BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002F05

Length=556
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009783836.1|  PREDICTED: proteasome subunit beta type-5-like     340   4e-115   Nicotiana sylvestris
ref|XP_009596640.1|  PREDICTED: proteasome subunit beta type-5-like     333   2e-112   Nicotiana tomentosiformis
ref|XP_009780639.1|  PREDICTED: proteasome subunit beta type-5-like     329   7e-111   Nicotiana sylvestris
ref|XP_009619742.1|  PREDICTED: proteasome subunit beta type-5-like     328   2e-110   Nicotiana tomentosiformis
ref|XP_006363770.1|  PREDICTED: proteasome subunit beta type-5-li...    328   3e-110   Solanum tuberosum [potatoes]
ref|XP_004239661.1|  PREDICTED: proteasome subunit beta type-5          327   5e-110   Solanum lycopersicum
ref|XP_006345787.1|  PREDICTED: proteasome subunit beta type-5-like     326   2e-109   Solanum tuberosum [potatoes]
ref|XP_002264828.1|  PREDICTED: proteasome subunit beta type-5          316   2e-105   Vitis vinifera
emb|CDP13326.1|  unnamed protein product                                316   1e-104   Coffea canephora [robusta coffee]
gb|KHG05622.1|  Proteasome subunit beta type-5                          313   2e-104   Gossypium arboreum [tree cotton]
gb|KJB15718.1|  hypothetical protein B456_002G192400                    313   2e-104   Gossypium raimondii
ref|XP_011071212.1|  PREDICTED: proteasome subunit beta type-5-like     313   3e-104   Sesamum indicum [beniseed]
gb|KDP26783.1|  hypothetical protein JCGZ_17941                         312   4e-104   Jatropha curcas
ref|XP_008340194.1|  PREDICTED: proteasome subunit beta type-5          312   5e-104   
gb|KHG25400.1|  Proteasome subunit beta type-5                          312   5e-104   Gossypium arboreum [tree cotton]
ref|XP_007045045.1|  N-terminal nucleophile aminohydrolases (Ntn ...    310   7e-104   
ref|XP_009372313.1|  PREDICTED: proteasome subunit beta type-5          311   8e-104   Pyrus x bretschneideri [bai li]
ref|XP_004144192.1|  PREDICTED: proteasome subunit beta type-5-like     311   1e-103   Cucumis sativus [cucumbers]
gb|KJB78067.1|  hypothetical protein B456_012G175200                    311   1e-103   Gossypium raimondii
gb|EPS61043.1|  hypothetical protein M569_13757                         310   2e-103   Genlisea aurea
ref|XP_008222076.1|  PREDICTED: proteasome subunit beta type-5          310   3e-103   Prunus mume [ume]
ref|XP_008445492.1|  PREDICTED: proteasome subunit beta type-5          309   5e-103   Cucumis melo [Oriental melon]
ref|XP_007045043.1|  N-terminal nucleophile aminohydrolases (Ntn ...    309   6e-103   
ref|XP_007222598.1|  hypothetical protein PRUPE_ppa009896mg             308   1e-102   Prunus persica
ref|XP_010682823.1|  PREDICTED: proteasome subunit beta type-5          308   1e-102   Beta vulgaris subsp. vulgaris [field beet]
gb|KCW61971.1|  hypothetical protein EUGRSUZ_H04655                     305   2e-102   Eucalyptus grandis [rose gum]
sp|O24361.1|PSB5_SPIOL  RecName: Full=Proteasome subunit beta typ...    308   2e-102   Spinacia oleracea
ref|XP_010025332.1|  PREDICTED: proteasome subunit beta type-5-B        305   2e-101   Eucalyptus grandis [rose gum]
ref|XP_008381840.1|  PREDICTED: proteasome subunit beta type-5-like     305   3e-101   
ref|XP_006395566.1|  hypothetical protein EUTSA_v10004762mg             305   3e-101   Eutrema salsugineum [saltwater cress]
ref|XP_009376552.1|  PREDICTED: proteasome subunit beta type-5-like     303   1e-100   Pyrus x bretschneideri [bai li]
gb|EYU42103.1|  hypothetical protein MIMGU_mgv1a011714mg                303   1e-100   Erythranthe guttata [common monkey flower]
ref|XP_010105786.1|  Proteasome subunit beta type-5                     303   1e-100   Morus notabilis
ref|XP_011029673.1|  PREDICTED: proteasome subunit beta type-5-B-...    303   2e-100   Populus euphratica
ref|XP_002312631.2|  20S proteasome beta subunit family protein         303   2e-100   
ref|XP_006291670.1|  hypothetical protein CARUB_v10017828mg             302   4e-100   Capsella rubella
ref|XP_010538272.1|  PREDICTED: proteasome subunit beta type-5-B-...    302   4e-100   Tarenaya hassleriana [spider flower]
ref|NP_189265.1|  proteasome subunit beta type-5-B                      302   4e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010425347.1|  PREDICTED: proteasome subunit beta type-5-B        302   4e-100   Camelina sativa [gold-of-pleasure]
ref|XP_010250770.1|  PREDICTED: proteasome subunit beta type-5          302   5e-100   Nelumbo nucifera [Indian lotus]
ref|XP_010514289.1|  PREDICTED: proteasome subunit beta type-5-B-...    300   2e-99    Camelina sativa [gold-of-pleasure]
emb|CDY26610.1|  BnaA09g46670D                                          300   2e-99    Brassica napus [oilseed rape]
emb|CDY21081.1|  BnaA08g24440D                                          300   3e-99    Brassica napus [oilseed rape]
emb|CDY34594.1|  BnaC03g56940D                                          300   3e-99    Brassica napus [oilseed rape]
ref|XP_010540655.1|  PREDICTED: proteasome subunit beta type-5-B        300   3e-99    Tarenaya hassleriana [spider flower]
emb|CDY16054.1|  BnaC08g40690D                                          300   3e-99    Brassica napus [oilseed rape]
ref|XP_009110603.1|  PREDICTED: proteasome subunit beta type-5-B        300   4e-99    Brassica rapa
emb|CDX98014.1|  BnaA06g07650D                                          300   4e-99    
ref|XP_009148547.1|  PREDICTED: proteasome subunit beta type-5-B-...    300   4e-99    Brassica rapa
ref|XP_008810773.1|  PREDICTED: proteasome subunit beta type-5-like     298   9e-99    Phoenix dactylifera
ref|XP_009416647.1|  PREDICTED: proteasome subunit beta type-5-like     298   9e-99    Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY19402.1|  BnaC05g09110D                                          298   1e-98    Brassica napus [oilseed rape]
ref|XP_006417162.1|  hypothetical protein EUTSA_v10008454mg             298   1e-98    Eutrema salsugineum [saltwater cress]
