BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002F06

Length=586
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP10212.1|  unnamed protein product                                151   5e-40   Coffea canephora [robusta coffee]
ref|XP_004242572.1|  PREDICTED: protein RTF2 homolog                    147   1e-38   Solanum lycopersicum
ref|XP_009605181.1|  PREDICTED: protein RTF2 homolog                    145   1e-37   Nicotiana tomentosiformis
ref|XP_011084005.1|  PREDICTED: protein RTF2 homolog                    142   5e-37   Sesamum indicum [beniseed]
gb|EYU25350.1|  hypothetical protein MIMGU_mgv1a009079mg                140   2e-36   Erythranthe guttata [common monkey flower]
ref|XP_009775838.1|  PREDICTED: protein RTF2 homolog                    141   2e-36   Nicotiana sylvestris
ref|XP_007204400.1|  hypothetical protein PRUPE_ppa007127mg             138   4e-35   Prunus persica
ref|XP_009358470.1|  PREDICTED: protein RTF2 homolog                    137   6e-35   Pyrus x bretschneideri [bai li]
ref|XP_008242961.1|  PREDICTED: protein RTF2 homolog                    137   6e-35   Prunus mume [ume]
ref|XP_008354336.1|  PREDICTED: LOW QUALITY PROTEIN: protein RTF2...    132   5e-33   
ref|XP_008384467.1|  PREDICTED: protein RTF2 homolog                    132   5e-33   
ref|XP_008352093.1|  PREDICTED: LOW QUALITY PROTEIN: protein RTF2...    130   2e-32   
ref|XP_008336905.1|  PREDICTED: protein RTF2 homolog                    130   2e-32   
ref|XP_010048830.1|  PREDICTED: protein RTF2 homolog                    123   9e-30   
gb|AFK37128.1|  unknown                                                 122   2e-29   Medicago truncatula
ref|XP_004146693.1|  PREDICTED: UPF0549 protein C20orf43 homolog        121   3e-29   
gb|KGN65240.1|  hypothetical protein Csa_1G269330                       121   3e-29   Cucumis sativus [cucumbers]
gb|AES92550.2|  replication termination factor 2                        122   4e-29   Medicago truncatula
ref|XP_003610353.1|  hypothetical protein MTR_4g131190                  122   4e-29   
ref|XP_004507721.1|  PREDICTED: protein RTF2 homolog                    120   6e-29   Cicer arietinum [garbanzo]
ref|XP_008444038.1|  PREDICTED: protein RTF2 homolog                    115   4e-27   Cucumis melo [Oriental melon]
ref|XP_010092212.1|  hypothetical protein L484_003302                   115   6e-27   Morus notabilis
ref|XP_004287118.1|  PREDICTED: protein RTF2 homolog                    112   6e-26   Fragaria vesca subsp. vesca
ref|XP_002279315.2|  PREDICTED: protein RTF2 homolog                    110   5e-25   Vitis vinifera
emb|CBI36519.3|  unnamed protein product                                108   1e-24   Vitis vinifera
ref|XP_007154899.1|  hypothetical protein PHAVU_003G157300g             108   2e-24   Phaseolus vulgaris [French bean]
gb|EPS61282.1|  hypothetical protein M569_13513                         107   3e-24   Genlisea aurea
ref|XP_003519140.1|  PREDICTED: protein RTF2 homolog isoform X1         107   5e-24   Glycine max [soybeans]
ref|XP_006600555.1|  PREDICTED: protein RTF2 homolog                    105   2e-23   Glycine max [soybeans]
ref|XP_010275754.1|  PREDICTED: protein RTF2 homolog                    103   7e-23   Nelumbo nucifera [Indian lotus]
ref|XP_011018002.1|  PREDICTED: protein RTF2 homolog                    102   1e-22   Populus euphratica
ref|XP_002324550.2|  hypothetical protein POPTR_0018s11830g             102   2e-22   
ref|XP_009366284.1|  PREDICTED: protein RTF2 homolog                    102   2e-22   Pyrus x bretschneideri [bai li]
ref|XP_006372125.1|  hypothetical protein POPTR_0018s11830g             102   2e-22   
ref|XP_008794332.1|  PREDICTED: protein RTF2 homolog                    101   6e-22   Phoenix dactylifera
ref|XP_002523496.1|  conserved hypothetical protein                     100   9e-22   Ricinus communis
ref|XP_006857183.1|  hypothetical protein AMTR_s00065p00181400          100   9e-22   Amborella trichopoda
ref|XP_002309334.2|  hypothetical protein POPTR_0006s20100g             100   1e-21   
ref|XP_010929138.1|  PREDICTED: protein RTF2 homolog                  99.8    2e-21   Elaeis guineensis
gb|KDP38661.1|  hypothetical protein JCGZ_04014                         100   2e-21   Jatropha curcas
ref|XP_011033455.1|  PREDICTED: protein RTF2 homolog                  99.4    3e-21   Populus euphratica
ref|XP_010942116.1|  PREDICTED: protein RTF2 homolog                  99.0    3e-21   Elaeis guineensis
ref|XP_009380799.1|  PREDICTED: protein RTF2 homolog                  99.0    3e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008799632.1|  PREDICTED: protein RTF2 homolog                  98.2    5e-21   Phoenix dactylifera
gb|KDO59414.1|  hypothetical protein CISIN_1g017480mg                 98.6    6e-21   Citrus sinensis [apfelsine]
ref|XP_006453662.1|  hypothetical protein CICLE_v10008691mg           98.2    6e-21   Citrus clementina [clementine]
ref|XP_007011964.1|  Uncharacterized protein TCM_037082               97.8    8e-21   
ref|XP_009605182.1|  PREDICTED: protein RTF2 homolog                  96.7    8e-21   Nicotiana tomentosiformis
ref|XP_009387545.1|  PREDICTED: LOW QUALITY PROTEIN: protein RTF2...  97.1    1e-20   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB82856.1|  hypothetical protein B456_013G217000                  95.1    7e-20   Gossypium raimondii
ref|NP_200610.1|  uncharacterized protein                             95.1    8e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002864545.1|  hypothetical protein ARALYDRAFT_495908           92.8    5e-19   Arabidopsis lyrata subsp. lyrata
ref|XP_010687725.1|  PREDICTED: protein RTF2 homolog                  92.4    7e-19   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010443515.1|  PREDICTED: protein RTF2 homolog                  89.4    1e-17   Camelina sativa [gold-of-pleasure]
gb|KFK27335.1|  hypothetical protein AALP_AA8G369800                  88.6    1e-17   Arabis alpina [alpine rockcress]
ref|XP_009120318.1|  PREDICTED: protein RTF2 homolog                  88.2    2e-17   Brassica rapa
ref|XP_010545464.1|  PREDICTED: protein RTF2 homolog                  87.8    2e-17   Tarenaya hassleriana [spider flower]
emb|CDY62263.1|  BnaCnng39770D                                        87.8    2e-17   Brassica napus [oilseed rape]
ref|XP_010483365.1|  PREDICTED: protein RTF2 homolog                  88.6    2e-17   Camelina sativa [gold-of-pleasure]
ref|XP_006281450.1|  hypothetical protein CARUB_v10027528mg           87.4    4e-17   Capsella rubella
emb|CDY55015.1|  BnaA10g29400D                                        87.0    4e-17   Brassica napus [oilseed rape]
ref|XP_010453088.1|  PREDICTED: protein RTF2 homolog                  86.7    1e-16   Camelina sativa [gold-of-pleasure]
emb|CDY02786.1|  BnaC02g11030D                                        85.9    1e-16   
emb|CDY32732.1|  BnaA02g07940D                                        85.1    2e-16   Brassica napus [oilseed rape]
dbj|BAB10993.1|  unnamed protein product                              84.0    4e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006401138.1|  hypothetical protein EUTSA_v10013961mg           84.3    4e-16   Eutrema salsugineum [saltwater cress]
ref|XP_010545460.1|  PREDICTED: uncharacterized protein LOC104817826  86.7    5e-16   Tarenaya hassleriana [spider flower]
ref|XP_009126796.1|  PREDICTED: protein RTF2 homolog                  84.0    6e-16   Brassica rapa
gb|KJB38813.1|  hypothetical protein B456_006G273400                  81.3    4e-15   Gossypium raimondii
ref|XP_002437966.1|  hypothetical protein SORBIDRAFT_10g005640        78.2    8e-14   Sorghum bicolor [broomcorn]
dbj|BAJ91885.1|  predicted protein                                    77.4    1e-13   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KIZ06037.1|  putative UPF0549 protein C20orf43 like protein        76.3    6e-13   Monoraphidium neglectum
gb|ADE77365.1|  unknown                                               74.7    2e-12   Picea sitchensis
ref|XP_001759344.1|  predicted protein                                73.2    2e-12   
ref|XP_002986106.1|  hypothetical protein SELMODRAFT_46144            72.0    7e-12   
ref|XP_002989658.1|  hypothetical protein SELMODRAFT_46143            71.6    1e-11   
ref|XP_008659193.1|  PREDICTED: protein RTF2 homolog                  70.5    4e-11   Zea mays [maize]
ref|XP_003564198.1|  PREDICTED: protein RTF2 homolog                  69.3    9e-11   Brachypodium distachyon [annual false brome]
ref|XP_006846448.1|  hypothetical protein AMTR_s00018p00078470        63.9    6e-10   
ref|NP_001056989.1|  Os06g0183900                                     65.9    1e-09   
ref|XP_004966674.1|  PREDICTED: protein RTF2 homolog                  66.2    2e-09   
ref|XP_002953114.1|  hypothetical protein VOLCADRAFT_63267            61.6    3e-08   Volvox carteri f. nagariensis
ref|XP_005646218.1|  DUF602-domain-containing protein                 60.5    1e-07   Coccomyxa subellipsoidea C-169
ref|XP_001695672.1|  predicted protein                                59.3    3e-07   Chlamydomonas reinhardtii
ref|XP_005851016.1|  hypothetical protein CHLNCDRAFT_140862           54.3    1e-05   Chlorella variabilis
gb|KJB07591.1|  hypothetical protein B456_001G031600                  52.4    3e-05   Gossypium raimondii
ref|XP_011402109.1|  RTF2-like protein                                50.1    3e-04   Auxenochlorella protothecoides
gb|EMT23675.1|  hypothetical protein F775_09679                       49.7    4e-04   



>emb|CDP10212.1| unnamed protein product [Coffea canephora]
Length=381

 Score =   151 bits (381),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 117/139 (84%), Gaps = 1/139 (1%)
 Frame = +1

Query  169  SKSQNFQIFIQSPDLKIPTRAISLESPNPGFTIKDLKAFIFSKTLTLIQHSGYFTLDGKL  348
            +K+Q FQ+FIQSP+L+IPT+A+++E+PNP FT++DLK+ +F+K    +  S YFTL+GK 
Sbjct  3    TKTQKFQVFIQSPELQIPTQALNVENPNPNFTLQDLKSSLFAKAHQNLS-SLYFTLNGKP  61

Query  349  IPDSTPVNSSLIAPlstltlrlrflggggdggatgAESRDCYLKMYAEKKPDKIDPNEVR  528
            + DST + +S IAPLSTLTLR R LGGGGDGGATGAESRDCYL MYA KKPDK+DPNE R
Sbjct  62   LSDSTKLPNSQIAPLSTLTLRCRLLGGGGDGGATGAESRDCYLNMYATKKPDKVDPNETR  121

Query  529  LSKWLNCTLSNEPLKHPVV  585
            LSKWLNC +SNEPLK PVV
Sbjct  122  LSKWLNCAISNEPLKRPVV  140



>ref|XP_004242572.1| PREDICTED: protein RTF2 homolog [Solanum lycopersicum]
Length=393

 Score =   147 bits (372),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 91/139 (65%), Positives = 109/139 (78%), Gaps = 3/139 (2%)
 Frame = +1

Query  178  QNFQIFIQSPDLKIPTRAISLESPNPGFTIKDLKAFIFSKT---LTLIQHSGYFTLDGKL  348
            +NF +FIQSP+L+IPT  +++E+PNP FT++DLK+ +  KT   L  I+ S Y T DG+ 
Sbjct  6    RNFPVFIQSPELQIPTHVLNIENPNPNFTLQDLKSCLLEKTQKSLAAIKDSVYLTFDGRP  65

Query  349  IPDSTPVNSSLIAPlstltlrlrflggggdggatgAESRDCYLKMYAEKKPDKIDPNEVR  528
            I DST +  S I+P STL LR R  GGGGDGGATGAESRDCYLKMYA KKPDKIDPNE+R
Sbjct  66   IKDSTLLYGSGISPFSTLVLRFRLRGGGGDGGATGAESRDCYLKMYAVKKPDKIDPNEIR  125

Query  529  LSKWLNCTLSNEPLKHPVV  585
            LS+WLNC LSNE LKHPVV
Sbjct  126  LSRWLNCALSNESLKHPVV  144



>ref|XP_009605181.1| PREDICTED: protein RTF2 homolog [Nicotiana tomentosiformis]
Length=394

 Score =   145 bits (365),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 92/140 (66%), Positives = 111/140 (79%), Gaps = 4/140 (3%)
 Frame = +1

Query  178  QNFQIFIQSPDLKIPTRAISLESPNPGFTIKDLKAFIF---SKTLTLIQ-HSGYFTLDGK  345
            +NF IFIQSP+L+IP   ++LE+PNP FT++ LK+ +     K+L  I+ +S YFT +G+
Sbjct  6    RNFPIFIQSPELQIPNHVLNLENPNPNFTLQSLKSNLMDKIQKSLGSIKDNSVYFTFNGR  65

