BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002F08

Length=582
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009595864.1|  PREDICTED: monosaccharide-sensing protein 2        148   7e-38   Nicotiana tomentosiformis
ref|XP_009796447.1|  PREDICTED: monosaccharide-sensing protein 2-...    148   1e-37   Nicotiana sylvestris
ref|XP_007135975.1|  hypothetical protein PHAVU_009G007600g             147   1e-37   Phaseolus vulgaris [French bean]
ref|XP_006342166.1|  PREDICTED: monosaccharide-sensing protein 2-...    147   2e-37   Solanum tuberosum [potatoes]
ref|XP_011074068.1|  PREDICTED: monosaccharide-sensing protein 2-...    147   2e-37   Sesamum indicum [beniseed]
ref|XP_003527273.1|  PREDICTED: monosaccharide-sensing protein 2-...    147   2e-37   Glycine max [soybeans]
ref|NP_001289848.1|  monosaccharide-sensing protein 2                   147   3e-37   Solanum lycopersicum
ref|XP_006577928.1|  PREDICTED: monosaccharide-sensing protein 2-...    146   4e-37   Glycine max [soybeans]
gb|KHN33775.1|  Monosaccharide-sensing protein 2                        146   4e-37   Glycine soja [wild soybean]
gb|KDO85211.1|  hypothetical protein CISIN_1g004673mg                   144   6e-37   Citrus sinensis [apfelsine]
emb|CDP07261.1|  unnamed protein product                                145   1e-36   Coffea canephora [robusta coffee]
ref|XP_010094525.1|  Monosaccharide-sensing protein 2                   144   2e-36   Morus notabilis
gb|KDO85208.1|  hypothetical protein CISIN_1g004673mg                   144   3e-36   Citrus sinensis [apfelsine]
ref|XP_006435423.1|  hypothetical protein CICLE_v10000400mg             144   3e-36   Citrus clementina [clementine]
ref|XP_003603868.1|  Monosaccharide-sensing protein                     143   7e-36   Medicago truncatula
gb|KDP36756.1|  hypothetical protein JCGZ_08047                         142   2e-35   Jatropha curcas
ref|XP_011100175.1|  PREDICTED: monosaccharide-sensing protein 2-...    141   3e-35   Sesamum indicum [beniseed]
ref|XP_004500833.1|  PREDICTED: monosaccharide-sensing protein 2-...    140   6e-35   Cicer arietinum [garbanzo]
gb|KJB14182.1|  hypothetical protein B456_002G113400                    139   6e-35   Gossypium raimondii
gb|KJB14183.1|  hypothetical protein B456_002G113400                    139   6e-35   Gossypium raimondii
gb|KHG10189.1|  Monosaccharide-sensing 2 -like protein                  140   7e-35   Gossypium arboreum [tree cotton]
ref|XP_007018119.1|  Tonoplast monosaccharide transporter2 isoform 1    140   9e-35   
ref|XP_007018122.1|  Tonoplast monosaccharide transporter2 isoform 4    140   9e-35   
emb|CDY33650.1|  BnaC08g19500D                                          138   2e-34   Brassica napus [oilseed rape]
ref|XP_010061214.1|  PREDICTED: monosaccharide-sensing protein 2-...    139   3e-34   Eucalyptus grandis [rose gum]
ref|XP_006416357.1|  hypothetical protein EUTSA_v10006916mg             139   3e-34   Eutrema salsugineum [saltwater cress]
dbj|BAJ33724.1|  unnamed protein product                                138   3e-34   Eutrema halophilum
ref|XP_009110209.1|  PREDICTED: monosaccharide-sensing protein 1        138   3e-34   Brassica rapa
emb|CDX96618.1|  BnaA08g21610D                                          138   3e-34   
gb|KJB14177.1|  hypothetical protein B456_002G113400                    138   5e-34   Gossypium raimondii
ref|XP_002510716.1|  sugar transporter, putative                        138   5e-34   Ricinus communis
emb|CDY31497.1|  BnaC05g16060D                                          136   6e-34   Brassica napus [oilseed rape]
emb|CDY29502.1|  BnaA06g14680D                                          136   1e-33   Brassica napus [oilseed rape]
ref|XP_009149562.1|  PREDICTED: monosaccharide-sensing protein 1        136   1e-33   Brassica rapa
emb|CAA90628.1|  sugar transporter                                      136   1e-33   Arabidopsis thaliana [mouse-ear cress]
ref|NP_173508.1|  tonoplast monosaccharide transporter1                 136   2e-33   Arabidopsis thaliana [mouse-ear cress]
gb|AAD30608.1|AC007369_18  Sugar transporter                            136   2e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006306868.1|  hypothetical protein CARUB_v10008415mg             136   2e-33   
ref|XP_002893133.1|  hypothetical protein ARALYDRAFT_472320             136   2e-33   
ref|XP_008373385.1|  PREDICTED: monosaccharide-sensing protein 2-...    135   3e-33   
ref|XP_004300112.1|  PREDICTED: monosaccharide-sensing protein 2        135   3e-33   Fragaria vesca subsp. vesca
ref|XP_010539774.1|  PREDICTED: monosaccharide-sensing protein 1-...    135   3e-33   Tarenaya hassleriana [spider flower]
ref|XP_010537220.1|  PREDICTED: monosaccharide-sensing protein 1-...    135   6e-33   Tarenaya hassleriana [spider flower]
ref|XP_011034826.1|  PREDICTED: monosaccharide-sensing protein 2-...    135   7e-33   Populus euphratica
dbj|BAK00015.1|  predicted protein                                      128   7e-33   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010477336.1|  PREDICTED: monosaccharide-sensing protein 1        134   9e-33   Camelina sativa [gold-of-pleasure]
ref|XP_002307812.1|  hypothetical protein POPTR_0005s27680g             133   2e-32   Populus trichocarpa [western balsam poplar]
ref|XP_002300629.1|  hypothetical protein POPTR_0002s00760g             133   2e-32   Populus trichocarpa [western balsam poplar]
ref|XP_011041174.1|  PREDICTED: monosaccharide-sensing protein 2-...    133   2e-32   Populus euphratica
emb|CBI40753.3|  unnamed protein product                                132   3e-32   Vitis vinifera
gb|AAX47312.1|  hexose transporter 6                                    132   3e-32   Vitis vinifera
emb|CAN59780.1|  hypothetical protein VITISV_024656                     132   4e-32   Vitis vinifera
ref|NP_001267873.1|  hexose transporter-like                            132   4e-32   Vitis vinifera
ref|XP_010686712.1|  PREDICTED: monosaccharide-sensing protein 2        132   5e-32   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009372620.1|  PREDICTED: monosaccharide-sensing protein 2        132   5e-32   Pyrus x bretschneideri [bai li]
gb|KJB31963.1|  hypothetical protein B456_005G216600                    132   6e-32   Gossypium raimondii
gb|EAY85098.1|  hypothetical protein OsI_06450                          131   7e-32   Oryza sativa Indica Group [Indian rice]
gb|EAZ22316.1|  hypothetical protein OsJ_05971                          132   8e-32   Oryza sativa Japonica Group [Japonica rice]
emb|CDI66586.1|  putative sugar transporter type 2a protein             131   1e-31   Saccharum hybrid cultivar R570
emb|CDI66591.1|  putative sugar transporter type 2a protein             131   1e-31   Saccharum hybrid cultivar R570
ref|XP_010063149.1|  PREDICTED: monosaccharide-sensing protein 2-...    131   1e-31   Eucalyptus grandis [rose gum]
emb|CBI21577.3|  unnamed protein product                                130   2e-31   Vitis vinifera
ref|NP_001046359.1|  Os02g0229400                                       130   2e-31   
ref|XP_002276373.1|  PREDICTED: monosaccharide-sensing protein 2        130   3e-31   Vitis vinifera
gb|EMT06669.1|  Monosaccharide-sensing protein 2                        130   3e-31   
gb|EMS49950.1|  Monosaccharide-sensing protein 2                        129   4e-31   Triticum urartu
ref|XP_006855646.1|  hypothetical protein AMTR_s00044p00110510          129   4e-31   
ref|XP_003571780.1|  PREDICTED: monosaccharide-sensing protein 2-...    129   4e-31   Brachypodium distachyon [annual false brome]
gb|AIQ77649.1|  tonoplastic transporter 1                               129   6e-31   Vitis vinifera
dbj|BAJ89532.1|  predicted protein                                      129   6e-31   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010909820.1|  PREDICTED: monosaccharide-sensing protein 2-...    129   6e-31   Elaeis guineensis
ref|XP_006647093.1|  PREDICTED: monosaccharide-sensing protein 2-...    128   1e-30   Oryza brachyantha
gb|KHG14026.1|  Monosaccharide-sensing 2 -like protein                  128   1e-30   Gossypium arboreum [tree cotton]
ref|XP_009401004.1|  PREDICTED: monosaccharide-sensing protein 2-...    128   1e-30   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009390770.1|  PREDICTED: monosaccharide-sensing protein 2-...    128   2e-30   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009397963.1|  PREDICTED: monosaccharide-sensing protein 2-...    127   2e-30   
gb|EYU43534.1|  hypothetical protein MIMGU_mgv1a001953mg                126   5e-30   Erythranthe guttata [common monkey flower]
emb|CDP14489.1|  unnamed protein product                                126   7e-30   Coffea canephora [robusta coffee]
ref|XP_010940242.1|  PREDICTED: monosaccharide-sensing protein 2-...    126   8e-30   Elaeis guineensis
ref|XP_007204446.1|  hypothetical protein PRUPE_ppa026426mg             125   1e-29   Prunus persica
ref|XP_008237926.1|  PREDICTED: monosaccharide-sensing protein 2        125   2e-29   Prunus mume [ume]
ref|XP_008778122.1|  PREDICTED: monosaccharide-sensing protein 2-...    125   2e-29   
ref|XP_008242106.1|  PREDICTED: monosaccharide-sensing protein 2-...    125   2e-29   Prunus mume [ume]
ref|XP_010029562.1|  PREDICTED: monosaccharide-sensing protein 2-...    125   2e-29   Eucalyptus grandis [rose gum]
gb|AJO70165.1|  tonoplast monosaccharide transporters 1                 125   2e-29   Camellia sinensis [black tea]
gb|KJB79727.1|  hypothetical protein B456_013G064200                    123   3e-29   Gossypium raimondii
ref|XP_010906859.1|  PREDICTED: monosaccharide-sensing protein 2-...    122   3e-29   
gb|EMS63940.1|  Monosaccharide-sensing protein 2                        124   3e-29   Triticum urartu
gb|EMT29091.1|  Monosaccharide-sensing protein 2                        124   4e-29   
ref|XP_004951395.1|  PREDICTED: monosaccharide-sensing protein 2-...    124   4e-29   Setaria italica
gb|AAP54842.2|  hexose transporter, putative, expressed                 121   6e-29   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007142576.1|  hypothetical protein PHAVU_008G292400g             123   8e-29   Phaseolus vulgaris [French bean]
ref|XP_004144248.1|  PREDICTED: monosaccharide-sensing protein 2-...    123   9e-29   Cucumis sativus [cucumbers]
gb|KHG05233.1|  Monosaccharide-sensing 2 -like protein                  123   1e-28   Gossypium arboreum [tree cotton]
gb|KJB79728.1|  hypothetical protein B456_013G064200                    123   1e-28   Gossypium raimondii
ref|XP_007210337.1|  hypothetical protein PRUPE_ppa001932mg             122   1e-28   Prunus persica
ref|XP_006364349.1|  PREDICTED: monosaccharide-sensing protein 2-...    117   2e-28   
emb|CAD58958.1|  hexose transporter                                     122   2e-28   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ90138.1|  predicted protein                                      122   2e-28   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003574265.1|  PREDICTED: monosaccharide-sensing protein 2-...    122   2e-28   Brachypodium distachyon [annual false brome]
ref|XP_008351570.1|  PREDICTED: monosaccharide-sensing protein 2-...    116   2e-28   
ref|XP_010680636.1|  PREDICTED: monosaccharide-sensing protein 2-...    121   3e-28   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002467580.1|  hypothetical protein SORBIDRAFT_01g030430          121   3e-28   Sorghum bicolor [broomcorn]
ref|XP_008464819.1|  PREDICTED: monosaccharide-sensing protein 2-...    121   3e-28   Cucumis melo [Oriental melon]
dbj|BAI94493.1|  sugar transporter                                      121   4e-28   Dianthus caryophyllus [carnation]
ref|NP_001065182.1|  Os10g0539900                                       121   5e-28   
gb|EEC67373.1|  hypothetical protein OsI_34495                          121   5e-28   Oryza sativa Indica Group [Indian rice]
gb|KHN20087.1|  Monosaccharide-sensing protein 2                        120   6e-28   Glycine soja [wild soybean]
ref|XP_010548175.1|  PREDICTED: monosaccharide-sensing protein 2        120   1e-27   Tarenaya hassleriana [spider flower]
gb|KJB12352.1|  hypothetical protein B456_002G014400                    119   1e-27   Gossypium raimondii
gb|KCW64229.1|  hypothetical protein EUGRSUZ_G01880                     119   2e-27   Eucalyptus grandis [rose gum]
ref|XP_010066352.1|  PREDICTED: monosaccharide-sensing protein 2-...    119   2e-27   Eucalyptus grandis [rose gum]
ref|XP_008812559.1|  PREDICTED: monosaccharide-sensing protein 2-...    119   2e-27   Phoenix dactylifera
ref|XP_010678631.1|  PREDICTED: monosaccharide-sensing protein 2-...    119   2e-27   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009763350.1|  PREDICTED: monosaccharide-sensing protein 2-...    119   2e-27   Nicotiana sylvestris
ref|NP_195256.3|  monosaccharide-sensing protein 2                      119   2e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010090703.1|  Monosaccharide-sensing protein 2                   119   2e-27   Morus notabilis
ref|NP_849565.1|  monosaccharide-sensing protein 2                      119   2e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002867077.1|  hypothetical protein ARALYDRAFT_491117             119   2e-27   
ref|XP_004983796.1|  PREDICTED: monosaccharide-sensing protein 2-...    119   2e-27   Setaria italica
ref|XP_006283193.1|  hypothetical protein CARUB_v10004225mg             119   2e-27   Capsella rubella
ref|XP_009608796.1|  PREDICTED: monosaccharide-sensing protein 2-...    119   2e-27   Nicotiana tomentosiformis
ref|XP_007043079.1|  Tonoplast monosaccharide transporter2              119   3e-27   
ref|XP_011000869.1|  PREDICTED: monosaccharide-sensing protein 2-...    119   3e-27   Populus euphratica
gb|KJB12351.1|  hypothetical protein B456_002G014400                    119   3e-27   Gossypium raimondii
ref|NP_001151936.1|  LOC100285573                                       119   3e-27   Zea mays [maize]
gb|KJB12354.1|  hypothetical protein B456_002G014400                    119   3e-27   Gossypium raimondii
ref|XP_010266257.1|  PREDICTED: monosaccharide-sensing protein 2 ...    119   3e-27   Nelumbo nucifera [Indian lotus]
gb|AAO37640.1|  putative sugar transporter type 2a                      119   3e-27   Saccharum hybrid cultivar Q117
ref|XP_008645619.1|  PREDICTED: monosaccharide-sensing protein 2-...    118   4e-27   Zea mays [maize]
emb|CDX69128.1|  BnaC01g03250D                                          117   6e-27   
ref|XP_009103100.1|  PREDICTED: monosaccharide-sensing protein 2        117   6e-27   
ref|XP_002520608.1|  sugar transporter, putative                        117   6e-27   Ricinus communis
emb|CDY65623.1|  BnaCnng48010D                                          117   7e-27   Brassica napus [oilseed rape]
ref|XP_007201798.1|  hypothetical protein PRUPE_ppa001957mg             117   7e-27   Prunus persica
ref|NP_190717.1|  tonoplast monosaccharide transporter3                 117   8e-27   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001190054.1|  tonoplast monosaccharide transporter3              117   8e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008235816.1|  PREDICTED: monosaccharide-sensing protein 2        117   1e-26   Prunus mume [ume]
gb|KFK34392.1|  hypothetical protein AALP_AA5G139300                    117   1e-26   Arabis alpina [alpine rockcress]
ref|XP_008377843.1|  PREDICTED: monosaccharide-sensing protein 2-...    117   1e-26   
gb|KJB77474.1|  hypothetical protein B456_012G139000                    116   2e-26   Gossypium raimondii
ref|XP_002877807.1|  predicted protein                                  116   2e-26   
ref|XP_006412119.1|  hypothetical protein EUTSA_v10024517mg             116   2e-26   Eutrema salsugineum [saltwater cress]
ref|XP_002282975.1|  PREDICTED: monosaccharide-sensing protein 2        116   2e-26   Vitis vinifera
ref|XP_010266258.1|  PREDICTED: monosaccharide-sensing protein 2 ...    115   2e-26   
gb|KDP47010.1|  hypothetical protein JCGZ_10737                         116   3e-26   Jatropha curcas
gb|EYU40481.1|  hypothetical protein MIMGU_mgv1a001997mg                116   3e-26   Erythranthe guttata [common monkey flower]
gb|AFP89954.1|  tonoplastic transporter 2                               116   3e-26   Vitis vinifera
gb|EMT28528.1|  Monosaccharide-sensing protein 3                        114   3e-26   
emb|CAN80213.1|  hypothetical protein VITISV_042076                     116   3e-26   Vitis vinifera
emb|CBI37732.3|  unnamed protein product                                115   3e-26   Vitis vinifera
ref|XP_004290074.1|  PREDICTED: monosaccharide-sensing protein 2        115   3e-26   Fragaria vesca subsp. vesca
gb|KJB77472.1|  hypothetical protein B456_012G139000                    115   4e-26   Gossypium raimondii
gb|KHG04801.1|  Monosaccharide-sensing protein 2                        115   4e-26   Gossypium arboreum [tree cotton]
ref|XP_011099908.1|  PREDICTED: monosaccharide-sensing protein 2-...    115   4e-26   Sesamum indicum [beniseed]
gb|KDO68405.1|  hypothetical protein CISIN_1g004750mg                   114   6e-26   Citrus sinensis [apfelsine]
ref|XP_008349018.1|  PREDICTED: monosaccharide-sensing protein 2-...    110   6e-26   
ref|XP_009776539.1|  PREDICTED: monosaccharide-sensing protein 2-...    115   7e-26   Nicotiana sylvestris
ref|XP_010028861.1|  PREDICTED: LOW QUALITY PROTEIN: monosacchari...    114   9e-26   
ref|XP_006486570.1|  PREDICTED: monosaccharide-sensing protein 2-...    114   1e-25   Citrus sinensis [apfelsine]
ref|XP_010446942.1|  PREDICTED: monosaccharide-sensing protein 2        114   1e-25   Camelina sativa [gold-of-pleasure]
ref|XP_010437493.1|  PREDICTED: monosaccharide-sensing protein 2-...    114   1e-25   
ref|XP_009333794.1|  PREDICTED: monosaccharide-sensing protein 2-...    114   1e-25   
ref|XP_002306419.1|  hypothetical protein POPTR_0005s10180g             114   1e-25   
ref|XP_002312798.1|  transporter-related family protein                 114   1e-25   
ref|XP_009341490.1|  PREDICTED: monosaccharide-sensing protein 2-...    114   1e-25   Pyrus x bretschneideri [bai li]
gb|KDO68402.1|  hypothetical protein CISIN_1g004750mg                   114   1e-25   Citrus sinensis [apfelsine]
ref|XP_006422393.1|  hypothetical protein CICLE_v10027893mg             114   1e-25   
ref|XP_011022133.1|  PREDICTED: monosaccharide-sensing protein 2-...    114   1e-25   Populus euphratica
gb|AIN39841.1|  hypothetical protein                                    114   1e-25   Zoysia matrella [Japanese carpet grass]
ref|XP_010432297.1|  PREDICTED: monosaccharide-sensing protein 2-...    114   1e-25   Camelina sativa [gold-of-pleasure]
emb|CDP01766.1|  unnamed protein product                                114   1e-25   Coffea canephora [robusta coffee]
ref|XP_003526737.1|  PREDICTED: monosaccharide-sensing protein 2-...    114   1e-25   Glycine max [soybeans]
ref|XP_009340799.1|  PREDICTED: monosaccharide-sensing protein 2-...    114   2e-25   Pyrus x bretschneideri [bai li]
gb|EPS65490.1|  hypothetical protein M569_09283                         113   3e-25   Genlisea aurea
ref|XP_003543932.1|  PREDICTED: monosaccharide-sensing protein 2-...    113   3e-25   
gb|KHN33643.1|  Monosaccharide-sensing protein 2                        113   3e-25   Glycine soja [wild soybean]
ref|XP_006384856.1|  transporter-related family protein                 112   4e-25   
ref|XP_004139974.1|  PREDICTED: monosaccharide-sensing protein 2-...    112   6e-25   
ref|XP_009622210.1|  PREDICTED: monosaccharide-sensing protein 2-...    112   6e-25   Nicotiana tomentosiformis
ref|XP_010270527.1|  PREDICTED: monosaccharide-sensing protein 2        112   7e-25   Nelumbo nucifera [Indian lotus]
ref|XP_008382498.1|  PREDICTED: monosaccharide-sensing protein 2-...    112   8e-25   
gb|EYU30848.1|  hypothetical protein MIMGU_mgv1a001984mg                111   1e-24   Erythranthe guttata [common monkey flower]
ref|XP_011040809.1|  PREDICTED: monosaccharide-sensing protein 2-...    111   1e-24   Populus euphratica
ref|XP_009392211.1|  PREDICTED: monosaccharide-sensing protein 2-...    111   2e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008448165.1|  PREDICTED: monosaccharide-sensing protein 2        110   2e-24   Cucumis melo [Oriental melon]
ref|XP_009589978.1|  PREDICTED: monosaccharide-sensing protein 2-...    110   2e-24   Nicotiana tomentosiformis
ref|XP_009775817.1|  PREDICTED: monosaccharide-sensing protein 2-...    110   2e-24   Nicotiana sylvestris
ref|XP_007137297.1|  hypothetical protein PHAVU_009G115500g             110   2e-24   Phaseolus vulgaris [French bean]
ref|XP_006343319.1|  PREDICTED: monosaccharide-sensing protein 2-...    110   2e-24   Solanum tuberosum [potatoes]
ref|NP_001280690.1|  monosaccharide-sensing protein 2-like              110   2e-24   Solanum lycopersicum
ref|XP_011098017.1|  PREDICTED: monosaccharide-sensing protein 2-...    110   3e-24   Sesamum indicum [beniseed]
ref|XP_004500684.1|  PREDICTED: monosaccharide-sensing protein 2-...    110   3e-24   
ref|XP_010690557.1|  PREDICTED: monosaccharide-sensing protein 2        110   3e-24   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004289029.1|  PREDICTED: monosaccharide-sensing protein 2-...    110   4e-24   Fragaria vesca subsp. vesca
ref|NP_001067890.1|  Os11g0475600                                       110   4e-24   
gb|EAY80902.1|  hypothetical protein OsI_36080                          110   4e-24   Oryza sativa Indica Group [Indian rice]
ref|XP_004154526.1|  PREDICTED: monosaccharide-sensing protein 2-...    109   4e-24   
gb|KHN46863.1|  Monosaccharide-sensing protein 2                        109   6e-24   Glycine soja [wild soybean]
ref|XP_009359630.1|  PREDICTED: monosaccharide-sensing protein 2-...    109   6e-24   
ref|XP_009359629.1|  PREDICTED: monosaccharide-sensing protein 2-...    109   6e-24   Pyrus x bretschneideri [bai li]
ref|XP_009359631.1|  PREDICTED: monosaccharide-sensing protein 2-...    109   7e-24   
emb|CDY33275.1|  BnaA01g19420D                                          100   2e-23   Brassica napus [oilseed rape]
ref|XP_003560303.1|  PREDICTED: monosaccharide-sensing protein 2-...    107   4e-23   Brachypodium distachyon [annual false brome]
ref|XP_003518591.1|  PREDICTED: monosaccharide-sensing protein 2-...    105   2e-22   Glycine max [soybeans]
gb|KGN49001.1|  hypothetical protein Csa_6G509700                       105   2e-22   Cucumis sativus [cucumbers]
ref|XP_010029563.1|  PREDICTED: monosaccharide-sensing protein 2-...    105   2e-22   Eucalyptus grandis [rose gum]
ref|XP_004954530.1|  PREDICTED: monosaccharide-sensing protein 2-...    104   3e-22   Setaria italica
ref|XP_004964709.1|  PREDICTED: monosaccharide-sensing protein 2-...    103   5e-22   Setaria italica
ref|XP_004289030.1|  PREDICTED: monosaccharide-sensing protein 2        103   7e-22   Fragaria vesca subsp. vesca
gb|EPS57524.1|  hypothetical protein M569_17293                         102   2e-21   Genlisea aurea
ref|XP_002439068.1|  hypothetical protein SORBIDRAFT_10g031000          102   2e-21   Sorghum bicolor [broomcorn]
ref|XP_008440928.1|  PREDICTED: LOW QUALITY PROTEIN: monosacchari...    102   2e-21   
ref|XP_006403910.1|  hypothetical protein EUTSA_v10011113mg             102   3e-21   Eutrema salsugineum [saltwater cress]
ref|XP_006292750.1|  hypothetical protein CARUB_v10018997mg             101   3e-21   
ref|XP_004169167.1|  PREDICTED: LOW QUALITY PROTEIN: monosacchari...    101   3e-21   
ref|XP_004134823.1|  PREDICTED: monosaccharide-sensing protein 2-...    101   3e-21   
ref|XP_009148978.1|  PREDICTED: monosaccharide-sensing protein 3        101   4e-21   Brassica rapa
ref|XP_009359632.1|  PREDICTED: monosaccharide-sensing protein 2-...    101   4e-21   Pyrus x bretschneideri [bai li]
emb|CDY33276.1|  BnaA01g19430D                                          100   5e-21   Brassica napus [oilseed rape]
gb|KDP43790.1|  hypothetical protein JCGZ_22417                         100   6e-21   Jatropha curcas
ref|XP_010515555.1|  PREDICTED: monosaccharide-sensing protein 3        100   7e-21   Camelina sativa [gold-of-pleasure]
ref|XP_010503840.1|  PREDICTED: monosaccharide-sensing protein 3-...    100   7e-21   Camelina sativa [gold-of-pleasure]
ref|XP_010426703.1|  PREDICTED: monosaccharide-sensing protein 3-...    100   7e-21   Camelina sativa [gold-of-pleasure]
ref|XP_004978456.1|  PREDICTED: monosaccharide-sensing protein 2-...    100   7e-21   
ref|XP_003537696.1|  PREDICTED: monosaccharide-sensing protein 2-...    100   8e-21   Glycine max [soybeans]
emb|CDX78009.1|  BnaA09g32040D                                        99.4    1e-20   
ref|XP_009115837.1|  PREDICTED: monosaccharide-sensing protein 3      99.8    2e-20   Brassica rapa
emb|CDX73717.1|  BnaC08g22860D                                        99.4    2e-20   
emb|CDY16303.1|  BnaC01g23380D                                        99.4    2e-20   Brassica napus [oilseed rape]
ref|XP_002532480.1|  sugar transporter, putative                      98.6    2e-20   
ref|XP_003517121.1|  PREDICTED: monosaccharide-sensing protein 2-...  98.6    3e-20   
ref|XP_008242155.1|  PREDICTED: monosaccharide-sensing protein 2-...  98.6    4e-20   Prunus mume [ume]
ref|XP_007203009.1|  hypothetical protein PRUPE_ppa017631mg           98.2    4e-20   Prunus persica
ref|XP_007158028.1|  hypothetical protein PHAVU_002G118100g           98.2    5e-20   Phaseolus vulgaris [French bean]
ref|XP_003604104.1|  Monosaccharide-sensing protein                   97.4    8e-20   Medicago truncatula
ref|XP_010097645.1|  Monosaccharide-sensing protein 3                 97.1    1e-19   Morus notabilis
gb|KEH36403.1|  tonoplast monosaccharide transporter 2                96.3    2e-19   Medicago truncatula
gb|EMS60524.1|  Monosaccharide-sensing protein 3                      94.7    2e-19   Triticum urartu
gb|EAY88374.1|  hypothetical protein OsI_09831                        95.9    3e-19   Oryza sativa Indica Group [Indian rice]
gb|AAN17390.1|  Putative sugar transporter protein                    95.9    3e-19   Oryza sativa Japonica Group [Japonica rice]
dbj|BAA85398.1|  unnamed protein product                              95.9    3e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003548779.1|  PREDICTED: monosaccharide-sensing protein 3-...  95.1    5e-19   Glycine max [soybeans]
ref|XP_008786687.1|  PREDICTED: monosaccharide-sensing protein 2-...  94.7    8e-19   Phoenix dactylifera
dbj|BAK02857.1|  predicted protein                                    94.4    1e-18   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004509464.1|  PREDICTED: monosaccharide-sensing protein 2-...  94.0    1e-18   Cicer arietinum [garbanzo]
ref|XP_007156262.1|  hypothetical protein PHAVU_003G271500g           94.0    1e-18   Phaseolus vulgaris [French bean]
ref|XP_003629095.1|  Monosaccharide-sensing protein                   93.6    2e-18   
ref|XP_004512287.1|  PREDICTED: monosaccharide-sensing protein 2-...  93.2    2e-18   Cicer arietinum [garbanzo]
ref|XP_003573173.1|  PREDICTED: monosaccharide-sensing protein 2-...  92.8    3e-18   Brachypodium distachyon [annual false brome]
ref|XP_006649210.1|  PREDICTED: monosaccharide-sensing protein 2-...  92.8    3e-18   
ref|XP_002982939.1|  hypothetical protein SELMODRAFT_445340           90.9    1e-17   Selaginella moellendorffii
ref|XP_002981960.1|  hypothetical protein SELMODRAFT_179172           90.9    1e-17   Selaginella moellendorffii
ref|XP_003614108.1|  Monosaccharide-sensing protein                   90.1    2e-17   Medicago truncatula
ref|NP_001147067.1|  hexose transporter                               90.1    3e-17   Zea mays [maize]
gb|ACG25339.1|  hexose transporter                                    90.1    3e-17   Zea mays [maize]
ref|XP_003562146.1|  PREDICTED: monosaccharide-sensing protein 2-...  89.7    4e-17   
ref|XP_009387331.1|  PREDICTED: monosaccharide-sensing protein 1-...  89.0    4e-17   
gb|AES95370.2|  tonoplast monosaccharide transporter 2                89.4    5e-17   Medicago truncatula
ref|XP_002981894.1|  hypothetical protein SELMODRAFT_179271           88.6    8e-17   Selaginella moellendorffii
gb|EAY88138.1|  hypothetical protein OsI_09573                        88.6    8e-17   Oryza sativa Indica Group [Indian rice]
ref|XP_002986014.1|  hypothetical protein SELMODRAFT_182142           88.6    9e-17   Selaginella moellendorffii
dbj|BAD23011.1|  putative hexose transporter                          88.6    9e-17   Oryza sativa Japonica Group [Japonica rice]
gb|EMS63099.1|  Monosaccharide-sensing protein 3                      88.6    1e-16   Triticum urartu
gb|EMT02609.1|  Monosaccharide-sensing protein 3                      88.2    1e-16   
gb|KHN19961.1|  Monosaccharide-sensing protein 2                      84.0    4e-15   Glycine soja [wild soybean]
ref|XP_002978337.1|  hypothetical protein SELMODRAFT_268165           82.8    8e-15   
ref|XP_002970170.1|  hypothetical protein SELMODRAFT_231525           82.8    8e-15   
ref|XP_006653836.1|  PREDICTED: monosaccharide-sensing protein 2-...  80.5    5e-14   Oryza brachyantha
ref|XP_002979533.1|  hypothetical protein SELMODRAFT_111167           79.0    2e-13   
ref|XP_002977746.1|  hypothetical protein SELMODRAFT_10582            79.0    2e-13   
ref|XP_002453100.1|  hypothetical protein SORBIDRAFT_04g038460        77.8    2e-13   
ref|XP_001761207.1|  predicted protein                                77.4    6e-13   
ref|XP_003603869.1|  Monosaccharide-sensing protein                   76.6    8e-13   
ref|XP_010237535.1|  PREDICTED: monosaccharide-sensing protein 2-...  73.9    5e-12   
ref|XP_003577342.1|  PREDICTED: monosaccharide-sensing protein 2-...  73.9    7e-12   Brachypodium distachyon [annual false brome]
ref|XP_001784511.1|  predicted protein                                72.8    2e-11   
gb|EKE07916.1|  D-xylose-proton symporter                             66.6    8e-11   uncultured bacterium
ref|XP_006662557.1|  PREDICTED: monosaccharide-sensing protein 2-...  69.7    2e-10   
ref|XP_001773057.1|  predicted protein                                69.3    2e-10   
ref|XP_003612412.1|  Monosaccharide-sensing protein                   68.6    4e-10   
ref|WP_041063194.1|  MFS transporter                                  65.5    3e-09   
gb|KJB14185.1|  hypothetical protein B456_002G113400                  65.9    3e-09   
gb|EYU43535.1|  hypothetical protein MIMGU_mgv1a002513mg              65.5    4e-09   
ref|WP_017197861.1|  major facilitator transporter                    61.6    6e-08   
gb|KHG04802.1|  Monosaccharide-sensing protein 2                      61.6    7e-08   
dbj|GAF38784.1|  D-xylose proton-symporter XylT                       58.5    8e-08   
ref|NP_001173250.1|  Os03g0128900                                     59.3    8e-08   
gb|ABA94777.1|  Sugar transporter, putative, expressed                61.2    9e-08   
gb|ABA94776.1|  Sugar transporter, putative, expressed                61.2    9e-08   
ref|WP_041707370.1|  major facilitator transporter                    60.8    1e-07   
ref|WP_014679839.1|  sugar:proton symporter                           60.8    1e-07   
gb|AFV88196.1|  MFS family major facilitator transporter              60.8    1e-07   
ref|WP_034138354.1|  major facilitator transporter                    60.5    1e-07   
ref|WP_019203988.1|  hypothetical protein                             60.5    1e-07   
ref|WP_010331918.1|  MFS transporter                                  60.5    1e-07   
ref|WP_044159158.1|  MFS transporter                                  60.5    1e-07   
ref|WP_035888480.1|  hypothetical protein                             60.1    1e-07   
ref|XP_001754179.1|  predicted protein                                60.5    1e-07   
ref|WP_035895259.1|  hypothetical protein                             60.1    2e-07   
ref|WP_034881951.1|  hypothetical protein                             60.1    2e-07   
ref|WP_013942808.1|  putative metabolite transport protein ywtG       60.1    2e-07   
ref|XP_006663052.1|  PREDICTED: monosaccharide-sensing protein 2-...  60.1    2e-07   
ref|WP_027603375.1|  major facilitator transporter                    59.7    2e-07   
ref|WP_025286678.1|  major facilitator transporter                    59.7    2e-07   
ref|WP_025318950.1|  major facilitator transporter                    59.7    2e-07   
ref|WP_025320564.1|  major facilitator transporter                    59.7    2e-07   
ref|WP_011631971.1|  major facilitator transporter                    59.7    2e-07   
ref|WP_041777850.1|  MFS sugar transporter                            59.7    3e-07   
gb|ACB93764.1|  sugar transporter                                     59.7    3e-07   
ref|WP_019251315.1|  major facilitator transporter                    59.3    3e-07   
ref|WP_003666501.1|  major facilitator transporter                    59.3    3e-07   
ref|WP_013238482.1|  major facilitator transporter                    59.3    3e-07   
ref|WP_023163452.1|  sugar transporter                                59.3    3e-07   
ref|WP_013201166.1|  major facilitator transporter                    59.3    3e-07   
gb|AAM94321.1|  putative sugar transporter                            59.7    3e-07   
ref|WP_040444514.1|  hypothetical protein                             59.3    3e-07   
ref|XP_002449882.1|  hypothetical protein SORBIDRAFT_05g024860        59.7    3e-07   
ref|XP_004979746.1|  PREDICTED: monosaccharide-sensing protein 3-...  59.3    3e-07   
gb|EFH86020.1|  sugar transporter                                     58.9    4e-07   
ref|WP_016458053.1|  sugar porter (SP) family MFS transporter         58.9    4e-07   
gb|AAD27676.1|AF119222_8  putative sugar transporter protein          59.3    4e-07   
gb|EOA08512.1|  MFS transporter, sugar porter (SP) family             56.2    5e-07   
gb|EKD78085.1|  hypothetical protein ACD_42C00046G0002                58.5    5e-07   
ref|WP_034514653.1|  major facilitator transporter                    58.5    6e-07   
ref|WP_018178242.1|  hypothetical protein                             58.5    6e-07   
emb|CDR33502.1|  putative D-xylose-proton symporter                   58.5    6e-07   
ref|WP_018520641.1|  MULTISPECIES: sugar transporter                  58.5    6e-07   
ref|WP_029946600.1|  major facilitator transporter                    54.3    7e-07   
ref|WP_017895285.1|  major facilitator transporter                    58.2    7e-07   
ref|WP_026588992.1|  major facilitator transporter                    58.2    7e-07   
ref|WP_016876260.1|  major facilitator transporter                    58.2    7e-07   
ref|WP_018631168.1|  hypothetical protein                             58.2    7e-07   
ref|WP_004915014.1|  major facilitator transporter                    58.2    7e-07   
ref|WP_032816497.1|  hypothetical protein                             57.4    7e-07   
gb|EEC68553.1|  hypothetical protein OsI_36866                        58.2    8e-07   
ref|XP_004987196.1|  PREDICTED: monosaccharide-sensing protein 2-...  55.8    8e-07   
ref|WP_003551797.1|  major facilitator transporter                    58.2    8e-07   
ref|WP_003557282.1|  MULTISPECIES: major facilitator transporter      58.2    9e-07   
ref|WP_030266175.1|  major facilitator transporter                    58.2    9e-07   
ref|WP_003715948.1|  major facilitator transporter                    57.8    9e-07   
ref|WP_003712779.1|  major facilitator transporter                    57.8    9e-07   
ref|WP_007123566.1|  major facilitator transporter                    57.8    9e-07   
ref|WP_031060475.1|  major facilitator transporter                    57.8    9e-07   
gb|ABY23586.1|  glucose/fructose transport protein                    54.7    1e-06   
ref|WP_032393467.1|  major facilitator transporter                    57.8    1e-06   
ref|WP_037193447.1|  major facilitator transporter                    57.8    1e-06   
emb|CCC56913.1|  D-xylose proton-symporter                            57.8    1e-06   
ref|WP_010179449.1|  MFS transporter                                  57.8    1e-06   
ref|WP_007638147.1|  D-xylose-proton symporter                        57.4    1e-06   
ref|WP_041017256.1|  major facilitator transporter                    57.4    1e-06   
ref|WP_035166342.1|  major facilitator transporter                    57.4    1e-06   
ref|WP_032402905.1|  major facilitator transporter                    57.4    1e-06   
ref|WP_022817339.1|  hypothetical protein                             57.4    1e-06   
ref|WP_030900727.1|  major facilitator transporter                    57.4    1e-06   
gb|EFE71608.1|  bicyclomycin resistance protein TcaB                  57.4    1e-06   
ref|WP_016827864.1|  sugar transporter                                57.4    1e-06   
ref|WP_032378936.1|  major facilitator transporter                    57.4    1e-06   
ref|WP_035544271.1|  major facilitator transporter                    53.9    2e-06   
gb|AAN40021.1|  putative sugar transporter protein                    57.4    2e-06   
ref|WP_043495660.1|  sugar transporter                                57.4    2e-06   
ref|WP_021482816.1|  major facilitator transporter                    57.0    2e-06   
ref|WP_037162384.1|  major facilitator transporter                    57.0    2e-06   
ref|WP_019667160.1|  MULTISPECIES: major facilitator transporter      57.0    2e-06   
gb|KFD44116.1|  major facilitator transporter                         57.0    2e-06   
ref|WP_039734020.1|  MFS transporter                                  57.0    2e-06   
ref|WP_043655138.1|  major facilitator transporter                    57.0    2e-06   
ref|WP_034652519.1|  major facilitator transporter                    57.0    2e-06   
ref|WP_005769170.1|  major facilitator transporter                    57.0    2e-06   
ref|WP_037104504.1|  major facilitator transporter                    57.0    2e-06   
ref|WP_005772424.1|  major facilitator transporter                    57.0    2e-06   
ref|WP_019764279.1|  sugar transporter                                57.0    2e-06   
gb|AEB65072.1|  arabinose-like compounds permease                     56.6    2e-06   
ref|WP_031053894.1|  sugar transporter                                57.0    2e-06   
ref|WP_041915589.1|  MFS transporter                                  57.0    2e-06   
ref|WP_032138490.1|  major facilitator transporter                    57.0    2e-06   
ref|WP_034657393.1|  MFS transporter                                  57.0    2e-06   
gb|KFM78889.1|  Proton myo-inositol cotransporter                     53.5    2e-06   
ref|WP_013353664.1|  MFS transporter                                  56.6    2e-06   
ref|WP_006129538.1|  MULTISPECIES: sugar transporter                  57.0    2e-06   
ref|WP_032401253.1|  major facilitator transporter                    56.6    2e-06   
gb|EEI79462.1|  MFS transporter, SP family                            56.6    2e-06   
ref|WP_027497956.1|  MULTISPECIES: major facilitator transporter      56.6    2e-06   
ref|WP_035174295.1|  MFS transporter                                  55.5    2e-06   
ref|WP_043707819.1|  major facilitator transporter                    56.6    2e-06   
ref|WP_030334206.1|  sugar transporter                                56.6    2e-06   
gb|KDL14725.1|  hypothetical protein AF38_04702                       56.6    3e-06   
ref|WP_030114681.1|  MULTISPECIES: sugar transporter                  56.6    3e-06   
ref|WP_030187050.1|  MULTISPECIES: sugar transporter                  56.6    3e-06   
ref|WP_043250808.1|  sugar transporter                                56.6    3e-06   
ref|WP_026974727.1|  MFS transporter                                  56.6    3e-06   
ref|WP_002460768.1|  major facilitator transporter                    56.6    3e-06   
ref|WP_016937885.1|  MFS transporter                                  56.6    3e-06   
ref|WP_041464372.1|  major facilitator transporter                    56.6    3e-06   
ref|WP_033934372.1|  major facilitator transporter                    56.6    3e-06   
ref|WP_032437817.1|  hypothetical protein                             56.2    3e-06   
ref|WP_002492575.1|  major facilitator transporter                    56.2    3e-06   
ref|WP_026243089.1|  MULTISPECIES: sugar transporter                  56.6    3e-06   
ref|WP_040058206.1|  major facilitator transporter                    56.2    3e-06   
ref|WP_017261050.1|  major facilitator transporter                    56.2    3e-06   
ref|WP_002829469.1|  major facilitator transporter                    56.2    3e-06   
gb|KDP90415.1|  major facilitator transporter                         56.2    3e-06   
ref|WP_002832561.1|  major facilitator transporter                    56.2    3e-06   
ref|WP_004166330.1|  major facilitator transporter                    56.2    3e-06   
ref|WP_014418911.1|  MULTISPECIES: MFS transporter                    56.2    3e-06   
ref|WP_003151605.1|  MULTISPECIES: MFS transporter                    56.2    3e-06   
ref|WP_013644894.1|  major facilitator transporter                    56.2    3e-06   
ref|WP_032876389.1|  MULTISPECIES: MFS transporter                    56.2    3e-06   
ref|WP_008841561.1|  sugar transporter                                56.2    3e-06   
ref|WP_039063669.1|  MFS transporter                                  56.2    3e-06   
ref|WP_015490068.1|  putative sugar MFS permease                      56.2    3e-06   
ref|WP_032867015.1|  MULTISPECIES: MFS transporter                    56.2    3e-06   
emb|CAQ00890.1|  putative sugar transporter                           56.2    3e-06   
ref|WP_044170325.1|  sugar:proton symporter                           56.2    3e-06   
ref|WP_026962475.1|  MFS transporter                                  56.2    3e-06   
ref|WP_005288812.1|  MFS transporter                                  56.2    3e-06   
emb|CAN01427.1|  putative sugar MFS permease                          56.2    3e-06   
gb|ERJ42081.2|  MFS transporter                                       56.2    3e-06   
ref|WP_043940583.1|  major facilitator transporter                    56.2    3e-06   
ref|WP_025157472.1|  major facilitator transporter                    56.2    3e-06   
ref|WP_034541265.1|  major facilitator transporter                    56.2    3e-06   
ref|WP_010374991.1|  major facilitator transporter                    56.2    3e-06   
dbj|GAF37031.1|  D-xylose proton-symporter XylT                       53.1    3e-06   
ref|WP_037956567.1|  major facilitator transporter                    56.2    3e-06   
ref|WP_014471050.1|  MULTISPECIES: MFS transporter                    56.2    3e-06   
ref|WP_039398794.1|  major facilitator transporter                    56.2    4e-06   
ref|WP_003235220.1|  arabinose-related compounds permease             55.8    4e-06   
gb|AEK90645.1|  AraE family aromatic acid exporter                    55.8    4e-06   
ref|WP_020935552.1|  permease of the major facilitator superfamil...  55.8    4e-06   
ref|WP_006500344.1|  major facilitator transporter                    55.8    4e-06   
ref|WP_006639311.1|  sugar transporter YwtG                           55.8    4e-06   
ref|WP_019393119.1|  major facilitator transporter                    55.8    4e-06   
ref|WP_021296563.1|  hypothetical protein                             55.8    4e-06   
ref|WP_009112156.1|  major facilitator transporter                    55.8    4e-06   
ref|WP_044801856.1|  MFS transporter                                  55.8    4e-06   
ref|WP_014472703.1|  MULTISPECIES: major facilitator transporter      55.8    4e-06   
ref|WP_014471257.1|  major facilitator transporter                    55.8    4e-06   
ref|WP_013354164.1|  major facilitator transporter                    55.8    4e-06   
ref|WP_038592214.1|  MFS transporter                                  55.8    4e-06   
ref|WP_007625234.1|  major myo-inositol transporter iolT              55.8    4e-06   
ref|XP_008676723.1|  PREDICTED: uncharacterized protein LOC100272...  55.8    4e-06   
ref|WP_033195997.1|  major facilitator transporter                    55.8    4e-06   
gb|EFH84814.1|  sugar transporter                                     55.8    4e-06   
ref|WP_040446630.1|  hypothetical protein                             55.8    4e-06   
ref|WP_034583448.1|  MFS transporter                                  55.8    5e-06   
ref|WP_010964648.1|  MFS transporter                                  55.8    5e-06   
ref|WP_026260274.1|  sugar:proton symporter                           55.8    5e-06   
ref|WP_010328648.1|  MULTISPECIES: MFS transporter                    55.8    5e-06   
ref|WP_019715762.1|  MFS transporter                                  55.8    5e-06   
ref|WP_024967188.1|  IolT                                             55.8    5e-06   
ref|WP_041206706.1|  MFS transporter                                  55.5    5e-06   
ref|WP_003219952.1|  MULTISPECIES: MFS transporter                    55.8    5e-06   
ref|WP_041882616.1|  sugar:proton symporter                           55.8    5e-06   
ref|WP_017576349.1|  hypothetical protein                             55.8    5e-06   
ref|WP_034634458.1|  major facilitator transporter                    55.5    5e-06   
ref|WP_024713482.1|  MFS transporter                                  55.5    5e-06   
ref|WP_014465940.1|  MFS transporter                                  55.5    5e-06   
ref|WP_016954813.1|  hypothetical protein                             55.8    5e-06   
ref|WP_035000666.1|  MFS transporter                                  55.5    5e-06   
ref|WP_010332110.1|  major facilitator transporter                    55.5    5e-06   
ref|WP_033292529.1|  hypothetical protein                             55.5    5e-06   
ref|WP_024123064.1|  major facilitator transporter                    55.5    5e-06   
gb|ERS42122.1|  hypothetical protein HMPREF1292_00189                 55.5    5e-06   
ref|WP_034645402.1|  MULTISPECIES: MFS transporter                    55.5    6e-06   
ref|WP_020089467.1|  major facilitator transporter                    55.5    6e-06   
ref|WP_028925476.1|  major facilitator transporter                    55.1    7e-06   
ref|WP_041351268.1|  major facilitator transporter                    55.1    7e-06   
ref|WP_011997243.1|  major facilitator transporter                    55.1    7e-06   
ref|WP_008385733.1|  sugar transporter                                55.1    7e-06   
ref|WP_026964639.1|  MFS transporter                                  55.1    7e-06   
emb|CDL07154.1|  Arabinose-proton symporter                           52.8    7e-06   
gb|EKD46018.1|  hypothetical protein ACD_69C00046G0001                55.1    7e-06   
ref|WP_029697401.1|  hypothetical protein                             55.1    7e-06   
emb|CDS94297.1|  Sugar transporter                                    55.1    7e-06   
ref|WP_043587938.1|  major facilitator transporter                    55.1    7e-06   
ref|WP_037544280.1|  major facilitator transporter                    55.1    8e-06   
ref|WP_043022080.1|  major facilitator transporter                    55.1    8e-06   
ref|WP_043561634.1|  major facilitator transporter                    55.1    8e-06   
ref|WP_032726992.1|  major facilitator transporter                    55.1    8e-06   
emb|CAB07473.1|  ywtG                                                 55.1    8e-06   
ref|WP_024855255.1|  major facilitator transporter                    55.1    8e-06   
ref|WP_024525904.1|  major facilitator transporter                    55.1    8e-06   
ref|WP_021480749.1|  major facilitator transporter                    55.1    8e-06   
sp|O52733.1|XYLT_LACBR  RecName: Full=D-xylose-proton symporter; ...  55.1    8e-06   
ref|WP_021742415.1|  MFS transporter, SP family                       55.1    8e-06   
ref|WP_014478156.1|  major facilitator transporter                    55.1    8e-06   
ref|WP_043672908.1|  major facilitator transporter                    55.1    8e-06   
ref|WP_024572027.1|  hypothetical protein                             52.0    8e-06   
ref|WP_003243731.1|  major facilitator transporter                    55.1    8e-06   
ref|WP_017697351.1|  major facilitator transporter                    55.1    8e-06   
ref|WP_015473104.1|  D-xylose-proton symporter                        55.1    8e-06   
ref|WP_041333343.1|  major facilitator transporter                    55.1    8e-06   
ref|WP_029318758.1|  major facilitator transporter                    55.1    8e-06   
ref|WP_015251080.1|  hypothetical protein                             55.1    8e-06   
ref|WP_015384820.1|  hypothetical protein                             55.1    8e-06   
ref|WP_003227903.1|  major facilitator transporter                    55.1    8e-06   
ref|WP_019168203.1|  major facilitator transporter                    55.1    9e-06   
ref|WP_038429742.1|  MULTISPECIES: major facilitator transporter      55.1    9e-06   
ref|WP_024571920.1|  major facilitator transporter                    55.1    9e-06   
ref|WP_036962765.1|  major facilitator transporter                    55.1    9e-06   



