC007591_24 Identical to gb|L19997 signal recognition particle 54 kDa subunit 
(Srp54-1) from Arabidopsis thaliana. ESTs gb|T88590 and 
gb|T20603 come from this gene [Arabidopsis thaliana]
 gb|AAK06880.1|AF344329_1 unknown protein [Arabidopsis thaliana]
 gb|AAA19728.1| signal recognition particle 54 kDa subunit [Arabidopsis thaliana]
 gb|AAM64266.1| signal recognition particle 54 kDa protein 2 (SRP54), putative 
[Arabidopsis thaliana]
 dbj|BAD95382.1| putative signal recognition particle 54 kDa subunit [Arabidopsis 
thaliana]
 gb|AEE29301.1| Signal recognition particle protein 1 [Arabidopsis thaliana]
Length=479

 Score =   179 bits (455),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 85/107 (79%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA+LGG I+RA+QQM+N TIIDEKVLN+ LNEITRALLQSDV F LV  MQTNIK+IV
Sbjct  1    MVLAELGGRITRAIQQMNNVTIIDEKVLNDFLNEITRALLQSDVSFGLVEKMQTNIKKIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NLDDLAAGHNKR II+QA+F ELC++LDPGKP+F PKK KPSVVMFV
Sbjct  61   NLDDLAAGHNKRLIIEQAIFKELCRMLDPGKPAFAPKKAKPSVVMFV  107



>ref|XP_009147933.1| PREDICTED: signal recognition particle 54 kDa protein 3 [Brassica 
rapa]
Length=495

 Score =   180 bits (456),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 83/107 (78%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA+LGG I+ ALQ+MSN TIIDEK LNECL EITRALL SDV F LVR+MQ NIK+IV
Sbjct  1    MVLAELGGQIASALQKMSNVTIIDEKALNECLKEITRALLHSDVSFPLVREMQNNIKKIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NL++LAAGHNKR+II+QA+F+ELCK+LDPGKP+F PKK KPSVVMFV
Sbjct  61   NLEELAAGHNKRRIIEQAIFSELCKMLDPGKPAFAPKKAKPSVVMFV  107



>emb|CDX77276.1| BnaC08g03210D [Brassica napus]
Length=496

 Score =   179 bits (455),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA+LGG I+ ALQ+MSN TIIDEK L+ECL EITRALL SDV F LVR+MQ+NIK+IV
Sbjct  1    MVLAELGGQIASALQKMSNVTIIDEKALSECLKEITRALLHSDVSFPLVREMQSNIKKIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NL++LAAGHNKR+II+QA+F+ELCK+LDPGKP+F+PKK KPSVVMFV
Sbjct  61   NLEELAAGHNKRRIIEQAIFSELCKMLDPGKPAFSPKKAKPSVVMFV  107



>ref|NP_199761.1| Signal recognition particle SRP54 subunit protein [Arabidopsis 
thaliana]
 sp|P49966.2|SR542_ARATH RecName: Full=Signal recognition particle 54 kDa protein 2; Short=SRP54 
[Arabidopsis thaliana]
 dbj|BAB10763.1| SRP54 (signal recognition particle 54 KDa) protein [Arabidopsis 
thaliana]
 gb|AED95821.1| Signal recognition particle SRP54 subunit protein [Arabidopsis 
thaliana]
Length=497

 Score =   177 bits (449),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA+LGG I  A+Q+M+N TIIDEK LN+CLNEITRALLQSDV F LV++MQTNIK+IV
Sbjct  1    MVLAELGGRIMSAIQKMNNVTIIDEKALNDCLNEITRALLQSDVSFPLVKEMQTNIKKIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NL+DLAAGHNKR+II+QA+F+ELCK+LDPGK +F PKK KPSVVMFV
Sbjct  61   NLEDLAAGHNKRRIIEQAIFSELCKMLDPGKSAFAPKKAKPSVVMFV  107



>emb|CDY39632.1| BnaC05g11610D [Brassica napus]
Length=480

 Score =   176 bits (447),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA+LGG I+ A+ QM N TIIDEK LNE LNEITRALLQSDV F LV++MQTNIK+IV
Sbjct  1    MVLAELGGRITHAIHQMRNVTIIDEKALNERLNEITRALLQSDVSFSLVKEMQTNIKKIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            +L DLAAGHNKR+II+QA+F ELCK+LDPGKP+F PKK KPSVVMFV
Sbjct  61   SLQDLAAGHNKRRIIEQAIFGELCKMLDPGKPAFAPKKAKPSVVMFV  107



>gb|AAA66199.1| signal recognition particle 54 kDa subunit [Arabidopsis thaliana]
Length=495

 Score =   175 bits (444),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/107 (76%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA+LGG I  A+Q+M+N TIIDEK LN+CLNEITRALLQSDV F LV++MQTNIK+IV
Sbjct  1    MVLAELGGRIMSAIQKMNNVTIIDEKALNDCLNEITRALLQSDVSFPLVKEMQTNIKKIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NL+DLAAGHNKR+II+QA+F+ELCK+LDPGK +F PKK KP VVMFV
Sbjct  61   NLEDLAAGHNKRRIIEQAIFSELCKMLDPGKSAFAPKKAKPRVVMFV  107



>ref|XP_006416923.1| hypothetical protein EUTSA_v10009795mg, partial [Eutrema salsugineum]
 gb|ESQ35276.1| hypothetical protein EUTSA_v10009795mg, partial [Eutrema salsugineum]
Length=487

 Score =   175 bits (443),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA+LGG I+RA+Q+MS   ++DEK LNECLNEITRALLQSDV F LV++MQTNIK+IV
Sbjct  1    MVLAELGGRITRAIQKMSRVMVLDEKALNECLNEITRALLQSDVSFPLVKEMQTNIKKIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NL+DLAAGHNKR+II+QA+F ELC +LDPG P+F PKK KPS+VMFV
Sbjct  61   NLEDLAAGHNKRRIIEQAIFTELCNMLDPGMPAFFPKKAKPSIVMFV  107



>gb|AES68174.2| signal recognition particle 54 kDa protein [Medicago truncatula]
Length=470

 Score =   174 bits (440),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 81/107 (76%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA+LGGSI+RAL +M+N T+IDEK L +CLNEI RALLQSDV+F+L+RDMQ NIK IV
Sbjct  1    MVLAELGGSITRALHKMNNTTVIDEKALTDCLNEINRALLQSDVRFELIRDMQINIKNIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NL+ LAAGHNKRKIIQQAVF+ELC++L+PGKPSF PK+ K SVVMFV
Sbjct  61   NLEQLAAGHNKRKIIQQAVFDELCRMLNPGKPSFVPKREKTSVVMFV  107



>ref|XP_003597923.1| Signal recognition particle [Medicago truncatula]
Length=512

 Score =   173 bits (439),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 81/107 (76%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA+LGGSI+RAL +M+N T+IDEK L +CLNEI RALLQSDV+F+L+RDMQ NIK IV
Sbjct  1    MVLAELGGSITRALHKMNNTTVIDEKALTDCLNEINRALLQSDVRFELIRDMQINIKNIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NL+ LAAGHNKRKIIQQAVF+ELC++L+PGKPSF PK+ K SVVMFV
Sbjct  61   NLEQLAAGHNKRKIIQQAVFDELCRMLNPGKPSFVPKREKTSVVMFV  107



>ref|NP_001056003.1| Os05g0509500 [Oryza sativa Japonica Group]
 dbj|BAC80140.1| signal recognition particle 54kDa subunit [Oryza sativa Japonica 
Group]
 gb|AAT44271.1| putative signal recognition particle 54 KD protein (SRP54) [Oryza 
sativa Japonica Group]
 dbj|BAF17917.1| Os05g0509500 [Oryza sativa Japonica Group]
 dbj|BAG91183.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64312.1| hypothetical protein OsJ_19149 [Oryza sativa Japonica Group]
Length=483

 Score =   172 bits (437),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 92/107 (86%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLAQLGGSISRAL QMSNAT+ID+K   +CL+EI RALLQSDVQ ++V DM+ NI+R V
Sbjct  1    MVLAQLGGSISRALAQMSNATVIDDKAFADCLHEIARALLQSDVQIRMVSDMRANIRRAV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NLD L AG NKR+IIQQAVF ELC +LDPGKPSFTP KGKPSVVMFV
Sbjct  61   NLDALPAGTNKRRIIQQAVFAELCNMLDPGKPSFTPTKGKPSVVMFV  107



>gb|EAY98648.1| hypothetical protein OsI_20572 [Oryza sativa Indica Group]
Length=483

 Score =   172 bits (437),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 92/107 (86%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLAQLGGSISRAL QMSNAT+ID+K   +CL+EI RALLQSDVQ ++V DM+ NI+R V
Sbjct  1    MVLAQLGGSISRALAQMSNATVIDDKAFADCLHEIARALLQSDVQIRMVSDMRANIRRAV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NLD L AG NKR+IIQQAVF ELC +LDPGKPSFTP KGKPSVVMFV
Sbjct  61   NLDALPAGTNKRRIIQQAVFAELCNMLDPGKPSFTPTKGKPSVVMFV  107



>ref|XP_003567163.1| PREDICTED: signal recognition particle 54 kDa protein 2-like 
isoform X1 [Brachypodium distachyon]
Length=499

 Score =   172 bits (435),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 81/107 (76%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLAQLGGSI+RAL +MSN T+IDEKV  +CLN+ITRALLQ+DVQFK+V D+Q+NIKR+V
Sbjct  1    MVLAQLGGSITRALAKMSNDTVIDEKVFGDCLNDITRALLQADVQFKMVCDLQSNIKRVV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NL+ LAAG NKR II+QAVF+ELC +LDPGKPSF+PKKG P VVMFV
Sbjct  61   NLEALAAGTNKRGIIKQAVFSELCNMLDPGKPSFSPKKGNPCVVMFV  107



>ref|XP_010440656.1| PREDICTED: signal recognition particle 54 kDa protein 3-like 
[Camelina sativa]
Length=495

 Score =   171 bits (434),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA+L G I+ A+QQM NATI+DEK LN+CLNEITRALLQSDV F LV++MQTNIK+IV
Sbjct  1    MVLAELCGRITGAIQQMKNATIVDEKALNDCLNEITRALLQSDVSFHLVKEMQTNIKKIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NL+DLA GHNKR+II+QA+F ELCK+LDPGK +F PKK KPSVV+FV
Sbjct  61   NLEDLAVGHNKRRIIEQAIFCELCKMLDPGKSAFAPKKTKPSVVLFV  107



>gb|EYU27665.1| hypothetical protein MIMGU_mgv1a019132mg [Erythranthe guttata]
Length=484

 Score =   170 bits (431),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 81/108 (75%), Positives = 96/108 (89%), Gaps = 1/108 (1%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLAQLGG IS A++QMSNAT+ID+KVLN+CLNEIT ALLQ+DVQF +V D+ TNIKRIV
Sbjct  1    MVLAQLGGRISGAIRQMSNATVIDKKVLNDCLNEITHALLQADVQFSIVSDLHTNIKRIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPG-KPSFTPKKGKPSVVMFV  577
            + D LAAGH+KRKII +A+FNELC+IL+PG KP FTPK+GK SVVMFV
Sbjct  61   DFDALAAGHDKRKIISKAIFNELCRILNPGKKPPFTPKRGKTSVVMFV  108



>gb|KFK27972.1| hypothetical protein AALP_AA8G455400 [Arabis alpina]
Length=476

 Score =   170 bits (430),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA+LG  I+ A+++M+N TIIDEK LNECLNEITRALLQSDV F LV++MQTNIK IV
Sbjct  1    MVLAELGRRITCAIRKMNNVTIIDEKSLNECLNEITRALLQSDVSFPLVKNMQTNIKNIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NL DLAAGHNKRKII+QA+F+ELC++LDPGK  FTPKK KPSVVMFV
Sbjct  61   NLQDLAAGHNKRKIIEQAIFSELCQMLDPGKSVFTPKKTKPSVVMFV  107



>gb|EYU26337.1| hypothetical protein MIMGU_mgv1a026331mg [Erythranthe guttata]
Length=495

 Score =   169 bits (428),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA+LGG IS A++QMSN  IID+KVLN+CLNEITRAL+QSDVQF +V DMQ NIK+IV
Sbjct  1    MVLAELGGRISGAVRQMSNEIIIDDKVLNDCLNEITRALIQSDVQFSIVCDMQKNIKKIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
             L+D+AAGH+KRKII+QA+F ELC+IL+PGK SFTP+KGK SVVMFV
Sbjct  61   KLNDVAAGHDKRKIIKQAIFGELCRILNPGKASFTPRKGKTSVVMFV  107



>ref|XP_008649844.1| PREDICTED: signal recognition particle 54 kDa protein 2-like 
[Zea mays]
 gb|AFW78624.1| hypothetical protein ZEAMMB73_996048 [Zea mays]
Length=482

 Score =   167 bits (423),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA+LGGSI+RAL +MSNAT++DEKVL +CLNEI RALLQ+DV+F  VRD++ NI RIV
Sbjct  1    MVLAELGGSIARALARMSNATVVDEKVLADCLNEICRALLQADVRFDTVRDVKANINRIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NLD LAAG NKR+IIQQAV +EL ++LDPGKPSFTP KGKP+VVMFV
Sbjct  61   NLDALAAGTNKRRIIQQAVVDELRRMLDPGKPSFTPSKGKPNVVMFV  107



>ref|XP_002441352.1| hypothetical protein SORBIDRAFT_09g025050 [Sorghum bicolor]
 gb|EES19782.1| hypothetical protein SORBIDRAFT_09g025050 [Sorghum bicolor]
Length=482