Query  346  LIPDSTPVNSSLIAPlstltlrlrflggggdggatgAESRDCYLKMYAEKKPDKIDPNEV  525
             I DST ++ S I+P STL LRLR  GGGGDGGATGAESRDCYLKMYA KKPDKIDPNE+
Sbjct  66   PIKDSTLLHGSGISPFSTLVLRLRLRGGGGDGGATGAESRDCYLKMYATKKPDKIDPNEI  125

Query  526  RLSKWLNCTLSNEPLKHPVV  585
            RLSKWLNC LSNEPLKHP V
Sbjct  126  RLSKWLNCALSNEPLKHPAV  145



>ref|XP_011084005.1| PREDICTED: protein RTF2 homolog [Sesamum indicum]
Length=356

 Score =   142 bits (359),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 116/138 (84%), Gaps = 2/138 (1%)
 Frame = +1

Query  175  SQNFQIFIQSPDLKIPTRAISLESPNPGFTIKDLKAFIFSKTLTLIQHSGYFTLDGKLIP  354
            S+NFQIF+QSPDL+IPTRA+  ++P+P  T+  LK+ IF    ++ + S +FTL+GK + 
Sbjct  5    SRNFQIFVQSPDLRIPTRALIFQNPSPDLTLHHLKSSIFP-IASVPRGSLFFTLNGKPLA  63

Query  355  DSTPV-NSSLIAPlstltlrlrflggggdggatgAESRDCYLKMYAEKKPDKIDPNEVRL  531
            DST + ++SLIAPLSTLTL LRF GGGGDGGATGAESRDCYL MYA KKPDK+DPNE+RL
Sbjct  64   DSTRLLHNSLIAPLSTLTLHLRFHGGGGDGGATGAESRDCYLNMYAVKKPDKVDPNEMRL  123

Query  532  SKWLNCTLSNEPLKHPVV  585
            SKWLNC+LSNEPL+HPVV
Sbjct  124  SKWLNCSLSNEPLRHPVV  141



>gb|EYU25350.1| hypothetical protein MIMGU_mgv1a009079mg [Erythranthe guttata]
Length=354

 Score =   140 bits (354),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 93/138 (67%), Positives = 113/138 (82%), Gaps = 2/138 (1%)
 Frame = +1

Query  175  SQNFQIFIQSPDLKIPTRAISLESPNPGFTIKDLKAFIFSKTLTLIQHSGYFTLDGKLIP  354
            SQNFQIF++ P+ +IPTRA+  ++PNP  T+  LK+ +F  T ++   S +FTL+GK +P
Sbjct  5    SQNFQIFVRFPEFRIPTRALIFQNPNPNLTLHHLKSSLFP-TNSIPHSSLFFTLNGKPLP  63

Query  355  DSTPVNS-SLIAPlstltlrlrflggggdggatgAESRDCYLKMYAEKKPDKIDPNEVRL  531
            DSTP++  S IAPLSTLTL LRF GGGGDGGATGAESRDCYL MYA KKPDK DPNE+RL
Sbjct  64   DSTPLSQKSPIAPLSTLTLHLRFNGGGGDGGATGAESRDCYLNMYAIKKPDKADPNEMRL  123

Query  532  SKWLNCTLSNEPLKHPVV  585
            SKWLNC+LSNEPL+HPVV
Sbjct  124  SKWLNCSLSNEPLRHPVV  141



>ref|XP_009775838.1| PREDICTED: protein RTF2 homolog [Nicotiana sylvestris]
Length=394

 Score =   141 bits (356),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 91/140 (65%), Positives = 110/140 (79%), Gaps = 4/140 (3%)
 Frame = +1

Query  178  QNFQIFIQSPDLKIPTRAISLESPNPGFTIKDLKAFIFSK---TLTLIQHS-GYFTLDGK  345
            +NF IFIQSP+L+I    ++LE+PNP FT++DLK+ +  K   +L  I+ +  YFT +G+
Sbjct  6    RNFSIFIQSPELQISNYVLNLENPNPNFTLQDLKSNLMDKIHKSLGSIKDNFVYFTFNGR  65

Query  346  LIPDSTPVNSSLIAPlstltlrlrflggggdggatgAESRDCYLKMYAEKKPDKIDPNEV  525
             I DST ++ S I+P STL LRLR  GGGGDGGATGAESRDCYLKMYA KKPDKIDPNE+
Sbjct  66   PIKDSTLLHGSGISPFSTLVLRLRLRGGGGDGGATGAESRDCYLKMYATKKPDKIDPNEI  125

Query  526  RLSKWLNCTLSNEPLKHPVV  585
            RLSKWLNC LSNE LKHPVV
Sbjct  126  RLSKWLNCALSNESLKHPVV  145



>ref|XP_007204400.1| hypothetical protein PRUPE_ppa007127mg [Prunus persica]
 gb|EMJ05599.1| hypothetical protein PRUPE_ppa007127mg [Prunus persica]
Length=381

 Score =   138 bits (347),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 108/138 (78%), Gaps = 5/138 (4%)
 Frame = +1

Query  172  KSQNFQIFIQSPDLKIPTRAISLESPNPGFTIKDLKAFIFSKTLTLIQHSGYFTLDGKLI  351
            K  NFQIF+QSPDL+IPT+ I+L +P    T++ LK  IFS TL  +    YFTL+GK +
Sbjct  4    KLHNFQIFLQSPDLQIPTQTITL-APTQTPTLRHLKLSIFSHTLPSL----YFTLNGKPL  58

Query  352  PDSTPVNSSLIAPlstltlrlrflggggdggatgAESRDCYLKMYAEKKPDKIDPNEVRL  531
             DSTP+  S I PLSTL LR+R  GGGGDGGATGAESRDCYLKMYAEKKPDK+DPNE RL
Sbjct  59   NDSTPLLDSQITPLSTLVLRIRACGGGGDGGATGAESRDCYLKMYAEKKPDKVDPNEQRL  118

Query  532  SKWLNCTLSNEPLKHPVV  585
            SKWLNC+LSNEPLK P V
Sbjct  119  SKWLNCSLSNEPLKEPCV  136



>ref|XP_009358470.1| PREDICTED: protein RTF2 homolog [Pyrus x bretschneideri]
Length=381

 Score =   137 bits (345),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 95/138 (69%), Positives = 109/138 (79%), Gaps = 5/138 (4%)
 Frame = +1

Query  172  KSQNFQIFIQSPDLKIPTRAISLESPNPGFTIKDLKAFIFSKTLTLIQHSGYFTLDGKLI  351
            K QNFQIF+QSPDL+IPT+ ++L SP    T++ LK  IFS+ L  +    YFTL+GK +
Sbjct  4    KLQNFQIFLQSPDLQIPTQTLTL-SPIQTPTLRHLKLSIFSRVLPSL----YFTLNGKPL  58

Query  352  PDSTPVNSSLIAPlstltlrlrflggggdggatgAESRDCYLKMYAEKKPDKIDPNEVRL  531
             DSTP+  S I PLSTL LR+R LGGGGDGGATGAESRDCYLKMYAEKKPDK+DPNE RL
Sbjct  59   NDSTPLFDSQITPLSTLILRIRALGGGGDGGATGAESRDCYLKMYAEKKPDKVDPNEQRL  118

Query  532  SKWLNCTLSNEPLKHPVV  585
            SKWLNC LSNEPLK P V
Sbjct  119  SKWLNCALSNEPLKEPCV  136



>ref|XP_008242961.1| PREDICTED: protein RTF2 homolog [Prunus mume]
Length=381

 Score =   137 bits (345),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 108/138 (78%), Gaps = 5/138 (4%)
 Frame = +1

Query  172  KSQNFQIFIQSPDLKIPTRAISLESPNPGFTIKDLKAFIFSKTLTLIQHSGYFTLDGKLI  351
            K  NFQIF+QSPDL+IPT+ I+L +P    T++ LK  IFS TL  +    YFTL+GK +
Sbjct  4    KLHNFQIFLQSPDLQIPTQTITL-APTQTPTLRHLKLSIFSHTLPSL----YFTLNGKPL  58

Query  352  PDSTPVNSSLIAPlstltlrlrflggggdggatgAESRDCYLKMYAEKKPDKIDPNEVRL  531
             DSTP+  S I PLSTL LR+R  GGGGDGGATGAESRDCYLKMYAEKKPDK+DPNE RL
Sbjct  59   NDSTPLLDSQITPLSTLFLRIRACGGGGDGGATGAESRDCYLKMYAEKKPDKVDPNEQRL  118

Query  532  SKWLNCTLSNEPLKHPVV  585
            SKWLNC+LSNEPLK P V
Sbjct  119  SKWLNCSLSNEPLKEPCV  136



>ref|XP_008354336.1| PREDICTED: LOW QUALITY PROTEIN: protein RTF2 homolog [Malus domestica]
Length=381

 Score =   132 bits (332),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 93/138 (67%), Positives = 106/138 (77%), Gaps = 5/138 (4%)
 Frame = +1

Query  172  KSQNFQIFIQSPDLKIPTRAISLESPNPGFTIKDLKAFIFSKTLTLIQHSGYFTLDGKLI  351
            K QNFQIF+QSPDL+IPT+ ++L SP    T++ LK   FS  L  +    YFTL+GK +
Sbjct  4    KFQNFQIFLQSPDLQIPTQTLTL-SPIQTPTLRHLKLSXFSHALPSL----YFTLNGKPL  58

Query  352  PDSTPVNSSLIAPlstltlrlrflggggdggatgAESRDCYLKMYAEKKPDKIDPNEVRL  531
             DS P+  S I PLSTL LR+R LGGGGDGGATGAESRDCYLKMYAEKKPDK+DPNE RL
Sbjct  59   NDSXPLLDSQITPLSTLILRIRALGGGGDGGATGAESRDCYLKMYAEKKPDKVDPNEQRL  118

Query  532  SKWLNCTLSNEPLKHPVV  585
            SKWLNC LSNEPLK P V
Sbjct  119  SKWLNCALSNEPLKEPCV  136



>ref|XP_008384467.1| PREDICTED: protein RTF2 homolog [Malus domestica]
Length=381

 Score =   132 bits (332),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 93/138 (67%), Positives = 106/138 (77%), Gaps = 5/138 (4%)
 Frame = +1

Query  172  KSQNFQIFIQSPDLKIPTRAISLESPNPGFTIKDLKAFIFSKTLTLIQHSGYFTLDGKLI  351
            K QNFQIF+QSPDL+IPT+ ++L SP    T++ LK   FS  L  +    YFTL+GK +
Sbjct  4    KFQNFQIFLQSPDLQIPTQTLTL-SPIQTPTLRHLKLSXFSHALPSL----YFTLNGKPL  58

Query  352  PDSTPVNSSLIAPlstltlrlrflggggdggatgAESRDCYLKMYAEKKPDKIDPNEVRL  531
             DS P+  S I PLSTL LR+R LGGGGDGGATGAESRDCYLKMYAEKKPDK+DPNE RL
Sbjct  59   NDSXPLLDSQITPLSTLILRIRALGGGGDGGATGAESRDCYLKMYAEKKPDKVDPNEQRL  118

Query  532  SKWLNCTLSNEPLKHPVV  585
            SKWLNC LSNEPLK P V
Sbjct  119  SKWLNCALSNEPLKEPCV  136



>ref|XP_008352093.1| PREDICTED: LOW QUALITY PROTEIN: protein RTF2 homolog [Malus domestica]
Length=380

 Score =   130 bits (327),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 93/138 (67%), Positives = 106/138 (77%), Gaps = 5/138 (4%)
 Frame = +1

Query  172  KSQNFQIFIQSPDLKIPTRAISLESPNPGFTIKDLKAFIFSKTLTLIQHSGYFTLDGKLI  351
            K QNFQIF+QSPDL+IP + ++L SP    T++ LK  +FS  L     S YFTL+GK +
Sbjct  4    KLQNFQIFLQSPDLQIPIQTLTL-SPIQTPTLRHLKLSVFSHVLP----SLYFTLNGKPL  58

Query  352  PDSTPVNSSLIAPlstltlrlrflggggdggatgAESRDCYLKMYAEKKPDKIDPNEVRL  531
             DST +  S I PLSTL LR+R LGGGGDGGATGAESRDCYLKMYAEKKPDK+DPNE RL
Sbjct  59   NDSTSLFDSQITPLSTLILRIRALGGGGDGGATGAESRDCYLKMYAEKKPDKVDPNEQRL  118

Query  532  SKWLNCTLSNEPLKHPVV  585
            SKWLNC LSNEPLK P V
Sbjct  119  SKWLNCALSNEPLKEPCV  136



>ref|XP_008336905.1| PREDICTED: protein RTF2 homolog [Malus domestica]
Length=380

 Score =   130 bits (327),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 93/138 (67%), Positives = 106/138 (77%), Gaps = 5/138 (4%)
 Frame = +1

Query  172  KSQNFQIFIQSPDLKIPTRAISLESPNPGFTIKDLKAFIFSKTLTLIQHSGYFTLDGKLI  351
            K QNFQIF+QSPDL+IP + ++L SP    T++ LK  +FS  L     S YFTL+GK +
Sbjct  4    KLQNFQIFLQSPDLQIPIQTLTL-SPIQTPTLRHLKLSVFSHVLP----SLYFTLNGKPL  58