>ref|XP_009595864.1| PREDICTED: monosaccharide-sensing protein 2 [Nicotiana tomentosiformis]
 ref|XP_009595865.1| PREDICTED: monosaccharide-sensing protein 2 [Nicotiana tomentosiformis]
 ref|XP_009595866.1| PREDICTED: monosaccharide-sensing protein 2 [Nicotiana tomentosiformis]
Length=738

 Score =   148 bits (374),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 73/84 (87%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  509
            MNGAVLVA+AATIGNFLQGWDNATIAGAVVYIKKEL L+  +EGLVVAMSLIGATL+TTC
Sbjct  1    MNGAVLVALAATIGNFLQGWDNATIAGAVVYIKKELTLDASVEGLVVAMSLIGATLVTTC  60

Query  510  SGSIADWLGRRPMLILSSMFYFLS  581
            SG+I+D  GRRPMLILSSMFYFLS
Sbjct  61   SGTISDSFGRRPMLILSSMFYFLS  84



>ref|XP_009796447.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana sylvestris]
 ref|XP_009796448.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana sylvestris]
 ref|XP_009796450.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana sylvestris]
Length=738

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/84 (87%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  509
            MNGAVLVA+AATIGNFLQGWDNATIAGAVVYIKKEL L+  +EGLVVAMSLIGATL+TTC
Sbjct  1    MNGAVLVALAATIGNFLQGWDNATIAGAVVYIKKELTLDASVEGLVVAMSLIGATLVTTC  60

Query  510  SGSIADWLGRRPMLILSSMFYFLS  581
            SG I+D  GRRPMLILSSMFYFLS
Sbjct  61   SGPISDSFGRRPMLILSSMFYFLS  84



>ref|XP_007135975.1| hypothetical protein PHAVU_009G007600g [Phaseolus vulgaris]
 gb|ESW07969.1| hypothetical protein PHAVU_009G007600g [Phaseolus vulgaris]
Length=736

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/83 (84%), Positives = 78/83 (94%), Gaps = 0/83 (0%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  509
            M GAVLVAIAA+IGNFLQGWDNATIAGA+VYIKK+L L+T MEGLVVAMSLIGATLITTC
Sbjct  1    MKGAVLVAIAASIGNFLQGWDNATIAGAIVYIKKDLALQTTMEGLVVAMSLIGATLITTC  60

Query  510  SGSIADWLGRRPMLILSSMFYFL  578
            SG ++DWLGRRPMLI+SS+ YFL
Sbjct  61   SGPVSDWLGRRPMLIISSLLYFL  83



>ref|XP_006342166.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006342167.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X2 [Solanum 
tuberosum]
Length=737

 Score =   147 bits (372),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/84 (87%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  509
            MNGAVLVA+AATIGNFLQGWDNATIAGAVVYIKKEL L+  +EGLVVAMSLIGATL+TTC
Sbjct  1    MNGAVLVALAATIGNFLQGWDNATIAGAVVYIKKELALDASVEGLVVAMSLIGATLVTTC  60

Query  510  SGSIADWLGRRPMLILSSMFYFLS  581
            SGSIAD +GRRPMLI+SSM YFLS
Sbjct  61   SGSIADSIGRRPMLIMSSMLYFLS  84



>ref|XP_011074068.1| PREDICTED: monosaccharide-sensing protein 2-like [Sesamum indicum]
 ref|XP_011074069.1| PREDICTED: monosaccharide-sensing protein 2-like [Sesamum indicum]
Length=739

 Score =   147 bits (372),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  509
            MNGA LVAIAATIGNFLQGWDNATIAGAVVYIKKEL L   +EGL+VAMSLIGAT+ITTC
Sbjct  1    MNGAALVAIAATIGNFLQGWDNATIAGAVVYIKKELELGAAIEGLIVAMSLIGATVITTC  60

Query  510  SGSIADWLGRRPMLILSSMFYFLS  581
            SG+I+DW+GRRPMLILSS+FYFLS
Sbjct  61   SGTISDWIGRRPMLILSSIFYFLS  84



>ref|XP_003527273.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X1 [Glycine 
max]
 ref|XP_006581130.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X2 [Glycine 
max]
Length=737

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/83 (84%), Positives = 78/83 (94%), Gaps = 0/83 (0%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  509
            M GAVLVAIAA+IGNFLQGWDNATIAGA+VYIKK+L LET MEGLVVAMSLIGAT+ITTC
Sbjct  1    MKGAVLVAIAASIGNFLQGWDNATIAGAIVYIKKDLALETTMEGLVVAMSLIGATVITTC  60

Query  510  SGSIADWLGRRPMLILSSMFYFL  578
            SG +ADWLGRRPM+I+SS+ YFL
Sbjct  61   SGPVADWLGRRPMMIISSVLYFL  83



>ref|NP_001289848.1| monosaccharide-sensing protein 2 [Solanum lycopersicum]
 dbj|BAO96237.1| tonoplast monosaccharide transporter 2 [Solanum lycopersicum]
Length=738

 Score =   147 bits (370),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  509
            MNGAVLVA+AATIGNFLQGWDNATIAGAVVYIKKEL L+  +EGL+VAMSLIGATL+TTC
Sbjct  1    MNGAVLVALAATIGNFLQGWDNATIAGAVVYIKKELTLDASVEGLIVAMSLIGATLVTTC  60

Query  510  SGSIADWLGRRPMLILSSMFYFLS  581
            SGSIAD +GRRPMLI+SSM YFLS
Sbjct  61   SGSIADSIGRRPMLIMSSMLYFLS  84



>ref|XP_006577928.1| PREDICTED: monosaccharide-sensing protein 2-like [Glycine max]
Length=738

 Score =   146 bits (369),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 70/83 (84%), Positives = 78/83 (94%), Gaps = 0/83 (0%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  509
            M GAVLVAIAA+IGNFLQGWDNATIAGA+VYIKK+L L+T MEGLVVAMSLIGAT+ITTC
Sbjct  1    MKGAVLVAIAASIGNFLQGWDNATIAGAIVYIKKDLALQTTMEGLVVAMSLIGATVITTC  60