 Score =   167 bits (423),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA+LGGSI+RAL +MSNAT++DEKVL +CLNEI RALLQ+DV+F+ VRD++ NIKR+V
Sbjct  1    MVLAELGGSIARALSRMSNATVVDEKVLADCLNEICRALLQADVRFETVRDVKANIKRVV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NLD LAAG NKR+IIQQAV +E+ ++LDPGKPSFTP KGKP++VMFV
Sbjct  61   NLDALAAGTNKRRIIQQAVVDEIRRMLDPGKPSFTPSKGKPNLVMFV  107



>gb|EMT07581.1| Signal recognition particle 54 kDa protein 2 [Aegilops tauschii]
Length=119

 Score =   157 bits (396),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 87/107 (81%), Gaps = 12/107 (11%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLAQLGGSISRAL QMSNAT+IDEKVL ECLNEI+RALLQSDV            ++IV
Sbjct  1    MVLAQLGGSISRALAQMSNATVIDEKVLGECLNEISRALLQSDV------------RKIV  48

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NL+ LAAG NKR+IIQQ VF ELC +LDPGKP FTPKKGKP+VVMFV
Sbjct  49   NLETLAAGTNKRRIIQQVVFTELCNMLDPGKPVFTPKKGKPNVVMFV  95



>ref|XP_010482225.1| PREDICTED: signal recognition particle 54 kDa protein 3-like 
[Camelina sativa]
Length=504

 Score =   165 bits (417),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA+LGG I+  ++QM NATIIDEK LN+CL+EITRALLQ DV F LV++MQT IK+IV
Sbjct  1    MVLAKLGGRITGTIKQMKNATIIDEKTLNDCLDEITRALLQYDVSFHLVKEMQTTIKKIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NL+DLAAGHNKR II+QA+F ELCK+LDPGKP+F P K   S+VMFV
Sbjct  61   NLEDLAAGHNKRSIIEQAIFCELCKMLDPGKPAFAPNKANSSIVMFV  107



>gb|EMT01442.1| Signal recognition particle 54 kDa protein 3 [Aegilops tauschii]
Length=494

 Score =   164 bits (415),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA+LGGSISRAL +MS+AT++DE VL ECLNEI RAL+Q+DV+FK+V D+Q NIK+ V
Sbjct  1    MVLAELGGSISRALARMSSATVVDENVLRECLNEIARALMQADVRFKMVCDLQANIKKSV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NL+ LAAG NKR++I+ AV  ELCK+LDPGKP+F PKKGKP+VVMFV
Sbjct  61   NLEALAAGTNKRRVIETAVGKELCKMLDPGKPAFVPKKGKPNVVMFV  107



>gb|EMS67083.1| Signal recognition particle 54 kDa protein 3 [Triticum urartu]
Length=493

 Score =   164 bits (415),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA+LGGSISRAL +MS+AT++DE VL ECLNEI RAL+Q+DV+FK+V D+Q NIK+ V
Sbjct  1    MVLAELGGSISRALARMSSATVVDENVLRECLNEIARALMQADVRFKMVCDLQANIKKSV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NL+ LAAG NKR++I+ AV  ELCK+LDPGKP+F PKKGKP+VVMFV
Sbjct  61   NLEALAAGTNKRRVIETAVGKELCKMLDPGKPAFVPKKGKPNVVMFV  107



>gb|EMT27051.1| Signal recognition particle 54 kDa protein 2 [Aegilops tauschii]
Length=464

 Score =   163 bits (412),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLAQLGGS+SRAL  M+ AT++DEKVL +CLNEITRALLQ+DVQF +VRDMQ ++KR V
Sbjct  1    MVLAQLGGSLSRALGLMTGATVVDEKVLGDCLNEITRALLQADVQFDMVRDMQASVKRAV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            +L  LAAG +KR++I++AVF+ELC +LD GKP+F PKKGKP VVMFV
Sbjct  61   DLGALAAGTDKRRVIKKAVFDELCNMLDAGKPAFAPKKGKPCVVMFV  107



>ref|XP_004961562.1| PREDICTED: signal recognition particle 54 kDa protein 2-like 
[Setaria italica]
Length=479

 Score =   163 bits (412),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 92/107 (86%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLAQLGGSI+ AL +M  AT++DEKVL ECLNEI+RALLQ+DV+F+ VRD++ NIK   
Sbjct  1    MVLAQLGGSIAGALARMGKATVVDEKVLAECLNEISRALLQADVRFETVRDVKANIKTTA  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NLD LAAG +KR++IQ+AV  ELC++LDPGKPSFTP KGKPSVVMFV
Sbjct  61   NLDALAAGTDKRRVIQKAVVGELCRMLDPGKPSFTPSKGKPSVVMFV  107



>emb|CDJ26375.1| unnamed protein product [Triticum aestivum]
Length=484

 Score =   163 bits (412),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLAQLGGS+SRAL +M++AT++DEKVL +CLNEITRALLQ+DVQF +VRDMQ ++KR V
Sbjct  1    MVLAQLGGSLSRALARMTSATVVDEKVLGDCLNEITRALLQADVQFDMVRDMQASVKRAV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            +L  LAAG +KR++I+ AVF+ELC ++D GKP+F PKKGKP VVMFV
Sbjct  61   DLGALAAGTDKRRVIKTAVFDELCNMVDAGKPAFAPKKGKPCVVMFV  107



>gb|EMT28586.1| Signal recognition particle 54 kDa protein 2 [Aegilops tauschii]
Length=119

 Score =   153 bits (387),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 86/107 (80%), Gaps = 12/107 (11%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLAQLGGSISRAL QMSNAT+IDEKVL ECLNEI+R  LQSDV            ++I+
Sbjct  1    MVLAQLGGSISRALAQMSNATVIDEKVLGECLNEISRTPLQSDV------------RKII  48

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NL+ LAAG NKR+IIQQAVF ELC +LDPGKP FTPKKGKP+VVMFV
Sbjct  49   NLETLAAGTNKRRIIQQAVFTELCNMLDPGKPVFTPKKGKPNVVMFV  95



>emb|CDY10656.1| BnaA05g17060D [Brassica napus]
Length=196

 Score =   154 bits (390),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 71/94 (76%), Positives = 84/94 (89%), Gaps = 0/94 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA+LGG I+ ALQ+MSN TIIDEK LNECL EIT ALL SDV F LVR+MQ NIK+IV
Sbjct  1    MVLAELGGQIASALQKMSNVTIIDEKALNECLKEITHALLHSDVSFPLVREMQNNIKKIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSF  538
            NL++LAAGHNKR+II+QA+F+ELCK+LDPGKP+F
Sbjct  61   NLEELAAGHNKRRIIEQAIFSELCKMLDPGKPAF  94



>gb|EMS47723.1| Signal recognition particle 54 kDa protein 2 [Triticum urartu]
Length=117

 Score =   142 bits (358),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 72/105 (69%), Positives = 81/105 (77%), Gaps = 12/105 (11%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLAQLGGSI  AL QMSN T+IDEKVL ECLNEI+ ALLQSD             ++IV
Sbjct  1    MVLAQLGGSICHALAQMSNTTVIDEKVLGECLNEISHALLQSDA------------RKIV  48

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVM  571
            NL+ LAAG NKR+IIQQAVF ELC +LDPGKP FTPKKGKP+VV+
Sbjct  49   NLETLAAGTNKRRIIQQAVFRELCSMLDPGKPVFTPKKGKPNVVI  93



>sp|P49970.1|SR543_HORVU RecName: Full=Signal recognition particle 54 kDa protein 3; Short=SRP54 
[Hordeum vulgare]
 gb|AAA79356.1| signal recognition particle 54 kDa subunit [Hordeum vulgare]
Length=493

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 89/107 (83%), Gaps = 1/107 (1%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA +GGSISRAL  MS+A ++DE VL ECLNEI RAL+QSDV+FK V D+Q NI++ V
Sbjct  1    MVLADVGGSISRALA-MSSAAVVDESVLRECLNEIARALMQSDVRFKTVCDLQANIRKTV  59

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NL+ LAAG NKR+II+ +V  ELCK+LD GKP+F PKKGKP+VVMFV
Sbjct  60   NLEALAAGTNKRRIIETSVGKELCKMLDTGKPAFVPKKGKPNVVMFV  106



>ref|XP_004986804.1| PREDICTED: signal recognition particle 54 kDa protein 2-like 
[Setaria italica]
Length=478

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 86/107 (80%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLAQLGGSI+  L +MS AT++D+K L +CLNE++RALLQ+DV+F+ VRD++  IK   
Sbjct  1    MVLAQLGGSIASTLARMSQATVVDDKALADCLNEVSRALLQADVRFETVRDVKAAIKSAA  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NL  LA G ++R++I++AV  ELC++LDPGK SFTP KGKP VVMFV
Sbjct  61   NLAALAPGTDRRRVIRKAVVGELCRMLDPGKQSFTPSKGKPGVVMFV  107



>gb|AFG65368.1| hypothetical protein UMN_2824_02, partial [Pinus taeda]
 gb|AFG65369.1| hypothetical protein UMN_2824_02, partial [Pinus taeda]
 gb|AFG65370.1| hypothetical protein UMN_2824_02, partial [Pinus taeda]
Length=72

 Score =   132 bits (333),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 64/72 (89%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA+LGGSISRALQQMSNATIIDEK L +CLNEI+RALLQSDVQFKLVRDMQ NIK+IV
Sbjct  1    MVLAELGGSISRALQQMSNATIIDEKALQDCLNEISRALLQSDVQFKLVRDMQVNIKKIV  60

Query  437  NLDDLAAGHNKR  472
            NL+DLAAGHNKR
Sbjct  61   NLEDLAAGHNKR  72



>ref|XP_010051702.1| PREDICTED: signal recognition particle 54 kDa protein 2-like 
[Eucalyptus grandis]
Length=225

 Score =   133 bits (334),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/105 (63%), Positives = 82/105 (78%), Gaps = 6/105 (6%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLAQLGG+I+RA++QMSNAT++D+KVLNECLNEI RALL +DV+F+LVRDM  N+KRIV
Sbjct  1    MVLAQLGGTITRAIRQMSNATLVDQKVLNECLNEINRALLNADVRFQLVRDMHNNVKRIV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKG-KPSVV  568
            N DDLAAGHNKR+IIQQ       K        +  +KG KP++V
Sbjct  61   NFDDLAAGHNKRRIIQQVKTTTCTKY-----AYYHQRKGWKPALV  100



>gb|EMT11251.1| Signal recognition particle 54 kDa protein 2 [Aegilops tauschii]
Length=103

 Score =   126 bits (317),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/91 (69%), Positives = 71/91 (78%), Gaps = 12/91 (13%)
 Frame = +2

Query  305  MSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIVNLDDLAAGHNKRKIIQ  484
            MSNAT+IDEKVL ECLNEI+RALLQSDV            ++IVNL+ LA G NKR+IIQ
Sbjct  1    MSNATVIDEKVLGECLNEISRALLQSDV------------RKIVNLETLATGTNKRRIIQ  48

Query  485  QAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            Q VF ELC +LDPGKP FTPKKGKP+VVMFV
Sbjct  49   QVVFTELCNMLDPGKPVFTPKKGKPNVVMFV  79



>ref|XP_002964266.1| hypothetical protein SELMODRAFT_81201 [Selaginella moellendorffii]
 gb|EFJ34599.1| hypothetical protein SELMODRAFT_81201 [Selaginella moellendorffii]
Length=221

 Score =   130 bits (326),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 85/107 (79%), Gaps = 2/107 (2%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVL +LG  IS A+Q+++ AT+ID+K L  C+NEIT ALLQ+DVQFKLV+ + +N+++ V
Sbjct  1    MVLGELGSRISGAIQRLNTATVIDDKALTICVNEITHALLQADVQFKLVQALSSNVRKSV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
              + LAAGH+KR IIQ+AVF+EL  +LD GKPSFTP KG+ +VVM V
Sbjct  61   --EKLAAGHDKRHIIQKAVFHELRAMLDAGKPSFTPTKGRTNVVMLV  105



>ref|XP_002466776.1| hypothetical protein SORBIDRAFT_01g014030 [Sorghum bicolor]
 gb|EER93774.1| hypothetical protein SORBIDRAFT_01g014030 [Sorghum bicolor]
Length=476

 Score =   133 bits (334),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 68/109 (62%), Positives = 85/109 (78%), Gaps = 2/109 (2%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVL+QL GS+  AL +M NAT++D+KVL++CLNEI+RALLQ+DV+F+ VR +Q  IK  V
Sbjct  1    MVLSQLSGSLKGALSRMCNATLVDQKVLDDCLNEISRALLQADVRFETVRRVQATIKSTV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKG-KP-SVVMFV  577
            NL  LA G NKR++I +AV  EL + LDPGKPSF P KG KP SVVMFV
Sbjct  61   NLQALADGTNKRRVIHRAVVAELRRTLDPGKPSFAPTKGRKPASVVMFV  109



>ref|XP_005841045.1| hypothetical protein GUITHDRAFT_159167 [Guillardia theta CCMP2712]
 gb|EKX54065.1| hypothetical protein GUITHDRAFT_159167 [Guillardia theta CCMP2712]
Length=494

 Score =   130 bits (326),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 85/107 (79%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA+LGG I++A++ M++ T+IDE+ ++  L EI+ ALL SDV  KLV  ++ N+K  +
Sbjct  1    MVLAELGGRIAQAMRSMTSKTVIDEEAVDNMLKEISSALLSSDVNVKLVSSLRKNVKNRI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NL+DLA G N+R++IQQAVF ELC++L+PGK  + PKKGKP+V+MFV
Sbjct  61   NLEDLATGLNRRRMIQQAVFEELCEMLNPGKKPYQPKKGKPNVIMFV  107



>emb|CDY16473.1| BnaA08g02940D [Brassica napus]
Length=80

 Score =   122 bits (305),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA+LGG I+ ALQ+MSN TIIDEK LNECL EITRALL SDV F LVR+MQ NIK+IV
Sbjct  1    MVLAELGGQIASALQKMSNVTIIDEKALNECLKEITRALLHSDVSFPLVREMQNNIKKIV  60