Query  352  PDSTPVNSSLIAPlstltlrlrflggggdggatgAESRDCYLKMYAEKKPDKIDPNEVRL  531
             DST +  S I PLSTL LR+R LGGGGDGGATGAESRDCYLKMYAEKKPDK+DPNE RL
Sbjct  59   NDSTXLFDSQITPLSTLILRIRALGGGGDGGATGAESRDCYLKMYAEKKPDKVDPNEQRL  118

Query  532  SKWLNCTLSNEPLKHPVV  585
            SKWLNC LSNEPLK P V
Sbjct  119  SKWLNCALSNEPLKEPCV  136



>ref|XP_010048830.1| PREDICTED: protein RTF2 homolog [Eucalyptus grandis]
 gb|KCW81223.1| hypothetical protein EUGRSUZ_C02595 [Eucalyptus grandis]
Length=378

 Score =   123 bits (308),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 84/134 (63%), Positives = 100/134 (75%), Gaps = 3/134 (2%)
 Frame = +1

Query  184  FQIFIQSPDLKIPTRAISLESPNPGFTIKDLKAFIFSKTLTLIQHSGYFTLDGKLIPDST  363
            FQIF+QS DL+IPTR ++L SP P  T++ LK  +F    +      YFTLDGK + DST
Sbjct  9    FQIFLQSHDLRIPTRTLTL-SPAPSDTLRHLKRSLFPAADSPPDL--YFTLDGKALDDST  65

Query  364  PVNSSLIAPlstltlrlrflggggdggatgAESRDCYLKMYAEKKPDKIDPNEVRLSKWL  543
            P+  S ++PLSTL LR R  GGGGDGGATGAESRDCYL MYAEKKPDK DPNE R+SKW+
Sbjct  66   PIVGSGVSPLSTLVLRCRLRGGGGDGGATGAESRDCYLNMYAEKKPDKADPNEQRISKWV  125

Query  544  NCTLSNEPLKHPVV  585
            NC LS+EPL+ P V
Sbjct  126  NCALSSEPLREPCV  139



>gb|AFK37128.1| unknown [Medicago truncatula]
Length=361

 Score =   122 bits (305),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 80/136 (59%), Positives = 99/136 (73%), Gaps = 9/136 (7%)
 Frame = +1

Query  178  QNFQIFIQSPDLKIPTRAISLESPNPGFTIKDLKAFIFSKTLTLIQHSGYFTLDGKLIPD  357
            ++FQI +QSPDL+I  ++++ +      T+ DLK  IF  +    Q S YFTL+GK + D
Sbjct  4    KSFQILVQSPDLQIHPKSVTGDE-----TLSDLKHSIFPNS----QSSFYFTLNGKPLSD  54

Query  358  STPVNSSLIAPlstltlrlrflggggdggatgAESRDCYLKMYAEKKPDKIDPNEVRLSK  537
             T  ++S IAPLSTL L+ R  GGGGDGG+T AESRDCYLKMYAEKKPDK+DPNE RLSK
Sbjct  55   DTNFSTSRIAPLSTLVLQSRLRGGGGDGGSTCAESRDCYLKMYAEKKPDKVDPNEQRLSK  114

Query  538  WLNCTLSNEPLKHPVV  585
            W NC LSNEPL+ P V
Sbjct  115  WQNCALSNEPLREPCV  130



>ref|XP_004146693.1| PREDICTED: UPF0549 protein C20orf43 homolog [Cucumis sativus]
 ref|XP_004165942.1| PREDICTED: UPF0549 protein C20orf43 homolog [Cucumis sativus]
Length=349

 Score =   121 bits (304),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 87/137 (64%), Positives = 104/137 (76%), Gaps = 4/137 (3%)
 Frame = +1

Query  178  QNFQIFIQSPDLKIPTRAISLESPNPGFTIKDLKAFIFSKTL-TLIQHSGYFTLDGKLIP  354
              FQIF+QSPDL+I ++ ++L    P  T++DLK  + ++ L + I  S YFTL+GK + 
Sbjct  7    HRFQIFLQSPDLQIESKIVNLPQ-TPAKTLEDLKFSLLTEILASRIASSFYFTLNGKPLL  65

Query  355  DSTPVNSSLIAPlstltlrlrflggggdggatgAESRDCYLKMYAEKKPDKIDPNEVRLS  534
            DST +  SLI PLSTL LR R LGGGGDGGATGAESRDCYL MYAEKKPDK+DPNE RLS
Sbjct  66   DSTTI--SLIPPLSTLILRTRVLGGGGDGGATGAESRDCYLNMYAEKKPDKVDPNEQRLS  123

Query  535  KWLNCTLSNEPLKHPVV  585
            KWLNC LSNEPL+ P V
Sbjct  124  KWLNCALSNEPLREPCV  140



>gb|KGN65240.1| hypothetical protein Csa_1G269330 [Cucumis sativus]
Length=386

 Score =   121 bits (304),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 87/137 (64%), Positives = 104/137 (76%), Gaps = 4/137 (3%)
 Frame = +1

Query  178  QNFQIFIQSPDLKIPTRAISLESPNPGFTIKDLKAFIFSKTL-TLIQHSGYFTLDGKLIP  354
              FQIF+QSPDL+I ++ ++L    P  T++DLK  + ++ L + I  S YFTL+GK + 
Sbjct  7    HRFQIFLQSPDLQIESKIVNLPQ-TPAKTLEDLKFSLLTEILASRIASSFYFTLNGKPLL  65

Query  355  DSTPVNSSLIAPlstltlrlrflggggdggatgAESRDCYLKMYAEKKPDKIDPNEVRLS  534
            DST +  SLI PLSTL LR R LGGGGDGGATGAESRDCYL MYAEKKPDK+DPNE RLS
Sbjct  66   DSTTI--SLIPPLSTLILRTRVLGGGGDGGATGAESRDCYLNMYAEKKPDKVDPNEQRLS  123

Query  535  KWLNCTLSNEPLKHPVV  585
            KWLNC LSNEPL+ P V
Sbjct  124  KWLNCALSNEPLREPCV  140



>gb|AES92550.2| replication termination factor 2 [Medicago truncatula]
Length=452

 Score =   122 bits (305),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 80/136 (59%), Positives = 99/136 (73%), Gaps = 9/136 (7%)
 Frame = +1

Query  178  QNFQIFIQSPDLKIPTRAISLESPNPGFTIKDLKAFIFSKTLTLIQHSGYFTLDGKLIPD  357
            ++FQI +QSPDL+I  ++++ +      T+ DLK  IF  +    Q S YFTL+GK + D
Sbjct  4    KSFQILVQSPDLQIHPKSVTGDE-----TLSDLKHSIFPNS----QSSFYFTLNGKPLSD  54

Query  358  STPVNSSLIAPlstltlrlrflggggdggatgAESRDCYLKMYAEKKPDKIDPNEVRLSK  537
             T  ++S IAPLSTL L+ R  GGGGDGG+T AESRDCYLKMYAEKKPDK+DPNE RLSK
Sbjct  55   DTNFSTSRIAPLSTLVLQSRLRGGGGDGGSTCAESRDCYLKMYAEKKPDKVDPNEQRLSK  114

Query  538  WLNCTLSNEPLKHPVV  585
            W NC LSNEPL+ P V
Sbjct  115  WQNCALSNEPLREPCV  130



>ref|XP_003610353.1| hypothetical protein MTR_4g131190 [Medicago truncatula]
Length=459

 Score =   122 bits (305),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 80/136 (59%), Positives = 99/136 (73%), Gaps = 9/136 (7%)
 Frame = +1

Query  178  QNFQIFIQSPDLKIPTRAISLESPNPGFTIKDLKAFIFSKTLTLIQHSGYFTLDGKLIPD  357
            ++FQI +QSPDL+I  ++++ +      T+ DLK  IF  +    Q S YFTL+GK + D
Sbjct  4    KSFQILVQSPDLQIHPKSVTGDE-----TLSDLKHSIFPNS----QSSFYFTLNGKPLSD  54

Query  358  STPVNSSLIAPlstltlrlrflggggdggatgAESRDCYLKMYAEKKPDKIDPNEVRLSK  537
             T  ++S IAPLSTL L+ R  GGGGDGG+T AESRDCYLKMYAEKKPDK+DPNE RLSK
Sbjct  55   DTNFSTSRIAPLSTLVLQSRLRGGGGDGGSTCAESRDCYLKMYAEKKPDKVDPNEQRLSK  114

Query  538  WLNCTLSNEPLKHPVV  585
            W NC LSNEPL+ P V
Sbjct  115  WQNCALSNEPLREPCV  130



>ref|XP_004507721.1| PREDICTED: protein RTF2 homolog [Cicer arietinum]
Length=364

 Score =   120 bits (302),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 102/136 (75%), Gaps = 5/136 (4%)
 Frame = +1

Query  178  QNFQIFIQSPDLKIPTRAISLESPNPGFTIKDLKAFIFSKTLTLIQHSGYFTLDGKLIPD  357
            ++FQ+ +QSPD ++  ++++ +      T+ DLK  +F  +  L+  S YFTL+GK +PD
Sbjct  4    KSFQVLVQSPDQQVYPKSVTGDQ-----TLSDLKFSLFPNSQHLLPSSFYFTLNGKPLPD  58

Query  358  STPVNSSLIAPlstltlrlrflggggdggatgAESRDCYLKMYAEKKPDKIDPNEVRLSK  537
            +T  ++S IAPLSTL L+ R  GGGGDGGATGAESRDCYLKMYAEKKPDK+DPNE RLSK
Sbjct  59   NTVFSTSRIAPLSTLVLQSRLRGGGGDGGATGAESRDCYLKMYAEKKPDKVDPNEQRLSK  118

Query  538  WLNCTLSNEPLKHPVV  585
            W NC LSNEPL+ P V
Sbjct  119  WQNCALSNEPLREPCV  134



>ref|XP_008444038.1| PREDICTED: protein RTF2 homolog [Cucumis melo]
Length=386

 Score =   115 bits (289),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 85/137 (62%), Positives = 101/137 (74%), Gaps = 4/137 (3%)
 Frame = +1

Query  178  QNFQIFIQSPDLKIPTRAISLESPNPGFTIKDLKAFIFSKTL-TLIQHSGYFTLDGKLIP  354
               QIF+ SPDL+I ++ + L   +   T++DLK  + S+TL + +  S YFTL+GK + 
Sbjct  7    HRLQIFLHSPDLQIQSKIVDLPQTSAK-TLEDLKFSLLSETLASRVASSLYFTLNGKPLL  65

Query  355  DSTPVNSSLIAPlstltlrlrflggggdggatgAESRDCYLKMYAEKKPDKIDPNEVRLS  534
            DST +  SLI PLSTL LR R LGGGGDGGATGAESRDCYL MYAEKKPDK+DPNE RLS
Sbjct  66   DSTTI--SLIPPLSTLILRTRVLGGGGDGGATGAESRDCYLNMYAEKKPDKVDPNEQRLS  123

Query  535  KWLNCTLSNEPLKHPVV  585
            KWLNC LSNEPL  P V
Sbjct  124  KWLNCALSNEPLSEPCV  140



>ref|XP_010092212.1| hypothetical protein L484_003302 [Morus notabilis]
 gb|EXB50473.1| hypothetical protein L484_003302 [Morus notabilis]
Length=384

 Score =   115 bits (288),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 103/139 (74%), Gaps = 4/139 (3%)
 Frame = +1

Query  169  SKSQNFQIFIQSPDLKIPTRAISLESPNPGFTIKDLKAFIFSKTLTLIQHSGYFTLDGKL  348
            S+++  QIF++SPDL+ PT+ ++L       T++ LK F+F    + I  S YFTL+GK 
Sbjct  3    SEARRMQIFVESPDLQTPTKTLTLTPTKSQ-TLRSLKLFLFP---SEILSSCYFTLNGKR  58

Query  349  IPDSTPVNSSLIAPlstltlrlrflggggdggatgAESRDCYLKMYAEKKPDKIDPNEVR  528
            + D + + SS IAPLSTL LR R  GGGGDGGATGAESRDCYL MYAEKKPDK+DPNE R
Sbjct  59   LDDDSSILSSQIAPLSTLILRSRARGGGGDGGATGAESRDCYLNMYAEKKPDKVDPNEQR  118

Query  529  LSKWLNCTLSNEPLKHPVV  585
            LSKWLNC LSNEPLK P V
Sbjct  119  LSKWLNCALSNEPLKEPCV  137



>ref|XP_004287118.1| PREDICTED: protein RTF2 homolog [Fragaria vesca subsp. vesca]
Length=375

 Score =   112 bits (281),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 85/136 (63%), Positives = 102/136 (75%), Gaps = 8/136 (6%)
 Frame = +1

Query  178  QNFQIFIQSPDLKIPTRAISLESPNPGFTIKDLKAFIFSKTLTLIQHSGYFTLDGKLIPD  357
            Q+FQIF+QSPDL+IPT+ ++L SP    T+  LK  +F +TL  +    +FTL+GK + D
Sbjct  6    QSFQIFLQSPDLQIPTQTLTL-SPIQTPTLHHLKLSLFPQTLPSL----FFTLNGKPLLD  60

Query  358  STPVNSSLIAPlstltlrlrflggggdggatgAESRDCYLKMYAEKKPDKIDPNEVRLSK  537
            STP+      PLSTL LR+R  GGGGDGGATGAESRDCYL MYAEKKPDK+DP E RLSK
Sbjct  61   STPLQ---FPPLSTLILRIRTPGGGGDGGATGAESRDCYLNMYAEKKPDKVDPYEQRLSK  117