Query  510  SGSIADWLGRRPMLILSSMFYFL  578
            SG IADWLGRRPM+I+SS+ YFL
Sbjct  61   SGPIADWLGRRPMMIISSVLYFL  83



>gb|KHN33775.1| Monosaccharide-sensing protein 2 [Glycine soja]
Length=737

 Score =   146 bits (369),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 70/83 (84%), Positives = 78/83 (94%), Gaps = 0/83 (0%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  509
            M GAVLVAIAA+IGNFLQGWDNATIAGA+VYIKK+L L+T MEGLVVAMSLIGAT+ITTC
Sbjct  1    MKGAVLVAIAASIGNFLQGWDNATIAGAIVYIKKDLALQTTMEGLVVAMSLIGATVITTC  60

Query  510  SGSIADWLGRRPMLILSSMFYFL  578
            SG IADWLGRRPM+I+SS+ YFL
Sbjct  61   SGPIADWLGRRPMMIISSVLYFL  83



>gb|KDO85211.1| hypothetical protein CISIN_1g004673mg [Citrus sinensis]
Length=592

 Score =   144 bits (364),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 71/84 (85%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  509
            MNGA LVAIAATIGNFLQGWDNATIAGA+VYIKK+L L T +EGLVVAMSLIGAT ITTC
Sbjct  1    MNGAALVAIAATIGNFLQGWDNATIAGAIVYIKKDLNLGTTVEGLVVAMSLIGATAITTC  60

Query  510  SGSIADWLGRRPMLILSSMFYFLS  581
            SG I+DWLGRRPMLILSS+ YF+S
Sbjct  61   SGPISDWLGRRPMLILSSVLYFVS  84



>emb|CDP07261.1| unnamed protein product [Coffea canephora]
Length=737

 Score =   145 bits (366),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 70/84 (83%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  509
            M GAV VA++AT+GNFLQGWDNATIAGAVVY+KKEL LE  +EGLVVAMSLIGATLITTC
Sbjct  1    MKGAVFVALSATVGNFLQGWDNATIAGAVVYMKKELDLEATVEGLVVAMSLIGATLITTC  60

Query  510  SGSIADWLGRRPMLILSSMFYFLS  581
            SGSI+DW+GRRPMLILSS FYF S
Sbjct  61   SGSISDWIGRRPMLILSSSFYFFS  84



>ref|XP_010094525.1| Monosaccharide-sensing protein 2 [Morus notabilis]
 gb|EXB56279.1| Monosaccharide-sensing protein 2 [Morus notabilis]
Length=739

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/84 (82%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  509
            M GA LVAIAATIGNFLQGWDNATIAGA+VYIKK+LVLE+ +EGLVVAMSLIGAT ITTC
Sbjct  1    MKGAALVAIAATIGNFLQGWDNATIAGAIVYIKKDLVLESSVEGLVVAMSLIGATAITTC  60

Query  510  SGSIADWLGRRPMLILSSMFYFLS  581
            SG+++DWLGRRPMLI+SS+ YF+S
Sbjct  61   SGAVSDWLGRRPMLIISSVLYFIS  84



>gb|KDO85208.1| hypothetical protein CISIN_1g004673mg [Citrus sinensis]
Length=706

 Score =   144 bits (362),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 71/84 (85%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  509
            MNGA LVAIAATIGNFLQGWDNATIAGA+VYIKK+L L T +EGLVVAMSLIGAT ITTC
Sbjct  1    MNGAALVAIAATIGNFLQGWDNATIAGAIVYIKKDLNLGTTVEGLVVAMSLIGATAITTC  60

Query  510  SGSIADWLGRRPMLILSSMFYFLS  581
            SG I+DWLGRRPMLILSS+ YF+S
Sbjct  61   SGPISDWLGRRPMLILSSVLYFVS  84



>ref|XP_006435423.1| hypothetical protein CICLE_v10000400mg [Citrus clementina]
 ref|XP_006473839.1| PREDICTED: monosaccharide-sensing protein 2-like [Citrus sinensis]
 gb|ESR48663.1| hypothetical protein CICLE_v10000400mg [Citrus clementina]
 gb|KDO85209.1| hypothetical protein CISIN_1g004673mg [Citrus sinensis]
Length=738

 Score =   144 bits (362),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 71/84 (85%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  509
            MNGA LVAIAATIGNFLQGWDNATIAGA+VYIKK+L L T +EGLVVAMSLIGAT ITTC
Sbjct  1    MNGAALVAIAATIGNFLQGWDNATIAGAIVYIKKDLNLGTTVEGLVVAMSLIGATAITTC  60

Query  510  SGSIADWLGRRPMLILSSMFYFLS  581
            SG I+DWLGRRPMLILSS+ YF+S
Sbjct  61   SGPISDWLGRRPMLILSSVLYFVS  84



>ref|XP_003603868.1| Monosaccharide-sensing protein [Medicago truncatula]
 gb|AES74119.1| tonoplast monosaccharide transporter 2 [Medicago truncatula]
Length=730

 Score =   143 bits (360),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 67/83 (81%), Positives = 78/83 (94%), Gaps = 0/83 (0%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  509
            M GAVLVAIAA+IGNFLQGWDNATIAG+++YIKK+L L+T MEGLVVAMSLIGAT+ITTC
Sbjct  1    MKGAVLVAIAASIGNFLQGWDNATIAGSILYIKKDLALQTTMEGLVVAMSLIGATVITTC  60

Query  510  SGSIADWLGRRPMLILSSMFYFL  578
            SG I+DWLGRRPM+I+SS+ YFL
Sbjct  61   SGPISDWLGRRPMMIISSVLYFL  83



>gb|KDP36756.1| hypothetical protein JCGZ_08047 [Jatropha curcas]
Length=739

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 69/84 (82%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  509
            MNGAVLVAIAA IG+FLQGWDNATIAGA+VYIK +L L+T +EGLVVAMSLIGAT ITTC
Sbjct  1    MNGAVLVAIAACIGSFLQGWDNATIAGAIVYIKDDLDLQTTVEGLVVAMSLIGATAITTC  60

Query  510  SGSIADWLGRRPMLILSSMFYFLS  581
            SG+I+DWLGRRPMLI+SSM YF+S
Sbjct  61   SGAISDWLGRRPMLIMSSMLYFVS  84



>ref|XP_011100175.1| PREDICTED: monosaccharide-sensing protein 2-like [Sesamum indicum]
Length=740

 Score =   141 bits (356),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 71/84 (85%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  509
            M GA LVAIAATIGNFLQGWDNATIAGAVVYIKKEL L   +EGL+VAMSLIGATLITTC
Sbjct  1    MKGAALVAIAATIGNFLQGWDNATIAGAVVYIKKELQLGAAIEGLIVAMSLIGATLITTC  60

Query  510  SGSIADWLGRRPMLILSSMFYFLS  581
            SG+I+D +GRRPMLI SSMFYFLS
Sbjct  61   SGTISDLIGRRPMLISSSMFYFLS  84



>ref|XP_004500833.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X1 [Cicer 
arietinum]
 ref|XP_004500834.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X2 [Cicer 
arietinum]
Length=736

 Score =   140 bits (353),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 66/83 (80%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  509
            M GAV VAI A+IGNFLQGWDNATIAGA++YIKK+L L T MEGLVVAMSLIGAT+ITTC
Sbjct  1    MKGAVFVAIVASIGNFLQGWDNATIAGAILYIKKDLALHTTMEGLVVAMSLIGATVITTC  60

Query  510  SGSIADWLGRRPMLILSSMFYFL  578
            SG I+DWLGRRPM+I+SS+ YFL
Sbjct  61   SGPISDWLGRRPMMIISSVLYFL  83



>gb|KJB14182.1| hypothetical protein B456_002G113400 [Gossypium raimondii]
Length=548

 Score =   139 bits (349),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 67/84 (80%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  509
            M GA  VAIAATIGNFLQGWDNATIAGA+VYIK +L L T +EGLVVAMSLIGAT ITTC
Sbjct  1    MRGAAFVAIAATIGNFLQGWDNATIAGAIVYIKNDLNLGTSVEGLVVAMSLIGATAITTC  60

Query  510  SGSIADWLGRRPMLILSSMFYFLS  581
            SG+I+DW+GRRPMLI+SSM YF+S
Sbjct  61   SGAISDWIGRRPMLIMSSMLYFVS  84



>gb|KJB14183.1| hypothetical protein B456_002G113400 [Gossypium raimondii]
Length=557

 Score =   139 bits (349),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 67/84 (80%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  509
            M GA  VAIAATIGNFLQGWDNATIAGA+VYIK +L L T +EGLVVAMSLIGAT ITTC
Sbjct  1    MRGAAFVAIAATIGNFLQGWDNATIAGAIVYIKNDLNLGTSVEGLVVAMSLIGATAITTC  60

Query  510  SGSIADWLGRRPMLILSSMFYFLS  581
            SG+I+DW+GRRPMLI+SSM YF+S
Sbjct  61   SGAISDWIGRRPMLIMSSMLYFVS  84



>gb|KHG10189.1| Monosaccharide-sensing 2 -like protein [Gossypium arboreum]
Length=739

 Score =   140 bits (353),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 69/84 (82%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  509
            M GA LVAIAATIGNFLQGWDNATIAGA+VYIK +L L T +EGLVVAMSLIGAT ITTC
Sbjct  1    MRGAALVAIAATIGNFLQGWDNATIAGAIVYIKNDLDLGTSVEGLVVAMSLIGATAITTC  60

Query  510  SGSIADWLGRRPMLILSSMFYFLS  581
            SG+I+DWLGRRPMLI+SSM YF+S
Sbjct  61   SGAISDWLGRRPMLIMSSMLYFVS  84



>ref|XP_007018119.1| Tonoplast monosaccharide transporter2 isoform 1 [Theobroma cacao]
 ref|XP_007018120.1| Tonoplast monosaccharide transporter2 isoform 1 [Theobroma cacao]
 ref|XP_007018121.1| Tonoplast monosaccharide transporter2 isoform 1 [Theobroma cacao]
 gb|EOY15344.1| Tonoplast monosaccharide transporter2 isoform 1 [Theobroma cacao]
 gb|EOY15345.1| Tonoplast monosaccharide transporter2 isoform 1 [Theobroma cacao]
 gb|EOY15346.1| Tonoplast monosaccharide transporter2 isoform 1 [Theobroma cacao]
Length=739

 Score =   140 bits (352),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 68/84 (81%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  509
            M GA LVAIAATIGNFLQGWDNATIAGA+VYIK++L L T +EGLVVAMSLIGAT+ITTC
Sbjct  1    MRGAALVAIAATIGNFLQGWDNATIAGAIVYIKEDLNLGTSVEGLVVAMSLIGATVITTC  60

Query  510  SGSIADWLGRRPMLILSSMFYFLS  581
            SG+I+DWLGRRPMLI+SS+ YF+S
Sbjct  61   SGAISDWLGRRPMLIISSILYFVS  84



>ref|XP_007018122.1| Tonoplast monosaccharide transporter2 isoform 4 [Theobroma cacao]
 gb|EOY15347.1| Tonoplast monosaccharide transporter2 isoform 4 [Theobroma cacao]
Length=740

 Score =   140 bits (352),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 68/84 (81%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  509
            M GA LVAIAATIGNFLQGWDNATIAGA+VYIK++L L T +EGLVVAMSLIGAT+ITTC
Sbjct  1    MRGAALVAIAATIGNFLQGWDNATIAGAIVYIKEDLNLGTSVEGLVVAMSLIGATVITTC  60

Query  510  SGSIADWLGRRPMLILSSMFYFLS  581
            SG+I+DWLGRRPMLI+SS+ YF+S
Sbjct  61   SGAISDWLGRRPMLIISSILYFVS  84



>emb|CDY33650.1| BnaC08g19500D [Brassica napus]
Length=697

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/84 (80%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  509
            M GA LVA+AATIGNFLQGWDNATIAGA+VYI K++ L T ++GLVVAMSLIGAT+ITTC
Sbjct  1    MKGATLVALAATIGNFLQGWDNATIAGAMVYINKDMNLPTSVQGLVVAMSLIGATVITTC  60

Query  510  SGSIADWLGRRPMLILSSMFYFLS  581
            SG I+DWLGRRPMLILSS+ YFLS
Sbjct  61   SGPISDWLGRRPMLILSSVMYFLS  84



>ref|XP_010061214.1| PREDICTED: monosaccharide-sensing protein 2-like [Eucalyptus 
grandis]
 gb|KCW68134.1| hypothetical protein EUGRSUZ_F01805 [Eucalyptus grandis]
Length=735

 Score =   139 bits (349),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 67/84 (80%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  509
            M GAV VAIAATIGNFLQGWDNATIAGA++YIK++L L T +EGLVVAMSLIGAT+ITTC
Sbjct  1    MKGAVWVAIAATIGNFLQGWDNATIAGAIIYIKEDLDLGTTVEGLVVAMSLIGATVITTC  60

Query  510  SGSIADWLGRRPMLILSSMFYFLS  581
            SG+I+DW+GRRPMLILSS+ YF+S
Sbjct  61   SGAISDWVGRRPMLILSSLLYFIS  84



>ref|XP_006416357.1| hypothetical protein EUTSA_v10006916mg [Eutrema salsugineum]
 ref|XP_006416358.1| hypothetical protein EUTSA_v10006916mg [Eutrema salsugineum]
 gb|ESQ34710.1| hypothetical protein EUTSA_v10006916mg [Eutrema salsugineum]
 gb|ESQ34711.1| hypothetical protein EUTSA_v10006916mg [Eutrema salsugineum]
Length=733

 Score =   139 bits (349),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 67/84 (80%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  509
            M GA LVA+AATIGNFLQGWDNATIAGA+VYI K++ L T ++GLVVAMSLIGAT+ITTC
Sbjct  1    MKGATLVALAATIGNFLQGWDNATIAGAMVYINKDMNLPTSVQGLVVAMSLIGATVITTC  60

Query  510  SGSIADWLGRRPMLILSSMFYFLS  581
            SG I+DWLGRRPMLILSS+ YFLS
Sbjct  61   SGPISDWLGRRPMLILSSIMYFLS  84



>dbj|BAJ33724.1| unnamed protein product [Thellungiella halophila]
Length=733

 Score =   138 bits (348),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 67/84 (80%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  509
            M GA LVA+AATIGNFLQGWDNATIAGA+VYI K++ L T ++GLVVAMSLIGAT+ITTC
Sbjct  1    MKGATLVALAATIGNFLQGWDNATIAGAMVYINKDMNLPTSVQGLVVAMSLIGATVITTC  60

Query  510  SGSIADWLGRRPMLILSSMFYFLS  581
            SG I+DWLGRRPMLILSS+ YFLS
Sbjct  61   SGPISDWLGRRPMLILSSIMYFLS  84



>ref|XP_009110209.1| PREDICTED: monosaccharide-sensing protein 1 [Brassica rapa]
Length=726

 Score =   138 bits (348),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 67/84 (80%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  509
            M GA LVA+AATIGNFLQGWDNATIAGA+VYI K++ L T ++GLVVAMSLIGAT+ITTC
Sbjct  1    MKGATLVALAATIGNFLQGWDNATIAGAMVYINKDMNLPTSVQGLVVAMSLIGATVITTC  60

Query  510  SGSIADWLGRRPMLILSSMFYFLS  581
            SG I+DWLGRRPMLILSS+ YFLS
Sbjct  61   SGPISDWLGRRPMLILSSVMYFLS  84



>emb|CDX96618.1| BnaA08g21610D [Brassica napus]
Length=725

 Score =   138 bits (348),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 67/84 (80%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  509
            M GA LVA+AATIGNFLQGWDNATIAGA+VYI K++ L T ++GLVVAMSLIGAT+ITTC
Sbjct  1    MKGATLVALAATIGNFLQGWDNATIAGAMVYINKDMNLPTSVQGLVVAMSLIGATVITTC  60

Query  510  SGSIADWLGRRPMLILSSMFYFLS  581
            SG I+DWLGRRPMLILSS+ YFLS
Sbjct  61   SGPISDWLGRRPMLILSSVMYFLS  84



>gb|KJB14177.1| hypothetical protein B456_002G113400 [Gossypium raimondii]
 gb|KJB14178.1| hypothetical protein B456_002G113400 [Gossypium raimondii]
 gb|KJB14179.1| hypothetical protein B456_002G113400 [Gossypium raimondii]
 gb|KJB14180.1| hypothetical protein B456_002G113400 [Gossypium raimondii]
 gb|KJB14181.1| hypothetical protein B456_002G113400 [Gossypium raimondii]
 gb|KJB14184.1| hypothetical protein B456_002G113400 [Gossypium raimondii]
Length=739

 Score =   138 bits (347),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 67/84 (80%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  509
            M GA  VAIAATIGNFLQGWDNATIAGA+VYIK +L L T +EGLVVAMSLIGAT ITTC
Sbjct  1    MRGAAFVAIAATIGNFLQGWDNATIAGAIVYIKNDLNLGTSVEGLVVAMSLIGATAITTC  60

Query  510  SGSIADWLGRRPMLILSSMFYFLS  581
            SG+I+DW+GRRPMLI+SSM YF+S
Sbjct  61   SGAISDWIGRRPMLIMSSMLYFVS  84



>ref|XP_002510716.1| sugar transporter, putative [Ricinus communis]
 gb|EEF52903.1| sugar transporter, putative [Ricinus communis]
Length=739

 Score =   138 bits (347),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 67/84 (80%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  509
            M GAVLVAI A IG+FLQGWDNATIAGA+VYIKK+L L+T +EGLVVAMSLIGAT ITTC
Sbjct  1    MKGAVLVAITACIGSFLQGWDNATIAGAIVYIKKDLNLQTTVEGLVVAMSLIGATTITTC  60

Query  510  SGSIADWLGRRPMLILSSMFYFLS  581
            SG+I+DWLGRRPMLI+SS  YF+S
Sbjct  61   SGAISDWLGRRPMLIISSTLYFVS  84



>emb|CDY31497.1| BnaC05g16060D [Brassica napus]
Length=632

 Score =   136 bits (343),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  509
            M GA LVA+AATIGNFLQGWDNATIAGA+VYI K++ L T ++GLVVAMSLIGAT+ITTC
Sbjct  1    MKGATLVALAATIGNFLQGWDNATIAGAMVYINKDMNLATSVQGLVVAMSLIGATVITTC  60

Query  510  SGSIADWLGRRPMLILSSMFYFLS  581
            SG I+DWLGRRPMLIL+S+ YFLS
Sbjct  61   SGPISDWLGRRPMLILASVMYFLS  84



>emb|CDY29502.1| BnaA06g14680D [Brassica napus]
Length=659

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  509
            M GA LVA+AATIGNFLQGWDNATIAGA+VYI K++ L T ++GLVVAMSLIGAT+ITTC
Sbjct  1    MKGATLVALAATIGNFLQGWDNATIAGAMVYINKDMNLATSVQGLVVAMSLIGATVITTC  60

Query  510  SGSIADWLGRRPMLILSSMFYFLS  581
            SG I+DWLGRRPMLIL+S+ YFLS
Sbjct  61   SGPISDWLGRRPMLILASVMYFLS  84



>ref|XP_009149562.1| PREDICTED: monosaccharide-sensing protein 1 [Brassica rapa]
 ref|XP_009149563.1| PREDICTED: monosaccharide-sensing protein 1 [Brassica rapa]
Length=721

 Score =   136 bits (343),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  509
            M GA LVA+AATIGNFLQGWDNATIAGA+VYI K++ L T ++GLVVAMSLIGAT+ITTC
Sbjct  1    MKGATLVALAATIGNFLQGWDNATIAGAMVYINKDMNLATSVQGLVVAMSLIGATVITTC  60

Query  510  SGSIADWLGRRPMLILSSMFYFLS  581
            SG I+DWLGRRPMLIL+S+ YFLS
Sbjct  61   SGPISDWLGRRPMLILASVMYFLS  84



>emb|CAA90628.1| sugar transporter [Arabidopsis thaliana]
Length=734

 Score =   136 bits (343),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 66/83 (80%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  509
            M GA LVA+AATIGNFLQGWDNATIAGA+VYI K+L L T ++GLVVAMSLIGAT+ITTC
Sbjct  1    MKGATLVALAATIGNFLQGWDNATIAGAMVYINKDLNLPTSVQGLVVAMSLIGATVITTC  60

Query  510  SGSIADWLGRRPMLILSSMFYFL  578
            SG I+DWLGRRPMLILSS+ YF+
Sbjct  61   SGPISDWLGRRPMLILSSVMYFV  83



>ref|NP_173508.1| tonoplast monosaccharide transporter1 [Arabidopsis thaliana]
 sp|Q96290.2|MSSP1_ARATH RecName: Full=Monosaccharide-sensing protein 1; AltName: Full=Monosaccharide 
transporter 1; AltName: Full=Sugar transporter 
MSSP1; AltName: Full=Sugar transporter MT1 [Arabidopsis thaliana]
 gb|AAF80627.1|AC069251_20 F2D10.36 [Arabidopsis thaliana]
 gb|AEE30030.1| tonoplast monosaccharide transporter1 [Arabidopsis thaliana]
Length=734

 Score =   136 bits (343),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/83 (80%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  509
            M GA LVA+AATIGNFLQGWDNATIAGA+VYI K+L L T ++GLVVAMSLIGAT+ITTC
Sbjct  1    MKGATLVALAATIGNFLQGWDNATIAGAMVYINKDLNLPTSVQGLVVAMSLIGATVITTC  60

Query  510  SGSIADWLGRRPMLILSSMFYFL  578
            SG I+DWLGRRPMLILSS+ YF+
Sbjct  61   SGPISDWLGRRPMLILSSVMYFV  83



>gb|AAD30608.1|AC007369_18 Sugar transporter [Arabidopsis thaliana]
Length=734

 Score =   136 bits (343),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/83 (80%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  509
            M GA LVA+AATIGNFLQGWDNATIAGA+VYI K+L L T ++GLVVAMSLIGAT+ITTC
Sbjct  1    MKGATLVALAATIGNFLQGWDNATIAGAMVYINKDLNLPTSVQGLVVAMSLIGATVITTC  60

Query  510  SGSIADWLGRRPMLILSSMFYFL  578
            SG I+DWLGRRPMLILSS+ YF+
Sbjct  61   SGPISDWLGRRPMLILSSVMYFV  83



>ref|XP_006306868.1| hypothetical protein CARUB_v10008415mg [Capsella rubella]
 ref|XP_006306869.1| hypothetical protein CARUB_v10008415mg [Capsella rubella]
 ref|XP_006306870.1| hypothetical protein CARUB_v10008415mg [Capsella rubella]
 gb|EOA39766.1| hypothetical protein CARUB_v10008415mg [Capsella rubella]
 gb|EOA39767.1| hypothetical protein CARUB_v10008415mg [Capsella rubella]
 gb|EOA39768.1| hypothetical protein CARUB_v10008415mg [Capsella rubella]
Length=736

 Score =   136 bits (343),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/83 (80%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  509
            M GA LVA+AATIGNFLQGWDNATIAGA+VYI K+L L T ++GLVVAMSLIGAT+ITTC
Sbjct  1    MKGATLVALAATIGNFLQGWDNATIAGAMVYINKDLNLPTSVQGLVVAMSLIGATVITTC  60

Query  510  SGSIADWLGRRPMLILSSMFYFL  578
            SG I+DWLGRRPMLILSS+ YF+
Sbjct  61   SGPISDWLGRRPMLILSSVMYFV  83



>ref|XP_002893133.1| hypothetical protein ARALYDRAFT_472320 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69392.1| hypothetical protein ARALYDRAFT_472320 [Arabidopsis lyrata subsp. 
lyrata]
Length=735

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/83 (80%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  509
            M GA LVA+AATIGNFLQGWDNATIAGA+VYI K+L L T ++GLVVAMSLIGAT+ITTC
Sbjct  1    MKGATLVALAATIGNFLQGWDNATIAGAMVYINKDLNLPTSVQGLVVAMSLIGATVITTC  60

Query  510  SGSIADWLGRRPMLILSSMFYFL  578
            SG I+DWLGRRPMLILSS+ YF+
Sbjct  61   SGPISDWLGRRPMLILSSVMYFV  83



>ref|XP_008373385.1| PREDICTED: monosaccharide-sensing protein 2-like [Malus domestica]
Length=739

 Score =   135 bits (341),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 66/83 (80%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  NGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTCS  512
             GAVLVAIAATIGN LQGWDNATIAGA+VYI KE  L + +EGLVVAMSLIGAT+ITTCS
Sbjct  3    KGAVLVAIAATIGNLLQGWDNATIAGAIVYITKEFDLGSSLEGLVVAMSLIGATIITTCS  62

Query  513  GSIADWLGRRPMLILSSMFYFLS  581
            G+I+DW+GRRPMLI SS+FYF+S
Sbjct  63   GAISDWIGRRPMLIASSVFYFVS  85



>ref|XP_004300112.1| PREDICTED: monosaccharide-sensing protein 2 [Fragaria vesca subsp. 
vesca]
 ref|XP_011465026.1| PREDICTED: monosaccharide-sensing protein 2 [Fragaria vesca subsp. 
vesca]
Length=738

 Score =   135 bits (341),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  509
            M GAV VAIAATIGNFLQGWDNATIAGA+VYI  +  L++ +EGLVVAMSLIGAT+ITTC
Sbjct  1    MKGAVFVAIAATIGNFLQGWDNATIAGAIVYITDDFALDSSVEGLVVAMSLIGATVITTC  60

Query  510  SGSIADWLGRRPMLILSSMFYFLS  581
            SG+++DWLGRRPMLI SS+ YF+S
Sbjct  61   SGAVSDWLGRRPMLITSSVLYFVS  84



>ref|XP_010539774.1| PREDICTED: monosaccharide-sensing protein 1-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010539775.1| PREDICTED: monosaccharide-sensing protein 1-like isoform X2 [Tarenaya 
hassleriana]
Length=723

 Score =   135 bits (341),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  509
            M GA LVA+AATIGNFLQGWDNATIAGA+VYIK E+ L T ++GLVVAMSLIGAT ITTC
Sbjct  1    MKGAALVALAATIGNFLQGWDNATIAGAMVYIKNEMNLATSVQGLVVAMSLIGATAITTC  60

Query  510  SGSIADWLGRRPMLILSSMFYFLS  581
            SG I DWLGRRPMLI SS+ YF+S
Sbjct  61   SGPITDWLGRRPMLIFSSILYFIS  84



>ref|XP_010537220.1| PREDICTED: monosaccharide-sensing protein 1-like [Tarenaya hassleriana]
 ref|XP_010537221.1| PREDICTED: monosaccharide-sensing protein 1-like [Tarenaya hassleriana]
 ref|XP_010537222.1| PREDICTED: monosaccharide-sensing protein 1-like [Tarenaya hassleriana]
Length=735

 Score =   135 bits (339),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 65/84 (77%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  509
            M GA LVA+AATIGNFLQGWDNATIAGA+VYIK ++ L T ++GLVVAMSLIGAT ITTC
Sbjct  1    MKGAALVALAATIGNFLQGWDNATIAGAMVYIKNDMNLATSVQGLVVAMSLIGATAITTC  60

Query  510  SGSIADWLGRRPMLILSSMFYFLS  581
            SG I+DWLGRRPMLI SS+ YF+S
Sbjct  61   SGPISDWLGRRPMLIFSSILYFIS  84



>ref|XP_011034826.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
 ref|XP_011034827.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
 ref|XP_011034828.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
 ref|XP_011034829.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
Length=738

 Score =   135 bits (339),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  509
            M GA LVAIAA +GNFLQGWDNATIAGAV+Y+KK+L L++ +EGLVVAMSLIGA  ITTC
Sbjct  1    MKGASLVAIAACVGNFLQGWDNATIAGAVIYVKKDLKLQSSVEGLVVAMSLIGAAAITTC  60

Query  510  SGSIADWLGRRPMLILSSMFYFLS  581
            SGSI+DW+GRRPMLI SS+ YF+S
Sbjct  61   SGSISDWIGRRPMLISSSILYFVS  84



>dbj|BAK00015.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=236

 Score =   128 bits (322),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 75/86 (87%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLE--TYMEGLVVAMSLIGATLIT  503
            M+GA LVAIAA+IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGAT+IT
Sbjct  1    MSGAALVAIAASIGNLLQGWDNATIAGAVLYIKKEFQLENDPTVEGLIVAMSLIGATIIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            T SG ++DW+GRRPMLILSS+ YFLS
Sbjct  61   TFSGPVSDWVGRRPMLILSSILYFLS  86