Query  437  NLDDLAAGHNKRKIIQ  484
            NL++LAAGHNKR+II+
Sbjct  61   NLEELAAGHNKRRIIE  76



>ref|XP_002964268.1| hypothetical protein SELMODRAFT_82182 [Selaginella moellendorffii]
 gb|EFJ34601.1| hypothetical protein SELMODRAFT_82182 [Selaginella moellendorffii]
Length=467

 Score =   129 bits (325),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 85/107 (79%), Gaps = 2/107 (2%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVL +LG  IS A+Q+++ AT+ID+K L  C+NEIT ALLQ+DVQFKLV+ + +N+++ V
Sbjct  1    MVLGELGSRISGAIQRLNTATVIDDKALTICVNEITHALLQADVQFKLVQALSSNVRKSV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
              + LAAGH+KR IIQ+AVF+EL  +LD GKPSFTP KG+ +VVM V
Sbjct  61   --EKLAAGHDKRHIIQKAVFHELRAMLDAGKPSFTPTKGRTNVVMLV  105



>ref|XP_780650.3| PREDICTED: signal recognition particle 54 kDa protein-like [Strongylocentrotus 
purpuratus]
Length=513

 Score =   129 bits (325),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ +SNATIIDE VLN  LNEI RALL++DV  +LV+ ++ N+K ++
Sbjct  1    MVLADLGRKITSALKSLSNATIIDEDVLNSMLNEICRALLEADVNIRLVKALKENVKSVI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            + D++AAG NKRK+IQ AVF EL K++DPG   +TP K KP+++MFV
Sbjct  61   DFDEMAAGLNKRKMIQTAVFKELVKLVDPGVKVWTPTKAKPNIIMFV  107



>ref|XP_002989541.1| hypothetical protein SELMODRAFT_129975 [Selaginella moellendorffii]
 gb|EFJ09417.1| hypothetical protein SELMODRAFT_129975 [Selaginella moellendorffii]
Length=467

 Score =   129 bits (323),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 84/107 (79%), Gaps = 2/107 (2%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVL +LG  IS A+Q+++ AT+ID+K L  C+NEIT ALLQ+DVQFKLV+ + +N+++ V
Sbjct  1    MVLGELGSRISGAIQRLNTATVIDDKALTICVNEITHALLQADVQFKLVQALSSNVRKSV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
              + LAAGH+KR IIQ+AVF+EL  +LD GKPSFTP KG+ + VM V
Sbjct  61   --EKLAAGHDKRHIIQKAVFHELHAMLDAGKPSFTPTKGRTNAVMLV  105



>gb|EAW65893.1| hCG2033479, isoform CRA_c [Homo sapiens]
Length=177

 Score =   122 bits (306),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ +SNATII+E+VLN  L E+  ALL++DV  KLV+ ++ N+K  +
Sbjct  1    MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            +L+++A+G NKRK+IQ AVF EL K++DPG  ++TP KGK +V+MFV
Sbjct  61   DLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNVIMFV  107



>ref|XP_002514106.1| signal recognition particle 54 kD protein, putative [Ricinus 
communis]
 gb|EEF48060.1| signal recognition particle 54 kD protein, putative [Ricinus 
communis]
Length=206

 Score =   122 bits (307),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 81/110 (74%), Gaps = 11/110 (10%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            M LA+LGGS+SRA+QQM+NA+IID      CLNEI  +L QSDVQF LVR MQ NIK+ +
Sbjct  1    MALAELGGSMSRAIQQMNNASIIDL-----CLNEIALSLFQSDVQFNLVRKMQVNIKKFI  55

Query  437  -NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFT----PKKG-KPSVV  568
             N    AAG++K  IIQ A+FNELCK+LDPG+PSF      KKG +P++V
Sbjct  56   HNNHYFAAGYDKPYIIQHAIFNELCKLLDPGEPSFARKIKKKKGWRPAIV  105



>ref|XP_004314467.1| PREDICTED: signal recognition particle 54 kDa protein-like [Tursiops 
truncatus]
Length=217

 Score =   122 bits (306),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ +SNATII+E+VLN  L E+  ALL++DV  KLV+ ++ N+K  +
Sbjct  1    MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            +L+++A+G NKRK+IQ AVF EL K++DPG  ++TP KGK +V+MFV
Sbjct  61   DLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNVIMFV  107



>ref|NP_988977.1| signal recognition particle 54kDa [Xenopus (Silurana) tropicalis]
 gb|AAH61368.1| signal recognition particle 54 [Xenopus (Silurana) tropicalis]
Length=504

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 85/107 (79%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ +SNATII+E+VLN  L E+ +ALL++DV  KLV+ ++ N+K  +
Sbjct  1    MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCKALLEADVNIKLVKQLRENVKSAI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            +L+++A+G NKRK+IQ AVF EL K++DPG  ++TP KGKP+V+MFV
Sbjct  61   DLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKPNVIMFV  107



>ref|XP_003987587.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X1 [Felis catus]
 ref|XP_007073798.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X1 [Panthera tigris altaica]
Length=526

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 85/109 (78%), Gaps = 0/109 (0%)
 Frame = +2

Query  251  FKMVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKR  430
            FKMVLA LG  I+ AL+ +SNATII+E+VLN  L E+  ALL++DV  KLV+ ++ N+K 
Sbjct  21   FKMVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKS  80

Query  431  IVNLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
             ++L+++A+G NKRK+IQ AVF EL K++DPG  ++TP KGK +V+MFV
Sbjct  81   AIDLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNVIMFV  129



>ref|XP_002464203.1| hypothetical protein SORBIDRAFT_01g014055 [Sorghum bicolor]
 gb|EER91201.1| hypothetical protein SORBIDRAFT_01g014055 [Sorghum bicolor]
Length=471

 Score =   125 bits (313),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 64/104 (62%), Positives = 81/104 (78%), Gaps = 2/104 (2%)
 Frame = +2

Query  272  LGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIVNLDDL  451
            L GS+  AL +M NAT++D+KVL++CLNEI+RALLQ+DV+F+ VR +Q +IK  VNL  L
Sbjct  1    LSGSLKGALSRMCNATLVDQKVLDDCLNEISRALLQADVRFETVRRVQASIKSTVNLQAL  60

Query  452  AAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKG-KP-SVVMFV  577
            A G NKR++I +AV  EL + LDPGKPSF P KG KP SVVMFV
Sbjct  61   ADGTNKRRVIHRAVVAELRRTLDPGKPSFAPTKGRKPASVVMFV  104



>ref|XP_001363021.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X1 [Monodelphis domestica]
 ref|XP_007473307.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X2 [Monodelphis domestica]
 ref|XP_007473308.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X3 [Monodelphis domestica]
Length=504

 Score =   125 bits (313),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 84/107 (79%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ +SNATII+E+VLN  L E+  ALL++DV  KLV+ ++ N+K  +
Sbjct  1    MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            +L+++A+G NKRK+IQ AVF EL K++DPG  ++TP KGKP+V+MFV
Sbjct  61   DLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKPNVIMFV  107



>ref|XP_006812603.1| PREDICTED: signal recognition particle 54 kDa protein [Saccoglossus 
kowalevskii]
Length=502

 Score =   125 bits (313),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 84/107 (79%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ +SNAT+I+E VLN  L+EI RALL++DV  K V+ ++ N++ ++
Sbjct  1    MVLADLGRKITTALRSLSNATVINEDVLNSMLSEICRALLEADVNIKQVKKLRENVRSVI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            + D++AAG NKR++IQ AVF EL K++DPG  ++TP KGKP+V+MFV
Sbjct  61   DFDEMAAGLNKRRMIQSAVFKELVKLVDPGVKAWTPVKGKPNVIMFV  107



>emb|CDP08251.1| unnamed protein product [Coffea canephora]
Length=468

 Score =   124 bits (312),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 59/121 (49%), Positives = 86/121 (71%), Gaps = 15/121 (12%)
 Frame = +2

Query  260  VLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIVN  439
            +L +L   +++A++ M NAT++DE V+NECLNEITRALL+ DV F  V+++  N+K+  N
Sbjct  1    MLVELKDRLTQAIRDMKNATVVDESVVNECLNEITRALLRGDVPFHFVKELVNNVKKSAN  60

Query  440  LDDLAAGHNKRKIIQQ---------------AVFNELCKILDPGKPSFTPKKGKPSVVMF  574
            L++L +G NKRKI+++                +F+ELC +L+PGKPSFTP+KGK SVVMF
Sbjct  61   LNNLPSGINKRKILEELTTFYCSLVDDHETACIFSELCNMLNPGKPSFTPRKGKTSVVMF  120

Query  575  V  577
            V
Sbjct  121  V  121



>ref|XP_008480600.1| PREDICTED: signal recognition particle 54 kDa protein-like [Diaphorina 
citri]
Length=202

 Score =   120 bits (301),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 84/107 (79%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ +SNAT+I+E+VLN  L EI  ALL++DV  KLV+ ++ N+++++
Sbjct  1    MVLADLGRKITSALRSLSNATVINEEVLNSMLKEICAALLEADVNIKLVKKLRENVRQVI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            + D++A+G NKR++IQ +V+ EL K++DPG  +  P+KGKP+V+MFV
Sbjct  61   DFDEMASGLNKRRMIQSSVYKELIKLVDPGVKAHQPQKGKPNVIMFV  107



>ref|XP_005989239.1| PREDICTED: signal recognition particle 54 kDa protein [Latimeria 
chalumnae]
Length=504

 Score =   124 bits (311),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 84/107 (79%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ +SNATII+E+VLN  L E+  ALL++DV  KLV+ ++ N+K  +
Sbjct  1    MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKAAI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            +L+++A+G NKRK+IQ AVF EL K++DPG  ++TP KGKP+V+MFV
Sbjct  61   DLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKPNVIMFV  107



>ref|NP_001080564.1| signal recognition particle 54kDa [Xenopus laevis]
 gb|AAH44991.1| Srp54 protein [Xenopus laevis]
Length=504

 Score =   124 bits (311),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 84/107 (79%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ +SNATII+E+VLN  L E+  ALL++DV  KLV+ ++ N+K  +
Sbjct  1    MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            +L+++A+G NKRK+IQ AVF EL K++DPG  ++TP KGKP+V+MFV
Sbjct  61   DLEEMASGLNKRKMIQTAVFKELVKLVDPGVKAWTPTKGKPNVIMFV  107



>gb|EFZ22659.1| hypothetical protein SINV_03515 [Solenopsis invicta]
Length=275

 Score =   121 bits (303),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ +SNAT+I+E+VLN  L EI  ALL++DV  +LV+ ++ N+++++
Sbjct  1    MVLADLGRKITSALRSLSNATVINEEVLNSMLKEICAALLEADVNIRLVKKLRENVRQVI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            + +D+A G NKR++IQ AVF EL K++DPG  ++ P KG+P+V+MFV
Sbjct  61   DFEDMAGGLNKRRMIQSAVFKELVKLIDPGVKAYQPVKGRPNVIMFV  107



>dbj|BAC41048.1| unnamed protein product [Mus musculus]
Length=502

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 84/107 (79%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ +SNATII+E+VLN  L E+  ALL++DV  KLV+ ++ N+K  +
Sbjct  1    MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            +L+++A+G N+RK+IQ AVF EL K++DPG  ++TP KGKP+V+MFV
Sbjct  61   DLEEMASGLNQRKMIQHAVFKELVKLVDPGVKAWTPTKGKPNVIMFV  107



>ref|XP_005707608.1| signal recognition particle subunit SRP54 [Galdieria sulphuraria]
 gb|EME31088.1| signal recognition particle subunit SRP54 [Galdieria sulphuraria]
Length=482

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 86/107 (80%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVL++LG  IS AL++++N T++DE+ LNE LNE++RALL++DV  K+V+ ++ ++K+ V
Sbjct  1    MVLSELGKKISGALRKLANRTVVDEEALNEMLNEVSRALLEADVNVKMVQALRQSVKKKV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NL++LAAG N+RK+IQ+AVF ELC +L PG      KKG+P+VVMFV
Sbjct  61   NLEELAAGVNRRKLIQKAVFEELCNMLSPGTSPPPLKKGRPNVVMFV  107



>ref|XP_008209172.1| PREDICTED: signal recognition particle 54 kDa protein [Nasonia 
vitripennis]
Length=439

 Score =   123 bits (308),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ +S+ATII+E+VLN  L EI  ALL+SDV  +LV++++ N++ ++
Sbjct  1    MVLADLGRKITSALRSLSHATIINEEVLNSMLKEICAALLESDVNIRLVKNLRENVRSVI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            + DD+A G NKR++IQ AVF EL K++DPG  ++ P KG+P+V+MFV
Sbjct  61   DFDDMAGGLNKRRMIQSAVFKELVKLIDPGVKAYQPVKGRPNVIMFV  107



>gb|EAW65895.1| hCG2033479, isoform CRA_e [Homo sapiens]
Length=341

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ +SNATII+E+VLN  L E+  ALL++DV  KLV+ ++ N+K  +
Sbjct  1    MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            +L+++A+G NKRK+IQ AVF EL K++DPG  ++TP KGK +V+MFV
Sbjct  61   DLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNVIMFV  107



>gb|EAW65894.1| hCG2033479, isoform CRA_d, partial [Homo sapiens]
Length=337

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ +SNATII+E+VLN  L E+  ALL++DV  KLV+ ++ N+K  +
Sbjct  1    MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            +L+++A+G NKRK+IQ AVF EL K++DPG  ++TP KGK +V+MFV
Sbjct  61   DLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNVIMFV  107



>ref|XP_011452623.1| PREDICTED: signal recognition particle 54 kDa protein [Crassostrea 
gigas]
 gb|EKC41631.1| Signal recognition particle 54 kDa protein [Crassostrea gigas]
Length=504