ref|XP_010502548.1|  PREDICTED: proteasome subunit beta type-5-B-...    298   1e-98    Camelina sativa [gold-of-pleasure]
ref|XP_010251768.1|  PREDICTED: proteasome subunit beta type-5-like     298   2e-98    Nelumbo nucifera [Indian lotus]
ref|XP_006842100.1|  hypothetical protein AMTR_s00078p00083100          298   3e-98    
ref|XP_002876966.1|  hypothetical protein ARALYDRAFT_484397             296   6e-98    
ref|XP_003526966.1|  PREDICTED: proteasome subunit beta type-5-like     296   6e-98    Glycine max [soybeans]
gb|KDO81953.1|  hypothetical protein CISIN_1g022125mg                   294   7e-98    Citrus sinensis [apfelsine]
ref|XP_007137929.1|  hypothetical protein PHAVU_009G167300g             295   2e-97    Phaseolus vulgaris [French bean]
ref|XP_010905449.1|  PREDICTED: proteasome subunit beta type-5-like     295   2e-97    Elaeis guineensis
gb|KHN31904.1|  Proteasome subunit beta type-5                          295   2e-97    Glycine soja [wild soybean]
gb|ABK25888.1|  unknown                                                 295   2e-97    Picea sitchensis
gb|ACU23791.1|  unknown                                                 295   3e-97    Glycine max [soybeans]
gb|ACP43315.1|  20S proteasome beta subunit 5                           294   7e-97    Citrus maxima [buntan]
ref|XP_006484070.1|  PREDICTED: proteasome subunit beta type-5-B-...    294   7e-97    Citrus sinensis [apfelsine]
ref|XP_002315619.1|  20S proteasome beta subunit family protein         294   7e-97    Populus trichocarpa [western balsam poplar]
gb|AFK46055.1|  unknown                                                 293   1e-96    Lotus japonicus
ref|XP_006438069.1|  hypothetical protein CICLE_v10032238mg             293   1e-96    Citrus clementina [clementine]
gb|ABK25785.1|  unknown                                                 293   2e-96    Picea sitchensis
ref|XP_008806245.1|  PREDICTED: proteasome subunit beta type-5-like     293   2e-96    Phoenix dactylifera
ref|XP_006438071.1|  hypothetical protein CICLE_v10032238mg             293   2e-96    
ref|XP_004135309.1|  PREDICTED: proteasome subunit beta type-5-like     293   2e-96    Cucumis sativus [cucumbers]
ref|XP_011041516.1|  PREDICTED: proteasome subunit beta type-5-B-...    293   2e-96    Populus euphratica
ref|XP_010912107.1|  PREDICTED: proteasome subunit beta type-5-like     292   3e-96    Elaeis guineensis
ref|XP_003523139.1|  PREDICTED: proteasome subunit beta type-5-li...    292   3e-96    Glycine max [soybeans]
gb|KGN51684.1|  hypothetical protein Csa_5G590010                       293   3e-96    Cucumis sativus [cucumbers]
ref|XP_009118034.1|  PREDICTED: proteasome subunit beta type-5-B-...    292   3e-96    Brassica rapa
ref|XP_010476293.1|  PREDICTED: proteasome subunit beta type-5-A-...    292   5e-96    Camelina sativa [gold-of-pleasure]
ref|XP_010458748.1|  PREDICTED: proteasome subunit beta type-5-A-...    291   6e-96    Camelina sativa [gold-of-pleasure]
ref|XP_011457464.1|  PREDICTED: proteasome subunit beta type-5-like     291   6e-96    Fragaria vesca subsp. vesca
ref|XP_003602092.1|  Proteasome subunit beta type                       291   7e-96    Medicago truncatula
ref|XP_010494920.1|  PREDICTED: proteasome subunit beta type-5-A        291   8e-96    Camelina sativa [gold-of-pleasure]
ref|XP_006305519.1|  hypothetical protein CARUB_v10009991mg             291   9e-96    Capsella rubella
ref|XP_002889982.1|  hypothetical protein ARALYDRAFT_471459             290   2e-95    
gb|AFK34329.1|  unknown                                                 289   4e-95    Medicago truncatula
gb|ACJ85344.1|  unknown                                                 289   4e-95    Medicago truncatula
ref|NP_172765.1|  20S proteasome beta subunit E1                        290   4e-95    Arabidopsis thaliana [mouse-ear cress]
gb|AFK38197.1|  unknown                                                 289   6e-95    Medicago truncatula
ref|XP_002514943.1|  proteasome subunit beta type 5,8, putative         288   6e-95    
gb|AAK92808.1|  putative proteasome epsilon chain precursor             289   6e-95    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001184978.1|  20S proteasome beta subunit E1                     277   8e-90    Arabidopsis thaliana [mouse-ear cress]
gb|KDO81951.1|  hypothetical protein CISIN_1g022125mg                   274   8e-89    Citrus sinensis [apfelsine]
ref|XP_006655798.1|  PREDICTED: proteasome subunit beta type-5-A-...    273   1e-88    Oryza brachyantha
ref|XP_006484069.1|  PREDICTED: proteasome subunit beta type-5-B-...    273   2e-88    Citrus sinensis [apfelsine]
gb|AFW85805.1|  hypothetical protein ZEAMMB73_646691                    269   4e-88    
ref|XP_006438070.1|  hypothetical protein CICLE_v10032238mg             272   4e-88    
ref|XP_010912828.1|  PREDICTED: proteasome subunit beta type-5-like     271   6e-88    Elaeis guineensis
gb|AFW85803.1|  hypothetical protein ZEAMMB73_646691                    269   3e-87    
ref|NP_001132821.1|  uncharacterized protein LOC100194311               269   6e-87    Zea mays [maize]
ref|XP_004964820.1|  PREDICTED: proteasome subunit beta type-5-A-...    268   2e-86    Setaria italica
gb|ACU51028.1|  20S proteasome beta5 subunit                            268   2e-86    Conocephalum conicum
ref|XP_001759925.1|  predicted protein                                  267   2e-86    
dbj|BAA96838.1|  beta 5 subunit of 20S proteasome                       267   4e-86    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002437853.1|  hypothetical protein SORBIDRAFT_10g003770          266   4e-86    Sorghum bicolor [broomcorn]
ref|XP_008791726.1|  PREDICTED: proteasome subunit beta type-5-like     266   6e-86    Phoenix dactylifera
gb|EEE65108.1|  hypothetical protein OsJ_20167                          266   8e-86    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001056842.1|  Os06g0153800                                       265   1e-85    