>ref|XP_010477336.1| PREDICTED: monosaccharide-sensing protein 1 [Camelina sativa]
 ref|XP_010477338.1| PREDICTED: monosaccharide-sensing protein 1 [Camelina sativa]
Length=734

 Score =   134 bits (337),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 65/83 (78%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  509
            M GA LVA+AATIGNFLQGWDNATIAGA+VYI  +L L T ++GLVVAMSLIGAT+ITTC
Sbjct  1    MKGATLVALAATIGNFLQGWDNATIAGAMVYINNDLNLPTSVQGLVVAMSLIGATVITTC  60

Query  510  SGSIADWLGRRPMLILSSMFYFL  578
            SG I+DWLGRRPMLILSS+ YF+
Sbjct  61   SGPISDWLGRRPMLILSSVMYFV  83



>ref|XP_002307812.1| hypothetical protein POPTR_0005s27680g [Populus trichocarpa]
 gb|EEE94808.1| hypothetical protein POPTR_0005s27680g [Populus trichocarpa]
Length=738

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  509
            M GA LVAIAA IGNFLQGWDNATIAGA++Y+ K+L L+  +EGLVVAMSLIGA  ITTC
Sbjct  1    MKGAALVAIAACIGNFLQGWDNATIAGAIIYVNKDLKLQASVEGLVVAMSLIGAAAITTC  60

Query  510  SGSIADWLGRRPMLILSSMFYFLS  581
            SG I+DWLGRRPMLI+SS+ YF+S
Sbjct  61   SGPISDWLGRRPMLIISSILYFVS  84



>ref|XP_002300629.1| hypothetical protein POPTR_0002s00760g [Populus trichocarpa]
 gb|EEE79902.1| hypothetical protein POPTR_0002s00760g [Populus trichocarpa]
Length=738

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  509
            M GA LVAIAA +GNFLQGWDNATIAGAV+Y+KK+L L++ +EGLVVAMSLIGA  ITTC
Sbjct  1    MKGASLVAIAACVGNFLQGWDNATIAGAVIYVKKDLKLQSSVEGLVVAMSLIGAAAITTC  60

Query  510  SGSIADWLGRRPMLILSSMFYFLS  581
            SG I+DW+GRRPMLI SS+ YF+S
Sbjct  61   SGPISDWIGRRPMLISSSILYFVS  84



>ref|XP_011041174.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
Length=740

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  509
            M GA LVAIAA IGNFLQGWDNATIAGA++Y+ K+L L+  +EGLVVAMSLIGA  ITTC
Sbjct  1    MKGAALVAIAACIGNFLQGWDNATIAGAIIYVNKDLKLQASVEGLVVAMSLIGAAAITTC  60

Query  510  SGSIADWLGRRPMLILSSMFYFLS  581
            SG I+DWLGRRPMLI+SS+ YF+S
Sbjct  61   SGPISDWLGRRPMLIISSVLYFVS  84



>emb|CBI40753.3| unnamed protein product [Vitis vinifera]
Length=662

 Score =   132 bits (332),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 71/84 (85%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  509
            MNGAVLVAIAA IGNFLQGWDNATIAGA+VYIKKEL LE+ +EGLVVAMSLIGATL+TTC
Sbjct  1    MNGAVLVAIAAAIGNFLQGWDNATIAGAIVYIKKELDLESTVEGLVVAMSLIGATLVTTC  60

Query  510  SGSIADWLGRRPMLILSSMFYFLS  581
            SG+I+DW+GRRPMLI+SSM YF+S
Sbjct  61   SGAISDWIGRRPMLIVSSMLYFIS  84



>gb|AAX47312.1| hexose transporter 6 [Vitis vinifera]
Length=740

 Score =   132 bits (333),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 71/84 (85%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  509
            MNGAVLVAIAA IGNFLQGWDNATIAGA+VYIKKEL LE+ +EGLVVAMSLIGATL+TTC
Sbjct  1    MNGAVLVAIAAAIGNFLQGWDNATIAGAIVYIKKELDLESTVEGLVVAMSLIGATLVTTC  60

Query  510  SGSIADWLGRRPMLILSSMFYFLS  581
            SG+I+DW+GRRPMLI+SSM YF+S
Sbjct  61   SGAISDWIGRRPMLIVSSMLYFIS  84



>emb|CAN59780.1| hypothetical protein VITISV_024656 [Vitis vinifera]
Length=740

 Score =   132 bits (333),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 71/84 (85%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  509
            MNGAVLVAIAA IGNFLQGWDNATIAGA+VYIKKEL LE+ +EGLVVAMSLIGATL+TTC
Sbjct  1    MNGAVLVAIAAAIGNFLQGWDNATIAGAIVYIKKELDLESTVEGLVVAMSLIGATLVTTC  60

Query  510  SGSIADWLGRRPMLILSSMFYFLS  581
            SG+I+DW+GRRPMLI+SSM YF+S
Sbjct  61   SGAISDWIGRRPMLIVSSMLYFIS  84



>ref|NP_001267873.1| hexose transporter-like [Vitis vinifera]
 gb|AAY40466.1| putative hexose transporter [Vitis vinifera]
 gb|ADP37147.1| putative tonoplastic monosaccharide transporter [Vitis vinifera]
Length=740

 Score =   132 bits (333),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 71/84 (85%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  509
            MNGAVLVAIAA IGNFLQGWDNATIAGA+VYIKKEL LE+ +EGLVVAMSLIGATL+TTC
Sbjct  1    MNGAVLVAIAAAIGNFLQGWDNATIAGAIVYIKKELDLESTVEGLVVAMSLIGATLVTTC  60

Query  510  SGSIADWLGRRPMLILSSMFYFLS  581
            SG+I+DW+GRRPMLI+SSM YF+S
Sbjct  61   SGAISDWIGRRPMLIVSSMLYFIS  84



>ref|XP_010686712.1| PREDICTED: monosaccharide-sensing protein 2 [Beta vulgaris subsp. 
vulgaris]
Length=735

 Score =   132 bits (332),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 76/83 (92%), Gaps = 0/83 (0%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  509
            M GAVLVA+AATIGNFLQGWDNATIAG+++YIKKEL L T MEGLVVAMSLIGAT+ITTC
Sbjct  1    MKGAVLVALAATIGNFLQGWDNATIAGSILYIKKELELSTAMEGLVVAMSLIGATVITTC  60

Query  510  SGSIADWLGRRPMLILSSMFYFL  578
            SG+++D +GRRP+L+LS+  YF+
Sbjct  61   SGAVSDAVGRRPLLMLSASLYFI  83



>ref|XP_009372620.1| PREDICTED: monosaccharide-sensing protein 2 [Pyrus x bretschneideri]
Length=739

 Score =   132 bits (332),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  NGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTCS  512
             GAVLVA+AATIGN LQGWDNATIAGA+VYI ++  L + +EGLVVAMSLIGAT ITTCS
Sbjct  3    KGAVLVAVAATIGNLLQGWDNATIAGAIVYITEDFSLGSSLEGLVVAMSLIGATFITTCS  62

Query  513  GSIADWLGRRPMLILSSMFYFLS  581
            G+I+DW+GRRPMLI SS+FYF+S
Sbjct  63   GAISDWIGRRPMLIASSVFYFVS  85



>gb|KJB31963.1| hypothetical protein B456_005G216600 [Gossypium raimondii]
 gb|KJB31964.1| hypothetical protein B456_005G216600 [Gossypium raimondii]
 gb|KJB31965.1| hypothetical protein B456_005G216600 [Gossypium raimondii]
 gb|KJB31966.1| hypothetical protein B456_005G216600 [Gossypium raimondii]
 gb|KJB31967.1| hypothetical protein B456_005G216600 [Gossypium raimondii]
Length=737

 Score =   132 bits (332),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 77/86 (90%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  503
            M+GAVLVA+ ATIGN LQGWD+ATIAGAV+YIKKE  LE+   +EGL+VAMSLIGAT IT
Sbjct  1    MSGAVLVALTATIGNLLQGWDSATIAGAVMYIKKEFKLESEPAIEGLIVAMSLIGATCIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            TCSGS++DWLGRRP+LI+SS+ YFLS
Sbjct  61   TCSGSLSDWLGRRPILIISSLLYFLS  86



>gb|EAY85098.1| hypothetical protein OsI_06450 [Oryza sativa Indica Group]
Length=689

 Score =   131 bits (330),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 66/92 (72%), Positives = 79/92 (86%), Gaps = 2/92 (2%)
 Frame = +3

Query  312  DSGLLRMNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLI  485
            D   ++M+GA LVAIAA+IGN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLI
Sbjct  24   DRRGVKMSGAALVAIAASIGNLLQGWDNATIAGAVLYIKKEFKLESEPTVEGLIVAMSLI  83

Query  486  GATLITTCSGSIADWLGRRPMLILSSMFYFLS  581
            GAT+ITT SG ++DW+GRRPMLILSS+ YFLS
Sbjct  84   GATIITTFSGPVSDWIGRRPMLILSSILYFLS  115



>gb|EAZ22316.1| hypothetical protein OsJ_05971 [Oryza sativa Japonica Group]
Length=775

 Score =   132 bits (331),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 66/92 (72%), Positives = 79/92 (86%), Gaps = 2/92 (2%)
 Frame = +3

Query  312  DSGLLRMNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLI  485
            D   ++M+GA LVAIAA+IGN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLI
Sbjct  24   DRRGVKMSGAALVAIAASIGNLLQGWDNATIAGAVLYIKKEFKLESEPTVEGLIVAMSLI  83

Query  486  GATLITTCSGSIADWLGRRPMLILSSMFYFLS  581
            GAT+ITT SG ++DW+GRRPMLILSS+ YFLS
Sbjct  84   GATIITTFSGPVSDWIGRRPMLILSSILYFLS  115



>emb|CDI66586.1| putative sugar transporter type 2a protein [Saccharum hybrid 
cultivar R570]
 emb|CDI66607.1| putative sugar transporter type 2a protein [Saccharum hybrid 
cultivar R570]
Length=745

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 66/86 (77%), Positives = 76/86 (88%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  503
            M+GAVLVAIAA+IGN LQGWDNATIAGAV+YIKKE  L  E  +EGL+VAMSLIGAT+IT
Sbjct  1    MSGAVLVAIAASIGNLLQGWDNATIAGAVLYIKKEFQLQSEPTVEGLIVAMSLIGATIIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            T SG ++DW+GRRPMLILSS+ YFLS
Sbjct  61   TFSGPVSDWIGRRPMLILSSVLYFLS  86



>emb|CDI66591.1| putative sugar transporter type 2a protein [Saccharum hybrid 
cultivar R570]
Length=745

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 66/86 (77%), Positives = 76/86 (88%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  503
            M+GAVLVAIAA+IGN LQGWDNATIAGAV+YIKKE  L  E  +EGL+VAMSLIGAT+IT
Sbjct  1    MSGAVLVAIAASIGNLLQGWDNATIAGAVLYIKKEFQLQSEPTVEGLIVAMSLIGATIIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            T SG ++DW+GRRPMLILSS+ YFLS
Sbjct  61   TFSGPVSDWIGRRPMLILSSVLYFLS  86



>ref|XP_010063149.1| PREDICTED: monosaccharide-sensing protein 2-like [Eucalyptus 
grandis]
 gb|KCW70342.1| hypothetical protein EUGRSUZ_F03585 [Eucalyptus grandis]
Length=740

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  509
            M GAV VA+AATIGNFLQGWDNATIAG +VYIK++L L + +EGLVVAMSLIGAT+ITT 
Sbjct  1    MRGAVFVALAATIGNFLQGWDNATIAGGIVYIKEDLDLGSTVEGLVVAMSLIGATVITTS  60

Query  510  SGSIADWLGRRPMLILSSMFYFL  578
            SG I+DWLGRRPMLI+SS+ YF+
Sbjct  61   SGPISDWLGRRPMLIMSSILYFI  83



>emb|CBI21577.3| unnamed protein product [Vitis vinifera]
Length=627

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 66/86 (77%), Positives = 74/86 (86%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  503
            MNGAVLVAI A IGN LQGWDNATIAGAV+YIK+E  L+T   +EGL+VAMSLIGAT IT
Sbjct  1    MNGAVLVAITAAIGNLLQGWDNATIAGAVLYIKREFHLQTEPTIEGLIVAMSLIGATAIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            T SG +ADWLGRRPMLI+SS+ YFLS
Sbjct  61   TFSGPVADWLGRRPMLIISSVLYFLS  86



>ref|NP_001046359.1| Os02g0229400 [Oryza sativa Japonica Group]
 dbj|BAD26163.1| putative hexose transporter [Oryza sativa Japonica Group]
 dbj|BAF08273.1| Os02g0229400 [Oryza sativa Japonica Group]
 gb|ADG21983.1| tonoplast monosaccharide transporter 2 [Oryza sativa Japonica 
Group]
Length=746

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 76/86 (88%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  503
            M+GA LVAIAA+IGN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLIGAT+IT
Sbjct  1    MSGAALVAIAASIGNLLQGWDNATIAGAVLYIKKEFKLESEPTVEGLIVAMSLIGATIIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            T SG ++DW+GRRPMLILSS+ YFLS
Sbjct  61   TFSGPVSDWIGRRPMLILSSILYFLS  86



>ref|XP_002276373.1| PREDICTED: monosaccharide-sensing protein 2 [Vitis vinifera]
 gb|ADP37149.1| putative tonoplastic monosaccharide transporter [Vitis vinifera]
Length=742

 Score =   130 bits (327),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 66/86 (77%), Positives = 74/86 (86%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  503
            MNGAVLVAI A IGN LQGWDNATIAGAV+YIK+E  L+T   +EGL+VAMSLIGAT IT
Sbjct  1    MNGAVLVAITAAIGNLLQGWDNATIAGAVLYIKREFHLQTEPTIEGLIVAMSLIGATAIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            T SG +ADWLGRRPMLI+SS+ YFLS
Sbjct  61   TFSGPVADWLGRRPMLIISSVLYFLS  86



>gb|EMT06669.1| Monosaccharide-sensing protein 2 [Aegilops tauschii]
Length=787

 Score =   130 bits (327),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 76/87 (87%), Gaps = 2/87 (2%)
 Frame = +3

Query  327  RMNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLI  500
            +M+GA LVAIAA+IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGAT+I
Sbjct  43   KMSGAALVAIAASIGNLLQGWDNATIAGAVLYIKKEFQLENNPTVEGLIVAMSLIGATII  102

Query  501  TTCSGSIADWLGRRPMLILSSMFYFLS  581
            TT SG ++DW+GRRPMLILSS+ YFLS
Sbjct  103  TTFSGPVSDWVGRRPMLILSSLLYFLS  129



>gb|EMS49950.1| Monosaccharide-sensing protein 2 [Triticum urartu]
Length=686

 Score =   129 bits (325),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 75/86 (87%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  503
            M+GA LVAIAA+IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGAT+IT
Sbjct  1    MSGAALVAIAASIGNLLQGWDNATIAGAVLYIKKEFQLENNPTVEGLIVAMSLIGATIIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            T SG ++DW+GRRPMLILSS+ YFLS
Sbjct  61   TFSGPVSDWVGRRPMLILSSLLYFLS  86



>ref|XP_006855646.1| hypothetical protein AMTR_s00044p00110510 [Amborella trichopoda]
 gb|ERN17113.1| hypothetical protein AMTR_s00044p00110510 [Amborella trichopoda]
Length=743

 Score =   129 bits (325),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 74/86 (86%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  503
            M GAVLVAIAA+IGN LQGWDNATIA AV+YIK+E  L  E  +EGL+VAMSLIGAT+IT
Sbjct  1    MRGAVLVAIAASIGNLLQGWDNATIAAAVLYIKEEFDLDNEPTLEGLIVAMSLIGATIIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            TCSG I+DW+GRRPMLI SS+ YF+S
Sbjct  61   TCSGPISDWIGRRPMLIFSSILYFVS  86



>ref|XP_003571780.1| PREDICTED: monosaccharide-sensing protein 2-like [Brachypodium 
distachyon]
Length=749

 Score =   129 bits (325),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 64/88 (73%), Positives = 76/88 (86%), Gaps = 2/88 (2%)
 Frame = +3

Query  324  LRMNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATL  497
            ++M+GA LVAIAA+IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGAT+
Sbjct  3    VKMSGAALVAIAASIGNLLQGWDNATIAGAVLYIKKEFKLENDPTLEGLIVAMSLIGATI  62

Query  498  ITTCSGSIADWLGRRPMLILSSMFYFLS  581
            ITT SG ++DW+GRRPMLILSS+ YF S
Sbjct  63   ITTFSGPVSDWVGRRPMLILSSILYFFS  90



>gb|AIQ77649.1| tonoplastic transporter 1 [Vitis vinifera]
Length=740

 Score =   129 bits (324),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 70/84 (83%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  509
            MNGAVLVAIAA IGNFLQGW NATIAGA+VYIKKEL LE+ +EGLVVAMSLIGATL+TTC
Sbjct  1    MNGAVLVAIAAAIGNFLQGWGNATIAGAIVYIKKELDLESTVEGLVVAMSLIGATLVTTC  60

Query  510  SGSIADWLGRRPMLILSSMFYFLS  581
            SG+I+DW+GRRPMLI+SSM YF+S
Sbjct  61   SGAISDWIGRRPMLIVSSMLYFIS  84



>dbj|BAJ89532.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=744

 Score =   129 bits (324),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 75/86 (87%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  503
            M+GA LVAIAA+IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGAT+IT
Sbjct  1    MSGAALVAIAASIGNLLQGWDNATIAGAVLYIKKEFQLENDPTVEGLIVAMSLIGATIIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            T SG ++DW+GRRPMLILSS+ YFLS
Sbjct  61   TFSGPVSDWVGRRPMLILSSILYFLS  86



>ref|XP_010909820.1| PREDICTED: monosaccharide-sensing protein 2-like [Elaeis guineensis]
 ref|XP_010909821.1| PREDICTED: monosaccharide-sensing protein 2-like [Elaeis guineensis]
 ref|XP_010909822.1| PREDICTED: monosaccharide-sensing protein 2-like [Elaeis guineensis]
 ref|XP_010909823.1| PREDICTED: monosaccharide-sensing protein 2-like [Elaeis guineensis]
 ref|XP_010909824.1| PREDICTED: monosaccharide-sensing protein 2-like [Elaeis guineensis]
 ref|XP_010909825.1| PREDICTED: monosaccharide-sensing protein 2-like [Elaeis guineensis]
 ref|XP_010909826.1| PREDICTED: monosaccharide-sensing protein 2-like [Elaeis guineensis]
 ref|XP_010909827.1| PREDICTED: monosaccharide-sensing protein 2-like [Elaeis guineensis]
 ref|XP_010909828.1| PREDICTED: monosaccharide-sensing protein 2-like [Elaeis guineensis]
 ref|XP_010909829.1| PREDICTED: monosaccharide-sensing protein 2-like [Elaeis guineensis]
Length=747

 Score =   129 bits (324),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 76/85 (89%), Gaps = 2/85 (2%)
 Frame = +3

Query  333  NGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLITT  506
             GAVLVAIAA+IGN LQGWDNATIAGAV+YIKKE  LET   +EGL+VAMSLIGAT+ITT
Sbjct  3    RGAVLVAIAASIGNLLQGWDNATIAGAVLYIKKEFKLETEPTVEGLIVAMSLIGATIITT  62

Query  507  CSGSIADWLGRRPMLILSSMFYFLS  581
             SG+++DW+GRRP+LILSS+ YFLS
Sbjct  63   FSGAVSDWIGRRPILILSSVLYFLS  87



>ref|XP_006647093.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X1 [Oryza 
brachyantha]
 ref|XP_006647094.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X2 [Oryza 
brachyantha]
Length=746

 Score =   128 bits (322),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/85 (75%), Positives = 75/85 (88%), Gaps = 2/85 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  503
            M+GA LVAIAA+IGN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLIGAT+IT
Sbjct  1    MSGAALVAIAASIGNLLQGWDNATIAGAVLYIKKEFNLESEPTVEGLIVAMSLIGATIIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFL  578
            T SG ++DW+GRRPMLILSS+ YFL
Sbjct  61   TFSGPVSDWIGRRPMLILSSILYFL  85



>gb|KHG14026.1| Monosaccharide-sensing 2 -like protein [Gossypium arboreum]
Length=737

 Score =   128 bits (322),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 76/86 (88%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  503
            M+GAVLVA+ ATIGN LQGWD+ATIAGAV+YIKKE  LE+   +EGL+VAMSLIGAT IT
Sbjct  1    MSGAVLVALTATIGNLLQGWDSATIAGAVMYIKKEFKLESEPAIEGLIVAMSLIGATCIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            TCSGS++DWLGRRP+LI+SS+ Y LS
Sbjct  61   TCSGSMSDWLGRRPILIISSLLYCLS  86



>ref|XP_009401004.1| PREDICTED: monosaccharide-sensing protein 2-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009401005.1| PREDICTED: monosaccharide-sensing protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=738

 Score =   128 bits (322),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 75/86 (87%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  503
            M GAVLVAIAA+IGN LQGWDNATIAG+++YIKKE  L  E  +EGL+VAMSLIGAT+IT
Sbjct  1    MRGAVLVAIAASIGNLLQGWDNATIAGSILYIKKEFKLDSEPTIEGLIVAMSLIGATIIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            T SG ++DW+GRRPMLI+SS+ YFLS
Sbjct  61   TFSGPVSDWVGRRPMLIISSILYFLS  86



>ref|XP_009390770.1| PREDICTED: monosaccharide-sensing protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=741

 Score =   128 bits (321),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 76/86 (88%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  503
            M GAVLVA+AA+IGN LQGWDNATIAGAV+YIKKE  LET   MEGL+VAMSLIGAT+IT
Sbjct  1    MRGAVLVAVAASIGNLLQGWDNATIAGAVLYIKKEFKLETQPTMEGLIVAMSLIGATIIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            T SG+++D +GRRPMLI+SS+ YF+S
Sbjct  61   TFSGAVSDMVGRRPMLIISSVLYFVS  86



>ref|XP_009397963.1| PREDICTED: monosaccharide-sensing protein 2-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009397964.1| PREDICTED: monosaccharide-sensing protein 2-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009397965.1| PREDICTED: monosaccharide-sensing protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=738

 Score =   127 bits (320),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 75/86 (87%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  503
            M GA LVAI A+IGN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLIGAT+IT
Sbjct  1    MQGAALVAIVASIGNLLQGWDNATIAGAVLYIKKEFKLESEPTIEGLIVAMSLIGATIIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            T SG+++DW+GRRPMLI+SS+ YFLS
Sbjct  61   TFSGAVSDWVGRRPMLIISSVLYFLS  86



>gb|EYU43534.1| hypothetical protein MIMGU_mgv1a001953mg [Erythranthe guttata]
Length=734

 Score =   126 bits (317),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 71/84 (85%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  509
            MNGA L+AIAATIGNFLQGWDNATIAGAVVYIKKEL L   +EGL+VAMSLIGATLITTC
Sbjct  1    MNGAALIAIAATIGNFLQGWDNATIAGAVVYIKKELELGAAIEGLIVAMSLIGATLITTC  60

Query  510  SGSIADWLGRRPMLILSSMFYFLS  581
            SG+I+D +GRRPMLI SSMFYFLS
Sbjct  61   SGTISDSIGRRPMLIASSMFYFLS  84



>emb|CDP14489.1| unnamed protein product [Coffea canephora]
Length=742

 Score =   126 bits (317),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 76/86 (88%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  503
            M+GAVLVAI ATIGN LQGWDNATIAGAV++IK+EL LE+   +EGL+VAMSLIGA L+T
Sbjct  1    MSGAVLVAIGATIGNLLQGWDNATIAGAVLFIKRELKLESDPTVEGLIVAMSLIGAVLVT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            T +G +ADWLGRRPMLI+SS+ YF+S
Sbjct  61   TFAGGVADWLGRRPMLIVSSVLYFVS  86



>ref|XP_010940242.1| PREDICTED: monosaccharide-sensing protein 2-like [Elaeis guineensis]
Length=745

 Score =   126 bits (316),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 74/86 (86%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  503
            M GA LVAIAA+IGN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLIGAT+IT
Sbjct  1    MRGAALVAIAASIGNLLQGWDNATIAGAVLYIKKEFNLESEPTIEGLIVAMSLIGATIIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
              SG+I+DW GRRPMLI+SS+FYF S
Sbjct  61   MFSGAISDWGGRRPMLIVSSIFYFFS  86



>ref|XP_007204446.1| hypothetical protein PRUPE_ppa026426mg [Prunus persica]
 gb|EMJ05645.1| hypothetical protein PRUPE_ppa026426mg [Prunus persica]
Length=742

 Score =   125 bits (314),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 74/84 (88%), Gaps = 2/84 (2%)
 Frame = +3

Query  336  GAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLITTC  509
            G+VLVAIAATIGN LQGWDNATIAGAV+YIK+E  LET   +EGL+VAMSLIGAT+ITT 
Sbjct  3    GSVLVAIAATIGNLLQGWDNATIAGAVLYIKREFKLETQPTIEGLIVAMSLIGATVITTF  62

Query  510  SGSIADWLGRRPMLILSSMFYFLS  581
            SG ++D LGRRPMLI+SS+ YFLS
Sbjct  63   SGPVSDSLGRRPMLIISSVLYFLS  86



>ref|XP_008237926.1| PREDICTED: monosaccharide-sensing protein 2 [Prunus mume]
Length=739

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  509
            M  A++VAIAATIGN LQGWDNATIAGA+VYI ++  L + +EGLVVAMSLIGAT ITTC
Sbjct  1    MRSAMMVAIAATIGNLLQGWDNATIAGAIVYITEDFDLGSSLEGLVVAMSLIGATAITTC  60

Query  510  SGSIADWLGRRPMLILSSMFYFLS  581
            SG+I+DW+GR+PMLI SS+ YF+S
Sbjct  61   SGAISDWIGRKPMLIASSVLYFVS  84



>ref|XP_008778122.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
 ref|XP_008778123.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
 ref|XP_008778124.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
 ref|XP_008778125.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
 ref|XP_008778126.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
Length=747

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 75/86 (87%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  503
            M GAVLVAI A+IGN LQGWDNATIAGAV+YIKKE  LET   +EGL+VAMSLIGAT+IT
Sbjct  2    MQGAVLVAIVASIGNLLQGWDNATIAGAVLYIKKEFKLETEPTIEGLIVAMSLIGATIIT  61

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            T SG+++D +GRRP+LILSS+ YFLS
Sbjct  62   TFSGAVSDCIGRRPILILSSVLYFLS  87



>ref|XP_008242106.1| PREDICTED: monosaccharide-sensing protein 2-like [Prunus mume]
Length=742

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 74/84 (88%), Gaps = 2/84 (2%)
 Frame = +3

Query  336  GAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLITTC  509
            G+VLVAIAATIGN LQGWDNATIAGAV+YIK+E  LET   +EGL+VAMSLIGAT+ITT 
Sbjct  3    GSVLVAIAATIGNLLQGWDNATIAGAVLYIKREFKLETQPTIEGLIVAMSLIGATVITTF  62

Query  510  SGSIADWLGRRPMLILSSMFYFLS  581
            SG ++D LGRRPMLI+SS+ YFLS
Sbjct  63   SGPVSDSLGRRPMLIISSVLYFLS  86



>ref|XP_010029562.1| PREDICTED: monosaccharide-sensing protein 2-like [Eucalyptus 
grandis]
 gb|KCW56480.1| hypothetical protein EUGRSUZ_I02208 [Eucalyptus grandis]
Length=731

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 74/86 (86%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLE--TYMEGLVVAMSLIGATLIT  503
            M GAVLVA+AATIGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGAT+IT
Sbjct  1    MRGAVLVAVAATIGNLLQGWDNATIAGAVLYIKKEFDLEGQPTIEGLIVAMSLIGATVIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            T SG ++D +GRRPM+I+SS+ YFLS
Sbjct  61   TFSGPVSDSIGRRPMMIISSILYFLS  86



>gb|AJO70165.1| tonoplast monosaccharide transporters 1 [Camellia sinensis]
Length=736

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/71 (82%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = +3

Query  369  GNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTCSGSIADWLGRRPM  548
            GNFLQGWDNATIAGA+VYIK++L LET +EGLVVAMSLIGATL+TTCSG I+D +GRRPM
Sbjct  14   GNFLQGWDNATIAGAIVYIKEDLSLETTIEGLVVAMSLIGATLVTTCSGPISDLIGRRPM  73

Query  549  LILSSMFYFLS  581
            LI+SSMFYF+S
Sbjct  74   LIMSSMFYFVS  84



>gb|KJB79727.1| hypothetical protein B456_013G064200 [Gossypium raimondii]
Length=592