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ + NATII+E+VLNE L EI +AL+++DV  KLV+ ++ N++ ++
Sbjct  1    MVLADLGRKITSALRSLGNATIINEEVLNEMLKEICKALIEADVNIKLVKSLRENVRSVI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            + D++A G NKR++IQ AVF EL K++DPG  ++TP KGK +V+MFV
Sbjct  61   DFDEMAGGLNKRRMIQSAVFKELVKLIDPGVKAWTPTKGKNNVIMFV  107



>ref|XP_005714472.1| signal recognition particle recognition component SRP54 [Chondrus 
crispus]
 emb|CDF34653.1| signal recognition particle recognition component SRP54 [Chondrus 
crispus]
Length=492

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 81/107 (76%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVL  LGG I+ AL++M+N+T+IDE+ L E L EI  ALL++DV  K V +++ N+   V
Sbjct  1    MVLESLGGRITGALRKMTNSTVIDEEALKEMLKEIAHALLEADVNIKSVVELRKNVTNRV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            NL++LAAG NKRK+IQ+AVF+ELC +LDPG      K+GKP+VVMFV
Sbjct  61   NLEELAAGVNKRKLIQKAVFDELCSMLDPGTKPVQMKRGKPNVVMFV  107



>ref|XP_011161944.1| PREDICTED: signal recognition particle 54 kDa protein [Solenopsis 
invicta]
Length=314

 Score =   120 bits (302),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ +SNAT+I+E+VLN  L EI  ALL++DV  +LV+ ++ N+++++
Sbjct  1    MVLADLGRKITSALRSLSNATVINEEVLNSMLKEICAALLEADVNIRLVKKLRENVRQVI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            + +D+A G NKR++IQ AVF EL K++DPG  ++ P KG+P+V+MFV
Sbjct  61   DFEDMAGGLNKRRMIQSAVFKELVKLIDPGVKAYQPVKGRPNVIMFV  107



>tpg|DAA34489.1| TPA_inf: signal recognition particle subunit Srp54 [Amblyomma 
variegatum]
Length=160

 Score =   117 bits (293),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ +SNATII+++VL+  L EI  ALL++D+  KLV+ ++ N++ ++
Sbjct  8    MVLADLGRKITNALRSLSNATIINKEVLDSMLKEICTALLEADINIKLVKQLRENVRSVI  67

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            ++D++AAG NKR++IQ AVF EL K++DPG  ++ P KGK +V+MFV
Sbjct  68   DIDEMAAGLNKRRMIQSAVFKELIKLVDPGVKAWQPTKGKNNVIMFV  114



>gb|EFX73155.1| hypothetical protein DAPPUDRAFT_325390 [Daphnia pulex]
Length=506

 Score =   122 bits (307),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 81/107 (76%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ +SNAT+I+E+VLN  L EI  ALL+SDV  +LV+ ++ N+K ++
Sbjct  1    MVLADLGRKITSALRSLSNATVINEEVLNAMLKEICAALLESDVNIRLVKQLRENVKSVI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            + DD+A G NKR++IQ AVF EL K++DPG   + P KG+P+V+MFV
Sbjct  61   DFDDMAGGLNKRRMIQSAVFKELIKLVDPGVKPYQPVKGRPNVIMFV  107



>ref|XP_009061606.1| hypothetical protein LOTGIDRAFT_127402 [Lottia gigantea]
 gb|ESO87711.1| hypothetical protein LOTGIDRAFT_127402 [Lottia gigantea]
Length=500

 Score =   122 bits (306),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ +SNATII+E+VLN+ L EI RAL+++DV  +LV+ ++ N++ ++
Sbjct  1    MVLADLGRKITSALKSLSNATIINEEVLNDMLKEICRALMEADVNIRLVKSLRENVRSVI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            + D++A G NKR++IQ AV+ EL K++DPG  +F P KGK +V+MFV
Sbjct  61   DFDEMAGGLNKRRMIQSAVYKELVKLIDPGVKAFHPSKGKSNVIMFV  107



>ref|XP_002131641.1| PREDICTED: signal recognition particle 54 kDa protein-like [Ciona 
intestinalis]
Length=497

 Score =   122 bits (306),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ +SNATII+E+VL   L+EI RALL+SDV  +LV+ ++ N++  +
Sbjct  1    MVLADLGRKINNALRSLSNATIINEEVLQSMLSEICRALLESDVNIRLVKKLRENVRSAI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            + D++A+G NKRK+IQ AVF EL K++DPG  ++ P KGKP+V+MFV
Sbjct  61   DFDEMASGLNKRKMIQSAVFRELVKLVDPGVKAWQPTKGKPNVIMFV  107



>ref|XP_011055547.1| PREDICTED: signal recognition particle 54 kDa protein [Acromyrmex 
echinatior]
 gb|EGI64601.1| Signal recognition particle 54 kDa protein [Acromyrmex echinatior]
Length=506

 Score =   122 bits (306),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ +SNAT+I+E+VLN  L EI  ALL++DV  +LV+ ++ N+++++
Sbjct  1    MVLADLGRKITSALRSLSNATVINEEVLNSMLKEICAALLEADVNIRLVKKLRENVRKVI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            + DD+A G NKR++IQ AVF EL K++DPG  ++ P KG+P+++MFV
Sbjct  61   DFDDMAGGINKRRMIQSAVFKELVKLIDPGVKAYQPVKGRPNIIMFV  107



>ref|XP_004367866.1| signal peptide binding domain containing protein [Acanthamoeba 
castellanii str. Neff]
 gb|ELR25111.1| signal peptide binding domain containing protein [Acanthamoeba 
castellanii str. Neff]
Length=496

 Score =   122 bits (306),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 82/107 (77%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA+LG  I+ AL+ MSN+T+ID+ V++  L EI+ AL+ +DVQF LV  ++ NI   V
Sbjct  1    MVLAELGSKITHALRNMSNSTVIDKDVVDAMLKEISNALMAADVQFNLVLKLRKNILDKV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
             ++D+AAG NKRKIIQQAVF+ELC ++DPG+  +   KGKP+V+MFV
Sbjct  61   KIEDMAAGLNKRKIIQQAVFDELCALVDPGQKPYKLVKGKPNVIMFV  107



>ref|XP_006985324.1| PREDICTED: signal recognition particle 54 kDa protein [Peromyscus 
maniculatus bairdii]
Length=443

 Score =   121 bits (304),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ +SNATII+E+VLN  L E+  ALL++DV  KLV+ ++ N+K  +
Sbjct  1    MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            +L+++A+G NKRK+IQ AVF EL K++DPG  ++TP KGK +V+MFV
Sbjct  61   DLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNVIMFV  107



>ref|XP_009970774.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X1 [Tyto alba]
 gb|KFV58151.1| Signal recognition particle 54 kDa protein [Tyto alba]
Length=504

 Score =   122 bits (305),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 84/107 (79%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ +SNATII+E+VLN  L E+ +ALL++DV  KLV+ ++ N+K  +
Sbjct  1    MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCKALLEADVNIKLVKQLRENVKSAI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            +L+++A+G NKRK+IQ AVF EL K++DPG  ++TP KGK +++MFV
Sbjct  61   DLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNIIMFV  107



>ref|XP_008546734.1| PREDICTED: signal recognition particle 54 kDa protein [Microplitis 
demolitor]
Length=506

 Score =   122 bits (305),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 82/107 (77%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ +SNAT+I+E+VLN  L EI  ALL++DV  +LV+ ++ N++ ++
Sbjct  1    MVLADLGRKITSALRSLSNATVINEEVLNSMLKEICAALLEADVNIRLVKKLRENVRSVI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            + DD+A G NKR++IQ AVF EL K++DPG  ++ P KG+P+V+MFV
Sbjct  61   DFDDMAGGLNKRRMIQSAVFKELVKLIDPGVKAYQPVKGRPNVIMFV  107



>gb|ERE72537.1| signal recognition particle protein [Cricetulus griseus]
Length=450

 Score =   121 bits (304),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ +SNATII+E+VLN  L E+  ALL++DV  KLV+ ++ N+K  +
Sbjct  1    MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            +L+++A+G NKRK+IQ AVF EL K++DPG  ++TP KGK +V+MFV
Sbjct  61   DLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNVIMFV  107



>ref|XP_001641637.1| predicted protein [Nematostella vectensis]
 gb|EDO49574.1| predicted protein [Nematostella vectensis]
Length=498

 Score =   121 bits (304),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 82/107 (77%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ +SNAT+I+E+VLN  L E+  ALL+SDV  +LV+ ++ N+K  +
Sbjct  1    MVLADLGRKITTALRSLSNATVINEEVLNAMLKEVCAALLESDVNVQLVKRLRENVKAAI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            + +++AAG NKRK+IQ  VF ELCK++DPG  ++TP KGK +V+MFV
Sbjct  61   DFEEMAAGLNKRKMIQHTVFQELCKLVDPGVKAWTPSKGKKNVIMFV  107



>ref|XP_007632101.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X3 [Cricetulus griseus]
Length=477

 Score =   121 bits (304),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ +SNATII+E+VLN  L E+  ALL++DV  KLV+ ++ N+K  +
Sbjct  1    MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            +L+++A+G NKRK+IQ AVF EL K++DPG  ++TP KGK +V+MFV
Sbjct  61   DLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNVIMFV  107



>ref|XP_006891639.1| PREDICTED: signal recognition particle 54 kDa protein [Elephantulus 
edwardii]
Length=477

 Score =   121 bits (304),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ +SNATII+E+VLN  L E+  ALL++DV  KLV+ ++ N+K  +
Sbjct  1    MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            +L+++A+G NKRK+IQ AVF EL K++DPG  ++TP KGK +V+MFV
Sbjct  61   DLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNVIMFV  107



>ref|XP_005268081.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X1 [Homo sapiens]
Length=447

 Score =   121 bits (303),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ +SNATII+E+VLN  L E+  ALL++DV  KLV+ ++ N+K  +
Sbjct  1    MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            +L+++A+G NKRK+IQ AVF EL K++DPG  ++TP KGK +V+MFV
Sbjct  61   DLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNVIMFV  107



>ref|XP_004649653.1| PREDICTED: signal recognition particle 54 kDa protein [Jaculus 
jaculus]
Length=497

 Score =   121 bits (304),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ +SNATII+E+VLN  L E+  ALL++DV  KLV+ ++ N+K  +
Sbjct  1    MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            +L+++A+G NKRK+IQ AVF EL K++DPG  ++TP KGK +V+MFV
Sbjct  61   DLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNVIMFV  107



>ref|XP_006515381.1| PREDICTED: signal recognition particle 54C isoform X1 [Mus musculus]
Length=482

 Score =   121 bits (304),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ +SNATII+E+VLN  L E+  ALL++DV  KLV+ ++ N+K  +
Sbjct  1    MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            +L+++A+G NKRK+IQ AVF EL K++DPG  ++TP KGK +V+MFV
Sbjct  61   DLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNVIMFV  107



>gb|ERE72538.1| signal recognition particle protein [Cricetulus griseus]
Length=471

 Score =   121 bits (304),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ +SNATII+E+VLN  L E+  ALL++DV  KLV+ ++ N+K  +
Sbjct  1    MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            +L+++A+G NKRK+IQ AVF EL K++DPG  ++TP KGK +V+MFV
Sbjct  61   DLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNVIMFV  107



>ref|XP_006240159.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X1 [Rattus norvegicus]
Length=447

 Score =   121 bits (303),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ +SNATII+E+VLN  L E+  ALL++DV  KLV+ ++ N+K  +
Sbjct  1    MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            +L+++A+G NKRK+IQ AVF EL K++DPG  ++TP KGK +V+MFV
Sbjct  61   DLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNVIMFV  107



>ref|XP_008828041.1| PREDICTED: signal recognition particle 54 kDa protein [Nannospalax 
galili]
Length=469

 Score =   121 bits (303),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ +SNATII+E+VLN  L E+  ALL++DV  KLV+ ++ N+K  +
Sbjct  1    MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            +L+++A+G NKRK+IQ AVF EL K++DPG  ++TP KGK +V+MFV
Sbjct  61   DLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNVIMFV  107



>ref|NP_001093580.1| signal recognition particle 54C [Mus musculus]
Length=504

 Score =   121 bits (304),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ +SNATII+E+VLN  L E+  ALL++DV  KLV+ ++ N+K  +
Sbjct  1    MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            +L+++A+G NKRK+IQ AVF EL K++DPG  ++TP KGK +V+MFV
Sbjct  61   DLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNVIMFV  107



>ref|XP_010114686.1| PREDICTED: signal recognition particle 54 kDa protein, partial 
[Chlamydotis macqueenii]
Length=442

 Score =   121 bits (303),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ +SNATII+E+VLN  L E+  ALL++DV  KLV+ ++ N+K  +
Sbjct  1    MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            +L+++A+G NKRK+IQ AVF EL K++DPG  ++TP KGK +++MFV
Sbjct  61   DLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNIIMFV  107



>gb|KIY97276.1| hypothetical protein MNEG_10689, partial [Monoraphidium neglectum]
Length=161

 Score =   116 bits (290),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 62/126 (49%), Positives = 82/126 (65%), Gaps = 19/126 (15%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVL +LG  I+ AL  M+N  +IDE VL++CL EI +ALLQSDV  +LV +++ NIK+ V
Sbjct  1    MVLNELGRGITSALAAMANTMVIDEAVLDDCLKEICKALLQSDVNVRLVANLRANIKKRV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKIL-------------------DPGKPSFTPKKGKP  559
            N+++LAAG NKRKII++AVF+ELC +L                     G  S+  KKGKP
Sbjct  61   NVEELAAGLNKRKIIEKAVFDELCAMLDGDGDKDKDAKAKEASKGGKDGAGSYGVKKGKP  120