Query  538  WLNCTLSNEPLKHPVV  585
            +LNC LSNEPLK P V
Sbjct  118  FLNCALSNEPLKDPCV  133



>ref|XP_002279315.2| PREDICTED: protein RTF2 homolog [Vitis vinifera]
Length=378

 Score =   110 bits (274),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 83/139 (60%), Positives = 98/139 (71%), Gaps = 8/139 (6%)
 Frame = +1

Query  172  KSQNFQIFIQSPDLKIPTRAISLESPNPGFTIKDLK-AFIFSKTLTLIQHSGYFTLDGKL  348
            K    QI IQSPDL I TRA++L   NP  T+++LK + +  +TL     S +FTL GK 
Sbjct  5    KQSQIQILIQSPDLPIATRALTL---NPNSTLRNLKLSLLPPQTLD----SFFFTLHGKA  57

Query  349  IPDSTPVNSSLIAPlstltlrlrflggggdggatgAESRDCYLKMYAEKKPDKIDPNEVR  528
            + DS+ +  S I PLSTL LR R  GGGGDGGATGAESRDCYL MYA KKPDK+DPNE R
Sbjct  58   LHDSSTLQKSGINPLSTLVLRFRLPGGGGDGGATGAESRDCYLNMYAVKKPDKVDPNEQR  117

Query  529  LSKWLNCTLSNEPLKHPVV  585
            LSKW  C+LS EPL+HP V
Sbjct  118  LSKWTTCSLSFEPLRHPCV  136



>emb|CBI36519.3| unnamed protein product [Vitis vinifera]
Length=332

 Score =   108 bits (270),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 82/136 (60%), Positives = 97/136 (71%), Gaps = 8/136 (6%)
 Frame = +1

Query  181  NFQIFIQSPDLKIPTRAISLESPNPGFTIKDLK-AFIFSKTLTLIQHSGYFTLDGKLIPD  357
              QI IQSPDL I TRA++L   NP  T+++LK + +  +TL     S +FTL GK + D
Sbjct  12   QIQILIQSPDLPIATRALTL---NPNSTLRNLKLSLLPPQTL----DSFFFTLHGKALHD  64

Query  358  STPVNSSLIAPlstltlrlrflggggdggatgAESRDCYLKMYAEKKPDKIDPNEVRLSK  537
            S+ +  S I PLSTL LR R  GGGGDGGATGAESRDCYL MYA KKPDK+DPNE RLSK
Sbjct  65   SSTLQKSGINPLSTLVLRFRLPGGGGDGGATGAESRDCYLNMYAVKKPDKVDPNEQRLSK  124

Query  538  WLNCTLSNEPLKHPVV  585
            W  C+LS EPL+HP V
Sbjct  125  WTTCSLSFEPLRHPCV  140



>ref|XP_007154899.1| hypothetical protein PHAVU_003G157300g [Phaseolus vulgaris]
 gb|ESW26893.1| hypothetical protein PHAVU_003G157300g [Phaseolus vulgaris]
Length=359

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 80/136 (59%), Positives = 99/136 (73%), Gaps = 11/136 (8%)
 Frame = +1

Query  178  QNFQIFIQSPDLKIPTRAISLESPNPGFTIKDLKAFIFSKTLTLIQHSGYFTLDGKLIPD  357
            ++ QI +QSPDL      IS++S     T+ D+K  +F ++      S YFTL+GK +PD
Sbjct  4    KSLQILVQSPDL-----GISVQSTTNHRTLSDVKHCLFPQSY----QSYYFTLNGKPLPD  54

Query  358  STPVNSSLIAPlstltlrlrflggggdggatgAESRDCYLKMYAEKKPDKIDPNEVRLSK  537
             T +  + IAPLSTL+LR R LGGGGDGGATGAESRDCYL MYAEKKPDK+DP+E RLSK
Sbjct  55   ETLL--TRIAPLSTLSLRSRLLGGGGDGGATGAESRDCYLNMYAEKKPDKVDPHEQRLSK  112

Query  538  WLNCTLSNEPLKHPVV  585
            W NC+LSNEPL+ P V
Sbjct  113  WHNCSLSNEPLREPCV  128



>gb|EPS61282.1| hypothetical protein M569_13513, partial [Genlisea aurea]
Length=325

 Score =   107 bits (267),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 96/134 (72%), Gaps = 1/134 (1%)
 Frame = +1

Query  187  QIFIQSPDLKIPTRAISLESPNPGFTIKDLKAFIFSKTLTLIQHSGYFTLDGKLIPDSTP  366
            Q+F++ P     T +I L +P+P +T++DL + +          S +FT+D K++ DSTP
Sbjct  1    QVFVELPYPGTSTLSIYLRNPSPDYTLRDLLSSLPPTVRLPPMSSLFFTMDRKIVSDSTP  60

Query  367  V-NSSLIAPlstltlrlrflggggdggatgAESRDCYLKMYAEKKPDKIDPNEVRLSKWL  543
            + N S +   STL +  R  GGGGDGGATGAESRDCYL MYA+KKPDK+DPNEVRLSKW+
Sbjct  61   IFNGSPMPAFSTLRIDHRIRGGGGDGGATGAESRDCYLNMYADKKPDKVDPNEVRLSKWV  120

Query  544  NCTLSNEPLKHPVV  585
            NC+LS EPL+HP+V
Sbjct  121  NCSLSYEPLRHPIV  134



>ref|XP_003519140.1| PREDICTED: protein RTF2 homolog isoform X1 [Glycine max]
 ref|XP_006575307.1| PREDICTED: protein RTF2 homolog isoform X2 [Glycine max]
Length=362

 Score =   107 bits (266),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 96/137 (70%), Gaps = 11/137 (8%)
 Frame = +1

Query  175  SQNFQIFIQSPDLKIPTRAISLESPNPGFTIKDLKAFIFSKTLTLIQHSGYFTLDGKLIP  354
            +++ QI + SPDL      ISL+S     T+ DLK  +F ++      S YFT +GK +P
Sbjct  3    TKSLQILVHSPDL-----GISLQSTTNHETLSDLKNSLFPQS----HQSFYFTFNGKPLP  53

Query  355  DSTPVNSSLIAPlstltlrlrflggggdggatgAESRDCYLKMYAEKKPDKIDPNEVRLS  534
            D TP+  S   PLSTL+LR R LGGGGDGGATGAESRDCYL MYA+KKPDK+DPNE RLS
Sbjct  54   DKTPL--SQFPPLSTLSLRSRLLGGGGDGGATGAESRDCYLNMYADKKPDKVDPNEQRLS  111

Query  535  KWLNCTLSNEPLKHPVV  585
            KW NC LSNEPL+ P V
Sbjct  112  KWHNCALSNEPLREPCV  128



>ref|XP_006600555.1| PREDICTED: protein RTF2 homolog [Glycine max]
Length=363

 Score =   105 bits (262),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 94/136 (69%), Gaps = 11/136 (8%)
 Frame = +1

Query  178  QNFQIFIQSPDLKIPTRAISLESPNPGFTIKDLKAFIFSKTLTLIQHSGYFTLDGKLIPD  357
            ++ QI +QSPDL      ISL+      T+ DLK  +F ++      S YFT +GK +PD
Sbjct  4    KSLQILVQSPDL-----GISLQPTTKHETLSDLKHSLFPQS----HRSFYFTFNGKPLPD  54

Query  358  STPVNSSLIAPlstltlrlrflggggdggatgAESRDCYLKMYAEKKPDKIDPNEVRLSK  537
             TP+  S   PLSTL+LR R  GGGGDGGATGAESRDCYL MYA+KKPDK+DPNE RLSK
Sbjct  55   KTPL--SQFPPLSTLSLRSRLPGGGGDGGATGAESRDCYLNMYADKKPDKVDPNEQRLSK  112

Query  538  WLNCTLSNEPLKHPVV  585
            W NC LSNEPL+ P V
Sbjct  113  WHNCALSNEPLREPCV  128



>ref|XP_010275754.1| PREDICTED: protein RTF2 homolog [Nelumbo nucifera]
Length=382

 Score =   103 bits (258),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 77/135 (57%), Positives = 92/135 (68%), Gaps = 4/135 (3%)
 Frame = +1

Query  184  FQIFIQSPDLKIPTRAISLESPNPGFTIKDLK-AFIFSKTLTLIQHSGYFTLDGKLIPDS  360
            FQ+F+QSP+ +IP  A+++   NP  T   LK +FI          S +F+  GK + DS
Sbjct  7    FQVFVQSPEFQIPCHALTV---NPNQTFHHLKLSFISPTAPRETLDSLFFSFSGKPLLDS  63

Query  361  TPVNSSLIAPlstltlrlrflggggdggatgAESRDCYLKMYAEKKPDKIDPNEVRLSKW  540
            + +  S I P STLTLR R  GGGGDGGATGAESRDCYLKMYA KKPDK+DPNE RLS+W
Sbjct  64   STLLDSKILPFSTLTLRTRLRGGGGDGGATGAESRDCYLKMYASKKPDKVDPNETRLSRW  123

Query  541  LNCTLSNEPLKHPVV  585
              C LS EPLKHP V
Sbjct  124  TTCALSFEPLKHPCV  138



>ref|XP_011018002.1| PREDICTED: protein RTF2 homolog [Populus euphratica]
Length=375

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 77/142 (54%), Positives = 100/142 (70%), Gaps = 13/142 (9%)
 Frame = +1

Query  175  SQNFQIFIQSPDLKIPTRAISLESPNPGFTIKDLKAFIFSKTLTLIQ-----HSGYFTLD  339
            +++ QIFIQS + +  T+ ++L+ P    T+ +LK       L+LI       S YFTL+
Sbjct  3    TKSHQIFIQSQNPQFKTQTLTLD-PTQTLTLYNLK-------LSLITDYQNPSSFYFTLN  54

Query  340  GKLIPDSTPVNSSLIAPlstltlrlrflggggdggatgAESRDCYLKMYAEKKPDKIDPN  519
            GK + DST + +  I PL TL L+ R  GGGGDGGATGAESRDCYL MYA+KKPDK+DP+
Sbjct  55   GKPLKDSTCLPNPQITPLCTLILQARLSGGGGDGGATGAESRDCYLNMYADKKPDKVDPH  114

Query  520  EVRLSKWLNCTLSNEPLKHPVV  585
            E+RLSKWLNC+LSNEPL+ P V
Sbjct  115  ELRLSKWLNCSLSNEPLRQPCV  136



>ref|XP_002324550.2| hypothetical protein POPTR_0018s11830g [Populus trichocarpa]
 gb|EEF03115.2| hypothetical protein POPTR_0018s11830g [Populus trichocarpa]
Length=346

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 74/137 (54%), Positives = 99/137 (72%), Gaps = 3/137 (2%)
 Frame = +1

Query  175  SQNFQIFIQSPDLKIPTRAISLESPNPGFTIKDLKAFIFSKTLTLIQHSGYFTLDGKLIP  354
            +++ QIFIQS + +  T+ ++L+ P    T+ +LK  + +        S YFTL+GK + 
Sbjct  3    TKSHQIFIQSQNPQFKTQTLTLD-PTQTLTLYNLKLSLITDNQN--PSSFYFTLNGKPLK  59

Query  355  DSTPVNSSLIAPlstltlrlrflggggdggatgAESRDCYLKMYAEKKPDKIDPNEVRLS  534
            DST + +  I PL TL L++R  GGGGDGGATGAESRDCYL MYA+KKPDK+DP+E+RLS
Sbjct  60   DSTCLPNPQITPLCTLILQVRLSGGGGDGGATGAESRDCYLNMYADKKPDKVDPHELRLS  119

Query  535  KWLNCTLSNEPLKHPVV  585
            KWLNC+LSNEPL+ P V
Sbjct  120  KWLNCSLSNEPLRQPCV  136



>ref|XP_009366284.1| PREDICTED: protein RTF2 homolog, partial [Pyrus x bretschneideri]
Length=352

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 85/113 (75%), Gaps = 8/113 (7%)
 Frame = +1

Query  247  PNPGFTIKDLKAFIFSKTLTLIQHSGYFTLDGKLIPDSTPVNSSLIAPlstltlrlrflg  426
            PNP      +K  IFS  L  +    YFT++GK + DSTP+  S I PLSTL LR+R LG
Sbjct  2    PNPQI----IKLSIFSHALPSL----YFTVNGKPLNDSTPLLDSQITPLSTLILRIRALG  53

Query  427  gggdggatgAESRDCYLKMYAEKKPDKIDPNEVRLSKWLNCTLSNEPLKHPVV  585
            GGGDGGATGAESRDCYLKMYAEKKPDK+DPNE RLSKWLNC LSNEPLK P V
Sbjct  54   GGGDGGATGAESRDCYLKMYAEKKPDKVDPNEQRLSKWLNCALSNEPLKEPCV  106



>ref|XP_006372125.1| hypothetical protein POPTR_0018s11830g [Populus trichocarpa]
 gb|ERP49922.1| hypothetical protein POPTR_0018s11830g [Populus trichocarpa]
Length=375

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 77/142 (54%), Positives = 101/142 (71%), Gaps = 13/142 (9%)
 Frame = +1

Query  175  SQNFQIFIQSPDLKIPTRAISLESPNPGFTIKDLKAFIFSKTLTLIQ-----HSGYFTLD  339
            +++ QIFIQS + +  T+ ++L+ P    T+ +LK       L+LI       S YFTL+
Sbjct  3    TKSHQIFIQSQNPQFKTQTLTLD-PTQTLTLYNLK-------LSLITDNQNPSSFYFTLN  54