gb|EEC80034.1|  hypothetical protein OsI_21721                          265   1e-85    Oryza sativa Indica Group [Indian rice]
ref|XP_010440898.1|  PREDICTED: proteasome subunit beta type-5-B-...    260   2e-85    
ref|XP_002972642.1|  hypothetical protein SELMODRAFT_270977             254   4e-81    Selaginella moellendorffii
ref|XP_002994143.1|  hypothetical protein SELMODRAFT_272351             254   4e-81    Selaginella moellendorffii
ref|XP_003564317.1|  PREDICTED: proteasome subunit beta type-5-A-...    253   6e-81    Brachypodium distachyon [annual false brome]
gb|AAU82107.1|  20S proteasome beta 5 subunit                           252   3e-80    Triticum aestivum [Canadian hard winter wheat]
dbj|BAJ97061.1|  predicted protein                                      250   1e-79    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAT44125.1|  20S proteasome beta subunit E                           245   2e-79    Saussurea medusa
dbj|BAG92607.1|  unnamed protein product                                241   6e-77    Oryza sativa Japonica Group [Japonica rice]
ref|XP_001751936.1|  predicted protein                                  241   8e-77    
gb|AAT80906.1|  26S proteasome beta subunit                             233   2e-75    Lemna minor
gb|EMS57921.1|  Proteasome subunit beta type-5                          231   5e-73    Triticum urartu
ref|XP_003061052.1|  predicted protein                                  231   4e-72    Micromonas pusilla CCMP1545
ref|XP_001421201.1|  predicted protein                                  231   5e-72    Ostreococcus lucimarinus CCE9901
ref|XP_002506817.1|  predicted protein                                  230   2e-71    Micromonas commoda
gb|EMT01588.1|  Proteasome subunit beta type-5-A                        245   4e-71    
ref|XP_007514496.1|  predicted protein                                  229   5e-71    Bathycoccus prasinos
ref|XP_003083185.1|  20S proteasome, regulatory subunit beta type...    228   6e-71    Ostreococcus tauri
ref|XP_005851025.1|  hypothetical protein CHLNCDRAFT_56983              226   3e-70    Chlorella variabilis
gb|ABD61730.2|  26S proteasome beta subunit                             217   1e-68    Lupinus albus
ref|XP_002950006.1|  hypothetical protein VOLCADRAFT_74437              221   2e-68    Volvox carteri f. nagariensis
ref|XP_005643539.1|  20S proteasome beta subunit E, type beta 5         221   3e-68    Coccomyxa subellipsoidea C-169
ref|XP_001698605.1|  20S proteasome beta subunit E, type beta 5         221   3e-68    Chlamydomonas reinhardtii
ref|XP_011396916.1|  Proteasome subunit beta type-5-B                   218   4e-67    Auxenochlorella protothecoides
ref|NP_001265983.1|  proteasome subunit beta type-5-like                213   1e-65    Cicer arietinum [garbanzo]
gb|KDD75121.1|  proteasome subunit protein                              210   2e-64    Helicosporidium sp. ATCC 50920
gb|AAL26914.1|AF323592_1  putative 20S proteasome beta subunit 5        205   5e-63    Prunus persica
emb|CAC43326.1|  putative beta5 proteasome subunit                      204   8e-63    Nicotiana tabacum [American tobacco]
gb|ABE68720.1|  20S proteasome beta subunit                             202   1e-61    Arachis hypogaea [goober]
gb|EIE77859.1|  proteasome component PRE2                               202   7e-61    Rhizopus delemar RA 99-880
gb|EPB87271.1|  proteasome component PRE2                               200   3e-60    Mucor circinelloides f. circinelloides 1006PhL
dbj|GAN10935.1|  20S proteasome subunit                                 200   3e-60    Mucor ambiguus
emb|CBY21147.1|  unnamed protein product                                201   3e-60    Oikopleura dioica
emb|CEP17612.1|  hypothetical protein                                   200   4e-60    Parasitella parasitica
gb|AAS01050.1|  putative proteasome 20S beta5 subunit                   196   5e-60    Brassica napus [oilseed rape]
emb|CEG76258.1|  Putative Proteasome subunit beta type                  198   7e-60    Rhizopus microsporus
emb|CEG76257.1|  Putative Proteasome subunit beta type                  198   2e-59    Rhizopus microsporus
emb|CEJ04297.1|  Putative Proteasome subunit beta type                  196   2e-59    Rhizopus microsporus
ref|XP_002111558.1|  hypothetical protein TRIADDRAFT_55706              198   2e-59    Trichoplax adhaerens
ref|XP_002162379.2|  PREDICTED: proteasome subunit beta type-5-like     198   3e-59    Hydra vulgaris
gb|ACP43316.1|  20S proteasome beta subunit 5                           195   3e-59    Citrus maxima [buntan]
ref|XP_002889983.1|  hypothetical protein ARALYDRAFT_888660             192   5e-59    
gb|AAM18885.1|AF391293_2  unknown                                       197   6e-59    Branchiostoma floridae
ref|XP_002290272.1|  proteasome subunit beta type 5 precursor           196   1e-58    Thalassiosira pseudonana CCMP1335
ref|XP_001730616.1|  hypothetical protein MGL_2412                      197   1e-58    Malassezia globosa CBS 7966
ref|XP_005537552.1|  20S core proteasome subunit beta 5                 197   1e-58    Cyanidioschyzon merolae strain 10D
ref|XP_002730946.1|  PREDICTED: proteasome subunit beta type-5-like     196   1e-58    Saccoglossus kowalevskii
ref|XP_003801967.1|  PREDICTED: proteasome subunit beta type-5          196   1e-58    Otolemur garnettii
gb|ELT88834.1|  hypothetical protein CAPTEDRAFT_150903                  196   2e-58    Capitella teleta
emb|CDH56820.1|  20s proteasome subunit                                 196   2e-58    Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_009038619.1|  hypothetical protein AURANDRAFT_28593              196   2e-58    Aureococcus anophagefferens
gb|ELU16739.1|  hypothetical protein CAPTEDRAFT_41193                   191   2e-58    Capitella teleta
ref|XP_004474611.1|  PREDICTED: proteasome subunit beta type-5          195   3e-58    Dasypus novemcinctus
ref|XP_005875924.1|  PREDICTED: proteasome subunit beta type-5-like     195   3e-58    Myotis brandtii