 Score =   123 bits (309),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 68/86 (79%), Positives = 76/86 (88%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  503
            MNGAVLVA+AA IGN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLIGAT IT
Sbjct  1    MNGAVLVALAAAIGNMLQGWDNATIAGAVLYIKKEFKLESAPTIEGLIVAMSLIGATCIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            TCSG I+DWLGRRPMLI+SS+ YFLS
Sbjct  61   TCSGGISDWLGRRPMLIISSVLYFLS  86



>ref|XP_010906859.1| PREDICTED: monosaccharide-sensing protein 2-like [Elaeis guineensis]
Length=549

 Score =   122 bits (307),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 75/86 (87%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  503
            M GAVLVA+AATIGN LQGWDN+TIAGAV++IK+E  LE+   +EGL++AMSLIGAT+IT
Sbjct  1    MRGAVLVALAATIGNLLQGWDNSTIAGAVLFIKREFQLESEPTIEGLIIAMSLIGATIIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            T SG+++DW GRRPMLI +++F FLS
Sbjct  61   TFSGAVSDWFGRRPMLIAAAVFTFLS  86



>gb|EMS63940.1| Monosaccharide-sensing protein 2 [Triticum urartu]
Length=743

 Score =   124 bits (311),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 76/86 (88%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  503
            M+GAVLVAIAA+IGN LQGWDNATIAGAV+YIKKE  LET   +EGL+VAMSLIGAT+IT
Sbjct  1    MSGAVLVAIAASIGNLLQGWDNATIAGAVLYIKKEFSLETQPLIEGLIVAMSLIGATVIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            T SG++AD +GRRP+LI SS+ YF+S
Sbjct  61   TFSGAVADAVGRRPLLIASSVLYFVS  86



>gb|EMT29091.1| Monosaccharide-sensing protein 2 [Aegilops tauschii]
Length=743

 Score =   124 bits (311),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 76/86 (88%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  503
            M+GAVLVAIAA+IGN LQGWDNATIAGAV+YIKKE  LET   +EGL+VAMSLIGAT+IT
Sbjct  1    MSGAVLVAIAASIGNLLQGWDNATIAGAVLYIKKEFSLETQPLIEGLIVAMSLIGATVIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            T SG++AD +GRRP+LI SS+ YF+S
Sbjct  61   TFSGAVADAVGRRPLLIASSVLYFVS  86



>ref|XP_004951395.1| PREDICTED: monosaccharide-sensing protein 2-like [Setaria italica]
Length=745

 Score =   124 bits (311),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 74/86 (86%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  503
            M+GAVLVAIAA+IGN LQGWDNATIAGAV+YIKKE  L  E  +EGL+VAMSLIGAT+IT
Sbjct  1    MSGAVLVAIAASIGNLLQGWDNATIAGAVLYIKKEFNLQSEPTVEGLIVAMSLIGATIIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            T SG ++D +GRRPMLILSS+ YF S
Sbjct  61   TFSGPVSDLIGRRPMLILSSILYFCS  86



>gb|AAP54842.2| hexose transporter, putative, expressed [Oryza sativa Japonica 
Group]
Length=445

 Score =   121 bits (303),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 73/86 (85%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  503
            M GAVLVAIAA+IGN LQGWDNATIAGAV+YIKKE  L  E  +EGL+VAMSLIGAT+IT
Sbjct  1    MAGAVLVAIAASIGNLLQGWDNATIAGAVLYIKKEFNLQSEPLIEGLIVAMSLIGATIIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            T SG++AD  GRRPMLI S++ YF+S
Sbjct  61   TFSGAVADSFGRRPMLIASAVLYFVS  86



>ref|XP_007142576.1| hypothetical protein PHAVU_008G292400g [Phaseolus vulgaris]
 gb|ESW14570.1| hypothetical protein PHAVU_008G292400g [Phaseolus vulgaris]
Length=732

 Score =   123 bits (308),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 78/86 (91%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  503
            M+GAVLVA+AA IGNFLQGWDNATIAG+++YIK+E  LE+   +EGL+VAMSLIGAT++T
Sbjct  1    MSGAVLVALAAAIGNFLQGWDNATIAGSILYIKREFQLESEPTIEGLIVAMSLIGATVVT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            TCSG I+DWLGRRPMLI+SSM YFLS
Sbjct  61   TCSGPISDWLGRRPMLIISSMLYFLS  86



>ref|XP_004144248.1| PREDICTED: monosaccharide-sensing protein 2-like [Cucumis sativus]
 ref|XP_004171132.1| PREDICTED: monosaccharide-sensing protein 2-like [Cucumis sativus]
 gb|KGN47521.1| hypothetical protein Csa_6G355400 [Cucumis sativus]
Length=729

 Score =   123 bits (308),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 55/73 (75%), Positives = 69/73 (95%), Gaps = 0/73 (0%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  509
            M GAVLVA+AA++GNFLQGWDNATIAGA+VYIKK++VL + +EGL+VA+SLIGAT+ITTC
Sbjct  1    MKGAVLVALAASVGNFLQGWDNATIAGAMVYIKKDMVLNSSVEGLIVAISLIGATIITTC  60

Query  510  SGSIADWLGRRPM  548
            SG ++DW+GRRPM
Sbjct  61   SGPVSDWVGRRPM  73



>gb|KHG05233.1| Monosaccharide-sensing 2 -like protein [Gossypium arboreum]
Length=739

 Score =   123 bits (308),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 68/86 (79%), Positives = 76/86 (88%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  503
            MNGAVLVA+AA IGN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLIGAT IT
Sbjct  1    MNGAVLVALAAAIGNMLQGWDNATIAGAVLYIKKEFKLESAPTIEGLIVAMSLIGATCIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            TCSG I+DWLGRRPMLI+SS+ YFLS
Sbjct  61   TCSGGISDWLGRRPMLIISSVLYFLS  86



>gb|KJB79728.1| hypothetical protein B456_013G064200 [Gossypium raimondii]
Length=739

 Score =   123 bits (308),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 68/86 (79%), Positives = 76/86 (88%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  503
            MNGAVLVA+AA IGN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLIGAT IT
Sbjct  1    MNGAVLVALAAAIGNMLQGWDNATIAGAVLYIKKEFKLESAPTIEGLIVAMSLIGATCIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            TCSG I+DWLGRRPMLI+SS+ YFLS
Sbjct  61   TCSGGISDWLGRRPMLIISSVLYFLS  86



>ref|XP_007210337.1| hypothetical protein PRUPE_ppa001932mg [Prunus persica]
 ref|XP_007210338.1| hypothetical protein PRUPE_ppa001932mg [Prunus persica]
 gb|EMJ11536.1| hypothetical protein PRUPE_ppa001932mg [Prunus persica]
 gb|EMJ11537.1| hypothetical protein PRUPE_ppa001932mg [Prunus persica]
Length=739

 Score =   122 bits (307),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  509
            M GAV+VAIAATIGN LQGWDNATIAGA+VYI ++  L + +EGLVVAMSLIGAT ITTC
Sbjct  1    MRGAVMVAIAATIGNLLQGWDNATIAGAIVYITEDFDLGSSLEGLVVAMSLIGATAITTC  60

Query  510  SGSIADWLGRRPMLILSSMFYFLS  581
            SG I+D +GR+PMLI SS+ YF+S
Sbjct  61   SGVISDSIGRKPMLIASSVLYFVS  84



>ref|XP_006364349.1| PREDICTED: monosaccharide-sensing protein 2-like [Solanum tuberosum]
Length=257

 Score =   117 bits (294),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 77/86 (90%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  503
            M+GAVLVA+AA IG+FLQGWDNATIAG+++YIKKE  LET   MEGL+VAMSL+GA L+T
Sbjct  1    MSGAVLVAVAAAIGSFLQGWDNATIAGSILYIKKEFNLETQPTMEGLIVAMSLVGAVLMT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            TCSG+IADWLGRRP+LI SS+ YF+S
Sbjct  61   TCSGAIADWLGRRPLLITSSVLYFVS  86



>emb|CAD58958.1| hexose transporter [Hordeum vulgare subsp. vulgare]
Length=743

 Score =   122 bits (306),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 63/85 (74%), Positives = 75/85 (88%), Gaps = 2/85 (2%)
 Frame = +3

Query  333  NGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLITT  506
            +GAVLVAIAA+IGN LQGWDNATIAGAV+YIKKE  LET   +EGL+VAMSLIGAT+ITT
Sbjct  3    SGAVLVAIAASIGNLLQGWDNATIAGAVLYIKKEFSLETQPLIEGLIVAMSLIGATVITT  62

Query  507  CSGSIADWLGRRPMLILSSMFYFLS  581
             SG++AD +GRRP+LI SS+ YF+S
Sbjct  63   FSGAVADAVGRRPLLIASSVLYFVS  87



>dbj|BAJ90138.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=743

 Score =   122 bits (306),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 63/85 (74%), Positives = 75/85 (88%), Gaps = 2/85 (2%)
 Frame = +3

Query  333  NGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLITT  506
            +GAVLVAIAA+IGN LQGWDNATIAGAV+YIKKE  LET   +EGL+VAMSLIGAT+ITT
Sbjct  3    SGAVLVAIAASIGNLLQGWDNATIAGAVLYIKKEFSLETQPLIEGLIVAMSLIGATVITT  62

Query  507  CSGSIADWLGRRPMLILSSMFYFLS  581
             SG++AD +GRRP+LI SS+ YF+S
Sbjct  63   FSGAVADAVGRRPLLIASSVLYFVS  87



>ref|XP_003574265.1| PREDICTED: monosaccharide-sensing protein 2-like [Brachypodium 
distachyon]
Length=741

 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 76/86 (88%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  503
            M+GAVLVAIAA+IGN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLIGAT+IT
Sbjct  1    MSGAVLVAIAASIGNLLQGWDNATIAGAVLYIKKEFSLESQPLIEGLIVAMSLIGATVIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            T SG++AD +GRRP+LI S++ YF+S
Sbjct  61   TFSGAVADAVGRRPLLIASAVLYFVS  86



>ref|XP_008351570.1| PREDICTED: monosaccharide-sensing protein 2-like [Malus domestica]
Length=216

 Score =   116 bits (290),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 77/86 (90%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  503
            M+GAVLVA+AA IGN LQGWDNATIA +V+YIK+E  LE+   +EGL+VAMSLIGAT++T
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAASVLYIKREFNLESEPAVEGLIVAMSLIGATVVT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
             CSG++ADWLGRRPMLI+SS+FYFLS
Sbjct  61   FCSGAVADWLGRRPMLIISSVFYFLS  86



>ref|XP_010680636.1| PREDICTED: monosaccharide-sensing protein 2-like [Beta vulgaris 
subsp. vulgaris]
Length=728

 Score =   121 bits (304),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 60/85 (71%), Positives = 72/85 (85%), Gaps = 2/85 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  503
            M GAV  A+AAT+GN LQGWDNATIAGAV+YIK+E  LET   +EGL+VAMSLIGAT+IT
Sbjct  1    MRGAVFAALAATMGNLLQGWDNATIAGAVIYIKREFSLETQPTLEGLIVAMSLIGATVIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFL  578
            T SG ++D +GRRPMLI+SS+ YFL
Sbjct  61   TFSGPVSDSVGRRPMLIISSILYFL  85



>ref|XP_002467580.1| hypothetical protein SORBIDRAFT_01g030430 [Sorghum bicolor]
 gb|EER94578.1| hypothetical protein SORBIDRAFT_01g030430 [Sorghum bicolor]
Length=740

 Score =   121 bits (304),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 74/86 (86%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  503
            M GAVLVAIAA+IGN LQGWDNATIAGAV+YIKKE  L  E  +EGL+VAMSLIGAT+IT
Sbjct  1    MGGAVLVAIAASIGNLLQGWDNATIAGAVLYIKKEFNLQSEPLIEGLIVAMSLIGATVIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            T SG++AD +GRRPMLI S++ YF+S
Sbjct  61   TFSGAVADSVGRRPMLIASAILYFVS  86



>ref|XP_008464819.1| PREDICTED: monosaccharide-sensing protein 2-like [Cucumis melo]
 ref|XP_008464820.1| PREDICTED: monosaccharide-sensing protein 2-like [Cucumis melo]
 ref|XP_008464821.1| PREDICTED: monosaccharide-sensing protein 2-like [Cucumis melo]
 ref|XP_008464822.1| PREDICTED: monosaccharide-sensing protein 2-like [Cucumis melo]
Length=729

 Score =   121 bits (304),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 69/73 (95%), Gaps = 0/73 (0%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  509
            M GA+LVA+AA++GNFLQGWDNATIAGA+VYIKK++VL + +EGL+VA+SLIGAT+ITTC
Sbjct  1    MKGALLVALAASVGNFLQGWDNATIAGAMVYIKKDMVLNSSVEGLIVAISLIGATIITTC  60

Query  510  SGSIADWLGRRPM  548
            SG ++DW+GRRPM
Sbjct  61   SGPVSDWVGRRPM  73



>dbj|BAI94493.1| sugar transporter [Dianthus caryophyllus]
Length=733

 Score =   121 bits (303),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 76/86 (88%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  503
            M+GAV VAIAATIGNFLQGWDNATIAGAV+YIKKE  LE+   MEG+++AM+LIG+T+IT
Sbjct  1    MSGAVWVAIAATIGNFLQGWDNATIAGAVLYIKKEFHLESDPKMEGILLAMALIGSTIIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            TCSGS++DWLGRR M+I S++ + +S
Sbjct  61   TCSGSVSDWLGRRLMMISSAICFIVS  86



>ref|NP_001065182.1| Os10g0539900 [Oryza sativa Japonica Group]
 gb|AAG46115.1|AC073166_13 putative sugar transporter [Oryza sativa Japonica Group]
 gb|ABB47937.2| hexose transporter, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF27096.1| Os10g0539900 [Oryza sativa Japonica Group]
 gb|EAZ16837.1| hypothetical protein OsJ_32308 [Oryza sativa Japonica Group]
 gb|ADG21982.1| tonoplast monosaccharide transporter 1 [Oryza sativa Japonica 
Group]
Length=740

 Score =   121 bits (303),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 73/86 (85%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  503
            M GAVLVAIAA+IGN LQGWDNATIAGAV+YIKKE  L  E  +EGL+VAMSLIGAT+IT
Sbjct  1    MAGAVLVAIAASIGNLLQGWDNATIAGAVLYIKKEFNLQSEPLIEGLIVAMSLIGATIIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            T SG++AD  GRRPMLI S++ YF+S
Sbjct  61   TFSGAVADSFGRRPMLIASAVLYFVS  86



>gb|EEC67373.1| hypothetical protein OsI_34495 [Oryza sativa Indica Group]
Length=718

 Score =   121 bits (303),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 73/86 (85%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  503
            M GAVLVAIAA+IGN LQGWDNATIAGAV+YIKKE  L  E  +EGL+VAMSLIGAT+IT
Sbjct  1    MAGAVLVAIAASIGNLLQGWDNATIAGAVLYIKKEFNLQSEPLIEGLIVAMSLIGATIIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            T SG++AD  GRRPMLI S++ YF+S
Sbjct  61   TFSGAVADSFGRRPMLIASAVLYFVS  86



>gb|KHN20087.1| Monosaccharide-sensing protein 2 [Glycine soja]
Length=712

 Score =   120 bits (302),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 58/67 (87%), Positives = 63/67 (94%), Gaps = 0/67 (0%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  509
            M GAVLVAIAA+IGNFLQGWDNATIAGA+VYIKK+L LET MEGLVVAMSLIGAT+ITTC
Sbjct  1    MKGAVLVAIAASIGNFLQGWDNATIAGAIVYIKKDLALETTMEGLVVAMSLIGATVITTC  60

Query  510  SGSIADW  530
            SG +ADW
Sbjct  61   SGPVADW  67



>ref|XP_010548175.1| PREDICTED: monosaccharide-sensing protein 2 [Tarenaya hassleriana]
 ref|XP_010548176.1| PREDICTED: monosaccharide-sensing protein 2 [Tarenaya hassleriana]
 ref|XP_010548177.1| PREDICTED: monosaccharide-sensing protein 2 [Tarenaya hassleriana]
 ref|XP_010548178.1| PREDICTED: monosaccharide-sensing protein 2 [Tarenaya hassleriana]
Length=742

 Score =   120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 66/85 (78%), Positives = 76/85 (89%), Gaps = 2/85 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  503
            M+GAVLVA+AA IGNFLQGWDNATIAGAV+YIKKE  LE+   +EGL+VA SLIGATLIT
Sbjct  1    MSGAVLVAVAAAIGNFLQGWDNATIAGAVLYIKKEFDLESEPTIEGLIVATSLIGATLIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFL  578
            TCSG I+DWLGRRPMLI+SS+ YF+
Sbjct  61   TCSGGISDWLGRRPMLIISSVLYFV  85



>gb|KJB12352.1| hypothetical protein B456_002G014400 [Gossypium raimondii]
Length=592

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 76/86 (88%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  503
            M GAVLVA+AA IGNFLQGWD ATIAGAV+Y+K+E  LE+   +EGL++AMSLIGAT IT
Sbjct  1    MGGAVLVAVAAAIGNFLQGWDTATIAGAVLYVKREFKLESEPTIEGLIIAMSLIGATCIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            TCSG I+DWLGRRP+LI+SS+FYFLS
Sbjct  61   TCSGYISDWLGRRPLLIISSVFYFLS  86



>gb|KCW64229.1| hypothetical protein EUGRSUZ_G01880 [Eucalyptus grandis]
Length=739

 Score =   119 bits (299),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 76/84 (90%), Gaps = 2/84 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  503
            M+GAV VA+AA +GN LQGWDNATIAGAV+YIK+E  LE+   +EGL+VAMSLIGATL+T
Sbjct  1    MSGAVWVAVAAAVGNLLQGWDNATIAGAVLYIKREFDLESEPALEGLIVAMSLIGATLVT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYF  575
            TCSG+IADWLGRRP+LI+SS+FYF
Sbjct  61   TCSGAIADWLGRRPLLIISSVFYF  84



>ref|XP_010066352.1| PREDICTED: monosaccharide-sensing protein 2-like [Eucalyptus 
grandis]
 ref|XP_010066353.1| PREDICTED: monosaccharide-sensing protein 2-like [Eucalyptus 
grandis]
 ref|XP_010066354.1| PREDICTED: monosaccharide-sensing protein 2-like [Eucalyptus 
grandis]
 ref|XP_010066355.1| PREDICTED: monosaccharide-sensing protein 2-like [Eucalyptus 
grandis]
 gb|KCW64228.1| hypothetical protein EUGRSUZ_G01880 [Eucalyptus grandis]
Length=740

 Score =   119 bits (299),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 76/84 (90%), Gaps = 2/84 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  503
            M+GAV VA+AA +GN LQGWDNATIAGAV+YIK+E  LE+   +EGL+VAMSLIGATL+T
Sbjct  1    MSGAVWVAVAAAVGNLLQGWDNATIAGAVLYIKREFDLESEPALEGLIVAMSLIGATLVT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYF  575
            TCSG+IADWLGRRP+LI+SS+FYF
Sbjct  61   TCSGAIADWLGRRPLLIISSVFYF  84



>ref|XP_008812559.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
 ref|XP_008812567.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
 ref|XP_008812574.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
 ref|XP_008812580.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
Length=745

 Score =   119 bits (299),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 72/86 (84%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  503
            M GAVLVAIAA+IGN LQGWDNATIA AV+YIK+E  LE+   MEGL+VAMSLIGA +IT
Sbjct  1    MRGAVLVAIAASIGNLLQGWDNATIAVAVLYIKREFNLESEPTMEGLIVAMSLIGAMIIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
              SG+I+DW GRRPMLI+SS+FY  S
Sbjct  61   MFSGAISDWGGRRPMLIVSSIFYLFS  86



>ref|XP_010678631.1| PREDICTED: monosaccharide-sensing protein 2-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010678632.1| PREDICTED: monosaccharide-sensing protein 2-like [Beta vulgaris 
subsp. vulgaris]
Length=735

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 74/86 (86%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  503
            M+ AVLVAIAAT+G+ L GWDNATIAGAV+YIKKE  LE+   +EGL+VA S+IGATLIT
Sbjct  1    MSAAVLVAIAATVGDLLYGWDNATIAGAVLYIKKEFNLESSPTLEGLIVATSIIGATLIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            TCSG IAD LGRRPM+I+SS+ +F+S
Sbjct  61   TCSGPIADRLGRRPMMIISSVCFFVS  86



>ref|XP_009763350.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana sylvestris]
 ref|XP_009763351.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana sylvestris]
 ref|XP_009763352.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana sylvestris]
Length=734

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 76/86 (88%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  503
            M+GAVLVA+AA IG+FLQGWDNATIAG ++YIKKE  LET   MEGL+V+MSLIGA LIT
Sbjct  1    MSGAVLVAVAAAIGSFLQGWDNATIAGGILYIKKEFKLETQPTMEGLIVSMSLIGAVLIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            TCSG+IADWLGRRP+LI SS+ YF+S
Sbjct  61   TCSGAIADWLGRRPLLITSSVLYFIS  86



>ref|NP_195256.3| monosaccharide-sensing protein 2 [Arabidopsis thaliana]
 ref|NP_001154287.1| monosaccharide-sensing protein 2 [Arabidopsis thaliana]
 sp|Q8LPQ8.2|MSSP2_ARATH RecName: Full=Monosaccharide-sensing protein 2; AltName: Full=Sugar 
transporter MSSP2 [Arabidopsis thaliana]
 emb|CAA18739.1| putative sugar transporter protein [Arabidopsis thaliana]
 emb|CAB80247.1| putative sugar transporter protein [Arabidopsis thaliana]
 emb|CAD58692.1| monosaccharide sensing protein 2 [Arabidopsis thaliana]
 gb|AEE86494.1| monosaccharide-sensing protein 2 [Arabidopsis thaliana]
 gb|AEE86495.1| monosaccharide-sensing protein 2 [Arabidopsis thaliana]
Length=729

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 67/85 (79%), Positives = 76/85 (89%), Gaps = 2/85 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  503
            M+GAVLVAIAA +GN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLIGATLIT
Sbjct  1    MSGAVLVAIAAAVGNLLQGWDNATIAGAVLYIKKEFNLESNPSVEGLIVAMSLIGATLIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFL  578
            TCSG +ADWLGRRPMLILSS+ YF+
Sbjct  61   TCSGGVADWLGRRPMLILSSILYFV  85



>ref|XP_010090703.1| Monosaccharide-sensing protein 2 [Morus notabilis]
 gb|EXB40422.1| Monosaccharide-sensing protein 2 [Morus notabilis]
Length=740

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 67/86 (78%), Positives = 77/86 (90%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  503
            M+GAVLVAIAA +GN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VA SLIGATLIT
Sbjct  1    MSGAVLVAIAAAVGNLLQGWDNATIAGAVLYIKKEFHLESQPTLEGLIVATSLIGATLIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            TCSG+IADWLGRRP+LI+SS+ YFLS
Sbjct  61   TCSGAIADWLGRRPLLIISSILYFLS  86



>ref|NP_849565.1| monosaccharide-sensing protein 2 [Arabidopsis thaliana]
 ref|NP_001190923.1| monosaccharide-sensing protein 2 [Arabidopsis thaliana]
 gb|AAM19835.1| AT4g35300/F23E12_140 [Arabidopsis thaliana]
 gb|AEE86493.1| monosaccharide-sensing protein 2 [Arabidopsis thaliana]
 gb|AEE86497.1| monosaccharide-sensing protein 2 [Arabidopsis thaliana]
Length=739

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 67/85 (79%), Positives = 76/85 (89%), Gaps = 2/85 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  503
            M+GAVLVAIAA +GN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLIGATLIT
Sbjct  1    MSGAVLVAIAAAVGNLLQGWDNATIAGAVLYIKKEFNLESNPSVEGLIVAMSLIGATLIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFL  578
            TCSG +ADWLGRRPMLILSS+ YF+
Sbjct  61   TCSGGVADWLGRRPMLILSSILYFV  85



>ref|XP_002867077.1| hypothetical protein ARALYDRAFT_491117 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43336.1| hypothetical protein ARALYDRAFT_491117 [Arabidopsis lyrata subsp. 
lyrata]
Length=739

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 67/85 (79%), Positives = 76/85 (89%), Gaps = 2/85 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  503
            M+GAVLVAIAA +GN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLIGATLIT
Sbjct  1    MSGAVLVAIAAAVGNLLQGWDNATIAGAVLYIKKEFNLESNPSVEGLIVAMSLIGATLIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFL  578
            TCSG +ADWLGRRPMLILSS+ YF+
Sbjct  61   TCSGGVADWLGRRPMLILSSILYFV  85



>ref|XP_004983796.1| PREDICTED: monosaccharide-sensing protein 2-like [Setaria italica]
Length=739

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 73/86 (85%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  503
            M GAVLVAIAA+IGN LQGWDNATIAGAV+YIKKE  L  E  +EGL+VAMSL GAT++T
Sbjct  1    MGGAVLVAIAASIGNLLQGWDNATIAGAVLYIKKEFNLQSEPLIEGLIVAMSLFGATVVT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            T SG++AD +GRRPMLI S++ YF+S
Sbjct  61   TFSGALADSIGRRPMLIASAVLYFVS  86



>ref|XP_006283193.1| hypothetical protein CARUB_v10004225mg [Capsella rubella]
 ref|XP_006283194.1| hypothetical protein CARUB_v10004225mg [Capsella rubella]
 gb|EOA16091.1| hypothetical protein CARUB_v10004225mg [Capsella rubella]
 gb|EOA16092.1| hypothetical protein CARUB_v10004225mg [Capsella rubella]
Length=740

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 66/85 (78%), Positives = 76/85 (89%), Gaps = 2/85 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  503
            M+GAVLVA+AA +GN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLIGATLIT
Sbjct  1    MSGAVLVAVAAAVGNLLQGWDNATIAGAVLYIKKEFNLESNPSVEGLIVAMSLIGATLIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFL  578
            TCSG +ADWLGRRPMLILSS+ YF+
Sbjct  61   TCSGGVADWLGRRPMLILSSILYFV  85



>ref|XP_009608796.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana tomentosiformis]
 ref|XP_009608797.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana tomentosiformis]
 ref|XP_009608798.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana tomentosiformis]
Length=734

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 76/86 (88%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  503
            M+GAVLVA+AA IG+FLQGWDNATIAG ++YIKKE  LET   MEGL+V+MSLIGA LIT
Sbjct  1    MSGAVLVAVAAAIGSFLQGWDNATIAGGILYIKKEFKLETQPTMEGLIVSMSLIGAVLIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            TCSG+IADWLGRRP+LI SS+ YF+S
Sbjct  61   TCSGAIADWLGRRPLLITSSVLYFVS  86



>ref|XP_007043079.1| Tonoplast monosaccharide transporter2 [Theobroma cacao]
 gb|EOX98910.1| Tonoplast monosaccharide transporter2 [Theobroma cacao]
Length=739

 Score =   119 bits (297),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 66/86 (77%), Positives = 75/86 (87%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  503
            M+GAVLVA+AA IGN LQGWDNATIAGAV+YIKKE  LE+   MEGL+VAMSLIGAT IT
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAGAVLYIKKEFKLESDPTMEGLIVAMSLIGATCIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            TCSG I+DWLGRRPMLI+SS+ Y +S
Sbjct  61   TCSGGISDWLGRRPMLIISSVLYIIS  86



>ref|XP_011000869.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
 ref|XP_011000870.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
 ref|XP_011000871.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
Length=740

 Score =   119 bits (297),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 76/86 (88%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  503
            MNGAVLVA+AA IGN LQGWDNATIAGAV+YIK+E  LE+   +EGL+VA SL+GATLIT
Sbjct  1    MNGAVLVAVAAAIGNLLQGWDNATIAGAVLYIKREFHLESEPTIEGLIVATSLVGATLIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            TCSG I+DWLGRRP+LI+SS+ YF+S
Sbjct  61   TCSGPISDWLGRRPLLIISSILYFVS  86



>gb|KJB12351.1| hypothetical protein B456_002G014400 [Gossypium raimondii]
 gb|KJB12353.1| hypothetical protein B456_002G014400 [Gossypium raimondii]
Length=734

 Score =   119 bits (297),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 76/86 (88%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  503
            M GAVLVA+AA IGNFLQGWD ATIAGAV+Y+K+E  LE+   +EGL++AMSLIGAT IT
Sbjct  1    MGGAVLVAVAAAIGNFLQGWDTATIAGAVLYVKREFKLESEPTIEGLIIAMSLIGATCIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            TCSG I+DWLGRRP+LI+SS+FYFLS
Sbjct  61   TCSGYISDWLGRRPLLIISSVFYFLS  86