Query  340  GKLIPDSTPVNSSLIAPlstltlrlrflggggdggatgAESRDCYLKMYAEKKPDKIDPN  519
            GK + DST + +  I PL TL L++R  GGGGDGGATGAESRDCYL MYA+KKPDK+DP+
Sbjct  55   GKPLKDSTCLPNPQITPLCTLILQVRLSGGGGDGGATGAESRDCYLNMYADKKPDKVDPH  114

Query  520  EVRLSKWLNCTLSNEPLKHPVV  585
            E+RLSKWLNC+LSNEPL+ P V
Sbjct  115  ELRLSKWLNCSLSNEPLRQPCV  136



>ref|XP_008794332.1| PREDICTED: protein RTF2 homolog [Phoenix dactylifera]
Length=346

 Score =   101 bits (251),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 100/141 (71%), Gaps = 10/141 (7%)
 Frame = +1

Query  178  QNFQIFIQSPDLKIPTRAISLESPNPGFTIKDLK-AFI----FSKTLTLIQHSGYFTLDG  342
            +  ++F++SPDL +P+RA++L    P  T++ LK AF+     S+ LT+  +S YF+L+G
Sbjct  5    KKLRVFVRSPDLVLPSRALTLA---PDLTLRRLKLAFLPQSLLSQALTI--NSLYFSLNG  59

Query  343  KLIPDSTPVNSSLIAPlstltlrlrflggggdggatgAESRDCYLKMYAEKKPDKIDPNE  522
            K +PD + + ++ +   S LTLRLR  GGGGDGGATGAESRDCYL MYA KKPDK+DPNE
Sbjct  60   KPLPDDSSLAAAGVPDFSALTLRLRLRGGGGDGGATGAESRDCYLNMYAIKKPDKVDPNE  119

Query  523  VRLSKWLNCTLSNEPLKHPVV  585
             RLSKW  C LS EPL  P V
Sbjct  120  TRLSKWTTCALSAEPLSPPCV  140



>ref|XP_002523496.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF38835.1| conserved hypothetical protein [Ricinus communis]
Length=375

 Score =   100 bits (249),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 78/133 (59%), Positives = 93/133 (70%), Gaps = 4/133 (3%)
 Frame = +1

Query  187  QIFIQSPDLKIPTRAISLESPNPGFTIKDLKAFIFSKTLTLIQHSGYFTLDGKLIPDSTP  366
            QIF+Q P+ K+ T  ++L+S     T+ DLK  +F      +  S +FTL+GK + DSTP
Sbjct  7    QIFLQLPNSKLQT--LTLDSTQI-LTLHDLKLSLFPNNHQNLS-SFFFTLNGKPLLDSTP  62

Query  367  VNSSLIAPlstltlrlrflggggdggatgAESRDCYLKMYAEKKPDKIDPNEVRLSKWLN  546
            + +  I  LSTL L  R  GGGGDGGATGAESRDCYL MYAEKKPDK+DPNE RLSKWLN
Sbjct  63   IPNPQITSLSTLVLHSRLPGGGGDGGATGAESRDCYLNMYAEKKPDKVDPNEQRLSKWLN  122

Query  547  CTLSNEPLKHPVV  585
            C LSNEPL  P V
Sbjct  123  CALSNEPLMQPCV  135



>ref|XP_006857183.1| hypothetical protein AMTR_s00065p00181400 [Amborella trichopoda]
 gb|ERN18650.1| hypothetical protein AMTR_s00065p00181400 [Amborella trichopoda]
Length=388

 Score =   100 bits (250),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 73/137 (53%), Positives = 90/137 (66%), Gaps = 1/137 (1%)
 Frame = +1

Query  175  SQNFQIFIQSPDLKIPTRAISLESPNPGFTIKDLKAFIFSKTLTLIQHSGYFTLDGKLIP  354
            +QNFQIFI +P+L++P  ++++ SPN          F      T    S +F L+GK + 
Sbjct  3    TQNFQIFIHAPELQVPIYSLTV-SPNQTLGNLKSSLFSSFSVGTKTLDSFFFALNGKPLS  61

Query  355  DSTPVNSSLIAPlstltlrlrflggggdggatgAESRDCYLKMYAEKKPDKIDPNEVRLS  534
            DS  ++   ++P STL  R R LGGGGDGGATGAESRDCYL MYA KKPDK+DPNE RLS
Sbjct  62   DSCKLSDCGVSPFSTLISRARVLGGGGDGGATGAESRDCYLNMYASKKPDKVDPNETRLS  121

Query  535  KWLNCTLSNEPLKHPVV  585
            KW  C LS EPLK P V
Sbjct  122  KWSTCALSYEPLKPPCV  138



>ref|XP_002309334.2| hypothetical protein POPTR_0006s20100g [Populus trichocarpa]
 gb|EEE92857.2| hypothetical protein POPTR_0006s20100g [Populus trichocarpa]
Length=332

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 75/137 (55%), Positives = 96/137 (70%), Gaps = 3/137 (2%)
 Frame = +1

Query  175  SQNFQIFIQSPDLKIPTRAISLESPNPGFTIKDLKAFIFSKTLTLIQHSGYFTLDGKLIP  354
            +++ QIFIQS + +  T+ ++L+ P    T+ +LK  +          S YFTL+GK + 
Sbjct  3    TKSHQIFIQSQNPQFKTQTLTLD-PTQTLTLHNLKLSLLPNNQN--PSSFYFTLNGKPLK  59

Query  355  DSTPVNSSLIAPlstltlrlrflggggdggatgAESRDCYLKMYAEKKPDKIDPNEVRLS  534
            DS+ + +  I PLSTL L+ R  GGGGDGGATGAESRDCYL MYAEKKPDK+DP+E RLS
Sbjct  60   DSSVLPNPQITPLSTLILQTRLSGGGGDGGATGAESRDCYLNMYAEKKPDKVDPHEQRLS  119

Query  535  KWLNCTLSNEPLKHPVV  585
            KWLNC+LSNEPL  P V
Sbjct  120  KWLNCSLSNEPLMQPCV  136



>ref|XP_010929138.1| PREDICTED: protein RTF2 homolog [Elaeis guineensis]
 ref|XP_010929139.1| PREDICTED: protein RTF2 homolog [Elaeis guineensis]
 ref|XP_010929140.1| PREDICTED: protein RTF2 homolog [Elaeis guineensis]
 ref|XP_010929141.1| PREDICTED: protein RTF2 homolog [Elaeis guineensis]
Length=346

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 77/141 (55%), Positives = 95/141 (67%), Gaps = 10/141 (7%)
 Frame = +1

Query  178  QNFQIFIQSPDLKIPTRAISLESPNPGFTIKDLK-----AFIFSKTLTLIQHSGYFTLDG  342
            +  ++F++ PDL + TRA+ L    P  T++ LK       + S+TLTL   S YF L+G
Sbjct  5    KKLRVFVRCPDLGLSTRALILA---PDLTLRRLKLSFLPQSLLSQTLTL--DSLYFCLNG  59

Query  343  KLIPDSTPVNSSLIAPlstltlrlrflggggdggatgAESRDCYLKMYAEKKPDKIDPNE  522
            K +PDS+ + ++ I   S LTLRLR  GGGGDGGATGAESRDCYL MYA KKPDK+DPNE
Sbjct  60   KPLPDSSSLAAAGIPNSSALTLRLRLRGGGGDGGATGAESRDCYLNMYATKKPDKVDPNE  119

Query  523  VRLSKWLNCTLSNEPLKHPVV  585
             RLSKW  C LS EPL  P V
Sbjct  120  TRLSKWTTCALSAEPLVPPCV  140



>gb|KDP38661.1| hypothetical protein JCGZ_04014 [Jatropha curcas]
Length=373

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 90/133 (68%), Gaps = 5/133 (4%)
 Frame = +1

Query  187  QIFIQSPDLKIPTRAISLESPNPGFTIKDLKAFIFSKTLTLIQHSGYFTLDGKLIPDSTP  366
            QIF+Q P+ ++ T  +         T+  LK  +F     L   S YFTL+GKL+ DS+P
Sbjct  7    QIFLQFPNSQVQTLTLDHSQVT---TLHSLKLSLFPNNRNL--SSFYFTLNGKLLHDSSP  61

Query  367  VNSSLIAPlstltlrlrflggggdggatgAESRDCYLKMYAEKKPDKIDPNEVRLSKWLN  546
            + +  I+ LSTL L+ R  GGGGDGGATGAESRDCYL MYA KKPDK+DPNE RLSKWLN
Sbjct  62   IPNPQISSLSTLVLQSRLPGGGGDGGATGAESRDCYLNMYAVKKPDKVDPNEQRLSKWLN  121

Query  547  CTLSNEPLKHPVV  585
            C LSNEPL  P V
Sbjct  122  CALSNEPLTQPCV  134



>ref|XP_011033455.1| PREDICTED: protein RTF2 homolog [Populus euphratica]
 ref|XP_011033456.1| PREDICTED: protein RTF2 homolog [Populus euphratica]
Length=373

 Score = 99.4 bits (246),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 74/137 (54%), Positives = 97/137 (71%), Gaps = 3/137 (2%)
 Frame = +1

Query  175  SQNFQIFIQSPDLKIPTRAISLESPNPGFTIKDLKAFIFSKTLTLIQHSGYFTLDGKLIP  354
            +++ QIFIQS + +  T+ ++L+ P    T+ +LK  +          S YFT++GK + 
Sbjct  3    TKSHQIFIQSQNPQFKTQTLTLD-PTQTLTLHNLKLSLLPNNQN--PSSFYFTVNGKPLK  59

Query  355  DSTPVNSSLIAPlstltlrlrflggggdggatgAESRDCYLKMYAEKKPDKIDPNEVRLS  534
            DS+ + +  I+PLSTL L+ R  GGGGDGGATGAESRDCYL MYAEKKPDK+DP+E RLS
Sbjct  60   DSSVLPNPHISPLSTLILQTRLSGGGGDGGATGAESRDCYLNMYAEKKPDKVDPHEQRLS  119

Query  535  KWLNCTLSNEPLKHPVV  585
            KWLNC+LSNEPL  P V
Sbjct  120  KWLNCSLSNEPLTQPCV  136



>ref|XP_010942116.1| PREDICTED: protein RTF2 homolog [Elaeis guineensis]
Length=343

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 97/141 (69%), Gaps = 10/141 (7%)
 Frame = +1

Query  178  QNFQIFIQSPDLKIPTRAISLESPNPGFTIKDLK-----AFIFSKTLTLIQHSGYFTLDG  342
            +  ++F++SPDL +P+R+++L S     T++ LK       + S+TL L   S YF+L+G
Sbjct  5    KKLRVFVRSPDLGLPSRSLTLASD---LTLRRLKLSFVPQSVLSQTLNL--DSLYFSLNG  59

Query  343  KLIPDSTPVNSSLIAPlstltlrlrflggggdggatgAESRDCYLKMYAEKKPDKIDPNE  522
            K + DS+ +  S +   STLTLRLR  GGGGDGGATGAESRDCYL MYA KKPDK+DPNE
Sbjct  60   KPLIDSSSLAESGVPGSSTLTLRLRLRGGGGDGGATGAESRDCYLNMYATKKPDKVDPNE  119

Query  523  VRLSKWLNCTLSNEPLKHPVV  585
             RLSKW  C LS EPL  P V
Sbjct  120  TRLSKWTTCALSAEPLAPPCV  140



>ref|XP_009380799.1| PREDICTED: protein RTF2 homolog [Musa acuminata subsp. malaccensis]
Length=348

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 72/147 (49%), Positives = 102/147 (69%), Gaps = 11/147 (7%)
 Frame = +1

Query  163  VDSKSQNFQIFIQSPDLKIPTRAISLESPNPGFTIKDLK-AFI---FSKTLTLIQHSGYF  330
            ++ + +  ++F+++P+L +P+R ++L    P  T++ LK AF+   F +TL L   S +F
Sbjct  1    MEPQRKKLEVFVRAPELGLPSRFLTL---TPDVTLRRLKLAFLPRSFPQTLAL--ESLFF  55

Query  331  TLDGKLIPDSTPVNSSLI--APlstltlrlrflggggdggatgAESRDCYLKMYAEKKPD  504
             L G+ +PDS+ ++++ +  +  + L LRLR  GGGGDGGATGAESRDCYL MYA KKPD
Sbjct  56   DLGGRPLPDSSTLDAAGVFSSSSTVLDLRLRLRGGGGDGGATGAESRDCYLNMYAVKKPD  115

Query  505  KIDPNEVRLSKWLNCTLSNEPLKHPVV  585
            K+DPNE RLSKW  C LS EPL  PVV
Sbjct  116  KVDPNETRLSKWTTCALSAEPLAPPVV  142



>ref|XP_008799632.1| PREDICTED: protein RTF2 homolog [Phoenix dactylifera]
Length=346

 Score = 98.2 bits (243),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 77/141 (55%), Positives = 98/141 (70%), Gaps = 10/141 (7%)
 Frame = +1

Query  178  QNFQIFIQSPDLKIPTRAISLESPNPGFTIKDLK-AFI----FSKTLTLIQHSGYFTLDG  342
            +  ++F++SPDL +P+RA++L S     T++ LK +F+     S+TL     S YF+L+G
Sbjct  5    KKLRVFVRSPDLGLPSRALTLASD---LTLRRLKLSFVPQSFLSQTLNF--DSLYFSLNG  59

Query  343  KLIPDSTPVNSSLIAPlstltlrlrflggggdggatgAESRDCYLKMYAEKKPDKIDPNE  522
            K + DS+ +  + I   STLTLRLR  GGGGDGGATGAESRDCYL MYA KKPDK+DPNE
Sbjct  60   KPLVDSSSLADAGIPGSSTLTLRLRLRGGGGDGGATGAESRDCYLNMYATKKPDKVDPNE  119