Query  560  SVVMFV  577
             VVMFV
Sbjct  121  HVVMFV  126



>ref|NP_036029.2| signal recognition particle 54 kDa protein [Mus musculus]
 ref|NP_001093579.1| signal recognition particle 54 kDa protein [Mus musculus]
 ref|XP_005080557.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X1 [Mesocricetus auratus]
 sp|P14576.2|SRP54_MOUSE RecName: Full=Signal recognition particle 54 kDa protein; Short=SRP54 
[Mus musculus]
 dbj|BAB27921.1| unnamed protein product [Mus musculus]
 gb|AAH19683.1| Signal recognition particle 54a [Mus musculus]
 dbj|BAE22786.1| unnamed protein product [Mus musculus]
Length=504

 Score =   121 bits (304),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ +SNATII+E+VLN  L E+  ALL++DV  KLV+ ++ N+K  +
Sbjct  1    MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            +L+++A+G NKRK+IQ AVF EL K++DPG  ++TP KGK +V+MFV
Sbjct  61   DLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNVIMFV  107



>gb|AAH05543.1| Srp54c protein [Mus musculus]
Length=500

 Score =   121 bits (304),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ +SNATII+E+VLN  L E+  ALL++DV  KLV+ ++ N+K  +
Sbjct  1    MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            +L+++A+G NKRK+IQ AVF EL K++DPG  ++TP KGK +V+MFV
Sbjct  61   DLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNVIMFV  107



>emb|CAA34386.1| unnamed protein product [Mus musculus]
Length=504

 Score =   121 bits (304),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ +SNATII+E+VLN  L E+  ALL++DV  KLV+ ++ N+K  +
Sbjct  1    MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            +L+++A+G NKRK+IQ AVF EL K++DPG  ++TP KGK +V+MFV
Sbjct  61   DLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNVIMFV  107



>ref|XP_006732286.1| PREDICTED: signal recognition particle 54 kDa protein [Leptonychotes 
weddellii]
Length=504

 Score =   121 bits (304),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ +SNATII+E+VLN  L E+  ALL++DV  KLV+ ++ N+K  +
Sbjct  1    MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            +L+++A+G NKRK+IQ AVF EL K++DPG  ++TP KGK +V+MFV
Sbjct  61   DLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNVIMFV  107



>ref|XP_003511430.2| PREDICTED: signal recognition particle 54 kDa protein isoform 
X1 [Cricetulus griseus]
Length=504

 Score =   121 bits (304),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ +SNATII+E+VLN  L E+  ALL++DV  KLV+ ++ N+K  +
Sbjct  1    MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            +L+++A+G NKRK+IQ AVF EL K++DPG  ++TP KGK +V+MFV
Sbjct  61   DLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNVIMFV  107



>ref|NP_446323.1| signal recognition particle 54 kDa protein [Rattus norvegicus]
 ref|XP_007530297.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X1 [Erinaceus europaeus]
 sp|Q6AYB5.1|SRP54_RAT RecName: Full=Signal recognition particle 54 kDa protein; Short=SRP54 
[Rattus norvegicus]
 gb|AAH79117.1| Signal recognition particle 54a [Rattus norvegicus]
Length=504

 Score =   121 bits (303),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ +SNATII+E+VLN  L E+  ALL++DV  KLV+ ++ N+K  +
Sbjct  1    MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            +L+++A+G NKRK+IQ AVF EL K++DPG  ++TP KGK +V+MFV
Sbjct  61   DLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNVIMFV  107



>gb|KFP35422.1| Signal recognition particle 54 kDa protein, partial [Chlamydotis 
macqueenii]
Length=443

 Score =   121 bits (303),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ +SNATII+E+VLN  L E+  ALL++DV  KLV+ ++ N+K  +
Sbjct  1    MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            +L+++A+G NKRK+IQ AVF EL K++DPG  ++TP KGK +++MFV
Sbjct  61   DLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNIIMFV  107



>ref|XP_008069648.1| PREDICTED: signal recognition particle 54 kDa protein [Tarsius 
syrichta]
Length=504

 Score =   121 bits (303),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ +SNATII+E+VLN  L E+  ALL++DV  KLV+ ++ N+K  +
Sbjct  1    MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            +L+++A+G NKRK+IQ AVF EL K++DPG  ++TP KGK +V+MFV
Sbjct  61   DLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNVIMFV  107



>ref|NP_003127.1| signal recognition particle 54 kDa protein isoform 1 [Homo sapiens]
 ref|NP_001003272.1| signal recognition particle 54 kDa protein [Canis lupus familiaris]
 ref|NP_001033290.1| signal recognition particle 54 kDa protein [Bos taurus]
 ref|NP_001126912.1| signal recognition particle 54 kDa protein [Pongo abelii]
 ref|NP_001247781.1| signal recognition particle 54 kDa protein [Macaca mulatta]
 ref|NP_001270849.1| signal recognition particle 54 kDa protein [Macaca fascicularis]
 ref|XP_001491075.1| PREDICTED: signal recognition particle 54 kDa protein isoformX1 
[Equus caballus]
 ref|XP_002753859.1| PREDICTED: signal recognition particle 54 kDa protein [Callithrix 
jacchus]
 ref|XP_003263750.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
1 [Nomascus leucogenys]
 ref|XP_001927834.3| PREDICTED: signal recognition particle 54 kDa protein isoformX1 
[Sus scrofa]
 ref|XP_003408881.1| PREDICTED: signal recognition particle 54 kDa protein [Loxodonta 
africana]
 ref|XP_003792021.1| PREDICTED: signal recognition particle 54 kDa protein [Otolemur 
garnettii]
 ref|XP_003821240.1| PREDICTED: signal recognition particle 54 kDa protein [Pan paniscus]
 ref|XP_003901747.1| PREDICTED: signal recognition particle 54 kDa protein [Papio 
anubis]
 ref|XP_004017939.1| PREDICTED: signal recognition particle 54 kDa protein [Ovis aries]
 ref|XP_004270009.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
1 [Orcinus orca]
 ref|XP_004270010.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
2 [Orcinus orca]
 ref|XP_004399862.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
1 [Odobenus rosmarus divergens]
 ref|XP_004399863.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
2 [Odobenus rosmarus divergens]
 ref|XP_004436468.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
1 [Ceratotherium simum simum]
 ref|XP_004436469.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
2 [Ceratotherium simum simum]
 ref|XP_004467960.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
1 [Dasypus novemcinctus]
 ref|XP_004467961.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
2 [Dasypus novemcinctus]
 ref|XP_004467962.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
3 [Dasypus novemcinctus]
 ref|XP_004467963.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
4 [Dasypus novemcinctus]
 ref|XP_004584811.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X1 [Ochotona princeps]
 ref|XP_004612174.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X1 [Sorex araneus]
 ref|XP_004637148.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X1 [Octodon degus]
 ref|XP_004681999.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X1 [Condylura cristata]
 ref|XP_004773406.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X1 [Mustela putorius furo]
 ref|XP_004773407.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X2 [Mustela putorius furo]
 ref|XP_004820503.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X1 [Mustela putorius furo]
 ref|XP_004820504.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X2 [Mustela putorius furo]
 ref|XP_004884706.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X1 [Heterocephalus glaber]
 ref|XP_004867624.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X1 [Heterocephalus glaber]
 ref|XP_004867625.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X2 [Heterocephalus glaber]
 ref|XP_005222113.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X1 [Bos taurus]
 ref|XP_005222114.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X1 [Bos taurus]
 ref|XP_005222115.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X1 [Bos taurus]
 ref|XP_005322735.1| PREDICTED: signal recognition particle 54 kDa protein [Ictidomys 
tridecemlineatus]
 ref|XP_005376990.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X1 [Chinchilla lanigera]
 ref|XP_005376991.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X2 [Chinchilla lanigera]
 ref|XP_005376992.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X3 [Chinchilla lanigera]
 ref|XP_005561120.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X1 [Macaca fascicularis]
 ref|XP_005561122.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X3 [Macaca fascicularis]
 ref|XP_005561123.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X4 [Macaca fascicularis]
 ref|XP_005603493.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X2 [Equus caballus]
 ref|XP_005623237.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X1 [Canis lupus familiaris]
 ref|XP_005623238.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X2 [Canis lupus familiaris]
 ref|XP_005656358.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X2 [Sus scrofa]
 ref|XP_005656359.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X3 [Sus scrofa]
 ref|XP_005695288.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X1 [Capra hircus]
 ref|XP_005865026.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X1 [Myotis brandtii]
 ref|XP_005891873.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X1 [Bos mutus]
 ref|XP_005983412.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X1 [Pantholops hodgsonii]
 ref|XP_005983413.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X2 [Pantholops hodgsonii]
 ref|XP_006085900.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X1 [Myotis lucifugus]
 ref|XP_006186443.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X1 [Camelus ferus]
 ref|XP_006212824.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X1 [Vicugna pacos]
 ref|XP_006152438.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X1 [Tupaia chinensis]
 ref|XP_006152439.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X2 [Tupaia chinensis]
 ref|XP_006152440.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X3 [Tupaia chinensis]
 ref|XP_006759769.1| PREDICTED: signal recognition particle 54 kDa protein [Myotis 
davidii]
 ref|XP_006913539.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X1 [Pteropus alecto]
 ref|XP_006913540.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X2 [Pteropus alecto]
 ref|XP_007112372.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X1 [Physeter catodon]
 ref|XP_007112373.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X2 [Physeter catodon]
 ref|XP_006043917.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X1 [Bubalus bubalis]
 ref|XP_006043918.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X2 [Bubalus bubalis]
 ref|XP_007180768.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X1 [Balaenoptera acutorostrata scammoni]
 ref|XP_007180769.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X2 [Balaenoptera acutorostrata scammoni]
 ref|XP_007464877.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X1 [Lipotes vexillifer]
 ref|XP_007660701.1| PREDICTED: signal recognition particle 54 kDa protein [Ornithorhynchus 
anatinus]
 ref|XP_007984660.1| PREDICTED: signal recognition particle 54 kDa protein [Chlorocebus 
sabaeus]
 ref|XP_007984661.1| PREDICTED: signal recognition particle 54 kDa protein [Chlorocebus 
sabaeus]
 ref|XP_007984663.1| PREDICTED: signal recognition particle 54 kDa protein [Chlorocebus 
sabaeus]
 ref|XP_008511181.1| PREDICTED: signal recognition particle 54 kDa protein [Equus 
przewalskii]
 ref|XP_008511182.1| PREDICTED: signal recognition particle 54 kDa protein [Equus 
przewalskii]
 ref|XP_008572042.1| PREDICTED: signal recognition particle 54 kDa protein [Galeopterus 
variegatus]
 ref|XP_008692396.1| PREDICTED: signal recognition particle 54 kDa protein [Ursus 
maritimus]
 ref|XP_008692403.1| PREDICTED: signal recognition particle 54 kDa protein [Ursus 
maritimus]
 ref|XP_008692409.1| PREDICTED: signal recognition particle 54 kDa protein [Ursus 
maritimus]
 ref|XP_009004173.1| PREDICTED: signal recognition particle 54 kDa protein [Callithrix 
jacchus]
 ref|XP_009004174.1| PREDICTED: signal recognition particle 54 kDa protein [Callithrix 
jacchus]
 ref|XP_009004175.1| PREDICTED: signal recognition particle 54 kDa protein [Callithrix 
jacchus]
 ref|XP_009004177.1| PREDICTED: signal recognition particle 54 kDa protein [Callithrix 
jacchus]
 ref|XP_009004178.1| PREDICTED: signal recognition particle 54 kDa protein [Callithrix 
jacchus]
 ref|XP_008972920.1| PREDICTED: signal recognition particle 54 kDa protein [Pan paniscus]
 ref|XP_009209652.1| PREDICTED: signal recognition particle 54 kDa protein [Papio 
anubis]
 ref|XP_009209653.1| PREDICTED: signal recognition particle 54 kDa protein [Papio 
anubis]
 ref|XP_009425925.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X1 [Pan troglodytes]
 ref|XP_009425926.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X1 [Pan troglodytes]
 ref|XP_010375668.1| PREDICTED: signal recognition particle 54 kDa protein [Rhinopithecus 
roxellana]
 ref|XP_010631906.1| PREDICTED: signal recognition particle 54 kDa protein [Fukomys 
damarensis]
 ref|XP_010631907.1| PREDICTED: signal recognition particle 54 kDa protein [Fukomys 
damarensis]
 ref|XP_010833590.1| PREDICTED: signal recognition particle 54 kDa protein [Bison 
bison bison]
 ref|XP_010833591.1| PREDICTED: signal recognition particle 54 kDa protein [Bison 
bison bison]
 ref|XP_010966155.1| PREDICTED: signal recognition particle 54 kDa protein [Camelus 
bactrianus]
 ref|XP_010966156.1| PREDICTED: signal recognition particle 54 kDa protein [Camelus 
bactrianus]
 ref|XP_010984433.1| PREDICTED: signal recognition particle 54 kDa protein [Camelus 
dromedarius]
 ref|XP_010984434.1| PREDICTED: signal recognition particle 54 kDa protein [Camelus 
dromedarius]
 ref|XP_011227684.1| PREDICTED: signal recognition particle 54 kDa protein [Ailuropoda 
melanoleuca]
 ref|XP_011227685.1| PREDICTED: signal recognition particle 54 kDa protein [Ailuropoda 
melanoleuca]
 ref|XP_011227686.1| PREDICTED: signal recognition particle 54 kDa protein [Ailuropoda 
melanoleuca]
 sp|P61010.1|SRP54_CANFA RecName: Full=Signal recognition particle 54 kDa protein; Short=SRP54 
[Canis lupus familiaris]
 sp|P61011.1|SRP54_HUMAN RecName: Full=Signal recognition particle 54 kDa protein; Short=SRP54 
[Homo sapiens]
 sp|Q5R4R6.1|SRP54_PONAB RecName: Full=Signal recognition particle 54 kDa protein; Short=SRP54 
[Pongo abelii]
 sp|Q4R965.1|SRP54_MACFA RecName: Full=Signal recognition particle 54 kDa protein; Short=SRP54 
[Macaca fascicularis]
 sp|Q2T9U1.1|SRP54_BOVIN RecName: Full=Signal recognition particle 54 kDa protein; Short=SRP54 
[Bos taurus]
 pdb|2J37|W Chain W, Model Of Mammalian Srp Bound To 80s Rncs
 emb|CAA34385.1| unnamed protein product [Canis lupus familiaris]
 emb|CAA60132.1| SRP 54 [Homo sapiens]
 gb|AAC50994.1| signal recognition particle [Homo sapiens]
 gb|AAH00652.1| Signal recognition particle 54kDa [Homo sapiens]
 gb|AAH03389.1| Signal recognition particle 54kDa [Homo sapiens]
 emb|CAH93250.1| hypothetical protein [Pongo abelii]
 dbj|BAE00356.1| unnamed protein product [Macaca fascicularis]
 gb|AAI11271.1| Signal recognition particle 54kDa [Bos taurus]
 dbj|BAE87721.1| unnamed protein product [Macaca fascicularis]
 dbj|BAE87830.1| unnamed protein product [Macaca fascicularis]
 gb|ACB73260.1| signal recognition particle (predicted) [Rhinolophus ferrumequinum]
 dbj|BAG35706.1| unnamed protein product [Homo sapiens]
 tpg|DAA17468.1| TPA: signal recognition particle 54 kDa protein [Bos taurus]
 gb|ADZ15911.1| signal recognition particle 54kDa [synthetic construct]
 gb|EHB02974.1| Signal recognition particle 54 kDa protein [Heterocephalus glaber]
 gb|EHH27819.1| hypothetical protein EGK_18109 [Macaca mulatta]
 gb|EHH63553.1| hypothetical protein EGM_16545 [Macaca fascicularis]
 gb|ELR59207.1| Signal recognition particle 54 kDa protein [Bos mutus]
 gb|AIC63179.1| SRP54, partial [synthetic construct]
 prf||1512310A SRP protein 54kD
Length=504