>ref|NP_001151936.1| LOC100285573 [Zea mays]
 ref|XP_008680244.1| PREDICTED: LOC100285573 isoform X1 [Zea mays]
 gb|ACG45075.1| hexose transporter [Zea mays]
 tpg|DAA46098.1| TPA: hexose transporter isoform 1 [Zea mays]
 tpg|DAA46099.1| TPA: hexose transporter isoform 2 [Zea mays]
Length=747

 Score =   119 bits (297),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 73/86 (85%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  503
            M GAV+VAIAA+IGN LQGWDNATIAGAV+YIKKE  L  E  +EGL+VAMSLIGAT+IT
Sbjct  1    MGGAVMVAIAASIGNLLQGWDNATIAGAVLYIKKEFNLQSEPLIEGLIVAMSLIGATVIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            T SG+ AD +GRRPML+ S++ YF+S
Sbjct  61   TFSGAAADCVGRRPMLVASAVLYFVS  86



>gb|KJB12354.1| hypothetical protein B456_002G014400 [Gossypium raimondii]
Length=758

 Score =   119 bits (297),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 76/86 (88%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  503
            M GAVLVA+AA IGNFLQGWD ATIAGAV+Y+K+E  LE+   +EGL++AMSLIGAT IT
Sbjct  25   MGGAVLVAVAAAIGNFLQGWDTATIAGAVLYVKREFKLESEPTIEGLIIAMSLIGATCIT  84

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            TCSG I+DWLGRRP+LI+SS+FYFLS
Sbjct  85   TCSGYISDWLGRRPLLIISSVFYFLS  110



>ref|XP_010266257.1| PREDICTED: monosaccharide-sensing protein 2 isoform X1 [Nelumbo 
nucifera]
Length=742

 Score =   119 bits (297),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 75/86 (87%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  503
            M GAV VAIAA +GN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLIGAT+IT
Sbjct  1    MKGAVFVAIAAAVGNLLQGWDNATIAGAVLYIKKEFQLESEPTIEGLIVAMSLIGATIIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            TCSG ++DWLGRRPMLI+SS+ YF+S
Sbjct  61   TCSGPVSDWLGRRPMLIISSVLYFVS  86



>gb|AAO37640.1| putative sugar transporter type 2a [Saccharum hybrid cultivar 
Q117]
Length=745

 Score =   119 bits (297),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 73/86 (85%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  503
            M+GA LVAI A+IGN LQGWDNATI+ A++YIKKE  LE+   +EGL+VAMSLIGAT+IT
Sbjct  1    MSGAALVAIVASIGNLLQGWDNATISAALLYIKKEFKLESEPTVEGLIVAMSLIGATIIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            T SG ++DW+GR PMLILSS+ YF+S
Sbjct  61   TFSGPVSDWIGRLPMLILSSVLYFVS  86



>ref|XP_008645619.1| PREDICTED: monosaccharide-sensing protein 2-like [Zea mays]
 ref|XP_008645620.1| PREDICTED: monosaccharide-sensing protein 2-like [Zea mays]
 gb|AFW59275.1| LOW QUALITY PROTEIN: hypothetical protein ZEAMMB73_154299 [Zea 
mays]
 gb|AFW71237.1| hypothetical protein ZEAMMB73_210614 [Zea mays]
Length=745

 Score =   118 bits (296),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 72/86 (84%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  503
            M+GAVLVAI A+IGN LQGWDNATIA AV+YIKKE  L  E  +EGL+V+MSLIGAT++T
Sbjct  1    MSGAVLVAIVASIGNLLQGWDNATIAAAVLYIKKEFQLQNEPTVEGLIVSMSLIGATIVT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            T SG ++D +GRRPMLILSS+ YF S
Sbjct  61   TFSGPLSDSIGRRPMLILSSILYFFS  86



>emb|CDX69128.1| BnaC01g03250D [Brassica napus]
Length=683

 Score =   117 bits (294),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 67/85 (79%), Positives = 75/85 (88%), Gaps = 2/85 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  503
            M+GAVLVA+AA IGN LQGWDNATIAGAV+YIKKE  LE+   MEGL+VAMSLIGATLIT
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAGAVLYIKKEFHLESNPSMEGLIVAMSLIGATLIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFL  578
            T SG +ADWLGRRPMLILSS+ YF+
Sbjct  61   TWSGGVADWLGRRPMLILSSVLYFV  85



>ref|XP_009103100.1| PREDICTED: monosaccharide-sensing protein 2 [Brassica rapa]
 ref|XP_009103156.1| PREDICTED: monosaccharide-sensing protein 2 [Brassica rapa]
 emb|CDX75492.1| BnaA01g02100D [Brassica napus]
Length=740

 Score =   117 bits (294),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 67/85 (79%), Positives = 75/85 (88%), Gaps = 2/85 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  503
            M+GAVLVA+AA IGN LQGWDNATIAGAV+YIKKE  LE+   MEGL+VAMSLIGATLIT
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAGAVLYIKKEFHLESNPSMEGLIVAMSLIGATLIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFL  578
            T SG +ADWLGRRPMLILSS+ YF+
Sbjct  61   TWSGGVADWLGRRPMLILSSVLYFV  85



>ref|XP_002520608.1| sugar transporter, putative [Ricinus communis]
 gb|EEF41781.1| sugar transporter, putative [Ricinus communis]
Length=740

 Score =   117 bits (294),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 77/86 (90%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  503
            M+GAVLVA+AA +GN LQGWDNATIAGAV+YIK+E  LE+   +EGL+VA SLIGATLIT
Sbjct  1    MSGAVLVAVAAAVGNLLQGWDNATIAGAVLYIKREFNLESEPTIEGLIVATSLIGATLIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            TCSG+I+DWLGRRPMLI+SS+ YFLS
Sbjct  61   TCSGAISDWLGRRPMLIISSVLYFLS  86



>emb|CDY65623.1| BnaCnng48010D [Brassica napus]
Length=675

 Score =   117 bits (294),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 67/85 (79%), Positives = 75/85 (88%), Gaps = 2/85 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  503
            M+GAVLVA+AA IGN LQGWDNATIAGAV+YIKKE  LE+   MEGL+VAMSLIGATLIT
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAGAVLYIKKEFHLESNPSMEGLIVAMSLIGATLIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFL  578
            T SG +ADWLGRRPMLILSS+ YF+
Sbjct  61   TWSGGVADWLGRRPMLILSSVLYFV  85



>ref|XP_007201798.1| hypothetical protein PRUPE_ppa001957mg [Prunus persica]
 ref|XP_007201799.1| hypothetical protein PRUPE_ppa001957mg [Prunus persica]
 ref|XP_007201800.1| hypothetical protein PRUPE_ppa001957mg [Prunus persica]
 gb|EMJ02997.1| hypothetical protein PRUPE_ppa001957mg [Prunus persica]
 gb|EMJ02998.1| hypothetical protein PRUPE_ppa001957mg [Prunus persica]
 gb|EMJ02999.1| hypothetical protein PRUPE_ppa001957mg [Prunus persica]
Length=736

 Score =   117 bits (294),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 75/86 (87%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  503
            M+GAVLVA+ A IGN LQGWDNATIA +V+YIKKE  LE+   +EGL+VAMSLIGATLIT
Sbjct  1    MSGAVLVAVVAAIGNLLQGWDNATIAASVLYIKKEFKLESEPAVEGLIVAMSLIGATLIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            TCSG+IADWLGRRP+LI+SS+ YF S
Sbjct  61   TCSGAIADWLGRRPVLIISSVLYFFS  86



>ref|NP_190717.1| tonoplast monosaccharide transporter3 [Arabidopsis thaliana]
 sp|Q9SD00.1|MSSP3_ARATH RecName: Full=Monosaccharide-sensing protein 3; AltName: Full=Sugar 
transporter MSSP3 [Arabidopsis thaliana]
 emb|CAB63013.1| sugar transporter-like protein [Arabidopsis thaliana]
 emb|CAD58693.1| monosaccharide sensing protein 3 [Arabidopsis thaliana]
 gb|AEE78798.1| tonoplast monosaccharide transporter3 [Arabidopsis thaliana]
Length=729

 Score =   117 bits (294),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 70/86 (81%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLE--TYMEGLVVAMSLIGATLIT  503
            M   VLVA+AA IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGATLIT
Sbjct  1    MRSVVLVALAAAIGNMLQGWDNATIAGAVIYIKKEFHLEKEPKIEGLIVAMSLIGATLIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            T SG ++D +GRR MLILSS+ YFLS
Sbjct  61   TFSGPVSDKVGRRSMLILSSVLYFLS  86



>ref|NP_001190054.1| tonoplast monosaccharide transporter3 [Arabidopsis thaliana]
 gb|AEE78799.1| tonoplast monosaccharide transporter3 [Arabidopsis thaliana]
Length=737

 Score =   117 bits (294),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 70/86 (81%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLE--TYMEGLVVAMSLIGATLIT  503
            M   VLVA+AA IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGATLIT
Sbjct  1    MRSVVLVALAAAIGNMLQGWDNATIAGAVIYIKKEFHLEKEPKIEGLIVAMSLIGATLIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            T SG ++D +GRR MLILSS+ YFLS
Sbjct  61   TFSGPVSDKVGRRSMLILSSVLYFLS  86



>ref|XP_008235816.1| PREDICTED: monosaccharide-sensing protein 2 [Prunus mume]
 ref|XP_008235817.1| PREDICTED: monosaccharide-sensing protein 2 [Prunus mume]
Length=736

 Score =   117 bits (293),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 77/86 (90%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  503
            M+GAVLVA+AA IGN LQGWDNATIA +V+YIKKE  LE+   +EGL+VAMSLIGATLIT
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAASVLYIKKEFKLESDPAVEGLIVAMSLIGATLIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            TC+G+IADWLGRRP+LI+SS+ YFLS
Sbjct  61   TCAGAIADWLGRRPVLIISSVLYFLS  86



>gb|KFK34392.1| hypothetical protein AALP_AA5G139300 [Arabis alpina]
Length=739

 Score =   117 bits (292),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 70/86 (81%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLE--TYMEGLVVAMSLIGATLIT  503
            M   VLVA+AA IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGATLIT
Sbjct  1    MRSVVLVALAAAIGNMLQGWDNATIAGAVIYIKKEFHLEKEPKIEGLIVAMSLIGATLIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            T SG ++D +GRR MLILSS+ YF+S
Sbjct  61   TFSGPVSDRVGRRSMLILSSLLYFVS  86



>ref|XP_008377843.1| PREDICTED: monosaccharide-sensing protein 2-like [Malus domestica]
 ref|XP_008377844.1| PREDICTED: monosaccharide-sensing protein 2-like [Malus domestica]
Length=736

 Score =   117 bits (292),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 77/86 (90%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  503
            M+GAVLVA+AA IGN LQGWDNATIA +V+YIK+E  LE+   +EGL+VAMSLIGAT++T
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAASVLYIKREFNLESEXAVEGLIVAMSLIGATVVT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
             CSG++ADWLGRRPMLI+SS+FYFLS
Sbjct  61   FCSGAVADWLGRRPMLIISSVFYFLS  86



>gb|KJB77474.1| hypothetical protein B456_012G139000 [Gossypium raimondii]
Length=629

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 75/86 (87%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  503
            M+GAVLVA+AA IGN LQGWDNATIAGAV+YIK+E  LE+   +EGL+VAMSLIGAT IT
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAGAVLYIKREFSLESEPTIEGLIVAMSLIGATCIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            TCSG I+DWLGRRPMLI+SS+ Y +S
Sbjct  61   TCSGGISDWLGRRPMLIISSVLYCVS  86



>ref|XP_002877807.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54066.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=730

 Score =   116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 69/86 (80%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLE--TYMEGLVVAMSLIGATLIT  503
            M   V VA+AA IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGATLIT
Sbjct  1    MRSVVFVALAAAIGNMLQGWDNATIAGAVIYIKKEFHLEKEPKIEGLIVAMSLIGATLIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            T SG ++D +GRR MLILSS+ YFLS
Sbjct  61   TFSGPVSDKVGRRSMLILSSVLYFLS  86



>ref|XP_006412119.1| hypothetical protein EUTSA_v10024517mg [Eutrema salsugineum]
 ref|XP_006412120.1| hypothetical protein EUTSA_v10024517mg [Eutrema salsugineum]
 ref|XP_006412121.1| hypothetical protein EUTSA_v10024517mg [Eutrema salsugineum]
 gb|ESQ53572.1| hypothetical protein EUTSA_v10024517mg [Eutrema salsugineum]
 gb|ESQ53573.1| hypothetical protein EUTSA_v10024517mg [Eutrema salsugineum]
 gb|ESQ53574.1| hypothetical protein EUTSA_v10024517mg [Eutrema salsugineum]
Length=734

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 66/85 (78%), Positives = 75/85 (88%), Gaps = 2/85 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  503
            M+GAVLVA+AA +GN LQGWDNATIAGAV+YIKKE  LE+   MEGL+VAMSLIGATLIT
Sbjct  1    MSGAVLVAVAAAVGNLLQGWDNATIAGAVLYIKKEFHLESNPSMEGLIVAMSLIGATLIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFL  578
            T SG +ADWLGRRPMLILSS+ YF+
Sbjct  61   TWSGGVADWLGRRPMLILSSVLYFV  85



>ref|XP_002282975.1| PREDICTED: monosaccharide-sensing protein 2 [Vitis vinifera]
 gb|ADP37148.1| putative tonoplastic monosaccharide transporter [Vitis vinifera]
Length=739

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 76/86 (88%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  503
            M+GAVLVAIAA +GN LQGWDNATIAGAV+YIKKE  L  E  +EGL+VAMSLIGAT IT
Sbjct  1    MSGAVLVAIAAAVGNLLQGWDNATIAGAVLYIKKEFNLQGEPTVEGLIVAMSLIGATFIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            T SG+++DWLGRRPMLI+SS+FYF+S
Sbjct  61   TISGAVSDWLGRRPMLIISSLFYFVS  86



>ref|XP_010266258.1| PREDICTED: monosaccharide-sensing protein 2 isoform X2 [Nelumbo 
nucifera]
Length=653

 Score =   115 bits (289),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 64/86 (74%), Positives = 75/86 (87%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  503
            M GAV VAIAA +GN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLIGAT+IT
Sbjct  1    MKGAVFVAIAAAVGNLLQGWDNATIAGAVLYIKKEFQLESEPTIEGLIVAMSLIGATIIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            TCSG ++DWLGRRPMLI+SS+ YF+S
Sbjct  61   TCSGPVSDWLGRRPMLIISSVLYFVS  86



>gb|KDP47010.1| hypothetical protein JCGZ_10737 [Jatropha curcas]
Length=740

 Score =   116 bits (290),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 76/86 (88%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  503
            M+GAVLVA+ A +GN LQGWDNATIAGAV+YIK+E  LE+   +EGL+VAMSLIGATLIT
Sbjct  1    MSGAVLVAVVAAVGNLLQGWDNATIAGAVLYIKREFQLESEPTIEGLIVAMSLIGATLIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            TCSG+I+DWLGRRPMLI+SS+ Y +S
Sbjct  61   TCSGAISDWLGRRPMLIISSVLYCVS  86



>gb|EYU40481.1| hypothetical protein MIMGU_mgv1a001997mg [Erythranthe guttata]
Length=728

 Score =   116 bits (290),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 56/73 (77%), Positives = 62/73 (85%), Gaps = 2/73 (3%)
 Frame = +3

Query  369  GNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLITTCSGSIADWLGRR  542
            GN LQGWDNAT+AGA++YIKKE   E    MEGL VAMSLIGATLIT CSG I+DWLGRR
Sbjct  14   GNLLQGWDNATMAGAIIYIKKEFEWENEPTMEGLSVAMSLIGATLITLCSGGISDWLGRR  73

Query  543  PMLILSSMFYFLS  581
            PMLI+SSMFYF+S
Sbjct  74   PMLIVSSMFYFVS  86



>gb|AFP89954.1| tonoplastic transporter 2 [Vitis vinifera]
Length=739

 Score =   116 bits (290),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 76/86 (88%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  503
            M+GAVLVAIAA +GN LQGWDNATIAGAV+YIKKE  L  E  +EGL+VAMSLIGAT IT
Sbjct  1    MSGAVLVAIAAAVGNLLQGWDNATIAGAVLYIKKEFNLQGEPTVEGLIVAMSLIGATFIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            T SG+++DWLGRRPMLI+SS+FYF+S
Sbjct  61   TISGAVSDWLGRRPMLIISSLFYFVS  86



>gb|EMT28528.1| Monosaccharide-sensing protein 3 [Aegilops tauschii]
Length=531

 Score =   114 bits (286),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 62/85 (73%), Positives = 69/85 (81%), Gaps = 2/85 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  503
            M GAVLVAI A IGN LQG DNATIAGAV+YIK+E  LET   +EGLVVA SLIGAT+IT
Sbjct  1    MRGAVLVAITAAIGNMLQGVDNATIAGAVMYIKREFHLETQPAVEGLVVATSLIGATIIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFL  578
            T SG +AD +GRRPMLI SS+ YFL
Sbjct  61   TFSGPVADIVGRRPMLIASSLLYFL  85



>emb|CAN80213.1| hypothetical protein VITISV_042076 [Vitis vinifera]
Length=739

 Score =   116 bits (290),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 76/86 (88%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  503
            M+GAVLVAIAA +GN LQGWDNATIAGAV+YIKKE  L  E  +EGL+VAMSLIGAT IT
Sbjct  1    MSGAVLVAIAAAVGNLLQGWDNATIAGAVLYIKKEFNLQGEPTVEGLIVAMSLIGATFIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            T SG+++DWLGRRPMLI+SS+FYF+S
Sbjct  61   TISGAVSDWLGRRPMLIISSLFYFVS  86



>emb|CBI37732.3| unnamed protein product [Vitis vinifera]
Length=644

 Score =   115 bits (289),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 76/86 (88%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  503
            M+GAVLVAIAA +GN LQGWDNATIAGAV+YIKKE  L  E  +EGL+VAMSLIGAT IT
Sbjct  1    MSGAVLVAIAAAVGNLLQGWDNATIAGAVLYIKKEFNLQGEPTVEGLIVAMSLIGATFIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            T SG+++DWLGRRPMLI+SS+FYF+S
Sbjct  61   TISGAVSDWLGRRPMLIISSLFYFVS  86



>ref|XP_004290074.1| PREDICTED: monosaccharide-sensing protein 2 [Fragaria vesca subsp. 
vesca]
 ref|XP_011458100.1| PREDICTED: monosaccharide-sensing protein 2 [Fragaria vesca subsp. 
vesca]
Length=740

 Score =   115 bits (289),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 77/86 (90%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  503
            M+GAVLVAIAA +GN LQGWDNATIA +V+YIK+E  LE+   +EGL+VAMSLIGATL+T
Sbjct  1    MSGAVLVAIAAAVGNLLQGWDNATIAASVLYIKREFNLESQPAVEGLIVAMSLIGATLVT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            TCSG++ADW+GRRPMLI+SS+ YFLS
Sbjct  61   TCSGAVADWIGRRPMLIISSVLYFLS  86



>gb|KJB77472.1| hypothetical protein B456_012G139000 [Gossypium raimondii]
 gb|KJB77475.1| hypothetical protein B456_012G139000 [Gossypium raimondii]
Length=740

 Score =   115 bits (289),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 75/86 (87%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  503
            M+GAVLVA+AA IGN LQGWDNATIAGAV+YIK+E  LE+   +EGL+VAMSLIGAT IT
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAGAVLYIKREFSLESEPTIEGLIVAMSLIGATCIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            TCSG I+DWLGRRPMLI+SS+ Y +S
Sbjct  61   TCSGGISDWLGRRPMLIISSVLYCVS  86



>gb|KHG04801.1| Monosaccharide-sensing protein 2 [Gossypium arboreum]
 gb|KHG22589.1| Monosaccharide-sensing protein 2 [Gossypium arboreum]
Length=740

 Score =   115 bits (289),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 75/86 (87%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  503
            M+GAVLVA+AA IGN LQGWDNATIAGAV+YIK+E  LE+   +EGL+VAMSLIGAT IT
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAGAVLYIKREFSLESEPTIEGLIVAMSLIGATCIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            TCSG I+DWLGRRPMLI+SS+ Y +S
Sbjct  61   TCSGGISDWLGRRPMLIISSVLYCVS  86



>ref|XP_011099908.1| PREDICTED: monosaccharide-sensing protein 2-like [Sesamum indicum]
 ref|XP_011099909.1| PREDICTED: monosaccharide-sensing protein 2-like [Sesamum indicum]
Length=709

 Score =   115 bits (288),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 66/86 (77%), Positives = 74/86 (86%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  503
            M GAVLVAIAA IGN LQGWDNATIAGAV+YIK+E  L  E  +EGL+VAMSLIGAT+IT
Sbjct  1    MRGAVLVAIAAAIGNLLQGWDNATIAGAVLYIKREFHLQSEPTIEGLIVAMSLIGATVIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            TCSG ++DWLGRRPMLILSS+ Y LS
Sbjct  61   TCSGPVSDWLGRRPMLILSSVLYCLS  86



>gb|KDO68405.1| hypothetical protein CISIN_1g004750mg [Citrus sinensis]
Length=560

 Score =   114 bits (284),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 63/71 (89%), Gaps = 2/71 (3%)
 Frame = +3

Query  372  NFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLITTCSGSIADWLGRRP  545
            N LQGWDNATIAGAV+YIK+E  LET   +EGL+VAMSLIGAT ITTCSG+IADWLGRRP
Sbjct  15   NLLQGWDNATIAGAVLYIKREFHLETEPTIEGLIVAMSLIGATCITTCSGAIADWLGRRP  74

Query  546  MLILSSMFYFL  578
            MLI+SS+ YF+
Sbjct  75   MLIVSSVLYFI  85



>ref|XP_008349018.1| PREDICTED: monosaccharide-sensing protein 2-like [Malus domestica]
Length=254

 Score =   110 bits (276),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 75/86 (87%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  503
            M+GAVLVA+AA IGN LQGWDNATIA +V+YIK+E  LE+   +EGL+VAMSLIGAT++T
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAASVLYIKREFNLESEPAVEGLIVAMSLIGATVVT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
             CSG++ADWLGRRP LI+SS+ YFLS
Sbjct  61   FCSGAVADWLGRRPTLIVSSVLYFLS  86



>ref|XP_009776539.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana sylvestris]
 ref|XP_009776540.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana sylvestris]
Length=722

 Score =   115 bits (287),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 76/86 (88%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  503
            M+GAV+VA+AA IGN LQGWDNATIAGAV+YIKKE  L+T   +EGL+VAMSLIGAT+IT
Sbjct  1    MSGAVVVALAAAIGNLLQGWDNATIAGAVLYIKKEFNLQTQPTIEGLIVAMSLIGATVIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            T SGS++D  GRRPMLI+SS+FYFLS
Sbjct  61   TFSGSVSDMFGRRPMLIISSVFYFLS  86



>ref|XP_010028861.1| PREDICTED: LOW QUALITY PROTEIN: monosaccharide-sensing protein 
2 [Eucalyptus grandis]
Length=730

 Score =   114 bits (286),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 72/86 (84%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  503
            M+ AVL+A+ A  GN LQGWDNATIAGA++YIK+E  LE+   +EGL+VA+SL+GA L+T
Sbjct  1    MSRAVLIAVVAAFGNLLQGWDNATIAGAILYIKREFHLESEPAVEGLIVAISLLGAILVT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            TCSG++AD +GRRPML++SS FY +S
Sbjct  61   TCSGAMADCIGRRPMLVMSSHFYLIS  86



>ref|XP_006486570.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X1 [Citrus 
sinensis]
 ref|XP_006486571.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X2 [Citrus 
sinensis]
Length=732

 Score =   114 bits (286),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 63/71 (89%), Gaps = 2/71 (3%)
 Frame = +3

Query  372  NFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLITTCSGSIADWLGRRP  545
            N LQGWDNATIAGAV+YIK+E  LET   +EGL+VAMSLIGAT ITTCSG+IADWLGRRP
Sbjct  15   NLLQGWDNATIAGAVLYIKREFHLETEPTIEGLIVAMSLIGATCITTCSGAIADWLGRRP  74

Query  546  MLILSSMFYFL  578
            MLI+SS+ YF+
Sbjct  75   MLIISSVLYFI  85



>ref|XP_010446942.1| PREDICTED: monosaccharide-sensing protein 2 [Camelina sativa]
 ref|XP_010446943.1| PREDICTED: monosaccharide-sensing protein 2 [Camelina sativa]
 ref|XP_010446944.1| PREDICTED: monosaccharide-sensing protein 2 [Camelina sativa]
Length=739

 Score =   114 bits (286),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 75/85 (88%), Gaps = 2/85 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  503
            M+GAVLVA+AA +GN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLIGATLIT
Sbjct  1    MSGAVLVAVAAAVGNLLQGWDNATIAGAVLYIKKEFNLESNPSVEGLIVAMSLIGATLIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFL  578
            TCSG +AD LGRRPMLILSS+ YF+
Sbjct  61   TCSGGVADLLGRRPMLILSSILYFV  85



>ref|XP_010437493.1| PREDICTED: monosaccharide-sensing protein 2-like [Camelina sativa]
Length=739

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 75/85 (88%), Gaps = 2/85 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  503
            M+GAVLVA+AA +GN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLIGATLIT
Sbjct  1    MSGAVLVAVAAAVGNLLQGWDNATIAGAVLYIKKEFNLESNPSVEGLIVAMSLIGATLIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFL  578
            TCSG +AD LGRRPMLILSS+ YF+
Sbjct  61   TCSGGVADLLGRRPMLILSSILYFV  85



>ref|XP_009333794.1| PREDICTED: monosaccharide-sensing protein 2-like [Pyrus x bretschneideri]
Length=736

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 76/86 (88%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  503
            M+GAVLVA+AA IGN LQGWDNATIA +V+YIK+E  LE+   +EGL+VAMSLIGAT++T
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAASVLYIKREFNLESEPAVEGLIVAMSLIGATVVT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
             CSG++ADWLGRRPMLI+SS+ YFLS
Sbjct  61   FCSGAVADWLGRRPMLIISSVLYFLS  86



>ref|XP_002306419.1| hypothetical protein POPTR_0005s10180g [Populus trichocarpa]
 gb|EEE93415.1| hypothetical protein POPTR_0005s10180g [Populus trichocarpa]
Length=719

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 72/86 (84%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  503
            M GAVLVA+AAT+GN LQGWDN+TIAG++ YIK+EL L++   +EGL+VAMS+IG T IT
Sbjct  1    MRGAVLVALAATVGNLLQGWDNSTIAGSIPYIKEELNLQSQPAVEGLIVAMSIIGGTTIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            T SG+++D  GRRPMLI+SS+ Y LS
Sbjct  61   TFSGTVSDIFGRRPMLIMSSILYLLS  86



>ref|XP_002312798.1| transporter-related family protein [Populus trichocarpa]
 gb|EEE86753.1| transporter-related family protein [Populus trichocarpa]
Length=740

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 75/86 (87%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  503
            MNGAVLVA+AA IGN LQGWDNATIAGAV+YIK+E  LE+   +EGL+VA SL+GATLIT
Sbjct  1    MNGAVLVAVAAAIGNLLQGWDNATIAGAVLYIKREFHLESEPTIEGLIVATSLVGATLIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            TCSG I+D LGRRP+LI+SS+ YF+S
Sbjct  61   TCSGPISDCLGRRPLLIISSILYFVS  86



>ref|XP_009341490.1| PREDICTED: monosaccharide-sensing protein 2-like [Pyrus x bretschneideri]
Length=736

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 76/86 (88%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  503
            M+GAVLVA+AA IGN LQGWDNATIA +V+YIK+E  LE+   +EGL+VAMSLIGAT++T
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAASVLYIKREFNLESEPAVEGLIVAMSLIGATVVT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
             CSG++ADWLGRRPMLI+SS+ YFLS
Sbjct  61   FCSGAVADWLGRRPMLIISSVLYFLS  86



>gb|KDO68402.1| hypothetical protein CISIN_1g004750mg [Citrus sinensis]
 gb|KDO68403.1| hypothetical protein CISIN_1g004750mg [Citrus sinensis]
 gb|KDO68404.1| hypothetical protein CISIN_1g004750mg [Citrus sinensis]
Length=732

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 63/71 (89%), Gaps = 2/71 (3%)
 Frame = +3