Query  523  VRLSKWLNCTLSNEPLKHPVV  585
             RLSKW  C LS EPL  P V
Sbjct  120  TRLSKWTACALSAEPLAPPCV  140



>gb|KDO59414.1| hypothetical protein CISIN_1g017480mg [Citrus sinensis]
Length=371

 Score = 98.6 bits (244),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 92/134 (69%), Gaps = 6/134 (4%)
 Frame = +1

Query  187  QIFIQSPDLKIPTRAISLESPNPGFTIKDLKAFIFSKTLTLIQHSGYFTLDGKLIPDSTP  366
            QIFI+SP   + T  +     N   T+  LK  + S   +L     YFTL+GK++ +STP
Sbjct  6    QIFIKSPSNSLTTLTVG---ANQFETLNHLKRSLLSLDQSLSSL--YFTLNGKILDESTP  60

Query  367  V-NSSLIAPlstltlrlrflggggdggatgAESRDCYLKMYAEKKPDKIDPNEVRLSKWL  543
            +  +  IAPLSTL LR R  GGGGDGGATGAESRDCYL MYAEKKPDKIDPNE RLSKW 
Sbjct  61   LFKNPQIAPLSTLYLRQRVFGGGGDGGATGAESRDCYLNMYAEKKPDKIDPNEQRLSKWC  120

Query  544  NCTLSNEPLKHPVV  585
            NC LSNEPL+ P V
Sbjct  121  NCALSNEPLREPCV  134



>ref|XP_006453662.1| hypothetical protein CICLE_v10008691mg [Citrus clementina]
 gb|ESR66902.1| hypothetical protein CICLE_v10008691mg [Citrus clementina]
Length=371

 Score = 98.2 bits (243),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 92/134 (69%), Gaps = 6/134 (4%)
 Frame = +1

Query  187  QIFIQSPDLKIPTRAISLESPNPGFTIKDLKAFIFSKTLTLIQHSGYFTLDGKLIPDSTP  366
            QIFI+SP   + T  +     N   T+  LK  + S   +L     YFTL+GK++ +STP
Sbjct  6    QIFIKSPSNSLKTLTVG---ANQFETLNHLKRSLLSLDQSLSSL--YFTLNGKILDESTP  60

Query  367  V-NSSLIAPlstltlrlrflggggdggatgAESRDCYLKMYAEKKPDKIDPNEVRLSKWL  543
            +  +  IAPLSTL LR R  GGGGDGGATGAESRDCYL MYAEKKPDKIDPNE RLSKW 
Sbjct  61   LFKNPQIAPLSTLYLRQRVFGGGGDGGATGAESRDCYLNMYAEKKPDKIDPNEQRLSKWC  120

Query  544  NCTLSNEPLKHPVV  585
            NC LSNEPL+ P V
Sbjct  121  NCALSNEPLREPCV  134



>ref|XP_007011964.1| Uncharacterized protein TCM_037082 [Theobroma cacao]
 gb|EOY29583.1| Uncharacterized protein TCM_037082 [Theobroma cacao]
Length=343

 Score = 97.8 bits (242),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 75/135 (56%), Positives = 94/135 (70%), Gaps = 5/135 (4%)
 Frame = +1

Query  181  NFQIFIQSPDLKIPTRAISLESPNPGFTIKDLKAFIFSKTLTLIQHSGYFTLDGKLIPDS  360
            + Q F++SP+ +  T  ++LE+     T+  LK+ +  +   L   S YFTL+GK + DS
Sbjct  2    HLQFFVRSPNHQ--TLTLTLEATQS-LTLHHLKSSLLPEPQLL--SSFYFTLNGKPLSDS  56

Query  361  TPVNSSLIAPlstltlrlrflggggdggatgAESRDCYLKMYAEKKPDKIDPNEVRLSKW  540
            T + +S + PLSTL L  R  GGGGDGGATGAESRDCYLKMYA KKPDK+DPNE RL KW
Sbjct  57   TLLPNSQLTPLSTLFLVPRLSGGGGDGGATGAESRDCYLKMYAVKKPDKVDPNEQRLGKW  116

Query  541  LNCTLSNEPLKHPVV  585
            LNC LSNEPL+ P V
Sbjct  117  LNCALSNEPLREPCV  131



>ref|XP_009605182.1| PREDICTED: protein RTF2 homolog [Nicotiana tomentosiformis]
Length=233

 Score = 96.7 bits (239),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 69/87 (79%), Gaps = 0/87 (0%)
 Frame = +1

Query  325  YFTLDGKLIPDSTPVNSSLIAPlstltlrlrflggggdggatgAESRDCYLKMYAEKKPD  504
            YFT +G+   DST +N S I+P STL LRLR  GGGGDGGAT AESRDCYLK+Y  KK D
Sbjct  17   YFTFNGQSTKDSTLLNGSGISPFSTLVLRLRLRGGGGDGGATKAESRDCYLKIYVTKKLD  76

Query  505  KIDPNEVRLSKWLNCTLSNEPLKHPVV  585
            KID NE+RLSKWLNC LSNEPLKH VV
Sbjct  77   KIDSNEIRLSKWLNCALSNEPLKHHVV  103



>ref|XP_009387545.1| PREDICTED: LOW QUALITY PROTEIN: protein RTF2 homolog [Musa acuminata 
subsp. malaccensis]
Length=349

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 67/146 (46%), Positives = 85/146 (58%), Gaps = 8/146 (5%)
 Frame = +1

Query  163  VDSKSQNFQIFIQSPDLKIPTRAISLESPNPGFTIKDLK-AFIFSKTLT--LIQHSGYFT  333
            ++ + +  QI ++SPDL +P R I+L    P  T++ LK AF+    L   L   S YF 
Sbjct  1    MEFRRKKLQIVVRSPDLGLPARCITLA---PDLTLRGLKLAFLPGILLRQPLAFESLYFD  57

Query  334  LDGKLIPDSTPVNSSLIAPlstltlrlrflggggdggatgA--ESRDCYLKMYAEKKPDK  507
            L G+ + DS+ +  + IA  S+  L LR    GG G       ESRDCYL MYA KKPDK
Sbjct  58   LXGRPLTDSSTLTDAGIAAGSSALLTLRLRLRGGGGDGGATGAESRDCYLNMYATKKPDK  117

Query  508  IDPNEVRLSKWLNCTLSNEPLKHPVV  585
            +DPNE RLSKW  C LS EPL  PVV
Sbjct  118  VDPNETRLSKWTTCALSGEPLAPPVV  143



>gb|KJB82856.1| hypothetical protein B456_013G217000 [Gossypium raimondii]
Length=343

 Score = 95.1 bits (235),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 92/134 (69%), Gaps = 5/134 (4%)
 Frame = +1

Query  184  FQIFIQSPDLKIPTRAISLESPNPGFTIKDLKAFIFSKTLTLIQHSGYFTLDGKLIPDST  363
             Q F++SP  +  T  ++LES     T++ LK+ +     +L   S YFTL+GK + DST
Sbjct  3    LQFFLRSPSHQ--TLTVTLESTQS-LTLRQLKSSLLPNPQSL--SSFYFTLNGKPLSDST  57

Query  364  PVNSSLIAPlstltlrlrflggggdggatgAESRDCYLKMYAEKKPDKIDPNEVRLSKWL  543
             + +  I+ LSTL L  R  GGGGDGGATGAESRDCYLKMYA KKPDK+DPNE RL KWL
Sbjct  58   LLPNPQISHLSTLFLLPRVFGGGGDGGATGAESRDCYLKMYAVKKPDKVDPNERRLGKWL  117

Query  544  NCTLSNEPLKHPVV  585
            NC LSNEPL+ P V
Sbjct  118  NCALSNEPLREPCV  131



>ref|NP_200610.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAQ65183.1| At5g58020 [Arabidopsis thaliana]
 dbj|BAE98513.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED96988.1| uncharacterized protein AT5G58020 [Arabidopsis thaliana]
Length=354

 Score = 95.1 bits (235),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 88/133 (66%), Gaps = 2/133 (2%)
 Frame = +1

Query  187  QIFIQSPDLKIPTRAISLESPNPGFTIKDLKAFIFSKTLTLIQHSGYFTLDGKLIPDSTP  366
            QIF++SPD +    A+ L+      T+  + + + S +  +   +   TLDGKL+  ST 
Sbjct  6    QIFVKSPDCQ-KVVALQLDPAQSLLTLSGITSLLES-SQRISFSACSITLDGKLLNGSTR  63

Query  367  VNSSLIAPlstltlrlrflggggdggatgAESRDCYLKMYAEKKPDKIDPNEVRLSKWLN  546
            +  S +  +S LTL  R  GGGGDGGATGAESRDCYL MYAEKKPDK+DPNE RLSKWLN
Sbjct  64   IQVSKLPSVSMLTLFPRLRGGGGDGGATGAESRDCYLNMYAEKKPDKVDPNEQRLSKWLN  123

Query  547  CTLSNEPLKHPVV  585
            C LSNEPL  P V
Sbjct  124  CALSNEPLAEPCV  136



>ref|XP_002864545.1| hypothetical protein ARALYDRAFT_495908 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40804.1| hypothetical protein ARALYDRAFT_495908 [Arabidopsis lyrata subsp. 
lyrata]
Length=354

 Score = 92.8 bits (229),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 86/133 (65%), Gaps = 2/133 (2%)
 Frame = +1

Query  187  QIFIQSPDLKIPTRAISLESPNPGFTIKDLKAFIFSKTLTLIQHSGYFTLDGKLIPDSTP  366
            QIF++SPD +    A+ L+      T+  + + + S     +       LDGKL+  ST 
Sbjct  6    QIFVKSPDCQ-QVFALQLDPSQSVLTLSGITSLLESSQRNSLSDFS-VALDGKLLNGSTR  63

Query  367  VNSSLIAPlstltlrlrflggggdggatgAESRDCYLKMYAEKKPDKIDPNEVRLSKWLN  546
            +  S +  +S LTL  RF GGGGDGGATGAESRDCYL MYAEKKPDK+DPNE RLSKWLN
Sbjct  64   IQVSKLPSVSMLTLFPRFRGGGGDGGATGAESRDCYLNMYAEKKPDKVDPNEQRLSKWLN  123

Query  547  CTLSNEPLKHPVV  585
            C LSNEPL  P V
Sbjct  124  CALSNEPLAEPCV  136



>ref|XP_010687725.1| PREDICTED: protein RTF2 homolog [Beta vulgaris subsp. vulgaris]
Length=377

 Score = 92.4 bits (228),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 75/139 (54%), Positives = 91/139 (65%), Gaps = 3/139 (2%)
 Frame = +1

Query  169  SKSQNFQIFIQSPDLKIPTRAISLESPNPGFTIKDLKAFIFSKTLTLIQHSGYFTLDGKL  348
            +KSQ  QIFI+S + K P R ++L   NP  T  DL   + S + + I    +F+ +GK 
Sbjct  4    AKSQTLQIFIRSLNPKFPNRTLTL---NPTQTWGDLTKSLVSSSSSSISPLFFFSFNGKT  60

Query  349  IPDSTPVNSSLIAPlstltlrlrflggggdggatgAESRDCYLKMYAEKKPDKIDPNEVR  528
            +  S+ + SS I   ST+ L  + LGGGGDGGATGAESRDCYL MYAEKKPDK DPNE R
Sbjct  61   LDQSSTIASSKITEFSTINLHFKLLGGGGDGGATGAESRDCYLTMYAEKKPDKADPNEKR  120

Query  529  LSKWLNCTLSNEPLKHPVV  585
            LSKW  C LSNEPL  P V
Sbjct  121  LSKWTTCALSNEPLNPPCV  139



>ref|XP_010443515.1| PREDICTED: protein RTF2 homolog [Camelina sativa]
Length=392

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 65/85 (76%), Gaps = 0/85 (0%)
 Frame = +1

Query  331  TLDGKLIPDSTPVNSSLIAPlstltlrlrflggggdggatgAESRDCYLKMYAEKKPDKI  510
            TLDGKL+  ST +  S +   S LTL  R  GGGGDGGATGAESRDCYL MYAEKKPDK+
Sbjct  56   TLDGKLLNSSTRIQVSKLPSFSMLTLYPRLRGGGGDGGATGAESRDCYLNMYAEKKPDKV  115

Query  511  DPNEVRLSKWLNCTLSNEPLKHPVV  585
            DPNE RLSKWLNC LSNEPL  P V
Sbjct  116  DPNEQRLSKWLNCALSNEPLAEPCV  140



>gb|KFK27335.1| hypothetical protein AALP_AA8G369800 [Arabis alpina]
Length=354

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = +1

Query  334  LDGKLIPDSTPVNSSLIAPlstltlrlrflggggdggatgAESRDCYLKMYAEKKPDKID  513
            LDGKL+  ST +  S +  +STLTL  R  GGGGDGGATGAESRDCYLKMYAEKKPDK+D
Sbjct  53   LDGKLMNGSTRIQVSNLPSISTLTLHPRLCGGGGDGGATGAESRDCYLKMYAEKKPDKVD  112

Query  514  PNEVRLSKWLNCTLSNEPLKHPVV  585
            PNE RLSKWLNC LSNEPL  P V
Sbjct  113  PNEQRLSKWLNCALSNEPLAEPCV  136



>ref|XP_009120318.1| PREDICTED: protein RTF2 homolog [Brassica rapa]
Length=355

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 67/85 (79%), Gaps = 0/85 (0%)
 Frame = +1