gb|KFH71396.1|  20S proteasome subunit beta 5                           195   4e-58    Mortierella verticillata NRRL 6337
ref|XP_004694702.1|  PREDICTED: proteasome subunit beta type-5 is...    192   4e-58    
ref|XP_005338834.1|  PREDICTED: proteasome subunit beta type-5          192   4e-58    
dbj|BAA06097.1|  proteasome subunit X                                   192   5e-58    Homo sapiens [man]
gb|AAP36588.1|  Homo sapiens proteasome (prosome, macropain) subu...    192   5e-58    synthetic construct
ref|XP_004313402.1|  PREDICTED: proteasome subunit beta type-5 is...    192   5e-58    
ref|XP_008564788.1|  PREDICTED: proteasome subunit beta type-5          194   5e-58    Galeopterus variegatus [Malayan flying lemur]
ref|XP_008065987.1|  PREDICTED: proteasome subunit beta type-5          194   6e-58    Carlito syrichta
ref|XP_006957104.1|  20S proteasome subunit                             195   6e-58    Wallemia mellicola CBS 633.66
ref|XP_002678668.1|  predicted protein                                  195   6e-58    Naegleria gruberi strain NEG-M
ref|XP_009061521.1|  hypothetical protein LOTGIDRAFT_166223             194   6e-58    Lottia gigantea
ref|XP_007100517.1|  PREDICTED: proteasome subunit beta type-5 is...    194   7e-58    Physeter catodon
gb|EJU05281.1|  proteasome-domain-containing protein                    195   7e-58    Dacryopinax primogenitus
ref|XP_006776843.1|  PREDICTED: proteasome subunit beta type-5          194   7e-58    Myotis davidii
ref|XP_006100131.1|  PREDICTED: proteasome subunit beta type-5          194   8e-58    Myotis lucifugus
ref|XP_004283228.1|  PREDICTED: proteasome subunit beta type-5 is...    193   9e-58    Orcinus orca [Orca]
ref|XP_008156742.1|  PREDICTED: proteasome subunit beta type-5 is...    193   1e-57    Eptesicus fuscus
ref|XP_004313401.1|  PREDICTED: proteasome subunit beta type-5 is...    193   1e-57    Tursiops truncatus [Atlantic bottle-nosed dolphin]
ref|XP_007449602.1|  PREDICTED: proteasome subunit beta type-5 is...    193   1e-57    Lipotes vexillifer [baiji]
ref|XP_006144566.1|  PREDICTED: proteasome subunit beta type-5          193   1e-57    Tupaia chinensis
ref|XP_004565403.1|  PREDICTED: proteasome subunit beta type-5-like     193   1e-57    
ref|XP_007006996.1|  hypothetical protein TREMEDRAFT_34309              194   1e-57    Tremella mesenterica DSM 1558
ref|XP_003332961.2|  20S proteasome subunit beta 5                      194   1e-57    Puccinia graminis f. sp. tritici CRL 75-36-700-3
ref|XP_005740284.1|  PREDICTED: proteasome subunit beta type-5-like     194   1e-57    Pundamilia nyererei
ref|XP_005933706.1|  PREDICTED: proteasome subunit beta type-5-like     194   1e-57    Haplochromis burtoni
ref|XP_003987515.1|  PREDICTED: proteasome subunit beta type-5          193   1e-57    Felis catus [cat]
ref|XP_010781265.1|  PREDICTED: proteasome subunit beta type-5          193   1e-57    Notothenia coriiceps [yellowbelly rockcod]
ref|XP_003924370.1|  PREDICTED: proteasome subunit beta type-5          193   2e-57    Saimiri boliviensis boliviensis
pdb|4R3O|L  Chain L, Human Constitutive 20s Proteasome                  191   2e-57    Homo sapiens [man]
ref|XP_005978060.1|  PREDICTED: proteasome subunit beta type-5 is...    193   2e-57    Pantholops hodgsonii [Tibetan antelope]
ref|XP_003457456.2|  PREDICTED: proteasome subunit beta type-5-like     193   2e-57    Oreochromis niloticus
ref|XP_009021669.1|  hypothetical protein HELRODRAFT_83371              192   2e-57    Helobdella robusta
ref|XP_002718121.1|  PREDICTED: proteasome subunit beta type-5 is...    193   2e-57    Oryctolagus cuniculus [domestic rabbit]
ref|XP_005882305.1|  PREDICTED: proteasome subunit beta type-5          193   2e-57    Myotis brandtii
dbj|BAA08204.1|  proteasome subunit RCX                                 191   2e-57    Rattus rattus [house rat]
ref|XP_004010385.1|  PREDICTED: proteasome subunit beta type-5          192   2e-57    Ovis aries [domestic sheep]
gb|EJK48257.1|  hypothetical protein THAOC_32963                        192   2e-57    Thalassiosira oceanica
pdb|1IRU|L  Chain L, Crystal Structure Of The Mammalian 20s Prote...    191   2e-57    Bos taurus [bovine]
ref|XP_004694701.1|  PREDICTED: proteasome subunit beta type-5 is...    192   2e-57    Condylura cristata
ref|XP_004609529.1|  PREDICTED: proteasome subunit beta type-5          192   2e-57    Sorex araneus [Eurasian shrew]
ref|XP_008708757.1|  PREDICTED: proteasome subunit beta type-5          192   2e-57    Ursus maritimus [white bear]
ref|XP_004584741.1|  PREDICTED: proteasome subunit beta type-5          192   2e-57    Ochotona princeps [southern American pika]
ref|XP_006988553.1|  PREDICTED: proteasome subunit beta type-5          192   2e-57    Peromyscus maniculatus bairdii
ref|XP_009265754.1|  Proteasome component PRE2                          193   2e-57    Wallemia ichthyophaga EXF-994
ref|XP_004755394.1|  PREDICTED: proteasome subunit beta type-5 is...    192   2e-57    Mustela putorius furo [black ferret]
ref|XP_003639276.1|  PREDICTED: proteasome subunit beta type-5          192   2e-57    Canis lupus familiaris [dogs]
ref|XP_005978061.1|  PREDICTED: proteasome subunit beta type-5 is...    192   2e-57    Pantholops hodgsonii [Tibetan antelope]
ref|XP_007180616.1|  PREDICTED: proteasome subunit beta type-5          192   2e-57    Balaenoptera acutorostrata scammoni
ref|XP_002926051.1|  PREDICTED: proteasome subunit beta type-5          192   3e-57    Ailuropoda melanoleuca
ref|XP_001494538.2|  PREDICTED: proteasome subunit beta type-5 is...    192   3e-57    
ref|XP_007989004.1|  PREDICTED: proteasome subunit beta type-5 is...    192   3e-57    Chlorocebus sabaeus
ref|XP_007418509.1|  20S proteasome subunit                             193   3e-57    Melampsora larici-populina 98AG31
ref|XP_008527207.1|  PREDICTED: proteasome subunit beta type-5          192   3e-57    Equus przewalskii [Przewalski horse]