Query  372  NFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLITTCSGSIADWLGRRP  545
            N LQGWDNATIAGAV+YIK+E  LET   +EGL+VAMSLIGAT ITTCSG+IADWLGRRP
Sbjct  15   NLLQGWDNATIAGAVLYIKREFHLETEPTIEGLIVAMSLIGATCITTCSGAIADWLGRRP  74

Query  546  MLILSSMFYFL  578
            MLI+SS+ YF+
Sbjct  75   MLIVSSVLYFI  85



>ref|XP_006422393.1| hypothetical protein CICLE_v10027893mg [Citrus clementina]
 gb|ESR35633.1| hypothetical protein CICLE_v10027893mg [Citrus clementina]
Length=732

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 63/71 (89%), Gaps = 2/71 (3%)
 Frame = +3

Query  372  NFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLITTCSGSIADWLGRRP  545
            N LQGWDNATIAGAV+YIK+E  LET   +EGL+VAMSLIGAT ITTCSG+IADWLGRRP
Sbjct  15   NLLQGWDNATIAGAVLYIKREFHLETEPTIEGLIVAMSLIGATCITTCSGAIADWLGRRP  74

Query  546  MLILSSMFYFL  578
            MLI+SS+ YF+
Sbjct  75   MLIVSSVLYFI  85



>ref|XP_011022133.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
 ref|XP_011022134.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
Length=719

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 72/86 (84%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  503
            M GAVLVA+AAT+GN LQGWDN+TIAG++ YIK+EL L++   +EGL+VAMS+IG T IT
Sbjct  1    MRGAVLVALAATVGNLLQGWDNSTIAGSIPYIKEELNLQSQPAVEGLIVAMSIIGGTTIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            T SG+++D  GRRPMLI+SS+ Y LS
Sbjct  61   TFSGTVSDIFGRRPMLIMSSILYLLS  86



>gb|AIN39841.1| hypothetical protein [Zoysia matrella]
Length=744

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 66/75 (88%), Gaps = 2/75 (3%)
 Frame = +3

Query  363  TIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLITTCSGSIADWLG  536
            +IGN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLIGAT+ITT SG ++DW+G
Sbjct  12   SIGNLLQGWDNATIAGAVLYIKKEFKLESEPTVEGLIVAMSLIGATIITTFSGPVSDWIG  71

Query  537  RRPMLILSSMFYFLS  581
            RRPMLILSS+ YF+S
Sbjct  72   RRPMLILSSVLYFVS  86



>ref|XP_010432297.1| PREDICTED: monosaccharide-sensing protein 2-like [Camelina sativa]
 ref|XP_010432298.1| PREDICTED: monosaccharide-sensing protein 2-like [Camelina sativa]
Length=739

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 74/85 (87%), Gaps = 2/85 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  503
            M+GAVLVA+AA +GN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLIGATLIT
Sbjct  1    MSGAVLVAVAAAVGNLLQGWDNATIAGAVLYIKKEFNLESNPSVEGLIVAMSLIGATLIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFL  578
            TCSG +AD LGRRPMLILSS  YF+
Sbjct  61   TCSGGVADLLGRRPMLILSSFLYFV  85



>emb|CDP01766.1| unnamed protein product [Coffea canephora]
Length=724

 Score =   114 bits (284),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 63/85 (74%), Positives = 76/85 (89%), Gaps = 2/85 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  503
            M GAVLVAIAA +GNF+QGWDNATIAG+V+YIK+E  L+T   +EGL+VAMSLIGAT+IT
Sbjct  1    MRGAVLVAIAAVVGNFVQGWDNATIAGSVLYIKREFNLQTQPTVEGLIVAMSLIGATVIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFL  578
            T SGS+ADWLGRRPML++SS+ YFL
Sbjct  61   TFSGSVADWLGRRPMLVISSVLYFL  85



>ref|XP_003526737.1| PREDICTED: monosaccharide-sensing protein 2-like isoform 1 [Glycine 
max]
Length=738

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 76/86 (88%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  503
            M+GAVLVA+AA IGN LQGWDNATIAG+++YIKKE  LE    +EGL+VAMSLIGAT++T
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAGSILYIKKEFQLENEPTVEGLIVAMSLIGATVVT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            TCSG+++D LGRRPMLI+SSM YF+S
Sbjct  61   TCSGALSDLLGRRPMLIISSMLYFVS  86



>ref|XP_009340799.1| PREDICTED: monosaccharide-sensing protein 2-like [Pyrus x bretschneideri]
 ref|XP_009340800.1| PREDICTED: monosaccharide-sensing protein 2-like [Pyrus x bretschneideri]
Length=736

 Score =   114 bits (284),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 75/86 (87%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  503
            M+GAVLVA+AA IGN LQGWDNATIA +V+YIK+E  LE+   MEGL+VAMSLIGAT++T
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAASVLYIKREFNLESEPAMEGLIVAMSLIGATVVT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
             CSG++ADWLGRRP LI+SS+ YFLS
Sbjct  61   FCSGAVADWLGRRPTLIVSSVLYFLS  86



>gb|EPS65490.1| hypothetical protein M569_09283 [Genlisea aurea]
Length=734

 Score =   113 bits (282),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  509
            M GA LVAIAA IGNFLQGWDNATIA AVVYIK+E  L   +EGLVVA SLIGAT+ITTC
Sbjct  1    MKGAALVAIAAAIGNFLQGWDNATIAAAVVYIKREEHLGASVEGLVVATSLIGATVITTC  60

Query  510  SGSIADWLGRRPMLILSSMFYFL  578
            SG+I+D +GRRPML+LSS+FYF+
Sbjct  61   SGTISDAVGRRPMLVLSSVFYFI  83



>ref|XP_003543932.1| PREDICTED: monosaccharide-sensing protein 2-like [Glycine max]
Length=734

 Score =   113 bits (282),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 76/86 (88%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  503
            M+GAVLVA+AA IGN LQGWDNATIAG+++YIK+E  L  E  +EGL+VAMSLIGAT++T
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAGSILYIKREFQLQSEPTVEGLIVAMSLIGATVVT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            TCSG+++D LGRRPMLI+SSM YF+S
Sbjct  61   TCSGALSDLLGRRPMLIISSMLYFVS  86



>gb|KHN33643.1| Monosaccharide-sensing protein 2 [Glycine soja]
Length=734

 Score =   113 bits (282),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 76/86 (88%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  503
            M+GAVLVA+AA IGN LQGWDNATIAG+++YIK+E  L  E  +EGL+VAMSLIGAT++T
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAGSILYIKREFQLQSEPTVEGLIVAMSLIGATVVT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            TCSG+++D LGRRPMLI+SSM YF+S
Sbjct  61   TCSGALSDLLGRRPMLIISSMLYFVS  86



>ref|XP_006384856.1| transporter-related family protein [Populus trichocarpa]
 gb|ERP62653.1| transporter-related family protein [Populus trichocarpa]
Length=739

 Score =   112 bits (281),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 75/86 (87%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  503
            M+GAVLVA+AA IGN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSL+GATLIT
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAGAVLYIKKEFHLESEPAIEGLIVAMSLVGATLIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
             CSG I+D LGRRP+LI+SS+ YF+S
Sbjct  61   MCSGPISDLLGRRPLLIISSVLYFVS  86



>ref|XP_004139974.1| PREDICTED: monosaccharide-sensing protein 2-like [Cucumis sativus]
 gb|KGN46648.1| hypothetical protein Csa_6G118280 [Cucumis sativus]
Length=733

 Score =   112 bits (280),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 62/85 (73%), Positives = 76/85 (89%), Gaps = 2/85 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  503
            M+G+VLVA+AA +GNFLQGWDNATIAGAV+YIKKE  LE+   +EGL+VA SLIGAT+IT
Sbjct  1    MSGSVLVAVAAAVGNFLQGWDNATIAGAVLYIKKEFNLESSPTVEGLIVATSLIGATVIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFL  578
            TCSG+I+DWLGRR +LILSS+ YF+
Sbjct  61   TCSGAISDWLGRRLLLILSSVLYFI  85



>ref|XP_009622210.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana tomentosiformis]
 ref|XP_009622211.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana tomentosiformis]
 ref|XP_009622212.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana tomentosiformis]
Length=722

 Score =   112 bits (279),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 75/86 (87%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  503
            M+GAVLVA+AA IGN LQGWDNATIAGAV+YIKKE  L+T   +EGL+VAMSLIGAT+IT
Sbjct  1    MSGAVLVALAAAIGNLLQGWDNATIAGAVLYIKKEFNLQTQPTIEGLIVAMSLIGATVIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            T SG ++D LGRRPMLI+SS+ YFLS
Sbjct  61   TFSGPVSDMLGRRPMLIISSVLYFLS  86



>ref|XP_010270527.1| PREDICTED: monosaccharide-sensing protein 2 [Nelumbo nucifera]
 ref|XP_010270528.1| PREDICTED: monosaccharide-sensing protein 2 [Nelumbo nucifera]
Length=740

 Score =   112 bits (279),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 74/86 (86%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  503
            M GAVLVA+AA IGN LQGWDNATIAG+++YIK+E  LE+   +EGL+VAMSLIGAT IT
Sbjct  1    MRGAVLVAVAAAIGNLLQGWDNATIAGSILYIKREFKLESEPTIEGLIVAMSLIGATFIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            T SG ++DWLGRRPM+I+SS+ YF+S
Sbjct  61   TFSGPVSDWLGRRPMMIISSVLYFIS  86



>ref|XP_008382498.1| PREDICTED: monosaccharide-sensing protein 2-like [Malus domestica]
 ref|XP_008382499.1| PREDICTED: monosaccharide-sensing protein 2-like [Malus domestica]
Length=736

 Score =   112 bits (279),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 75/86 (87%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  503
            M+GAVLVA+AA IGN LQGWDNATIA +V+YIK+E  LE+   +EGL+VAMSLIGAT++T
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAASVLYIKREFNLESEPAVEGLIVAMSLIGATVVT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
             CSG++ADWLGRRP LI+SS+ YFLS
Sbjct  61   FCSGAVADWLGRRPTLIVSSVLYFLS  86



>gb|EYU30848.1| hypothetical protein MIMGU_mgv1a001984mg [Erythranthe guttata]
Length=730

 Score =   111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 74/86 (86%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  503
            M GAVLVAIAA IGN LQGWDNATIAGAV+YIK+E  L++   +EGL+VAMSLIGAT+IT
Sbjct  1    MRGAVLVAIAAAIGNLLQGWDNATIAGAVLYIKREFDLQSQPKIEGLIVAMSLIGATVIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            T SG ++DWLGRRPMLI SS+ YFLS
Sbjct  61   TFSGPVSDWLGRRPMLIASSILYFLS  86



>ref|XP_011040809.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
 ref|XP_011040810.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
 ref|XP_011040811.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
Length=738

 Score =   111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 75/86 (87%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  503
            M+GAVLVA+AA +GN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSL+GATLIT
Sbjct  1    MSGAVLVAVAAAVGNLLQGWDNATIAGAVLYIKKEFHLESEPAIEGLIVAMSLVGATLIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
             CSG I+D LGRRP+LI+SS+ YF+S
Sbjct  61   MCSGPISDMLGRRPLLIISSVLYFIS  86



>ref|XP_009392211.1| PREDICTED: monosaccharide-sensing protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=732

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 75/86 (87%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLE--TYMEGLVVAMSLIGATLIT  503
            M GAVLVAIAA IGN LQGWDNATIAGAV+YIK+E  LE    +EGL+VAMSLIGAT+IT
Sbjct  1    MQGAVLVAIAAAIGNMLQGWDNATIAGAVLYIKREFKLEGQPTIEGLIVAMSLIGATVIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            T SG+++DW+GRRPMLI+SS+ YF+S
Sbjct  61   TFSGAVSDWIGRRPMLIISSVLYFIS  86



>ref|XP_008448165.1| PREDICTED: monosaccharide-sensing protein 2 [Cucumis melo]
 ref|XP_008448166.1| PREDICTED: monosaccharide-sensing protein 2 [Cucumis melo]
 ref|XP_008448167.1| PREDICTED: monosaccharide-sensing protein 2 [Cucumis melo]
 ref|XP_008448168.1| PREDICTED: monosaccharide-sensing protein 2 [Cucumis melo]
 ref|XP_008448169.1| PREDICTED: monosaccharide-sensing protein 2 [Cucumis melo]
 ref|XP_008448170.1| PREDICTED: monosaccharide-sensing protein 2 [Cucumis melo]
 ref|XP_008448171.1| PREDICTED: monosaccharide-sensing protein 2 [Cucumis melo]
Length=733

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 75/85 (88%), Gaps = 2/85 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  503
            M+G+VLVA+AA +GNFLQGWDNATIAGAV+YIKKE  LE+   +EGL+VA SLIGAT+IT
Sbjct  1    MSGSVLVAVAAAVGNFLQGWDNATIAGAVLYIKKEFNLESSPTVEGLIVATSLIGATVIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFL  578
            TCSG+I+DWLGRR +LI SS+ YF+
Sbjct  61   TCSGAISDWLGRRLLLIFSSVLYFI  85



>ref|XP_009589978.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana tomentosiformis]
 ref|XP_009589979.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana tomentosiformis]
Length=721

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 75/86 (87%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  503
            M+GAVL+A+AA IGN LQGWDNATIAG+V+YIKKE  L+T   MEGL+VAMSLIGAT+IT
Sbjct  1    MSGAVLIALAAAIGNLLQGWDNATIAGSVLYIKKEFNLQTQPTMEGLIVAMSLIGATVIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            T SG ++D LGRRPMLI+SS+ YFLS
Sbjct  61   TFSGPVSDMLGRRPMLIISSVLYFLS  86



>ref|XP_009775817.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana sylvestris]
 ref|XP_009775879.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana sylvestris]
 ref|XP_009775941.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana sylvestris]
Length=721

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 75/86 (87%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  503
            M+GAVL+A+AA IGN LQGWDNATIAG+V+YIKKE  L+T   MEGL+VAMSLIGAT+IT
Sbjct  1    MSGAVLIALAAAIGNLLQGWDNATIAGSVLYIKKEFNLQTQPTMEGLIVAMSLIGATVIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            T SG ++D LGRRPMLI+SS+ YFLS
Sbjct  61   TFSGPVSDMLGRRPMLIISSVLYFLS  86



>ref|XP_007137297.1| hypothetical protein PHAVU_009G115500g [Phaseolus vulgaris]
 gb|ESW09291.1| hypothetical protein PHAVU_009G115500g [Phaseolus vulgaris]
Length=739

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 77/86 (90%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  503
            M+GA+LVA+AA IGN LQGWDNATIAG+++YIK+E  LE+   +EGL+VAMSLIGAT++T
Sbjct  1    MSGAILVAVAAAIGNLLQGWDNATIAGSILYIKREFQLESQPTVEGLIVAMSLIGATVVT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            TCSG+++D LGRRPMLI+SS+ YF+S
Sbjct  61   TCSGALSDLLGRRPMLIISSLLYFVS  86



>ref|XP_006343319.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006343320.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X2 [Solanum 
tuberosum]
Length=722

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 74/86 (86%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  503
            M GAVL+A+AA IGN LQGWDNATIAG+V+YIKKE  L+T   MEGL+VAMSLIGAT+IT
Sbjct  1    MRGAVLIALAAAIGNMLQGWDNATIAGSVLYIKKEFNLQTQPTMEGLIVAMSLIGATVIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            T SG ++D LGRRPMLI+SS+ YFLS
Sbjct  61   TFSGPVSDMLGRRPMLIISSVLYFLS  86



>ref|NP_001280690.1| monosaccharide-sensing protein 2-like [Solanum lycopersicum]
 dbj|BAO96236.1| tonoplast monosaccharide transporter 1 [Solanum lycopersicum]
Length=725

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 74/86 (86%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  503
            M GAVL+A+AA IGN LQGWDNATIAG+V+YIKKE  L+T   MEGL+VAMSLIGAT+IT
Sbjct  1    MRGAVLIALAAAIGNMLQGWDNATIAGSVLYIKKEFNLQTQPTMEGLIVAMSLIGATVIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            T SG ++D LGRRPMLI+SS+ YFLS
Sbjct  61   TFSGPVSDMLGRRPMLIISSVLYFLS  86



>ref|XP_011098017.1| PREDICTED: monosaccharide-sensing protein 2-like [Sesamum indicum]
 ref|XP_011098018.1| PREDICTED: monosaccharide-sensing protein 2-like [Sesamum indicum]
 ref|XP_011098019.1| PREDICTED: monosaccharide-sensing protein 2-like [Sesamum indicum]
Length=711

 Score =   110 bits (275),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 74/86 (86%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  503
            M GAVLVAIAA IGN LQGWDNATIAG+V+YIK+E  L+    +EGL+VAMSLIGAT+IT
Sbjct  1    MRGAVLVAIAAAIGNMLQGWDNATIAGSVLYIKREFDLQRQPTIEGLIVAMSLIGATVIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            T SG ++DWLGRRPMLI+SS+ YFLS
Sbjct  61   TFSGPVSDWLGRRPMLIISSVLYFLS  86



>ref|XP_004500684.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X1 [Cicer 
arietinum]
 ref|XP_004500685.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X2 [Cicer 
arietinum]
Length=740

 Score =   110 bits (275),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 76/86 (88%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  503
            M+GAV+VA+AA IGN LQGWDNATIAG+++YIKKE  LE    +EGL+VAMSLIGAT++T
Sbjct  1    MSGAVIVAVAAAIGNLLQGWDNATIAGSILYIKKEFQLENEPTVEGLIVAMSLIGATVVT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            TCSG+++D LGRRPMLI+SS+ YF+S
Sbjct  61   TCSGALSDLLGRRPMLIISSVLYFVS  86



>ref|XP_010690557.1| PREDICTED: monosaccharide-sensing protein 2 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010690558.1| PREDICTED: monosaccharide-sensing protein 2 [Beta vulgaris subsp. 
vulgaris]
Length=739

 Score =   110 bits (274),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 73/86 (85%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLE--TYMEGLVVAMSLIGATLIT  503
            M+GAVLVAIAA +GN LQGWDNATIAGAV+YIKKE  LE    MEGL+VAMSLIGAT+IT
Sbjct  1    MSGAVLVAIAAAVGNLLQGWDNATIAGAVLYIKKEFNLEGAPTMEGLIVAMSLIGATIIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            TCSG ++D  GRRPM+I+SS+ +F S
Sbjct  61   TCSGPVSDRFGRRPMMIISSICFFFS  86



>ref|XP_004289029.1| PREDICTED: monosaccharide-sensing protein 2-like [Fragaria vesca 
subsp. vesca]
 ref|XP_011461449.1| PREDICTED: monosaccharide-sensing protein 2-like [Fragaria vesca 
subsp. vesca]
Length=760

 Score =   110 bits (274),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 55/73 (75%), Positives = 63/73 (86%), Gaps = 2/73 (3%)
 Frame = +3

Query  369  GNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLITTCSGSIADWLGRR  542
            GN LQGWDNATIAGAV+YIKKE  LET   +EGL+VAMSLIGAT+ITT SG ++D LGRR
Sbjct  14   GNLLQGWDNATIAGAVLYIKKEFKLETQPTIEGLIVAMSLIGATVITTFSGPVSDSLGRR  73

Query  543  PMLILSSMFYFLS  581
            PMLI+SS+ YFLS
Sbjct  74   PMLIISSVLYFLS  86



>ref|NP_001067890.1| Os11g0475600 [Oryza sativa Japonica Group]
 gb|ABA93553.1| hexose transporter, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF28253.1| Os11g0475600 [Oryza sativa Japonica Group]
 gb|EAZ18344.1| hypothetical protein OsJ_33873 [Oryza sativa Japonica Group]
 dbj|BAH00841.1| unnamed protein product [Oryza sativa Japonica Group]
Length=757

 Score =   110 bits (274),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 72/84 (86%), Gaps = 2/84 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  503
            M GAVLVA+AA IGN+LQGWDNATIAGAV+YIK+E  LET   +EGLVVAMSLIGAT+IT
Sbjct  1    MRGAVLVAVAAAIGNYLQGWDNATIAGAVLYIKREFALETQPAVEGLVVAMSLIGATIIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYF  575
            T SG ++D +GRRPMLI SS+ YF
Sbjct  61   TFSGPVSDLVGRRPMLIASSLLYF  84



>gb|EAY80902.1| hypothetical protein OsI_36080 [Oryza sativa Indica Group]
Length=763

 Score =   110 bits (274),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 72/84 (86%), Gaps = 2/84 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  503
            M GAVLVA+AA IGN+LQGWDNATIAGAV+YIK+E  LET   +EGLVVAMSLIGAT+IT
Sbjct  1    MRGAVLVAVAAAIGNYLQGWDNATIAGAVLYIKREFALETQPAVEGLVVAMSLIGATIIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYF  575
            T SG ++D +GRRPMLI SS+ YF
Sbjct  61   TFSGPVSDLVGRRPMLIASSLLYF  84



>ref|XP_004154526.1| PREDICTED: monosaccharide-sensing protein 2-like [Cucumis sativus]
Length=733

 Score =   109 bits (273),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 75/85 (88%), Gaps = 2/85 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  503
            M+G+VLVA+AA +GN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VA SLIGAT+IT
Sbjct  1    MSGSVLVAVAAAVGNLLQGWDNATIAGAVLYIKKEFNLESSPTVEGLIVATSLIGATVIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFL  578
            TCSG+I+DWLGRR +LILSS+ YF+
Sbjct  61   TCSGAISDWLGRRLLLILSSVLYFI  85



>gb|KHN46863.1| Monosaccharide-sensing protein 2 [Glycine soja]
Length=717

 Score =   109 bits (272),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 74/85 (87%), Gaps = 2/85 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  503
            M+GAVLVA+AA IGN LQGWDNATIAG+++YIK+E  L  E  +EGL+VAMSLIGAT++T
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAGSILYIKREFNLQSEPTIEGLIVAMSLIGATVVT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFL  578
            TCSG ++D LGRRPMLI+SS+ YF+
Sbjct  61   TCSGPLSDLLGRRPMLIISSILYFV  85



>ref|XP_009359630.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X2 [Pyrus 
x bretschneideri]
Length=743

 Score =   109 bits (272),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 73/86 (85%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  503
            M GAV VAIAA IGN LQGWDNATIAGAV+YIK+E  LE+   +EGL+VAMSLIGAT+IT
Sbjct  1    MRGAVFVAIAAAIGNLLQGWDNATIAGAVLYIKREFKLESQPTIEGLIVAMSLIGATVIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            T SG ++D LGRRPMLI+SS+ YFLS
Sbjct  61   TFSGPVSDSLGRRPMLIISSVLYFLS  86



>ref|XP_009359629.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X1 [Pyrus 
x bretschneideri]
Length=753

 Score =   109 bits (272),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 73/86 (85%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  503
            M GAV VAIAA IGN LQGWDNATIAGAV+YIK+E  LE+   +EGL+VAMSLIGAT+IT
Sbjct  1    MRGAVFVAIAAAIGNLLQGWDNATIAGAVLYIKREFKLESQPTIEGLIVAMSLIGATVIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            T SG ++D LGRRPMLI+SS+ YFLS
Sbjct  61   TFSGPVSDSLGRRPMLIISSVLYFLS  86



>ref|XP_009359631.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X3 [Pyrus 
x bretschneideri]
Length=742

 Score =   109 bits (272),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 73/86 (85%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  503
            M GAV VAIAA IGN LQGWDNATIAGAV+YIK+E  LE+   +EGL+VAMSLIGAT+IT
Sbjct  1    MRGAVFVAIAAAIGNLLQGWDNATIAGAVLYIKREFKLESQPTIEGLIVAMSLIGATVIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            T SG ++D LGRRPMLI+SS+ YFLS
Sbjct  61   TFSGPVSDSLGRRPMLIISSVLYFLS  86



>emb|CDY33275.1| BnaA01g19420D [Brassica napus]
Length=119

 Score =   100 bits (250),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 52/75 (69%), Positives = 60/75 (80%), Gaps = 2/75 (3%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  503
            M   VLVA+AA IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGAT+IT
Sbjct  1    MRSVVLVALAAAIGNMLQGWDNATIAGAVIYIKKEFHLEKEPKIEGLIVAMSLIGATMIT  60

Query  504  TCSGSIADWLGRRPM  548
            T SG ++D +GRR M
Sbjct  61   TFSGPVSDRVGRRSM  75



>ref|XP_003560303.1| PREDICTED: monosaccharide-sensing protein 2-like [Brachypodium 
distachyon]
Length=770

 Score =   107 bits (266),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 64/85 (75%), Positives = 72/85 (85%), Gaps = 2/85 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  503
            M GAVLVAIAA IGN LQGWDNATIAGAV+YIK+E  LET+  +EGLVVA SLIGAT+IT
Sbjct  1    MRGAVLVAIAAAIGNLLQGWDNATIAGAVLYIKREFHLETHPAIEGLVVATSLIGATIIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFL  578
            T SG +AD +GRRPMLI SS+ YFL
Sbjct  61   TFSGPVADMVGRRPMLIASSILYFL  85



>ref|XP_003518591.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X1 [Glycine 
max]
 ref|XP_006575765.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X2 [Glycine 
max]
 ref|XP_006575766.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X3 [Glycine 
max]
 gb|KHN29885.1| Monosaccharide-sensing protein 2 [Glycine soja]
Length=711

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/72 (68%), Positives = 62/72 (86%), Gaps = 2/72 (3%)
 Frame = +3

Query  372  NFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLITTCSGSIADWLGRRP  545
            N LQGWDNATIAG+++YIK+E  L  E  +EGL+VAMSLIGAT++TTCSG ++D+LGRRP
Sbjct  17   NLLQGWDNATIAGSILYIKREFNLQSEPTIEGLIVAMSLIGATVVTTCSGPLSDFLGRRP  76

Query  546  MLILSSMFYFLS  581
            MLI+SS+ YF S
Sbjct  77   MLIISSVLYFAS  88



>gb|KGN49001.1| hypothetical protein Csa_6G509700 [Cucumis sativus]
Length=768

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 73/93 (78%), Gaps = 2/93 (2%)
 Frame = +3

Query  309  LDSGLLRMNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLE--TYMEGLVVAMSL  482
            L    LRM GAVLVAIAA IGN LQGWDNATIAGAV+YIKKE  LE     EGL+VAMSL
Sbjct  40   LSPSRLRMRGAVLVAIAAAIGNLLQGWDNATIAGAVMYIKKEFKLEGDPTTEGLIVAMSL  99

Query  483  IGATLITTCSGSIADWLGRRPMLILSSMFYFLS  581
            IGAT+ITT SG ++D +GRRP++I SS+ YF S
Sbjct  100  IGATVITTFSGPLSDSVGRRPLMIASSILYFTS  132



>ref|XP_010029563.1| PREDICTED: monosaccharide-sensing protein 2-like [Eucalyptus 
grandis]
 gb|KCW56481.1| hypothetical protein EUGRSUZ_I02209 [Eucalyptus grandis]
Length=738

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 67/86 (78%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  503
            M GAVLVAIAATIG  LQGWD +TIAG+V+YIK E  L+    +EGL+VAMSLIG+T IT
Sbjct  1    MRGAVLVAIAATIGTMLQGWDGSTIAGSVLYIKGEFDLQEQPTIEGLIVAMSLIGSTAIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            T SG ++D LGRRPM+I+ S+  F S
Sbjct  61   TFSGPLSDSLGRRPMMIICSVLSFAS  86



>ref|XP_004954530.1| PREDICTED: monosaccharide-sensing protein 2-like [Setaria italica]
Length=707

 Score =   104 bits (259),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 70/84 (83%), Gaps = 2/84 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  503
            M GAVLVAIAA IGN LQGWDNATIAGAV+YIK+E  LE +  MEGLVVA SLIGAT+IT
Sbjct  1    MRGAVLVAIAAAIGNMLQGWDNATIAGAVLYIKREFHLEAHPAMEGLVVATSLIGATVIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYF  575
            T SG ++D +GRRPMLI SS+ YF
Sbjct  61   TFSGPVSDSVGRRPMLIASSLLYF  84



>ref|XP_004964709.1| PREDICTED: monosaccharide-sensing protein 2-like [Setaria italica]
Length=748

 Score =   103 bits (258),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 70/84 (83%), Gaps = 2/84 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  503
            M GAVLVAIAA IGN LQGWDNATIAGAV+YIK+E  LET   +EGLVVA SLIGAT+IT
Sbjct  1    MQGAVLVAIAAAIGNMLQGWDNATIAGAVLYIKREFHLETQPALEGLVVATSLIGATIIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYF  575
            T SG ++D +GRRPMLI SS+ YF
Sbjct  61   TFSGPVSDNVGRRPMLIASSLLYF  84