Query  331  TLDGKLIPDSTPVNSSLIAPlstltlrlrflggggdggatgAESRDCYLKMYAEKKPDKI  510
            +LDGK +  ST +  S + P+S L L  R LGGGGDGGATGAESRDCYLKMYAEKKPDK+
Sbjct  53   SLDGKPLNASTRIQVSNLPPVSMLALHPRLLGGGGDGGATGAESRDCYLKMYAEKKPDKV  112

Query  511  DPNEVRLSKWLNCTLSNEPLKHPVV  585
            DPNE RLSKWLNC LSNEPL  P V
Sbjct  113  DPNEQRLSKWLNCALSNEPLAEPCV  137



>ref|XP_010545464.1| PREDICTED: protein RTF2 homolog [Tarenaya hassleriana]
Length=345

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 88/133 (66%), Gaps = 2/133 (2%)
 Frame = +1

Query  187  QIFIQSPDLKIPTRAISLESPNPGFTIKDLKAFIFSKTLTLIQHSGYFTLDGKLIPDSTP  366
            QIF++SP     + A+ L+  +   T+  L + + S     +     F L+GK +  ++ 
Sbjct  6    QIFVKSP-FNYQSLALRLDPTHSLITVSALHSLLESSHRQSLS-DFCFVLNGKPLDITSR  63

Query  367  VNSSLIAPlstltlrlrflggggdggatgAESRDCYLKMYAEKKPDKIDPNEVRLSKWLN  546
            ++ S I P+STLTL  R+  GGGDGGATGAESRDCYL MYAEKKPDK+DPNE RLSKWLN
Sbjct  64   ISVSEIPPVSTLTLYPRYRAGGGDGGATGAESRDCYLNMYAEKKPDKVDPNEQRLSKWLN  123

Query  547  CTLSNEPLKHPVV  585
            C LSNEPL  P V
Sbjct  124  CALSNEPLTEPCV  136



>emb|CDY62263.1| BnaCnng39770D [Brassica napus]
Length=355

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 67/85 (79%), Gaps = 0/85 (0%)
 Frame = +1

Query  331  TLDGKLIPDSTPVNSSLIAPlstltlrlrflggggdggatgAESRDCYLKMYAEKKPDKI  510
            +LDGK +  ST +  S + P+S L L  R LGGGGDGGATGAESRDCYLKMYAEKKPDK+
Sbjct  53   SLDGKPLNASTRIQVSNLPPVSMLALHPRLLGGGGDGGATGAESRDCYLKMYAEKKPDKV  112

Query  511  DPNEVRLSKWLNCTLSNEPLKHPVV  585
            DPNE RLSKWLNC LSNEPL  P V
Sbjct  113  DPNEQRLSKWLNCALSNEPLAEPCV  137



>ref|XP_010483365.1| PREDICTED: protein RTF2 homolog [Camelina sativa]
Length=401

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 70/134 (52%), Positives = 84/134 (63%), Gaps = 2/134 (1%)
 Frame = +1

Query  187  QIFIQSPDLKIPTRAISLESPNPGFTIKDLKAFIFSKTLTLIQHSGY-FTLDGKLIPDST  363
            QI ++SPD    T A+ L+      T+  + + + S +      S +   LDGKL+  ST
Sbjct  7    QILVKSPDFN-RTIALQLDPAQSVLTLSGITSLLESSSSHRNSLSDFCVALDGKLLNGST  65

Query  364  PVNSSLIAPlstltlrlrflggggdggatgAESRDCYLKMYAEKKPDKIDPNEVRLSKWL  543
             +  S +   S LTL  R  GGGGDGGATGAESRDCYL MYAEKKPDK+D NE RLSKWL
Sbjct  66   RIQVSKLPSFSMLTLYPRLRGGGGDGGATGAESRDCYLNMYAEKKPDKVDRNEQRLSKWL  125

Query  544  NCTLSNEPLKHPVV  585
            NC LSNEPL  P V
Sbjct  126  NCALSNEPLAEPCV  139



>ref|XP_006281450.1| hypothetical protein CARUB_v10027528mg [Capsella rubella]
 gb|EOA14348.1| hypothetical protein CARUB_v10027528mg [Capsella rubella]
Length=353

 Score = 87.4 bits (215),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 62/85 (73%), Positives = 67/85 (79%), Gaps = 0/85 (0%)
 Frame = +1

Query  331  TLDGKLIPDSTPVNSSLIAPlstltlrlrflggggdggatgAESRDCYLKMYAEKKPDKI  510
             LDGKL+  ST +  S +  +STLTL  RF GGGGDGGATGAESRDCYL MYAEKKPDK+
Sbjct  53   ALDGKLLNGSTRIQVSKLPSVSTLTLFPRFRGGGGDGGATGAESRDCYLNMYAEKKPDKV  112

Query  511  DPNEVRLSKWLNCTLSNEPLKHPVV  585
            DPNE RLSKWLNC LSNEPL  P V
Sbjct  113  DPNEQRLSKWLNCALSNEPLAEPCV  137



>emb|CDY55015.1| BnaA10g29400D [Brassica napus]
Length=355

 Score = 87.0 bits (214),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 62/85 (73%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = +1

Query  331  TLDGKLIPDSTPVNSSLIAPlstltlrlrflggggdggatgAESRDCYLKMYAEKKPDKI  510
            +LDGK +  ST +  S + P+S LTL  R LGGGGDGGATGAESRDCYLKMYAEKKPDK+
Sbjct  53   SLDGKPLNISTRIQVSNLPPVSMLTLHPRLLGGGGDGGATGAESRDCYLKMYAEKKPDKV  112

Query  511  DPNEVRLSKWLNCTLSNEPLKHPVV  585
            DPNE RLSKWLNC LSNEPL  P V
Sbjct  113  DPNEQRLSKWLNCALSNEPLAEPCV  137



>ref|XP_010453088.1| PREDICTED: protein RTF2 homolog [Camelina sativa]
Length=392

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 60/85 (71%), Positives = 64/85 (75%), Gaps = 0/85 (0%)
 Frame = +1

Query  331  TLDGKLIPDSTPVNSSLIAPlstltlrlrflggggdggatgAESRDCYLKMYAEKKPDKI  510
             LDGKL+  ST +  S +   S LTL  R  GGGGDGGATGAESRDCYL MYAEKKPDK+
Sbjct  56   ALDGKLLNVSTRIQVSKLPSFSMLTLYPRLRGGGGDGGATGAESRDCYLNMYAEKKPDKV  115

Query  511  DPNEVRLSKWLNCTLSNEPLKHPVV  585
            DPNE RLSKWLNC LSNEPL  P V
Sbjct  116  DPNEQRLSKWLNCALSNEPLAEPCV  140



>emb|CDY02786.1| BnaC02g11030D [Brassica napus]
Length=351

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/44 (84%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = +1

Query  454  AESRDCYLKMYAEKKPDKIDPNEVRLSKWLNCTLSNEPLKHPVV  585
            AESRDCYL MYAEKKPDK+DPNE RLSKWLNC LSNEPL  P V
Sbjct  93   AESRDCYLNMYAEKKPDKVDPNEQRLSKWLNCALSNEPLAEPCV  136



>emb|CDY32732.1| BnaA02g07940D [Brassica napus]
Length=351

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 87/134 (65%), Gaps = 4/134 (3%)
 Frame = +1

Query  187  QIFIQSPDLKIPTRAISLESPNPGFTIKDLKAFI-FSKTLTLIQHSGYFTLDGKLIPDST  363
            QI ++SP     T A+ L+      T+  L +F+  S+  +L   S    L+ K +  ST
Sbjct  6    QIIVKSP-YSQQTVALQLDPSQSVLTLSALTSFLESSQRQSLSDFS--VALNEKPLNAST  62

Query  364  PVNSSLIAPlstltlrlrflggggdggatgAESRDCYLKMYAEKKPDKIDPNEVRLSKWL  543
             + +S + P+S L L  R LGGGGDGGATGAESRDCYL MYAEKKPDK+DPNE RLSKWL
Sbjct  63   RIKASNLPPVSMLALYPRLLGGGGDGGATGAESRDCYLNMYAEKKPDKVDPNEQRLSKWL  122

Query  544  NCTLSNEPLKHPVV  585
            NC LSNEPL  P V
Sbjct  123  NCALSNEPLAEPCV  136



>dbj|BAB10993.1| unnamed protein product [Arabidopsis thaliana]
Length=281

 Score = 84.0 bits (206),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 36/43 (84%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  457  ESRDCYLKMYAEKKPDKIDPNEVRLSKWLNCTLSNEPLKHPVV  585
            ESRDCYL MYAEKKPDK+DPNE RLSKWLNC LSNEPL  P V
Sbjct  21   ESRDCYLNMYAEKKPDKVDPNEQRLSKWLNCALSNEPLAEPCV  63



>ref|XP_006401138.1| hypothetical protein EUTSA_v10013961mg [Eutrema salsugineum]
 gb|ESQ42591.1| hypothetical protein EUTSA_v10013961mg [Eutrema salsugineum]
Length=354

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 36/43 (84%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  457  ESRDCYLKMYAEKKPDKIDPNEVRLSKWLNCTLSNEPLKHPVV  585
            ESRDCYL MYAEKKPDK+DPNE RLSKWLNC LSNEPL  P V
Sbjct  94   ESRDCYLNMYAEKKPDKVDPNEQRLSKWLNCALSNEPLAEPCV  136



>ref|XP_010545460.1| PREDICTED: uncharacterized protein LOC104817826 [Tarenaya hassleriana]
Length=873

 Score = 86.7 bits (213),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 87/133 (65%), Gaps = 2/133 (2%)
 Frame = +1

Query  187  QIFIQSPDLKIPTRAISLESPNPGFTIKDLKAFIFSKTLTLIQHSGYFTLDGKLIPDSTP  366
            QIF++SP     + A+ L+  +   T+  L + + S     +     F L+GK +  ++ 
Sbjct  536  QIFVKSP-FNHQSLALRLDPTHSLVTVSALHSLLESSHRQSLSDF-CFVLNGKPLDITSR  593

Query  367  VNSSLIAPlstltlrlrflggggdggatgAESRDCYLKMYAEKKPDKIDPNEVRLSKWLN  546
            ++ S I P+STLTL  R   GGGDGGATGAESRDCYL MYAEKKPDK+DPNE RLSKWLN
Sbjct  594  ISVSEIPPVSTLTLYPRHRAGGGDGGATGAESRDCYLNMYAEKKPDKVDPNEQRLSKWLN  653

Query  547  CTLSNEPLKHPVV  585
            C LSNEPL  P V
Sbjct  654  CALSNEPLTEPCV  666



>ref|XP_009126796.1| PREDICTED: protein RTF2 homolog [Brassica rapa]
Length=351

 Score = 84.0 bits (206),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 36/43 (84%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  457  ESRDCYLKMYAEKKPDKIDPNEVRLSKWLNCTLSNEPLKHPVV  585
            ESRDCYL MYAEKKPDK+DPNE RLSKWLNC LSNEPL  P V
Sbjct  94   ESRDCYLNMYAEKKPDKVDPNEQRLSKWLNCALSNEPLAEPCV  136



>gb|KJB38813.1| hypothetical protein B456_006G273400 [Gossypium raimondii]
Length=324

 Score = 81.3 bits (199),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 68/93 (73%), Gaps = 0/93 (0%)
 Frame = +1

Query  307  LIQHSGYFTLDGKLIPDSTPVNSSLIAPlstltlrlrflggggdggatgAESRDCYLKMY  486
            L   S YFTL+GK + DST + +  I+ LSTL+   R  GGGGDGGATGAESRDCYLKMY
Sbjct  21   LSSSSFYFTLNGKPLSDSTLLPNPQISHLSTLSHLPRISGGGGDGGATGAESRDCYLKMY  80

Query  487  AEKKPDKIDPNEVRLSKWLNCTLSNEPLKHPVV  585
            A KKPDK+DP E RL KWLNC  S EPL+ P V
Sbjct  81   AVKKPDKVDPKEKRLGKWLNCAFSYEPLREPCV  113



>ref|XP_002437966.1| hypothetical protein SORBIDRAFT_10g005640 [Sorghum bicolor]
 gb|EER89333.1| hypothetical protein SORBIDRAFT_10g005640 [Sorghum bicolor]
Length=352

 Score = 78.2 bits (191),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 77/132 (58%), Gaps = 9/132 (7%)
 Frame = +1

Query  190  IFIQSPDLKIPTRAISLESPNPGFTIKDLKAFIFSKTLTLIQHSGYFTLDGKLIPDSTPV  369
            + ++  DL +P R +++ S  P   + DL       +L L   S Y T DG+ +P STPV
Sbjct  15   VVLRLDDLSLPPRYLTVPSHLP---VSDLLG-----SLPLPSSSYYLTADGRPLPSSTPV  66

Query  370  NSSLIAPlstltlrlrflggggdggatgAESRDCYLKMYAEKKPDKIDPNEVRLSKWLNC  549
             SSL    S         GGGGDGGATGAESRDCYL MY  KKPDK DPNE RLS++  C
Sbjct  67   -SSLRPSASVQLRLRALRGGGGDGGATGAESRDCYLSMYLAKKPDKADPNEARLSRFTCC  125

Query  550  TLSNEPLKHPVV  585
             LS EPL  P V
Sbjct  126  ALSGEPLAAPAV  137



>dbj|BAJ91885.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93378.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97413.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=345

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 60/132 (45%), Positives = 76/132 (58%), Gaps = 9/132 (7%)
 Frame = +1