ref|XP_004421295.1|  PREDICTED: proteasome subunit beta type-5          192   3e-57    Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_005139397.1|  PREDICTED: LOW QUALITY PROTEIN: proteasome (...    192   3e-57    
ref|XP_010376681.1|  PREDICTED: proteasome subunit beta type-5          192   3e-57    Rhinopithecus roxellana
ref|XP_003506173.1|  PREDICTED: proteasome subunit beta type-5          192   3e-57    Cricetulus griseus [Chinese hamsters]
ref|XP_002753673.3|  PREDICTED: proteasome subunit beta type-5          192   3e-57    Callithrix jacchus [common marmoset]
ref|NP_001099197.2|  proteasome subunit beta type-5                     192   4e-57    Rattus norvegicus [brown rat]
ref|XP_006802789.1|  PREDICTED: proteasome subunit beta type-5-like     192   4e-57    Neolamprologus brichardi [lyretail cichlid]
ref|XP_010744420.1|  PREDICTED: proteasome subunit beta type-5          192   4e-57    
ref|NP_001247774.1|  proteasome subunit beta type-5                     192   4e-57    Macaca mulatta [rhesus macaque]
ref|XP_009242876.1|  PREDICTED: proteasome subunit beta type-5-like     192   4e-57    Pongo abelii [orang utan]
ref|XP_010636092.1|  PREDICTED: proteasome subunit beta type-5          192   4e-57    Fukomys damarensis [Damara mole rat]
ref|XP_008036606.1|  proteasome component pts1                          193   5e-57    Trametes versicolor FP-101664 SS1
gb|KDQ60928.1|  hypothetical protein JAAARDRAFT_125152                  193   5e-57    Jaapia argillacea MUCL 33604
ref|NP_002788.1|  proteasome subunit beta type-5 isoform 1              192   5e-57    Homo sapiens [man]
ref|XP_007395513.1|  hypothetical protein PHACADRAFT_255622             192   5e-57    Phanerochaete carnosa HHB-10118-sp
gb|AAB87680.1|  proteasome subunit X                                    190   5e-57    Danio rerio [leopard danio]
ref|XP_005809292.1|  PREDICTED: proteasome subunit beta type-5-like     192   5e-57    Xiphophorus maculatus
ref|XP_004054980.1|  PREDICTED: proteasome subunit beta type-5 is...    191   5e-57    Gorilla gorilla gorilla [lowland gorilla]
ref|XP_003260670.1|  PREDICTED: proteasome subunit beta type-5 is...    191   5e-57    Nomascus leucogenys [White-cheeked Gibbon]
ref|XP_004879937.1|  PREDICTED: proteasome subunit beta type-5          191   6e-57    
gb|ELR56586.1|  Proteasome subunit beta type-5                          191   6e-57    Bos mutus
gb|ADO27969.1|  proteasome subunit beta type-5                          191   6e-57    Ictalurus furcatus
ref|XP_005370537.1|  PREDICTED: proteasome subunit beta type-5          191   6e-57    Microtus ochrogaster [prairie voles]
ref|XP_004402154.1|  PREDICTED: proteasome subunit beta type-5          191   6e-57    Odobenus rosmarus divergens
emb|CCO27714.1|  20S proteasome subunit beta 5                          192   6e-57    Rhizoctonia solani AG-1 IB
emb|CAD97956.1|  hypothetical protein                                   191   6e-57    Homo sapiens [man]
ref|XP_002179855.1|  predicted protein                                  192   6e-57    Phaeodactylum tricornutum CCAP 1055/1
emb|CAA66313.1|  LMP7-like protein                                      191   6e-57    Botryllus schlosseri
gb|KDE05583.1|  proteasome component PRE2                               193   6e-57    Microbotryum lychnidis-dioicae p1A1 Lamole
ref|XP_003474544.1|  PREDICTED: proteasome subunit beta type-5          191   6e-57    Cavia porcellus [guinea pig]
emb|CCU99044.1|  unnamed protein product                                191   6e-57    Malassezia sympodialis ATCC 42132
ref|XP_004054982.1|  PREDICTED: proteasome subunit beta type-5 is...    191   6e-57    
ref|NP_001032701.1|  proteasome subunit beta type-5                     191   7e-57    Bos taurus [bovine]
ref|XP_006066544.1|  PREDICTED: proteasome subunit beta type-5          191   7e-57    Bubalus bubalis [domestic water buffalo]
ref|XP_004661842.1|  PREDICTED: proteasome subunit beta type-5          191   7e-57    Jaculus jaculus
gb|ACO09253.1|  Proteasome subunit beta type 5 precursor                190   8e-57    Osmerus mordax
gb|AAD53518.1|AF155578_1  proteasome subunit beta 5                     191   8e-57    Danio rerio [leopard danio]
emb|CAQ14651.1|  proteasome (prosome, macropain) subunit, beta ty...    191   8e-57    Danio rerio [leopard danio]
ref|XP_006682354.1|  hypothetical protein BATDEDRAFT_14510              191   8e-57    Batrachochytrium dendrobatidis JAM81
ref|XP_006913661.1|  PREDICTED: proteasome subunit beta type-5          191   8e-57    Pteropus alecto
ref|NP_571226.1|  proteasome subunit beta type-5                        191   9e-57    Danio rerio [leopard danio]
gb|AAI53590.1|  Psmb5 protein                                           191   9e-57    Danio rerio [leopard danio]
ref|XP_007536740.1|  PREDICTED: proteasome subunit beta type-5          191   9e-57    Erinaceus europaeus [common hedgehog]
ref|XP_003755883.1|  PREDICTED: proteasome subunit beta type-5          191   9e-57    Sarcophilus harrisii
ref|XP_008838115.1|  PREDICTED: proteasome subunit beta type-5          191   9e-57    Nannospalax galili
pdb|3UNB|K  Chain K, Mouse Constitutive 20s Proteasome In Complex...    189   9e-57    Mus musculus [mouse]
sp|P28075.3|PSB5_RAT  RecName: Full=Proteasome subunit beta type-...    191   1e-56    Rattus norvegicus [brown rat]
ref|XP_007552653.1|  PREDICTED: proteasome subunit beta type-5          192   1e-56    Poecilia formosa
gb|AAB33092.1|  proteasome subunit MB1                                  189   1e-56    Homo sapiens [man]
ref|XP_007258118.1|  PREDICTED: proteasome subunit beta type-5-li...    191   1e-56    
ref|XP_002941560.1|  PREDICTED: proteasome subunit beta type-5          191   1e-56    Xenopus tropicalis [western clawed frog]
ref|XP_004646709.1|  PREDICTED: proteasome subunit beta type-5          191   1e-56    Octodon degus
gb|AAI55951.1|  LOC100127332 protein                                    190   1e-56    Xenopus laevis [clawed frog]
ref|XP_008431210.1|  PREDICTED: proteasome subunit beta type-5          191   1e-56    