>ref|XP_004289030.1| PREDICTED: monosaccharide-sensing protein 2 [Fragaria vesca subsp. 
vesca]
Length=714

 Score =   103 bits (257),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 69/86 (80%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  503
            M GAV VA+AA IGN LQGWDN+ IAG+V+YIKKE  LE+    EGL+VA SLIGAT+IT
Sbjct  1    MRGAVYVAVAAAIGNMLQGWDNSVIAGSVLYIKKEFSLESKPTFEGLIVATSLIGATVIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            T SG  +DWLGRR MLI+SS+ +FLS
Sbjct  61   TFSGPASDWLGRRTMLIMSSLLFFLS  86



>gb|EPS57524.1| hypothetical protein M569_17293, partial [Genlisea aurea]
Length=693

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 70/86 (81%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  503
            M GAVLVAIAA +GN LQGWDNATIAGAV+Y+K+E  LE+   +EGL+VA SLIGAT IT
Sbjct  1    MKGAVLVAIAAAVGNLLQGWDNATIAGAVLYVKREFHLESQPTVEGLIVATSLIGATFIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            T SG  +D  GRRPML+LSS+ YF+S
Sbjct  61   TISGPASDSFGRRPMLLLSSILYFVS  86



>ref|XP_002439068.1| hypothetical protein SORBIDRAFT_10g031000 [Sorghum bicolor]
 gb|EER90435.1| hypothetical protein SORBIDRAFT_10g031000 [Sorghum bicolor]
Length=767

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 70/84 (83%), Gaps = 2/84 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  503
            M GAVLVAIAA IGN LQGWDNATIAGAV+YIK+E  LET   +EGL+VA SLIGAT+IT
Sbjct  1    MQGAVLVAIAAAIGNLLQGWDNATIAGAVIYIKREFHLETQPAVEGLLVATSLIGATIIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYF  575
            T SG ++D +GRRPML+ SS+ YF
Sbjct  61   TFSGPVSDIVGRRPMLVASSLLYF  84



>ref|XP_008440928.1| PREDICTED: LOW QUALITY PROTEIN: monosaccharide-sensing protein 
2 [Cucumis melo]
Length=725

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 70/86 (81%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLE--TYMEGLVVAMSLIGATLIT  503
            M GAVLVAIAA IGN LQGWDNATIAGAV+YIKKE  LE     EGL+VAMSLIGAT+IT
Sbjct  1    MRGAVLVAIAAAIGNLLQGWDNATIAGAVMYIKKEFKLEGDPTTEGLIVAMSLIGATVIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            T SG ++D +GRRP++I SS+ YF S
Sbjct  61   TFSGPLSDSVGRRPLMITSSILYFTS  86



>ref|XP_006403910.1| hypothetical protein EUTSA_v10011113mg [Eutrema salsugineum]
 gb|ESQ45363.1| hypothetical protein EUTSA_v10011113mg [Eutrema salsugineum]
Length=739

 Score =   102 bits (253),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 53/75 (71%), Positives = 60/75 (80%), Gaps = 2/75 (3%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLE--TYMEGLVVAMSLIGATLIT  503
            M   VLVA+AA IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGATLIT
Sbjct  1    MQSVVLVALAAAIGNMLQGWDNATIAGAVIYIKKEFHLEKEPKIEGLIVAMSLIGATLIT  60

Query  504  TCSGSIADWLGRRPM  548
            T SG ++D +GRR M
Sbjct  61   TFSGPVSDRVGRRSM  75



>ref|XP_006292750.1| hypothetical protein CARUB_v10018997mg [Capsella rubella]
 gb|EOA25648.1| hypothetical protein CARUB_v10018997mg [Capsella rubella]
Length=729

 Score =   101 bits (252),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 53/75 (71%), Positives = 60/75 (80%), Gaps = 2/75 (3%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLE--TYMEGLVVAMSLIGATLIT  503
            M   VLVA+AA IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGATLIT
Sbjct  1    MRSVVLVALAAAIGNMLQGWDNATIAGAVIYIKKEFHLEKEPKIEGLIVAMSLIGATLIT  60

Query  504  TCSGSIADWLGRRPM  548
            T SG ++D +GRR M
Sbjct  61   TFSGPVSDKVGRRSM  75



>ref|XP_004169167.1| PREDICTED: LOW QUALITY PROTEIN: monosaccharide-sensing protein 
2-like [Cucumis sativus]
Length=722

 Score =   101 bits (252),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 70/86 (81%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLE--TYMEGLVVAMSLIGATLIT  503
            M GAVLVAIAA IGN LQGWDNATIAGAV+YIKKE  LE     EGL+VAMSLIGAT+IT
Sbjct  1    MRGAVLVAIAAAIGNLLQGWDNATIAGAVMYIKKEFKLEGDPTTEGLIVAMSLIGATVIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            T SG ++D +GRRP++I SS+ YF S
Sbjct  61   TFSGPLSDSVGRRPLMIASSILYFTS  86



>ref|XP_004134823.1| PREDICTED: monosaccharide-sensing protein 2-like [Cucumis sativus]
Length=722

 Score =   101 bits (252),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 70/86 (81%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLE--TYMEGLVVAMSLIGATLIT  503
            M GAVLVAIAA IGN LQGWDNATIAGAV+YIKKE  LE     EGL+VAMSLIGAT+IT
Sbjct  1    MRGAVLVAIAAAIGNLLQGWDNATIAGAVMYIKKEFKLEGDPTTEGLIVAMSLIGATVIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            T SG ++D +GRRP++I SS+ YF S
Sbjct  61   TFSGPLSDSVGRRPLMIASSILYFTS  86



>ref|XP_009148978.1| PREDICTED: monosaccharide-sensing protein 3 [Brassica rapa]
Length=741

 Score =   101 bits (251),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 52/75 (69%), Positives = 60/75 (80%), Gaps = 2/75 (3%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLE--TYMEGLVVAMSLIGATLIT  503
            M   VLVA+AA IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGAT+IT
Sbjct  1    MRSVVLVALAAAIGNMLQGWDNATIAGAVIYIKKEFHLEKEPKIEGLIVAMSLIGATMIT  60

Query  504  TCSGSIADWLGRRPM  548
            T SG ++D +GRR M
Sbjct  61   TFSGPVSDRVGRRSM  75



>ref|XP_009359632.1| PREDICTED: monosaccharide-sensing protein 2-like [Pyrus x bretschneideri]
Length=736

 Score =   101 bits (251),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 67/86 (78%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  503
            M GAV VA+AA IGN LQGWDN+ IAG+VVYIKKE  LE+    EGL+ A SLIGAT IT
Sbjct  1    MRGAVFVAVAAAIGNLLQGWDNSVIAGSVVYIKKEFELESEPTFEGLIAASSLIGATFIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            T SG  +DWLGRR MLI+SS+ +F+S
Sbjct  61   TFSGPASDWLGRRTMLIISSVLFFIS  86



>emb|CDY33276.1| BnaA01g19430D [Brassica napus]
Length=668

 Score =   100 bits (250),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 52/75 (69%), Positives = 60/75 (80%), Gaps = 2/75 (3%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLE--TYMEGLVVAMSLIGATLIT  503
            M   VLVA+AA IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGAT+IT
Sbjct  1    MRSVVLVALAAAIGNMLQGWDNATIAGAVIYIKKEFHLEKEPKIEGLIVAMSLIGATMIT  60

Query  504  TCSGSIADWLGRRPM  548
            T SG ++D +GRR M
Sbjct  61   TFSGPVSDRVGRRSM  75



>gb|KDP43790.1| hypothetical protein JCGZ_22417 [Jatropha curcas]
Length=729

 Score =   100 bits (250),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 72/86 (84%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  503
            M GAVLVA+AA +GN LQGWDN+TIAG+++YIKKE  L+T   MEGL+ AMSLIGAT+IT
Sbjct  1    MRGAVLVALAAAVGNMLQGWDNSTIAGSLLYIKKEFNLQTQPTMEGLIAAMSLIGATIIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            T SG ++D  GRRP++I+S++ YFLS
Sbjct  61   TFSGPVSDIYGRRPLMIISAIMYFLS  86



>ref|XP_010515555.1| PREDICTED: monosaccharide-sensing protein 3 [Camelina sativa]
Length=738

 Score =   100 bits (250),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 52/75 (69%), Positives = 60/75 (80%), Gaps = 2/75 (3%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLE--TYMEGLVVAMSLIGATLIT  503
            M   VLVA+AA IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGAT+IT
Sbjct  1    MRSVVLVALAAAIGNMLQGWDNATIAGAVIYIKKEFHLEKEPKIEGLIVAMSLIGATMIT  60

Query  504  TCSGSIADWLGRRPM  548
            T SG ++D +GRR M
Sbjct  61   TFSGPVSDKVGRRSM  75



>ref|XP_010503840.1| PREDICTED: monosaccharide-sensing protein 3-like [Camelina sativa]
Length=740

 Score =   100 bits (250),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 52/75 (69%), Positives = 60/75 (80%), Gaps = 2/75 (3%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLE--TYMEGLVVAMSLIGATLIT  503
            M   VLVA+AA IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGAT+IT
Sbjct  1    MRSVVLVALAAAIGNMLQGWDNATIAGAVIYIKKEFHLEKEPKIEGLIVAMSLIGATMIT  60

Query  504  TCSGSIADWLGRRPM  548
            T SG ++D +GRR M
Sbjct  61   TFSGPVSDKVGRRSM  75



>ref|XP_010426703.1| PREDICTED: monosaccharide-sensing protein 3-like [Camelina sativa]
Length=738

 Score =   100 bits (249),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 52/75 (69%), Positives = 60/75 (80%), Gaps = 2/75 (3%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLE--TYMEGLVVAMSLIGATLIT  503
            M   VLVA+AA IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGAT+IT
Sbjct  1    MRSVVLVALAAAIGNMLQGWDNATIAGAVIYIKKEFHLEKEPKIEGLIVAMSLIGATMIT  60

Query  504  TCSGSIADWLGRRPM  548
            T SG ++D +GRR M
Sbjct  61   TFSGPVSDKVGRRSM  75



>ref|XP_004978456.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X1 [Setaria 
italica]
 ref|XP_004978457.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X2 [Setaria 
italica]
 ref|XP_004978458.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X3 [Setaria 
italica]
Length=710

 Score =   100 bits (249),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 71/86 (83%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  503
            M GAVLVA+AA IGN LQGWDNATIAGAV+YIKKE  L  E  +EGL+VA SLIGAT +T
Sbjct  1    MGGAVLVAVAAAIGNLLQGWDNATIAGAVLYIKKEFNLQSEPLIEGLIVATSLIGATAVT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            T +G++AD +GRRP+LI S++ YF+S
Sbjct  61   TIAGAVADSIGRRPVLIASAVLYFVS  86



>ref|XP_003537696.1| PREDICTED: monosaccharide-sensing protein 2-like [Glycine max]
 gb|KHN41803.1| Monosaccharide-sensing protein 3 [Glycine soja]
Length=722

 Score =   100 bits (249),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = +3

Query  342  VLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTCSGSI  521
            V+VAIAAT+GN L GWD++TIA  + YIKKE VL+  +EGL+V+MS I  T++T  SG++
Sbjct  5    VIVAIAATLGNLLMGWDSSTIAAGMTYIKKEFVLDATLEGLIVSMSFITGTIVTLFSGTV  64

Query  522  ADWLGRRPMLILSSMFYFLS  581
            +D +GRRPMLI SS+ +FLS
Sbjct  65   SDLVGRRPMLITSSIMFFLS  84



>emb|CDX78009.1| BnaA09g32040D [Brassica napus]
Length=669

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 51/75 (68%), Positives = 60/75 (80%), Gaps = 2/75 (3%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLE--TYMEGLVVAMSLIGATLIT  503
            M   VLV++AA IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGAT+IT
Sbjct  1    MRSVVLVSLAAAIGNMLQGWDNATIAGAVIYIKKEFHLEKEPKIEGLIVAMSLIGATMIT  60

Query  504  TCSGSIADWLGRRPM  548
            T SG ++D +GRR M
Sbjct  61   TFSGPVSDKVGRRSM  75



>ref|XP_009115837.1| PREDICTED: monosaccharide-sensing protein 3 [Brassica rapa]
Length=731

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 51/75 (68%), Positives = 60/75 (80%), Gaps = 2/75 (3%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLE--TYMEGLVVAMSLIGATLIT  503
            M   VLV++AA IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGAT+IT
Sbjct  1    MRSVVLVSLAAAIGNMLQGWDNATIAGAVIYIKKEFHLEKEPKIEGLIVAMSLIGATMIT  60

Query  504  TCSGSIADWLGRRPM  548
            T SG ++D +GRR M
Sbjct  61   TFSGPVSDKVGRRSM  75



>emb|CDX73717.1| BnaC08g22860D [Brassica napus]
Length=681

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 51/75 (68%), Positives = 60/75 (80%), Gaps = 2/75 (3%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLE--TYMEGLVVAMSLIGATLIT  503
            M   VLV++AA IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGAT+IT
Sbjct  1    MRSVVLVSLAAAIGNMLQGWDNATIAGAVIYIKKEFHLEKEPKIEGLIVAMSLIGATMIT  60

Query  504  TCSGSIADWLGRRPM  548
            T SG ++D +GRR M
Sbjct  61   TFSGPVSDKVGRRSM  75



>emb|CDY16303.1| BnaC01g23380D [Brassica napus]
Length=670

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 51/75 (68%), Positives = 59/75 (79%), Gaps = 2/75 (3%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLE--TYMEGLVVAMSLIGATLIT  503
            M   VLVA+ A IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGAT+IT
Sbjct  1    MRSVVLVALTAAIGNMLQGWDNATIAGAVIYIKKEFHLEKEPKIEGLIVAMSLIGATMIT  60

Query  504  TCSGSIADWLGRRPM  548
            T SG ++D +GRR M
Sbjct  61   TFSGPVSDRVGRRSM  75



>ref|XP_002532480.1| sugar transporter, putative [Ricinus communis]
 gb|EEF29904.1| sugar transporter, putative [Ricinus communis]
Length=536

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 72/86 (84%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  503
            M GAVLVA+AA +GN LQGWDNATIAG+++YIK+E  L+T   MEGL+ A++LIGAT+IT
Sbjct  1    MRGAVLVALAAAVGNMLQGWDNATIAGSLLYIKREFNLQTQPTMEGLIAAVALIGATIIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
              +G ++D LGRRPMLI+S++ YFLS
Sbjct  61   IFTGPVSDLLGRRPMLIISAIMYFLS  86



>ref|XP_003517121.1| PREDICTED: monosaccharide-sensing protein 2-like [Glycine max]
Length=722

 Score = 98.6 bits (244),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = +3

Query  342  VLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTCSGSI  521
            V+VAIAAT+GN L GWD++TIA  + YIKKE VL+  +EGL+V+MS I  T++T  SG++
Sbjct  5    VIVAIAATLGNLLMGWDSSTIAAGMTYIKKEFVLDATLEGLIVSMSFIIGTVVTIFSGTV  64

Query  522  ADWLGRRPMLILSSMFYFLS  581
             D +GRRPMLI SS+ +FLS
Sbjct  65   CDLVGRRPMLITSSIMFFLS  84



>ref|XP_008242155.1| PREDICTED: monosaccharide-sensing protein 2-like [Prunus mume]
Length=738

 Score = 98.6 bits (244),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 66/86 (77%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  503
            M GAV VA+AA +GN LQGWDN+ IAG+V YIKKE  LE+    EGL+VA SLIGAT IT
Sbjct  1    MRGAVFVAVAAAVGNLLQGWDNSVIAGSVHYIKKEFELESQPTFEGLIVATSLIGATFIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            T SG  +DWLGRR MLI+SS  +F+S
Sbjct  61   TFSGPASDWLGRRTMLIISSALFFIS  86



>ref|XP_007203009.1| hypothetical protein PRUPE_ppa017631mg [Prunus persica]
 gb|EMJ04208.1| hypothetical protein PRUPE_ppa017631mg [Prunus persica]
Length=738

 Score = 98.2 bits (243),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 66/86 (77%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  503
            M GAV VA+AA +GN LQGWDN+ IAG+V YIKKE  LE+    EGL+VA SLIGAT IT
Sbjct  1    MRGAVFVAVAAAVGNLLQGWDNSVIAGSVHYIKKEFELESQPTFEGLIVATSLIGATFIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            T SG  +DWLGRR MLI+SS  +F+S
Sbjct  61   TFSGPASDWLGRRTMLIISSALFFIS  86



>ref|XP_007158028.1| hypothetical protein PHAVU_002G118100g [Phaseolus vulgaris]
 gb|ESW30022.1| hypothetical protein PHAVU_002G118100g [Phaseolus vulgaris]
Length=720

 Score = 98.2 bits (243),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = +3

Query  342  VLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTCSGSI  521
            V+VA+AATIGN L GWD++TIA  + YIKK+ +L+  +EGL+V+MS I  T++T  SG++
Sbjct  5    VIVALAATIGNLLMGWDSSTIAAGMTYIKKDFILDATIEGLIVSMSFITGTVVTIFSGAV  64

Query  522  ADWLGRRPMLILSSMFYFLS  581
            +D +GRRPMLI SS+ +FLS
Sbjct  65   SDMVGRRPMLITSSVMFFLS  84



>ref|XP_003604104.1| Monosaccharide-sensing protein [Medicago truncatula]
 gb|AES74355.1| tonoplast monosaccharide transporter 2 [Medicago truncatula]
Length=744

 Score = 97.4 bits (241),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 68/78 (87%), Gaps = 2/78 (3%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  503
            M+GAV+VA+AA IGN LQGWDNATIAG+++YIK+E  L  E  +EGL+VAMSLIGAT++T
Sbjct  1    MSGAVIVAVAAAIGNLLQGWDNATIAGSILYIKREFQLQSEPTVEGLIVAMSLIGATVVT  60

Query  504  TCSGSIADWLGRRPMLIL  557
            TCSG+++D  GRRPMLI+
Sbjct  61   TCSGALSDLFGRRPMLII  78



>ref|XP_010097645.1| Monosaccharide-sensing protein 3 [Morus notabilis]
 gb|EXB70345.1| Monosaccharide-sensing protein 3 [Morus notabilis]
Length=737

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 67/86 (78%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  503
            M GAV VAI A IGN LQGWDN+ IAG+++YIKKE  LE    +EGL++A SLIG TLIT
Sbjct  1    MKGAVAVAIVAAIGNLLQGWDNSVIAGSLLYIKKEFNLERKPTLEGLIIATSLIGGTLIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            T SG ++D +GRRPMLI+SS+ +F S
Sbjct  61   TVSGPVSDRVGRRPMLIMSSVLFFFS  86



>gb|KEH36403.1| tonoplast monosaccharide transporter 2 [Medicago truncatula]
Length=645

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 53/78 (68%), Positives = 68/78 (87%), Gaps = 2/78 (3%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  503
            M+GAV+VA+AA IGN LQGWDNATIAG+++YIK+E  L  E  +EGL+VAMSLIGAT++T
Sbjct  1    MSGAVIVAVAAAIGNLLQGWDNATIAGSILYIKREFQLQSEPTVEGLIVAMSLIGATVVT  60

Query  504  TCSGSIADWLGRRPMLIL  557
            TCSG+++D  GRRPMLI+
Sbjct  61   TCSGALSDLFGRRPMLII  78



>gb|EMS60524.1| Monosaccharide-sensing protein 3 [Triticum urartu]
Length=407

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 70/86 (81%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  503
            M GA LVA+AA +GN LQGWDNATIAG+++YIK++  L  +  ++GLVVA SLIGATLIT
Sbjct  1    MRGAALVALAAALGNMLQGWDNATIAGSLLYIKRDFGLHGQPALQGLVVATSLIGATLIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            T SGS++D +GRRPML+ SS+ Y L+
Sbjct  61   TFSGSLSDRVGRRPMLVASSLLYTLA  86



>gb|EAY88374.1| hypothetical protein OsI_09831 [Oryza sativa Indica Group]
Length=714

 Score = 95.9 bits (237),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 56/113 (50%), Positives = 76/113 (67%), Gaps = 3/113 (3%)
 Frame = +3

Query  252  PGSP*GL-ALLFLQSSY*LELDSGLLRMNGAVLVAIAATIGNFLQGWDNATIAGAVVYIK  428
            P SP  L + +F +SS  L   +       AVL AI A+IGN LQGWDNA IAGA++YIK
Sbjct  20   PSSPISLGSSVFSESSLELSTTTADGSTANAVLAAIVASIGNLLQGWDNAAIAGAIMYIK  79

Query  429  KELVLET--YMEGLVVAMSLIGATLITTCSGSIADWLGRRPMLILSSMFYFLS  581
             E  L+    MEGL++AMSLIGAT+IT  SG I + +G+RP+L ++++ Y +S
Sbjct  80   NEFNLQNDPMMEGLILAMSLIGATIITALSGMITNSIGKRPLLSVAAILYSIS  132



>gb|AAN17390.1| Putative sugar transporter protein [Oryza sativa Japonica Group]
 gb|ABF93784.1| major facilitator superfamily protein, expressed [Oryza sativa 
Japonica Group]
Length=714

 Score = 95.9 bits (237),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 56/113 (50%), Positives = 76/113 (67%), Gaps = 3/113 (3%)
 Frame = +3

Query  252  PGSP*GL-ALLFLQSSY*LELDSGLLRMNGAVLVAIAATIGNFLQGWDNATIAGAVVYIK  428
            P SP  L + +F +SS  L   +       AVL AI A+IGN LQGWDNA IAGA++YIK
Sbjct  20   PSSPISLGSSVFSESSLELSTTTADGSTANAVLAAIVASIGNLLQGWDNAAIAGAIMYIK  79

Query  429  KELVLET--YMEGLVVAMSLIGATLITTCSGSIADWLGRRPMLILSSMFYFLS  581
             E  L+    MEGL++AMSLIGAT+IT  SG I + +G+RP+L ++++ Y +S
Sbjct  80   NEFNLQNDPMMEGLILAMSLIGATIITALSGMITNSIGKRPLLSVAAILYSIS  132



>dbj|BAA85398.1| unnamed protein product [Oryza sativa Japonica Group]
Length=723

 Score = 95.9 bits (237),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 56/113 (50%), Positives = 76/113 (67%), Gaps = 3/113 (3%)
 Frame = +3

Query  252  PGSP*GL-ALLFLQSSY*LELDSGLLRMNGAVLVAIAATIGNFLQGWDNATIAGAVVYIK  428
            P SP  L + +F +SS  L   +       AVL AI A+IGN LQGWDNA IAGA++YIK
Sbjct  29   PSSPISLGSSVFSESSLELSTTTADGSTANAVLAAIVASIGNLLQGWDNAAIAGAIMYIK  88

Query  429  KELVLET--YMEGLVVAMSLIGATLITTCSGSIADWLGRRPMLILSSMFYFLS  581
             E  L+    MEGL++AMSLIGAT+IT  SG I + +G+RP+L ++++ Y +S
Sbjct  89   NEFNLQNDPMMEGLILAMSLIGATIITALSGMITNSIGKRPLLSVAAILYSIS  141



>ref|XP_003548779.1| PREDICTED: monosaccharide-sensing protein 3-like [Glycine max]
 gb|KHN37950.1| Monosaccharide-sensing protein 3 [Glycine soja]
Length=685

 Score = 95.1 bits (235),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 65/86 (76%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  503
            M   V+VAIAAT+GN L GWD++TIAG + YIK+E  LET   +EGL+V+ S +  T++T
Sbjct  1    MREVVIVAIAATLGNLLVGWDSSTIAGGLSYIKQEFHLETDPTLEGLIVSTSFLTGTVVT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
              SG+++D LGRRPMLI SS+ +FLS
Sbjct  61   IFSGTVSDMLGRRPMLITSSIMFFLS  86



>ref|XP_008786687.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
 ref|XP_008786688.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
 ref|XP_008786689.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
 ref|XP_008786690.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
Length=744

 Score = 94.7 bits (234),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 73/86 (85%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLE--TYMEGLVVAMSLIGATLIT  503
            M GAVLVAIAA IG+ LQGWD+AT+AGAV+YI +E  LE    +EGL+VAMSLIGAT+IT
Sbjct  1    MQGAVLVAIAAAIGSLLQGWDSATMAGAVLYINREFKLEADPTIEGLIVAMSLIGATIIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            + SG+++DW+GRRP+LI++++  FLS
Sbjct  61   SFSGALSDWVGRRPVLIVAAVLTFLS  86



>dbj|BAK02857.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=729

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 69/86 (80%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  503
            M GA LVA+AA +GN LQGWDNATIAG+++YIK++  L+    ++GLVVA SLIGATLIT
Sbjct  1    MRGAALVALAAALGNMLQGWDNATIAGSLLYIKRDFGLDAQPALQGLVVATSLIGATLIT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
            T SG ++D +GRRPML+ SS+ Y L+
Sbjct  61   TFSGPLSDHVGRRPMLVASSLLYALA  86



>ref|XP_004509464.1| PREDICTED: monosaccharide-sensing protein 2-like [Cicer arietinum]
Length=743

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 63/86 (73%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  503
            M   V+VA AAT+GN L GWD++TIAG + YIK+E  LET   +EGL+V+MS +  T +T
Sbjct  1    MREVVMVATAATLGNLLVGWDSSTIAGGMSYIKEEFKLETNPSLEGLIVSMSFLTGTFVT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
              SG+++D LGRRPMLI SS+ +F S
Sbjct  61   IFSGTVSDILGRRPMLITSSIMFFFS  86



>ref|XP_007156262.1| hypothetical protein PHAVU_003G271500g [Phaseolus vulgaris]
 gb|ESW28256.1| hypothetical protein PHAVU_003G271500g [Phaseolus vulgaris]
Length=687

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 64/86 (74%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  503
            M   V+VAIAAT+GN L GWD++TIAG + YIKKE  LET   +EGL+++ S +  T++T
Sbjct  1    MREVVIVAIAATVGNVLVGWDSSTIAGGMSYIKKEFKLETDPTLEGLIMSTSFLTGTVVT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
              SG++ D LGRRPMLI++S  +FLS
Sbjct  61   IFSGTVCDMLGRRPMLIVASTMFFLS  86



>ref|XP_003629095.1| Monosaccharide-sensing protein [Medicago truncatula]
 gb|AET03571.1| tonoplast monosaccharide transporter 2 [Medicago truncatula]
Length=716

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 63/86 (73%), Gaps = 2/86 (2%)
 Frame = +3

Query  330  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  503
            M   V++A AAT+GN L GWD++TIAG + YIK+E  LET   +EGL+V+MS +  T +T
Sbjct  1    MREIVMIATAATLGNLLVGWDSSTIAGGMRYIKQEFNLETDPTLEGLIVSMSFLTGTFVT  60

Query  504  TCSGSIADWLGRRPMLILSSMFYFLS  581
              SG+++D  GRRPMLI SS+ +FLS
Sbjct  61   IFSGTVSDMFGRRPMLITSSIMFFLS  86



>ref|XP_004512287.1| PREDICTED: monosaccharide-sensing protein 2-like [Cicer arietinum]
Length=720

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/82 (55%), Positives = 64/82 (78%), Gaps = 2/82 (2%)
 Frame = +3

Query  342  VLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLE--TYMEGLVVAMSLIGATLITTCSG  515
            V++A+AATIGN L GWD++TIAG + YIK+E  LE    +EGL+V+MS I  T++T  SG
Sbjct  5    VIIALAATIGNLLIGWDSSTIAGGMTYIKQEFDLEKDPTLEGLIVSMSFITGTVVTIFSG  64

Query  516  SIADWLGRRPMLILSSMFYFLS  581
            +++D +GRRP+LI SS+ YF+S
Sbjct  65   TVSDLVGRRPLLITSSVMYFIS  86



>ref|XP_003573173.1| PREDICTED: monosaccharide-sensing protein 2-like [Brachypodium 
distachyon]
Length=709

 Score = 92.8 bits (229),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 59/72 (82%), Gaps = 2/72 (3%)
 Frame = +3

Query  372  NFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLITTCSGSIADWLGRRP  545
            N LQGWDNATIAG+++YIK+E  LE +  +EGLVVA SLIGAT++TT SG ++D +GRRP
Sbjct  16   NMLQGWDNATIAGSLLYIKREFRLEGHPALEGLVVATSLIGATVVTTFSGPLSDSVGRRP  75

Query  546  MLILSSMFYFLS  581
            ML+ SS+ Y L+
Sbjct  76   MLVASSLLYALA  87



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 723952452455