 Score =   121 bits (303),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ +SNATII+E+VLN  L E+  ALL++DV  KLV+ ++ N+K  +
Sbjct  1    MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            +L+++A+G NKRK+IQ AVF EL K++DPG  ++TP KGK +V+MFV
Sbjct  61   DLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNVIMFV  107



>ref|XP_004055129.1| PREDICTED: signal recognition particle 54 kDa protein [Gorilla 
gorilla gorilla]
Length=502

 Score =   121 bits (303),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ +SNATII+E+VLN  L E+  ALL++DV  KLV+ ++ N+K  +
Sbjct  1    MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            +L+++A+G NKRK+IQ AVF EL K++DPG  ++TP KGK +V+MFV
Sbjct  61   DLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNVIMFV  107



>ref|XP_003987586.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X2 [Felis catus]
 ref|XP_004698583.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X1 [Echinops telfairi]
 ref|XP_006932864.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X2 [Felis catus]
 ref|XP_007073799.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X2 [Panthera tigris altaica]
 ref|XP_007073800.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X3 [Panthera tigris altaica]
Length=504

 Score =   121 bits (303),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ +SNATII+E+VLN  L E+  ALL++DV  KLV+ ++ N+K  +
Sbjct  1    MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            +L+++A+G NKRK+IQ AVF EL K++DPG  ++TP KGK +V+MFV
Sbjct  61   DLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNVIMFV  107



>ref|NP_001267455.1| signal recognition particle 54 kDa protein [Pan troglodytes]
 dbj|BAK61901.1| signal recognition particle 54 kDa protein [Pan troglodytes]
Length=504

 Score =   121 bits (303),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ +SNATII+E+VLN  L E+  ALL++DV  KLV+ ++ N+K  +
Sbjct  1    MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            +L+++A+G NKRK+IQ AVF EL K++DPG  ++TP KGK +V+MFV
Sbjct  61   DLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNVIMFV  107



>ref|XP_006258810.1| PREDICTED: signal recognition particle 54 kDa protein [Alligator 
mississippiensis]
Length=447

 Score =   120 bits (302),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ +SNATII+E+VLN  L E+  ALL++DV  KLV+ ++ N+K  +
Sbjct  1    MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            +L+++A+G NKRK+IQ AVF EL K++DPG  ++TP KGK +++MFV
Sbjct  61   DLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNIIMFV  107



>gb|ETE73017.1| Signal recognition particle 54 kDa protein [Ophiophagus hannah]
Length=447

 Score =   120 bits (302),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ +SNATII+E+VLN  L E+  ALL++DV  KLV+ ++ N+K  +
Sbjct  1    MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            +L+++A+G NKRK+IQ AVF EL K++DPG  ++TP KGK +++MFV
Sbjct  61   DLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNIIMFV  107



>ref|XP_002157121.2| PREDICTED: signal recognition particle 54 kDa protein-like, partial 
[Hydra vulgaris]
Length=282

 Score =   119 bits (297),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 80/107 (75%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ +SNAT+I+E+VLN  L EI  ALL++DV  +LV+ ++ NIK   
Sbjct  1    MVLADLGRKITSALKSLSNATVINEEVLNLMLKEICAALLEADVNVQLVQKLRANIKNAA  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            N +++AAG NKR++IQ  VF ELCK++DPG  ++ P KGK +V+MFV
Sbjct  61   NFEEMAAGTNKRRLIQHTVFQELCKLVDPGVKAWQPIKGKNNVIMFV  107



>ref|XP_004376574.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
1 [Trichechus manatus latirostris]
Length=504

 Score =   120 bits (302),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ +SNATII+E+VLN  L E+  ALL++DV  KLV+ ++ N+K  +
Sbjct  1    MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            +L+++A+G NKRK+IQ AVF EL K++DPG  ++TP KGK +V+MFV
Sbjct  61   DLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPMKGKQNVIMFV  107



>ref|XP_009288658.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X2 [Aptenodytes forsteri]
Length=493

 Score =   120 bits (302),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ +SNATII+E+VLN  L E+  ALL++DV  KLV+ ++ N+K  +
Sbjct  1    MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            +L+++A+G NKRK+IQ AVF EL K++DPG  ++TP KGK +++MFV
Sbjct  61   DLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNIIMFV  107



>ref|XP_009951795.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X1 [Leptosomus discolor]
 gb|KFQ13032.1| Signal recognition particle 54 kDa protein [Leptosomus discolor]
Length=504

 Score =   120 bits (302),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ +SNATII+E+VLN  L E+  ALL++DV  KLV+ ++ N+K  +
Sbjct  1    MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            +L+++A+G NKRK+IQ AVF EL K++DPG  ++TP KGK +++MFV
Sbjct  61   DLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNIIMFV  107



>ref|XP_006015436.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X1 [Alligator sinensis]
Length=504

 Score =   120 bits (302),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ +SNATII+E+VLN  L E+  ALL++DV  KLV+ ++ N+K  +
Sbjct  1    MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            +L+++A+G NKRK+IQ AVF EL K++DPG  ++TP KGK +++MFV
Sbjct  61   DLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNIIMFV  107



>gb|EMC83844.1| Signal recognition particle 54 kDa protein, partial [Columba 
livia]
Length=500

 Score =   120 bits (302),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ +SNATII+E+VLN  L E+  ALL++DV  KLV+ ++ N+K  +
Sbjct  1    MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            +L+++A+G NKRK+IQ AVF EL K++DPG  ++TP KGK +++MFV
Sbjct  61   DLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNIIMFV  107



>ref|XP_009317642.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X1 [Pygoscelis adeliae]
Length=508

 Score =   120 bits (302),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ +SNATII+E+VLN  L E+  ALL++DV  KLV+ ++ N+K  +
Sbjct  1    MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            +L+++A+G NKRK+IQ AVF EL K++DPG  ++TP KGK +++MFV
Sbjct  61   DLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNIIMFV  107



>ref|XP_011337551.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X1 [Cerapachys biroi]
Length=527

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ +SNAT+I+E+VLN  L EI  ALL++DV  +LV+ ++ N+++++
Sbjct  1    MVLADLGRKITSALRSLSNATVINEEVLNSMLKEICAALLEADVNIRLVKKLRENVRQVI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            + +D+A G NKR++IQ AVF EL K++DPG  ++ P KG+P+V+MFV
Sbjct  61   DFEDMAGGLNKRRMIQSAVFKELVKLIDPGVKAYQPVKGRPNVIMFV  107



>ref|XP_011146525.1| PREDICTED: signal recognition particle 54 kDa protein [Harpegnathos 
saltator]
 gb|EFN79801.1| Signal recognition particle 54 kDa protein [Harpegnathos saltator]
Length=506

 Score =   120 bits (302),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ +SNAT+I+E+VLN  L EI  ALL++DV  +LV+ ++ N+++++
Sbjct  1    MVLADLGRKITSALRSLSNATVINEEVLNSMLKEICAALLEADVNIRLVKKLRENVRQVI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            + +D+A G NKR++IQ AVF EL K++DPG  ++ P KG+P+V+MFV
Sbjct  61   DFEDMAGGLNKRRMIQSAVFKELVKLIDPGVKAYQPVKGRPNVIMFV  107



>ref|XP_011337552.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X2 [Cerapachys biroi]
 gb|EZA54974.1| Signal recognition particle 54 kDa protein [Cerapachys biroi]
Length=506

 Score =   120 bits (302),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ +SNAT+I+E+VLN  L EI  ALL++DV  +LV+ ++ N+++++
Sbjct  1    MVLADLGRKITSALRSLSNATVINEEVLNSMLKEICAALLEADVNIRLVKKLRENVRQVI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            + +D+A G NKR++IQ AVF EL K++DPG  ++ P KG+P+V+MFV
Sbjct  61   DFEDMAGGLNKRRMIQSAVFKELVKLIDPGVKAYQPVKGRPNVIMFV  107



>ref|XP_008503449.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X1 [Calypte anna]
 gb|KFO97182.1| Signal recognition particle 54 kDa protein [Calypte anna]
Length=504

 Score =   120 bits (302),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ +SNATII+E+VLN  L E+  ALL++DV  KLV+ ++ N+K  +
Sbjct  1    MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            +L+++A+G NKRK+IQ AVF EL K++DPG  ++TP KGK +++MFV
Sbjct  61   DLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNIIMFV  107



>ref|XP_008101593.1| PREDICTED: LOW QUALITY PROTEIN: signal recognition particle 54 
kDa protein [Anolis carolinensis]
Length=504

 Score =   120 bits (302),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ +SNATII+E+VLN  L E+  ALL++DV  KLV+ ++ N+K  +
Sbjct  1    MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            +L+++A+G NKRK+IQ AVF EL K++DPG  ++TP KGK +++MFV
Sbjct  61   DLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNIIMFV  107



>ref|XP_006117744.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X1 [Pelodiscus sinensis]
Length=504

 Score =   120 bits (302),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ +SNATII+E+VLN  L E+  ALL++DV  KLV+ ++ N+K  +
Sbjct  1    MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            +L+++A+G NKRK+IQ AVF EL K++DPG  ++TP KGK +++MFV
Sbjct  61   DLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNIIMFV  107



>ref|XP_005285401.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X1 [Chrysemys picta bellii]
 ref|XP_007065319.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X1 [Chelonia mydas]
 ref|XP_008162511.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X1 [Chrysemys picta bellii]
 ref|XP_008162518.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X1 [Chrysemys picta bellii]
 ref|XP_008162521.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X1 [Chrysemys picta bellii]
Length=504

 Score =   120 bits (302),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ +SNATII+E+VLN  L E+  ALL++DV  KLV+ ++ N+K  +
Sbjct  1    MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            +L+++A+G NKRK+IQ AVF EL K++DPG  ++TP KGK +++MFV
Sbjct  61   DLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNIIMFV  107



>ref|XP_624497.2| PREDICTED: signal recognition particle 54 kDa protein-like [Apis 
mellifera]
 ref|XP_006622562.1| PREDICTED: signal recognition particle 54 kDa protein-like [Apis 
dorsata]
Length=498

 Score =   120 bits (302),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 82/107 (77%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ +SNAT+I+E+VLN  L EI  ALL++DV  +LV+ ++ N++ ++
Sbjct  1    MVLADLGRKITSALRSLSNATVINEEVLNSMLKEICAALLEADVNIRLVKKLRENVRLVI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            + DD+A G NKR++IQ AVF EL K++DPG  ++ P KG+P+++MFV
Sbjct  61   DFDDMAGGLNKRRMIQSAVFKELVKLIDPGVKAYQPIKGRPNIIMFV  107



>ref|XP_011252983.1| PREDICTED: signal recognition particle 54 kDa protein [Camponotus 
floridanus]
 gb|EFN70554.1| Signal recognition particle 54 kDa protein [Camponotus floridanus]
Length=506

 Score =   120 bits (302),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ +SNAT+I+E+VLN  L EI  ALL++DV  +LV+ ++ N+++++
Sbjct  1    MVLADLGRKITSALRSLSNATVINEEVLNSMLKEICAALLEADVNIRLVKKLRENVRQVI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            + +D+A G NKR++IQ AVF EL K++DPG  ++ P KG+P+V+MFV
Sbjct  61   DFEDMAGGLNKRRMIQSAVFKELVKLIDPGVKAYQPVKGRPNVIMFV  107



>ref|XP_010159752.1| PREDICTED: signal recognition particle 54 kDa protein [Eurypyga 
helias]
 gb|KFV99709.1| Signal recognition particle 54 kDa protein [Eurypyga helias]
Length=504