ref|XP_007863011.1|  20S proteasome subunit                             192   1e-56    Gloeophyllum trabeum ATCC 11539
emb|CCM00020.1|  predicted protein                                      192   1e-56    Fibroporia radiculosa
ref|XP_001924480.2|  PREDICTED: proteasome subunit beta type-5          191   1e-56    Sus scrofa [pigs]
ref|XP_006217298.1|  PREDICTED: proteasome subunit beta type-5          191   1e-56    Vicugna pacos
gb|AAY98499.1|  LMP X                                                   191   1e-56    Swiftia exserta
emb|CAF97719.1|  unnamed protein product                                191   1e-56    Tetraodon nigroviridis
ref|XP_001509497.1|  PREDICTED: proteasome subunit beta type-5          190   1e-56    Ornithorhynchus anatinus [duck-billed platypus]
dbj|BAE93066.1|  low molecular mass polypeptide                         188   1e-56    Lethenteron camtschaticum [Japanese lamprey]
ref|XP_008332973.1|  PREDICTED: proteasome subunit beta type-5          191   2e-56    Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_003977752.1|  PREDICTED: proteasome subunit beta type-5-like     191   2e-56    
gb|KIY65291.1|  proteasome-domain-containing protein                    192   2e-56    
emb|CCF49354.1|  probable PRE2-20S core proteasome subunit (beta5)      192   2e-56    
ref|NP_035316.1|  proteasome subunit beta type-5                        190   2e-56    
gb|AAH12246.1|  Proteasome (prosome, macropain) subunit, beta type 5    190   2e-56    
ref|XP_002132107.1|  PREDICTED: proteasome subunit beta type-5          191   2e-56    
gb|KEP54479.1|  proteasome subunit beta type-5 protein                  191   2e-56    
gb|EUC61688.1|  proteasome subunit beta type-5 protein                  191   2e-56    
ref|XP_008292170.1|  PREDICTED: proteasome subunit beta type-5          190   2e-56    
ref|XP_004389982.1|  PREDICTED: proteasome subunit beta type-5          190   2e-56    
ref|XP_003421032.1|  PREDICTED: proteasome subunit beta type-5          190   2e-56    
ref|XP_001626004.1|  predicted protein                                  190   2e-56    
gb|EMS25821.1|  20S proteasome subunit beta 5                           191   3e-56    
ref|XP_006835507.1|  PREDICTED: proteasome subunit beta type-5          190   3e-56    
ref|XP_007949373.1|  PREDICTED: proteasome subunit beta type-5 is...    190   3e-56    
gb|ESA00717.1|  hypothetical protein GLOINDRAFT_338395                  191   3e-56    
ref|XP_005713380.1|  20S core proteasome subunit beta 5                 190   3e-56    
ref|XP_010870425.1|  PREDICTED: proteasome subunit beta type-5-like     190   3e-56    
gb|KIJ17479.1|  hypothetical protein PAXINDRAFT_168130                  191   3e-56    
gb|EDL31171.1|  mCG118255                                               188   3e-56    
ref|XP_007326468.1|  hypothetical protein AGABI1DRAFT_111072            191   4e-56    
ref|XP_004698955.1|  PREDICTED: proteasome subunit beta type-5          189   4e-56    
ref|XP_006457891.1|  20S proteasome subunit                             191   4e-56    
emb|CDQ86611.1|  unnamed protein product                                189   5e-56    
ref|XP_004994692.1|  LMP X protein                                      190   5e-56    
ref|XP_007880004.1|  hypothetical protein PFL1_04286                    191   5e-56    
gb|KDQ18004.1|  hypothetical protein BOTBODRAFT_104582                  190   6e-56    
gb|KIL00906.1|  hypothetical protein PAXRUDRAFT_821100                  190   6e-56    
emb|CDQ73245.1|  unnamed protein product                                189   6e-56    
gb|KDQ33416.1|  hypothetical protein PLEOSDRAFT_1110569                 190   6e-56    
ref|XP_008121563.1|  PREDICTED: proteasome subunit beta type-5          189   6e-56    
ref|XP_001379940.1|  PREDICTED: proteasome subunit beta type-5          189   7e-56    
ref|XP_005707411.1|  20S proteasome subunit beta 5                      189   7e-56    
gb|KII89158.1|  hypothetical protein PLICRDRAFT_109139                  190   7e-56    
gb|ACH85299.1|  proteasome (prosome, macropain) subunit beta type 5     189   7e-56    
gb|KDR73611.1|  hypothetical protein GALMADRAFT_124865                  190   7e-56    
gb|ACM08263.1|  Proteasome subunit beta type-5 precursor                189   7e-56    
gb|ACI67172.1|  Proteasome subunit beta type-5 precursor                189   7e-56    
dbj|BAB26942.1|  unnamed protein product                                189   8e-56    
ref|XP_004333043.1|  proteasome endopeptidase subunit, putative         189   8e-56    
gb|KIK08153.1|  hypothetical protein K443DRAFT_672633                   190   8e-56    
ref|XP_007439509.1|  PREDICTED: proteasome subunit beta type-5          188   8e-56    
gb|KIM65350.1|  hypothetical protein SCLCIDRAFT_542814                  190   9e-56    
gb|KIK59625.1|  hypothetical protein GYMLUDRAFT_201809                  189   9e-56    
gb|ACM08758.1|  Proteasome subunit beta type-5 precursor                189   9e-56    
gb|EST08741.1|  20S proteasome, regulatory subunit beta type PSMB...    191   1e-55    
ref|XP_004347536.2|  hypothetical protein CAOG_04785                    189   1e-55    
ref|XP_001875479.1|  20S proteasome subunit                             189   1e-55    
ref|XP_007385467.1|  N-terminal nucleophile aminohydrolase              190   1e-55    
ref|XP_005994469.1|  PREDICTED: proteasome subunit beta type-5-like     188   1e-55    
ref|XP_007361365.1|  N-terminal nucleophile aminohydrolase              189   1e-55    
emb|CBN74512.1|  conserved unknown protein                              189   1e-55    
ref|XP_006883201.1|  PREDICTED: proteasome subunit beta type-5          188   1e-55    
emb|CDI55907.1|  probable PRE2-20S core proteasome subunit (beta5...    189   2e-55    
ref|XP_007764597.1|  20S proteasome subunit                             189   2e-55    
ref|XP_007850837.1|  proteasome component pre2 precursor                189   2e-55    