Query  190  IFIQSPDLKIPTRAISLESPNPGFTIKDLKAFIFSKTLTLIQHSGYFTLDGKLIPDSTPV  369
            + ++  DL +P+R +++ S  P   + DL +F     L L   S Y T DG+ +  S PV
Sbjct  11   VVLRLDDLSLPSRYLTVASHLP---VSDLLSF-----LPLPSSSFYLTTDGRPLAPSAPV  62

Query  370  NSSLIAPlstltlrlrflggggdggatgAESRDCYLKMYAEKKPDKIDPNEVRLSKWLNC  549
             +SL    S         GGGGDGG+T AESRDCYL MY  KKPDK DPNE RLS++  C
Sbjct  63   -ASLAPSGSLQLRLRALRGGGGDGGSTCAESRDCYLSMYLAKKPDKADPNEARLSRFTCC  121

Query  550  TLSNEPLKHPVV  585
             LS EPL  P V
Sbjct  122  ALSGEPLAPPAV  133



>gb|KIZ06037.1| putative UPF0549 protein C20orf43 like protein [Monoraphidium 
neglectum]
Length=401

 Score = 76.3 bits (186),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 53/135 (39%), Positives = 80/135 (59%), Gaps = 8/135 (6%)
 Frame = +1

Query  184  FQIFIQSPDLKIPTRAISLESPNPGFTIKDLKAFIFSKTLTLIQHSGY-FTLDGKLIPDS  360
             Q+F++          + +E+P PG T+ DLK     K   ++    + F  +G+L+ DS
Sbjct  1    MQLFVRDAS------TVVVEAP-PGATVHDLKELWSQKAFGVVSTVSWAFVHEGRLLADS  53

Query  361  TPVNSSLIAPlstltlrlrflggggdggatgAESRDCYLKMYAEKKPDKIDPNEVRLSKW  540
              + ++ +   ++L  +LR  GGGGDGG+TGAESR CYL+MY  KKPDK++P E  L++W
Sbjct  54   ATLEAAGVRDGASLCAKLRLRGGGGDGGSTGAESRSCYLEMYQGKKPDKVNPAEELLARW  113

Query  541  LNCTLSNEPLKHPVV  585
              C +S EPL  P V
Sbjct  114  TRCHISGEPLAEPCV  128



>gb|ADE77365.1| unknown [Picea sitchensis]
Length=387

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 51/87 (59%), Positives = 59/87 (68%), Gaps = 0/87 (0%)
 Frame = +1

Query  325  YFTLDGKLIPDSTPVNSSLIAPlstltlrlrflggggdggatgAESRDCYLKMYAEKKPD  504
            YF+  GK + D+  +    +   S + L  R  GGGGDGGATGAESRDCYLKMYAEKKPD
Sbjct  54   YFSCGGKALADNCRLMDMDVGHNSLIQLIPRVCGGGGDGGATGAESRDCYLKMYAEKKPD  113

Query  505  KIDPNEVRLSKWLNCTLSNEPLKHPVV  585
            K+DPNE R+SKW  C LS E LK P  
Sbjct  114  KVDPNETRISKWSTCALSQETLKPPCA  140



>ref|XP_001759344.1| predicted protein [Physcomitrella patens]
 gb|EDQ76028.1| predicted protein, partial [Physcomitrella patens]
Length=274

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  457  ESRDCYLKMYAEKKPDKIDPNEVRLSKWLNCTLSNEPLKHPVV  585
            ESRDCYL MYA KKPDK+DPNE++L+K+ NC LS+EPLK P V
Sbjct  15   ESRDCYLNMYASKKPDKVDPNEIKLAKFTNCALSSEPLKPPCV  57



>ref|XP_002986106.1| hypothetical protein SELMODRAFT_46144, partial [Selaginella moellendorffii]
 gb|EFJ12925.1| hypothetical protein SELMODRAFT_46144, partial [Selaginella moellendorffii]
Length=294

 Score = 72.0 bits (175),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 60/82 (73%), Gaps = 0/82 (0%)
 Frame = +1

Query  340  GKLIPDSTPVNSSLIAPlstltlrlrflggggdggatgAESRDCYLKMYAEKKPDKIDPN  519
            GKL+    P+  S +   STL L +R  GGGGDGGATGAESRDCYLKMYAEKKPDK+DPN
Sbjct  1    GKLLGHGRPLQESGVGRWSTLHLGVRVRGGGGDGGATGAESRDCYLKMYAEKKPDKVDPN  60

Query  520  EVRLSKWLNCTLSNEPLKHPVV  585
            E RL++W  C LS + L+ P V
Sbjct  61   EARLARWCQCALSCDYLRPPCV  82



>ref|XP_002989658.1| hypothetical protein SELMODRAFT_46143, partial [Selaginella moellendorffii]
 gb|EFJ09328.1| hypothetical protein SELMODRAFT_46143, partial [Selaginella moellendorffii]
Length=311

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  457  ESRDCYLKMYAEKKPDKIDPNEVRLSKWLNCTLSNEPLKHPVV  585
            ESRDCYLKMYAEKKPDK+DPNE RL++W  C LS + L+ P V
Sbjct  40   ESRDCYLKMYAEKKPDKVDPNEARLARWCQCALSCDYLRPPCV  82



>ref|XP_008659193.1| PREDICTED: protein RTF2 homolog [Zea mays]
 gb|AFW85551.1| hypothetical protein ZEAMMB73_914033 [Zea mays]
Length=347

 Score = 70.5 bits (171),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 57/87 (66%), Gaps = 1/87 (1%)
 Frame = +1

Query  325  YFTLDGKLIPDSTPVNSSLIAPlstltlrlrflggggdggatgAESRDCYLKMYAEKKPD  504
            Y T DG+ +P S+PV ++L    S         GGGGDGGATGAESRDCYL MY  KKPD
Sbjct  50   YLTADGRPLPASSPV-AALPPSASVQLRLRALRGGGGDGGATGAESRDCYLSMYLAKKPD  108

Query  505  KIDPNEVRLSKWLNCTLSNEPLKHPVV  585
            K DPNE RLS++  C LS EPL  P V
Sbjct  109  KADPNEARLSRFTCCALSGEPLAAPAV  135



>ref|XP_003564198.1| PREDICTED: protein RTF2 homolog [Brachypodium distachyon]
Length=348

 Score = 69.3 bits (168),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 55/87 (63%), Gaps = 1/87 (1%)
 Frame = +1

Query  325  YFTLDGKLIPDSTPVNSSLIAPlstltlrlrflggggdggatgAESRDCYLKMYAEKKPD  504
            Y T DG+ +  S+PV +SL    S         GGGGDGG+T AESRDCYL MY  KKPD
Sbjct  53   YLTSDGRPLAPSSPV-ASLPPSASIQLRLRALRGGGGDGGSTCAESRDCYLSMYLAKKPD  111

Query  505  KIDPNEVRLSKWLNCTLSNEPLKHPVV  585
            K DPNE RLS++  C LS EPL  P V
Sbjct  112  KADPNEARLSRFTCCALSGEPLAAPAV  138



>ref|XP_006846448.1| hypothetical protein AMTR_s00018p00078470 [Amborella trichopoda]
 gb|ERN08123.1| hypothetical protein AMTR_s00018p00078470 [Amborella trichopoda]
Length=121

 Score = 63.9 bits (154),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 48/89 (54%), Positives = 58/89 (65%), Gaps = 0/89 (0%)
 Frame = +1

Query  319  SGYFTLDGKLIPDSTPVNSSLIAPlstltlrlrflggggdggatgAESRDCYLKMYAEKK  498
            S +FTL+GK + DS  +    ++ LS L  R+  LGGG DGGAT  ES+DCY  MYA KK
Sbjct  31   SFFFTLNGKPLSDSCKLRDCGVSQLSNLNSRVGVLGGGDDGGATRGESKDCYFSMYASKK  90

Query  499  PDKIDPNEVRLSKWLNCTLSNEPLKHPVV  585
            PDK D NE RLSK ++  LS EPLK   V
Sbjct  91   PDKFDSNETRLSKMVHLCLSCEPLKPACV  119



>ref|NP_001056989.1| Os06g0183900 [Oryza sativa Japonica Group]
 dbj|BAD72547.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD72510.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF18903.1| Os06g0183900 [Oryza sativa Japonica Group]
 gb|EAY99929.1| hypothetical protein OsI_21930 [Oryza sativa Indica Group]
 dbj|BAG98699.1| unnamed protein product [Oryza sativa Japonica Group]
Length=350

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 51/89 (57%), Positives = 56/89 (63%), Gaps = 1/89 (1%)
 Frame = +1

Query  319  SGYFTLDGKLIPDSTPVNSSLIAPlstltlrlrflggggdggatgAESRDCYLKMYAEKK  498
            S Y T DG+ +  S PV +SL    S         GGGGDGGATGAESRDCYL MY  KK
Sbjct  49   SFYLTADGRPLLLSAPV-ASLPPSGSVQLRLRALRGGGGDGGATGAESRDCYLSMYLAKK  107

Query  499  PDKIDPNEVRLSKWLNCTLSNEPLKHPVV  585
            PDK DPNE RLS++  C LS EPL  P V
Sbjct  108  PDKADPNEARLSRFTCCALSGEPLAAPAV  136



>ref|XP_004966674.1| PREDICTED: protein RTF2 homolog [Setaria italica]
Length=462

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  457  ESRDCYLKMYAEKKPDKIDPNEVRLSKWLNCTLSNEPLKHPVV  585
            ESRDCYL MY  KKPDK DPNE RLS++  C LS EPL  P V
Sbjct  205  ESRDCYLSMYLAKKPDKADPNEARLSRFTCCALSGEPLAAPAV  247



>ref|XP_002953114.1| hypothetical protein VOLCADRAFT_63267 [Volvox carteri f. nagariensis]
 gb|EFJ45713.1| hypothetical protein VOLCADRAFT_63267 [Volvox carteri f. nagariensis]
Length=292

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +1

Query  454  AESRDCYLKMYAEKKPDKIDPNEVRLSKWLNCTLSNEPLKHPVV  585
            AESR CYL+MY  KK DK++P E RL+KW  C LS EPL  P V
Sbjct  19   AESRSCYLEMYLGKKADKVNPEEERLAKWTRCHLSGEPLTPPCV  62



>ref|XP_005646218.1| DUF602-domain-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE21674.1| DUF602-domain-containing protein [Coccomyxa subellipsoidea C-169]
Length=369

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 62/107 (58%), Gaps = 0/107 (0%)
 Frame = +1

Query  262  TIKDLKAFIFSKTLTLIQHSGYFTLDGKLIPDSTPVNSSLIAPlstltlrlrflggggdg  441
            T+  LK  +       +        +G++ PD   +    I P S + + +R  GGGGDG
Sbjct  23   TVSALKERVVGSDSATLASDLRVVHNGRVCPDGARLAFCGILPGSQVNVAVRARGGGGDG  82

Query  442  gatgAESRDCYLKMYAEKKPDKIDPNEVRLSKWLNCTLSNEPLKHPV  582
            G+TGAESR  +L+MYA+KKPDKI+P E +L++W  C LS E L  PV
Sbjct  83   GSTGAESRSSFLEMYAQKKPDKINPEEEKLARWTTCRLSGERLSPPV  129



>ref|XP_001695672.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP01459.1| predicted protein [Chlamydomonas reinhardtii]
Length=323

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +1

Query  454  AESRDCYLKMYAEKKPDKIDPNEVRLSKWLNCTLSNEPLKHPVV  585
            AESR CYL+MYA KK +K++P E RL+KW  C LS E L  P V
Sbjct  30   AESRSCYLEMYAYKKVEKVNPEEARLAKWTRCHLSGELLAAPCV  73



>ref|XP_005851016.1| hypothetical protein CHLNCDRAFT_140862 [Chlorella variabilis]
 gb|EFN58914.1| hypothetical protein CHLNCDRAFT_140862 [Chlorella variabilis]
Length=355

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +1

Query  457  ESRDCYLKMYAEKKPDKIDPNEVRLSKWLNCTLSNEPLKHP  579
            ESR  YL+MY  K+PD++DP E RL++W  C LS  PL+ P
Sbjct  69   ESRSSYLEMYKIKRPDRVDPEEERLARWTMCQLSGMPLQPP  109



>gb|KJB07591.1| hypothetical protein B456_001G031600 [Gossypium raimondii]
Length=213

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/26 (85%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = +1

Query  454  AESRDCYLKMYAEKKPDKIDPNEVRL  531
            AESRDCYLKMYA KKPDK+DPNE R 
Sbjct  12   AESRDCYLKMYAVKKPDKVDPNEQRF  37



>ref|XP_011402109.1| RTF2-like protein [Auxenochlorella protothecoides]
 gb|KFM29060.1| RTF2-like protein [Auxenochlorella protothecoides]
Length=253

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = +1

Query  481  MYAEKKPDKIDPNEVRLSKWLNCTLSNEPLKHPVV  585
            MY  +KPDK++P E RL++W  C LS EPL  P+V
Sbjct  1    MYLGRKPDKVNPEEERLARWTTCHLSGEPLSRPIV  35



>gb|EMT23675.1| hypothetical protein F775_09679 [Aegilops tauschii]
Length=246

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = +1

Query  481  MYAEKKPDKIDPNEVRLSKWLNCTLSNEPLKHPVV  585
            MY  KKPDK DPNE RLS++  C LS EPL  P V
Sbjct  1    MYLAKKPDKADPNEARLSRFTCCALSGEPLAAPAV  35



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 737611932690