 Score =   120 bits (302),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ +SNATII+E+VLN  L E+  ALL++DV  KLV+ ++ N+K  +
Sbjct  1    MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            +L+++A+G NKRK+IQ AVF EL K++DPG  ++TP KGK +++MFV
Sbjct  61   DLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNIIMFV  107



>ref|XP_421238.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
2 [Gallus gallus]
 ref|XP_002200552.1| PREDICTED: signal recognition particle 54 kDa protein [Taeniopygia 
guttata]
 ref|XP_005014703.1| PREDICTED: signal recognition particle 54 kDa protein [Anas platyrhynchos]
 ref|XP_005047356.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X1 [Ficedula albicollis]
 ref|XP_005149362.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X1 [Melopsittacus undulatus]
 ref|XP_005243904.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X1 [Falco peregrinus]
 ref|XP_005479897.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X1 [Zonotrichia albicollis]
 ref|XP_005417545.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X1 [Geospiza fortis]
 ref|XP_005520352.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X1 [Pseudopodoces humilis]
 ref|XP_005502371.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X1 [Columba livia]
 ref|XP_008637801.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X1 [Corvus brachyrhynchos]
 ref|XP_008923236.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X1 [Manacus vitellinus]
 ref|XP_008939832.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X1 [Merops nubicus]
 ref|XP_009068026.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X1 [Acanthisitta chloris]
 ref|XP_009100164.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X1 [Serinus canaria]
 ref|XP_009288657.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X1 [Aptenodytes forsteri]
 ref|XP_009317643.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X2 [Pygoscelis adeliae]
 ref|XP_009490996.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X1 [Pelecanus crispus]
 ref|XP_009462352.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X1 [Nipponia nippon]
 ref|XP_009506830.1| PREDICTED: signal recognition particle 54 kDa protein [Phalacrocorax 
carbo]
 ref|XP_009561900.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X1 [Cuculus canorus]
 ref|XP_009579599.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X1 [Fulmarus glacialis]
 ref|XP_009669227.1| PREDICTED: signal recognition particle 54 kDa protein [Struthio 
camelus australis]
 ref|XP_009644986.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X1 [Egretta garzetta]
 ref|XP_009820299.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X1 [Gavia stellata]
 ref|XP_009699571.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X1 [Cariama cristata]
 ref|XP_009872064.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X1 [Apaloderma vittatum]
 ref|XP_009885250.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X1 [Charadrius vociferus]
 ref|XP_009901282.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X1 [Picoides pubescens]
 ref|XP_009917293.1| PREDICTED: signal recognition particle 54 kDa protein [Haliaeetus 
albicilla]
 ref|XP_009942440.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X1 [Opisthocomus hoazin]
 ref|XP_010008066.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X1 [Nestor notabilis]
 ref|XP_009982357.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X1 [Tauraco erythrolophus]
 ref|XP_009992157.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X1 [Chaetura pelagica]
 ref|XP_010141794.1| PREDICTED: signal recognition particle 54 kDa protein [Buceros 
rhinoceros silvestris]
 ref|XP_010170647.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X1 [Caprimulgus carolinensis]
 ref|XP_010083828.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X1 [Pterocles gutturalis]
 ref|XP_010181920.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X1 [Mesitornis unicolor]
 ref|XP_010202126.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X1 [Colius striatus]
 ref|XP_010295236.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X1 [Phaethon lepturus]
 ref|XP_010302673.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X1 [Balearica regulorum gibbericeps]
 ref|XP_010390587.1| PREDICTED: signal recognition particle 54 kDa protein [Corvus 
cornix cornix]
 ref|XP_010581945.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X1 [Haliaeetus leucocephalus]
 ref|XP_010709974.1| PREDICTED: signal recognition particle 54 kDa protein [Meleagris 
gallopavo]
 ref|XP_010709975.1| PREDICTED: signal recognition particle 54 kDa protein [Meleagris 
gallopavo]
 ref|XP_010709976.1| PREDICTED: signal recognition particle 54 kDa protein [Meleagris 
gallopavo]
 gb|EOB04999.1| Signal recognition particle 54 kDa protein, partial [Anas platyrhynchos]
 gb|KFO05257.1| Signal recognition particle 54 kDa protein [Balearica regulorum 
gibbericeps]
 gb|KFO63709.1| Signal recognition particle 54 kDa protein [Corvus brachyrhynchos]
 gb|KFO78192.1| Signal recognition particle 54 kDa protein [Cuculus canorus]
 gb|KFO94321.1| Signal recognition particle 54 kDa protein [Buceros rhinoceros 
silvestris]
 gb|KFP22453.1| Signal recognition particle 54 kDa protein [Egretta garzetta]
 gb|KFP23612.1| Signal recognition particle 54 kDa protein [Colius striatus]
 gb|KFP46499.1| Signal recognition particle 54 kDa protein [Cathartes aura]
 gb|KFP65598.1| Signal recognition particle 54 kDa protein [Cariama cristata]
 gb|KFP75301.1| Signal recognition particle 54 kDa protein [Acanthisitta chloris]
 gb|KFP90985.1| Signal recognition particle 54 kDa protein [Apaloderma vittatum]
 gb|KFQ04015.1| Signal recognition particle 54 kDa protein [Haliaeetus albicilla]
 gb|KFQ18888.1| Signal recognition particle 54 kDa protein [Merops nubicus]
 gb|KFQ27173.1| Signal recognition particle 54 kDa protein [Mesitornis unicolor]
 gb|KFQ46098.1| Signal recognition particle 54 kDa protein [Nestor notabilis]
 gb|KFQ58076.1| Signal recognition particle 54 kDa protein [Pelecanus crispus]
 gb|KFQ70544.1| Signal recognition particle 54 kDa protein [Phaethon lepturus]
 gb|KFQ72852.1| Signal recognition particle 54 kDa protein [Phoenicopterus ruber 
ruber]
 gb|KFQ96185.1| Signal recognition particle 54 kDa protein [Nipponia nippon]
 gb|KFR01995.1| Signal recognition particle 54 kDa protein [Opisthocomus hoazin]
 gb|KFU86806.1| Signal recognition particle 54 kDa protein [Chaetura pelagica]
 gb|KFV01392.1| Signal recognition particle 54 kDa protein [Tauraco erythrolophus]
 gb|KFV17067.1| Signal recognition particle 54 kDa protein [Pterocles gutturalis]
 gb|KFV49104.1| Signal recognition particle 54 kDa protein [Gavia stellata]
 gb|KFV69234.1| Signal recognition particle 54 kDa protein [Picoides pubescens]
 gb|KFV79277.1| Signal recognition particle 54 kDa protein [Struthio camelus 
australis]
 gb|KFW63850.1| Signal recognition particle 54 kDa protein [Pygoscelis adeliae]
 gb|KFW81910.1| Signal recognition particle 54 kDa protein [Manacus vitellinus]
 gb|KFW93093.1| Signal recognition particle 54 kDa protein [Phalacrocorax carbo]
 gb|KFZ62567.1| Signal recognition particle 54 kDa protein [Caprimulgus carolinensis]
 gb|KFZ67655.1| Signal recognition particle 54 kDa protein [Podiceps cristatus]
 gb|KGL94888.1| Signal recognition particle 54 kDa protein [Charadrius vociferus]
Length=504

 Score =   120 bits (302),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ +SNATII+E+VLN  L E+  ALL++DV  KLV+ ++ N+K  +
Sbjct  1    MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            +L+++A+G NKRK+IQ AVF EL K++DPG  ++TP KGK +++MFV
Sbjct  61   DLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNIIMFV  107



>ref|XP_007436853.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X1 [Python bivittatus]
 ref|XP_007436854.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X2 [Python bivittatus]
 ref|XP_007436855.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X3 [Python bivittatus]
Length=504

 Score =   120 bits (302),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ +SNATII+E+VLN  L E+  ALL++DV  KLV+ ++ N+K  +
Sbjct  1    MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            +L+++A+G NKRK+IQ AVF EL K++DPG  ++TP KGK +++MFV
Sbjct  61   DLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNIIMFV  107



>ref|XP_005444184.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X1 [Falco cherrug]
Length=504

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ +SNATII+E+VLN  L E+  ALL++DV  KLV+ ++ N+K  +
Sbjct  1    MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            +L+++A+G NKRK+IQ AVF EL K++DPG  ++TP KGK +++MFV
Sbjct  61   DLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNIIMFV  107



>ref|XP_004082449.2| PREDICTED: signal recognition particle 54 kDa protein, partial 
[Oryzias latipes]
Length=412

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ +SNATII+E+VLN  L E+  ALL++DV  KLV+ ++ N+K  +
Sbjct  1    MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCAALLEADVNIKLVKQLRENVKAAI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            +L+++A+G NKR++IQ AVF EL K++DPG  ++TP KGK +V+MFV
Sbjct  61   DLEEMASGLNKRRMIQHAVFKELVKLVDPGVKAWTPTKGKNNVIMFV  107



>ref|XP_008267717.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X3 [Oryctolagus cuniculus]
Length=575

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ +SNATII+E+VLN  L E+  ALL++DV  KLV+ ++ N+K  +
Sbjct  1    MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            +L+++A+G NKRK+IQ AVF EL K++DPG  ++TP KGK +V+MFV
Sbjct  61   DLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNVIMFV  107



>gb|KDR16155.1| Signal recognition particle 54 kDa protein [Zootermopsis nevadensis]
Length=504

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 81/107 (76%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ +SNAT+I+E VLN  L EI  ALL++DV  +LV+D++ N++ ++
Sbjct  1    MVLADLGRKITSALRSLSNATVINEDVLNAMLKEICTALLEADVNIRLVKDLRENVRAVI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            + D++A G NKR++IQ AVF EL K++DPG  +  P KGKP+++MFV
Sbjct  61   DFDEMAGGLNKRRMIQSAVFKELVKLVDPGVKAHQPVKGKPNIIMFV  107



>ref|XP_011314020.1| PREDICTED: signal recognition particle 54 kDa protein [Fopius 
arisanus]
Length=505

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 82/107 (77%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ +SNAT+I+E+VLN  L EI  ALL++DV  +LV+ ++ N++ ++
Sbjct  1    MVLADLGRKITSALRSLSNATVINEEVLNSMLKEICAALLEADVNIRLVKKLRENVRTVI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            + +D+A G NKR++IQ AVF EL K++DPG  ++ P KG+P+V+MFV
Sbjct  61   DFEDMAGGLNKRRMIQSAVFKELVKLIDPGVKAYQPVKGRPNVIMFV  107



>ref|XP_002786558.1| signal recognition particle 54 kDa protein 2 [Perkinsus marinus 
ATCC 50983]
 gb|EER18354.1| signal recognition particle 54 kDa protein 2 [Perkinsus marinus 
ATCC 50983]
Length=533

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 84/108 (78%), Gaps = 1/108 (1%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  IS AL+++  AT+IDE VL+ECL EI+ ALLQ+DV  + V +++ NIKR V
Sbjct  1    MVLADLGKQISGALRKLGKATVIDEAVLDECLKEISTALLQADVNVRYVAELRKNIKRTV  60

Query  437  NLDDLAA-GHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            +L++LAA G NK+++IQ+AV N+L ++L P K  + PKKG+P+V+MFV
Sbjct  61   DLEELAAPGSNKQRVIQKAVVNQLVEMLSPDKEPYKPKKGQPNVIMFV  108



>ref|XP_008312533.1| PREDICTED: signal recognition particle 54 kDa protein [Cynoglossus 
semilaevis]
Length=504

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ +SNATII+E+VLN  L E+  ALL++DV  KLV+ ++ N+K  +
Sbjct  1    MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCAALLEADVNIKLVKQLRENVKSAI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            +L+++A+G NKR++IQ AVF EL K++DPG  ++TP KGK +V+MFV
Sbjct  61   DLEEMASGLNKRRMIQHAVFKELVKLVDPGVKAWTPTKGKNNVIMFV  107



>ref|XP_010754152.1| PREDICTED: signal recognition particle 54 kDa protein [Larimichthys 
crocea]
Length=504

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ +SNATII+E+VLN  L E+  ALL++DV  KLV+ ++ N+K  +
Sbjct  1    MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCAALLEADVNIKLVKQLRENVKSAI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            +L+++A+G NKR++IQ AVF EL K++DPG  ++TP KGK +V+MFV
Sbjct  61   DLEEMASGLNKRRMIQHAVFKELVKLVDPGVKAWTPTKGKNNVIMFV  107



>ref|XP_005806889.1| PREDICTED: signal recognition particle 54 kDa protein-like [Xiphophorus 
maculatus]
 ref|XP_007574973.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X2 [Poecilia formosa]
 ref|XP_008396936.1| PREDICTED: signal recognition particle 54 kDa protein [Poecilia 
reticulata]
 ref|XP_008396937.1| PREDICTED: signal recognition particle 54 kDa protein [Poecilia 
reticulata]
Length=504

 Score =   120 bits (300),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ +SNATII+E+VLN  L E+  ALL++DV  KLV+ ++ N+K  +
Sbjct  1    MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCAALLEADVNIKLVKQLRENVKSAI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            +L+++A+G NKR++IQ AVF EL K++DPG  ++TP KGK +V+MFV
Sbjct  61   DLEEMASGLNKRRMIQHAVFKELVKLVDPGVKAWTPTKGKNNVIMFV  107



>ref|NP_001279235.1| signal recognition particle 54kDa [Callorhinchus milii]
 ref|XP_007891561.1| PREDICTED: signal recognition particle 54 kDa protein [Callorhinchus 
milii]
 gb|AFK11624.1| signal recognition particle protein [Callorhinchus milii]
Length=504

 Score =   120 bits (300),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ +SNATII+E+VLN  L E+  ALL++DV  KLV+ ++ N+K  +
Sbjct  1    MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKAAI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            +L+++A+G NKR++IQ AVF EL K++DPG  ++TP KGK +V+MFV
Sbjct  61   DLEEMASGLNKRRMIQHAVFKELVKLVDPGVKAWTPTKGKQNVIMFV  107