ref|XP_009541838.1|  subunit beta type peptidase T1A, 20S proteasome    189   2e-55    
gb|AAL74417.1|  proteosome PSMB5/8 protein                              185   2e-55    
ref|XP_002911819.1|  proteasome component pts1                          189   2e-55    
dbj|BAA10932.1|  LMPX of lamprey                                        187   2e-55    
gb|KFH65162.1|  20S proteasome subunit beta 5                           187   2e-55    
gb|KJA27011.1|  hypothetical protein HYPSUDRAFT_35526                   189   2e-55    
ref|XP_011441202.1|  PREDICTED: proteasome subunit beta type-5-like     187   2e-55    
emb|CDO73558.1|  hypothetical protein BN946_scf185014.g28               189   2e-55    
gb|KIJ69319.1|  hypothetical protein HYDPIDRAFT_79749                   189   3e-55    
emb|CAA66312.1|  LMP7-like protein                                      187   3e-55    
ref|NP_001270574.1|  uncharacterized protein LOC101865806               187   3e-55    
gb|ABQ50544.1|  hypothetical protein                                    185   5e-55    
ref|XP_011391773.1|  putative proteasome core particle subunit be...    187   5e-55    
ref|XP_007321997.1|  hypothetical protein SERLADRAFT_475676             188   5e-55    
dbj|BAA10935.1|  nurse shark LMPX                                       186   6e-55    
gb|KIO13433.1|  hypothetical protein M404DRAFT_122218                   187   6e-55    
gb|KDN39743.1|  putative PRE2-20S core proteasome subunit               187   7e-55    
ref|XP_006175925.1|  PREDICTED: proteasome subunit beta type-5          186   7e-55    
gb|EWM22648.1|  proteasome subunit beta type 5                          186   7e-55    
gb|KIP12266.1|  hypothetical protein PHLGIDRAFT_17679                   187   9e-55    
ref|XP_007319616.1|  hypothetical protein SERLADRAFT_470232             187   1e-54    
ref|XP_005290231.1|  PREDICTED: proteasome subunit beta type-5          186   1e-54    
ref|XP_007300583.1|  N-terminal nucleophile aminohydrolase              187   1e-54    
gb|KIY43500.1|  N-terminal nucleophile aminohydrolase                   187   1e-54    
gb|EPS96804.1|  hypothetical protein FOMPIDRAFT_1025230                 187   1e-54    
dbj|BAA10931.1|  LMPX of hagfish                                        186   1e-54    
gb|KIK46362.1|  hypothetical protein CY34DRAFT_420304                   186   2e-54    
emb|CCA68455.1|  probable PRE2-20S core proteasome subunit (beta5...    186   3e-54    
dbj|GAC98484.1|  20S proteasome subunit                                 191   3e-54    
gb|KIM79653.1|  hypothetical protein PILCRDRAFT_823192                  186   3e-54    
gb|KIL61310.1|  hypothetical protein M378DRAFT_861259                   186   4e-54    
ref|XP_006036581.1|  PREDICTED: proteasome subunit beta type-5          184   4e-54    
ref|XP_005110562.1|  PREDICTED: proteasome subunit beta type-5-like     185   4e-54    
ref|XP_003036093.1|  hypothetical protein SCHCODRAFT_81440              186   4e-54    
gb|ACM09015.1|  Proteasome subunit beta type-5 precursor                184   4e-54    
gb|ADL27419.1|  proteasome subunit beta type                            184   6e-54    
emb|CBQ69839.1|  probable PRE2-20S core proteasome subunit (beta5)      185   6e-54    
ref|XP_006261242.1|  PREDICTED: proteasome subunit beta type-5          184   6e-54    
ref|XP_002435468.1|  20S proteasome, regulatory subunit beta, put...    184   8e-54    
ref|XP_628966.1|  proteasome subunit beta type 5                        183   9e-54    
ref|XP_001745267.1|  hypothetical protein                               182   1e-53    
ref|XP_008301219.1|  PREDICTED: proteasome subunit beta type-8          183   1e-53    
dbj|GAA98585.1|  hypothetical protein E5Q_05272                         184   1e-53    
gb|KIJ26450.1|  hypothetical protein M422DRAFT_236567                   184   2e-53    
ref|XP_003388964.1|  PREDICTED: proteasome subunit beta type-5-like     183   2e-53    
ref|XP_008329167.1|  PREDICTED: proteasome subunit beta type-8 is...    182   2e-53    
ref|XP_005778345.1|  hypothetical protein EMIHUDRAFT_443537             182   2e-53    
ref|NP_001117007.1|  proteasome subunit beta type 7b                    182   3e-53    
emb|CDQ57423.1|  unnamed protein product                                182   3e-53    
dbj|BAD89554.1|  proteasome subunit                                     182   4e-53    
gb|KJE01830.1|  proteasome subunit beta type-5                          182   4e-53    
gb|AHF22837.1|  PSMB8 proteasome subunit beta type 8                    182   4e-53    
emb|CAA40494.1|  proteasome C1 subunit                                  179   4e-53    
gb|ABQ01989.1|  proteasome subunit beta type 8                          182   4e-53    
gb|ACI67854.1|  Proteasome subunit beta type-8 precursor                182   4e-53    
ref|XP_005825075.1|  20S proteasome subunit beta type 5                 182   5e-53    
emb|CBK22690.2|  unnamed protein product                                181   7e-53    
gb|EIF47547.1|  proteasome component pre2 precursor                     181   8e-53    
ref|XP_003287743.1|  proteasome subunit beta type 5                     181   8e-53    
gb|ETS60462.1|  hypothetical protein PaG_05302                          187   1e-52    
gb|EMD38457.1|  20S proteasome subunit                                  182   1e-52    
ref|NP_001264655.1|  proteasome subunit beta type-5                     180   1e-52    
ref|XP_007100520.1|  PREDICTED: proteasome subunit beta type-5 is...    178   1e-52    
gb|AAG43439.1|AF184937_1  low molecular mass protein 7                  180   2e-52    
gb|EPY87607.1|  proteasome subunit beta type-5-like isoform 1           178   2e-52    
ref|XP_007723577.1|  proteasome component PRE2                          181   2e-52    
gb|KIR99960.1|  proteasome subunit beta type-5                          181   2e-52    
ref|XP_003194765.1|  proteasome component                               181   2e-52    
ref|XP_571562.1|  proteasome component pts1                             181   2e-52    