>ref|XP_006632217.1| PREDICTED: signal recognition particle 54 kDa protein-like [Lepisosteus 
oculatus]
Length=504

 Score =   120 bits (300),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ +SNATII+E+VLN  L E+  ALL++DV  KLV+ ++ N+K  +
Sbjct  1    MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCAALLEADVNIKLVKQLRENVKSAI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            +L+++A+G NKR++IQ AVF EL K++DPG  ++TP KGK +V+MFV
Sbjct  61   DLEEMASGLNKRRMIQHAVFKELVKLVDPGVKAWTPTKGKNNVIMFV  107



>ref|XP_003457248.1| PREDICTED: signal recognition particle 54 kDa protein-like isoform 
X1 [Oreochromis niloticus]
 ref|XP_004569946.1| PREDICTED: signal recognition particle 54 kDa protein-like isoform 
X1 [Maylandia zebra]
 ref|XP_004569947.1| PREDICTED: signal recognition particle 54 kDa protein-like isoform 
X2 [Maylandia zebra]
 ref|XP_005461990.1| PREDICTED: signal recognition particle 54 kDa protein-like isoform 
X2 [Oreochromis niloticus]
 ref|XP_005751839.1| PREDICTED: signal recognition particle 54 kDa protein-like isoform 
X1 [Pundamilia nyererei]
 ref|XP_005751840.1| PREDICTED: signal recognition particle 54 kDa protein-like isoform 
X2 [Pundamilia nyererei]
 ref|XP_005947530.1| PREDICTED: signal recognition particle 54 kDa protein-like isoform 
X1 [Haplochromis burtoni]
 ref|XP_005947531.1| PREDICTED: signal recognition particle 54 kDa protein-like isoform 
X2 [Haplochromis burtoni]
 ref|XP_006800646.1| PREDICTED: signal recognition particle 54 kDa protein-like isoform 
X1 [Neolamprologus brichardi]
 ref|XP_006800647.1| PREDICTED: signal recognition particle 54 kDa protein-like isoform 
X2 [Neolamprologus brichardi]
Length=504

 Score =   120 bits (300),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ +SNATII+E+VLN  L E+  ALL++DV  KLV+ ++ N+K  +
Sbjct  1    MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCAALLEADVNIKLVKQLRENVKSAI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            +L+++A+G NKR++IQ AVF EL K++DPG  ++TP KGK +V+MFV
Sbjct  61   DLEEMASGLNKRRMIQHAVFKELVKLVDPGVKAWTPTKGKNNVIMFV  107



>ref|XP_008294896.1| PREDICTED: signal recognition particle 54 kDa protein [Stegastes 
partitus]
Length=504

 Score =   120 bits (300),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ +SNATII+E+VLN  L E+  ALL++DV  KLV+ ++ N+K  +
Sbjct  1    MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCAALLEADVNIKLVKQLRENVKSAI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            +L+++A+G NKR++IQ AVF EL K++DPG  ++TP KGK +V+MFV
Sbjct  61   DLEEMASGLNKRRMIQHAVFKELVKLVDPGVKAWTPTKGKNNVIMFV  107



>ref|XP_007936778.1| PREDICTED: signal recognition particle 54 kDa protein [Orycteropus 
afer afer]
Length=596

 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ +SNATII+E+VLN  L E+  ALL++DV  KLV+ ++ N+K  +
Sbjct  1    MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            +L+++A+G NKRK+IQ AVF EL K++DPG  ++TP KGK +V+MFV
Sbjct  61   DLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNVIMFV  107



>gb|AIC62032.1| SRP54, partial [synthetic construct]
Length=504

 Score =   119 bits (299),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 82/107 (77%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVL  LG  I+ AL+ +SNATII+E+VLN  L E+  ALL++DV  KLV+ ++ N+K  +
Sbjct  1    MVLTDLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            +L+++A+G NKRK+IQ AVF EL K++DPG  ++TP KGK +V+MFV
Sbjct  61   DLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNVIMFV  107



>ref|XP_003962842.1| PREDICTED: signal recognition particle 54 kDa protein-like isoform 
1 [Takifugu rubripes]
Length=504

 Score =   119 bits (299),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ +SNATII+E+VLN  L E+  ALL++DV  KLV+ ++ N+K  +
Sbjct  1    MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCAALLEADVNIKLVKQLRENVKAAI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            +L+++A+G NKR++IQ AVF EL K++DPG  ++TP KGK +V+MFV
Sbjct  61   DLEEMASGLNKRRMIQHAVFKELVKLVDPGVKAWTPTKGKNNVIMFV  107



>ref|NP_957282.1| signal recognition particle 54 kDa protein [Danio rerio]
 ref|XP_005158673.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X1 [Danio rerio]
 gb|AAH45474.1| Signal recognition particle 54 [Danio rerio]
 gb|AAH67588.1| Signal recognition particle 54 [Danio rerio]
 gb|AAI64217.1| Srp54 protein [Danio rerio]
Length=504

 Score =   119 bits (299),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ +SNATII+E+VLN  L E+  ALL++DV  KLV+ ++ N+K  +
Sbjct  1    MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCAALLEADVNIKLVKQLRENVKAAI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            +L+++A+G NKR++IQ AVF EL K++DPG  ++TP KGK +V+MFV
Sbjct  61   DLEEMASGLNKRRMIQHAVFKELVKLVDPGVKAWTPTKGKNNVIMFV  107



>ref|XP_006835414.1| PREDICTED: LOW QUALITY PROTEIN: signal recognition particle 54 
kDa protein [Chrysochloris asiatica]
Length=504

 Score =   119 bits (299),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 82/107 (77%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ +SNATII+E+VLN  L E+  ALL++DV  KLV+ ++ N+K  +
Sbjct  1    MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            +L+++A+G NKRK+IQ AVF EL K++DPG  ++ P KGK +V+MFV
Sbjct  61   DLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWAPTKGKXNVIMFV  107



>ref|XP_010581946.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X2 [Haliaeetus leucocephalus]
Length=577

 Score =   120 bits (300),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ +SNATII+E+VLN  L E+  ALL++DV  KLV+ ++ N+K  +
Sbjct  1    MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            +L+++A+G NKRK+IQ AVF EL K++DPG  ++TP KGK +++MFV
Sbjct  61   DLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNIIMFV  107



>ref|XP_007574970.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X1 [Poecilia formosa]
 ref|XP_007574972.1| PREDICTED: signal recognition particle 54 kDa protein isoform 
X1 [Poecilia formosa]
Length=520

 Score =   119 bits (298),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ +SNATII+E+VLN  L E+  ALL++DV  KLV+ ++ N+K  +
Sbjct  1    MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCAALLEADVNIKLVKQLRENVKSAI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            +L+++A+G NKR++IQ AVF EL K++DPG  ++TP KGK +V+MFV
Sbjct  61   DLEEMASGLNKRRMIQHAVFKELVKLVDPGVKAWTPTKGKNNVIMFV  107



>gb|KFM74977.1| Signal recognition particle protein, partial [Stegodyphus mimosarum]
Length=503

 Score =   119 bits (298),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ ++NATII+++VL+  L EI  ALL++DV  KLV+ ++ N++ ++
Sbjct  1    MVLADLGRKITNALRSLNNATIINKEVLDSMLKEICTALLEADVNIKLVKQLRENVRSVI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            + D++AAG NKR++IQ AVF EL K++DPG  ++ P KGKP+V+MFV
Sbjct  61   DFDEMAAGLNKRRMIQSAVFKELVKLVDPGVKAWQPTKGKPNVIMFV  107



>emb|CAF89626.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=514

 Score =   119 bits (298),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ +SNATII+E+VLN  L E+  ALL++DV  KLV+ ++ N+K  +
Sbjct  1    MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCAALLEADVNIKLVKQLRENVKAAI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            +L+++A+G NKR++IQ AVF EL K++DPG  ++TP KGK +V+MFV
Sbjct  61   DLEEMASGLNKRRMIQHAVFKELVKLVDPGVKAWTPTKGKNNVIMFV  107



>ref|XP_002117863.1| signal recognition particle 54 [Trichoplax adhaerens]
 gb|EDV19625.1| signal recognition particle 54, partial [Trichoplax adhaerens]
Length=505

 Score =   119 bits (297),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 84/107 (79%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA+LG  I+ AL+ +SNATII+E+V+   L EI  ALL+SDV  +LV+ ++ N++  +
Sbjct  1    MVLAELGRKITDALRSLSNATIINEEVVQALLKEICAALLESDVNVQLVKRLRENVRAAI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            + +++AAG NKR+I+Q+AVFNELCK++DPG  ++ P KGK +V+MFV
Sbjct  61   DFEEMAAGLNKRRILQRAVFNELCKLVDPGVKAWQPTKGKNNVIMFV  107



>ref|XP_004348635.1| signal recognition particle [Capsaspora owczarzaki ATCC 30864]
 gb|KJE91727.1| signal recognition particle [Capsaspora owczarzaki ATCC 30864]
Length=512

 Score =   119 bits (298),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 82/107 (77%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ M+ + +IDE+VL+  L EI  ALL++DV  KLV  ++T++K  V
Sbjct  1    MVLADLGRKITGALRNMTASAVIDEEVLDAMLKEICTALLEADVNVKLVMKLRTSVKAAV  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            N D++AAG NK+++IQ+AV++ELC+++DPG   + P KGKP+V+MFV
Sbjct  61   NFDEMAAGLNKKRVIQKAVYDELCRLVDPGIAPYKPVKGKPNVIMFV  107



>ref|XP_007240540.1| PREDICTED: signal recognition particle 54 kDa protein [Astyanax 
mexicanus]
Length=504

 Score =   119 bits (297),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ +SNATII+E+VLN  L E+  ALL++DV  KLV+ ++ N+K  +
Sbjct  1    MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCAALLEADVNIKLVKQLRENVKAAI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            +L+++A+G NKR++IQ AVF EL K++DPG  ++TP KGK +++MFV
Sbjct  61   DLEEMASGLNKRRMIQHAVFKELVKLVDPGVKAWTPTKGKNNIIMFV  107



>ref|XP_010891266.1| PREDICTED: signal recognition particle 54 kDa protein [Esox lucius]
 ref|XP_010891267.1| PREDICTED: signal recognition particle 54 kDa protein [Esox lucius]
 ref|XP_010891268.1| PREDICTED: signal recognition particle 54 kDa protein [Esox lucius]
 ref|XP_010891269.1| PREDICTED: signal recognition particle 54 kDa protein [Esox lucius]
Length=504

 Score =   119 bits (297),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ +SNATII+E+VLN  L E+  ALL++DV  KLV+ ++ N+K  +
Sbjct  1    MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCAALLEADVNIKLVKQLRENVKSAI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            +L+++A+G NKR++IQ +VF EL K++DPG  ++TP KGK +V+MFV
Sbjct  61   DLEEMASGLNKRRMIQHSVFKELVKLVDPGVKAWTPTKGKNNVIMFV  107



>ref|XP_003384056.1| PREDICTED: signal recognition particle 54 kDa protein-like [Amphimedon 
queenslandica]
Length=501

 Score =   119 bits (297),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 82/107 (77%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ +SNAT+I+E+V+   L EI  ALL++DV  KLV  ++ N++  +
Sbjct  1    MVLADLGRKITTALRSLSNATVINEEVVQAMLKEICTALLEADVNVKLVGRLRQNVRDAI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            + +++AAG NKRKIIQ +VFNELC+++DPG P++T  KGK +V+MFV
Sbjct  61   DFEEMAAGLNKRKIIQSSVFNELCRLIDPGVPAWTATKGKQNVIMFV  107



>gb|ACI33196.1| Signal recognition particle 54 kDa protein [Salmo salar]
Length=504

 Score =   119 bits (297),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ AL+ +SNATII+E+VLN  L E+  ALL++DV  KLV+ ++ N+K  +
Sbjct  1    MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCAALLEADVNIKLVKQLRENVKSAI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            +L+++A+G NKR++IQ +VF EL K++DPG  ++TP KGK +V+MFV
Sbjct  61   DLEEMASGLNKRRMIQHSVFKELVKLVDPGVKAWTPTKGKNNVIMFV  107



>ref|XP_967889.1| PREDICTED: signal recognition particle 54 kDa protein [Tribolium 
castaneum]
 gb|EEZ99794.1| hypothetical protein TcasGA2_TC002574 [Tribolium castaneum]
Length=508

 Score =   119 bits (297),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 80/107 (75%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ ALQ +S ATII+E+VLN  L EI  ALL++DV  +LV+ ++ N++ ++
Sbjct  1    MVLADLGRKITTALQSLSKATIINEEVLNGMLKEICAALLEADVNIRLVKKLRENVRAVI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            + D++A G NKR++IQ AVF EL K++DPG   + P KGKP+V+MFV
Sbjct  61   DFDEMAGGLNKRRMIQSAVFKELVKLVDPGVKPYQPVKGKPNVIMFV  107



>gb|EHJ78449.1| putative signal recognition particle 54 kDa protein [Danaus plexippus]
Length=501

 Score =   118 bits (296),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 81/107 (76%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  MVLAQLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQSDVQFKLVRDMQTNIKRIV  436
            MVLA LG  I+ ALQ +S ATII+E+VLN  L +I  ALL++DV  +LV++++ N++ ++
Sbjct  1    MVLADLGRKITTALQSLSRATIINEEVLNSMLKQICAALLEADVNIRLVKNLRENVRAVI  60

Query  437  NLDDLAAGHNKRKIIQQAVFNELCKILDPGKPSFTPKKGKPSVVMFV  577
            + D++A G NKR++IQ AVF EL K++DPG   + P KGKP+V+MFV
Sbjct  61   DFDEMAGGLNKRRMIQSAVFKELVKLVDPGVKPYQPVKGKPNVIMFV  107



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 710292972220