sp|P34065.2|PSB5_CHICK  RecName: Full=Proteasome subunit beta typ...    180   2e-52    
gb|AFR96090.1|  proteasome component PRE2                               182   2e-52    
ref|XP_005267928.1|  PREDICTED: proteasome subunit beta type-5 is...    177   2e-52    
gb|KFH47961.1|  Proteasome subunit beta type-like protein               180   2e-52    
gb|EFA82937.1|  proteasome subunit beta type 5                          180   3e-52    
dbj|BAH29665.1|  proteasome subunit, beta type 8                        179   3e-52    
gb|KDR22252.1|  Proteasome subunit beta type-5                          180   3e-52    
dbj|BAO00928.1|  proteasome subunit beta type 8,V-type                  178   3e-52    
ref|XP_010747117.1|  PREDICTED: proteasome subunit beta type-8          180   3e-52    
ref|XP_007264066.1|  N-terminal nucleophile aminohydrolase              181   3e-52    
gb|EAW66194.1|  proteasome (prosome, macropain) subunit, beta typ...    176   3e-52    
gb|ACQ58835.1|  Proteasome subunit beta type-8 precursor                179   3e-52    
gb|KIW62885.1|  proteasome subunit beta type-5                          180   3e-52    
ref|XP_011276949.1|  Proteasome subunit beta type-5                     180   4e-52    
ref|XP_007449603.1|  PREDICTED: proteasome subunit beta type-5 is...    177   4e-52    
dbj|BAA10933.1|  LMP7 of nurse shark                                    179   4e-52    
ref|XP_006040730.1|  PREDICTED: proteasome subunit beta type-5-like     177   4e-52    
ref|XP_008156743.1|  PREDICTED: proteasome subunit beta type-5 is...    177   4e-52    
ref|XP_007821942.1|  hypothetical protein MAA_05753                     179   4e-52    
ref|XP_004283229.1|  PREDICTED: proteasome subunit beta type-5 is...    177   4e-52    
dbj|GAK66792.1|  proteasome-domain-containing protein                   187   4e-52    
ref|XP_007730075.1|  proteasome component PRE2                          179   5e-52    
emb|CDQ73519.1|  unnamed protein product                                178   5e-52    
ref|XP_006696296.1|  hypothetical protein CTHT_0059780                  179   5e-52    
ref|XP_007347836.1|  proteasome-domain-containing protein               181   5e-52    
gb|KIW10869.1|  proteasome subunit beta type-5                          179   5e-52    
dbj|BAH29669.1|  proteasome subunit, beta type 8                        178   5e-52    
dbj|BAH29621.1|  proteasome subunit, beta type 8                        178   5e-52    
gb|KGB75936.1|  proteasome component pts1                               181   5e-52    
gb|ACO10097.1|  Proteasome subunit beta type 8 precursor                179   5e-52    
dbj|BAM15298.1|  proteasome subunit beta type 8                         176   7e-52    
dbj|GAC77344.1|  20S proteasome, regulatory subunit beta type PSM...    187   7e-52    
dbj|BAO00929.1|  proteasome subunit beta type 8,F-type                  176   8e-52    
dbj|BAH05024.1|  proteasome subunit, beta type 8                        179   8e-52    
gb|KIW80298.1|  hypothetical protein Z517_06913                         179   9e-52    
gb|KIX98319.1|  proteasome subunit beta type-5                          179   9e-52    
ref|XP_008731643.1|  proteasome component PRE2                          179   9e-52    
dbj|BAH05026.1|  proteasome subunit, beta type 8                        178   9e-52    
ref|XP_007739562.1|  proteasome component PRE2                          179   1e-51    
emb|CDK27355.1|  unnamed protein product                                178   1e-51    
gb|KIW59603.1|  proteasome subunit beta type-5                          178   1e-51    
ref|XP_007761346.1|  proteasome component PRE2                          178   1e-51    
ref|XP_010866810.1|  PREDICTED: proteasome subunit beta type-8-like     178   1e-51    
gb|KIW29970.1|  proteasome subunit beta type-5                          178   1e-51    
dbj|BAM21000.1|  proteasome subunit beta type-8                         177   1e-51    
ref|XP_004755395.1|  PREDICTED: proteasome subunit beta type-5 is...    176   1e-51    
ref|XP_004054985.1|  PREDICTED: proteasome subunit beta type-5 is...    178   1e-51    
gb|KHN95162.1|  proteasome component PRE2 precursor                     178   1e-51    
dbj|BAO50694.1|  proteasome subunit beta type 8,F-type                  176   1e-51    
dbj|BAO00926.1|  proteasome subunit beta type 8,A-type                  176   1e-51    
gb|KIJ26736.1|  hypothetical protein M422DRAFT_216150                   179   1e-51    
ref|XP_010866033.1|  PREDICTED: proteasome subunit beta type-8-like     178   1e-51    
emb|CDR40695.1|  CYFA0S05e03378g1_1                                     178   1e-51    
ref|XP_007989006.1|  PREDICTED: proteasome subunit beta type-5 is...    175   1e-51    
gb|KFM59336.1|  Proteasome subunit beta type-5                          178   2e-51    
ref|XP_009209435.1|  PREDICTED: proteasome subunit beta type-5 is...    175   2e-51    
emb|CAX70714.1|  proteasome (prosome, macropain) subunit, beta ty...    177   2e-51    
ref|XP_009160370.1|  proteasome component PRE2                          178   2e-51    
emb|CCX09778.1|  Similar to Proteasome component PRE2; acc. no. P...    178   2e-51    
dbj|BAH29681.1|  proteasome subunit, beta type 8                        177   2e-51    
dbj|BAH29629.1|  proteasome subunit, beta type 8                        177   2e-51    
ref|XP_003363600.1|  PREDICTED: proteasome subunit beta type-5 is...    175   2e-51    
gb|ERE89366.1|  proteasome subunit beta type-5-like protein             178   2e-51    
dbj|BAH29689.1|  proteasome subunit, beta type 8                        177   2e-51    
dbj|BAH29655.1|  proteasome subunit, beta type 8                        177   2e-51    
dbj|BAH29639.1|  proteasome subunit, beta type 8                        177   2e-51    
gb|KIW41006.1|  proteasome subunit beta type-5                          177   2e-51    
ref|XP_005560889.1|  PREDICTED: proteasome subunit beta type-5 is...    175   2e-51    
dbj|BAH29699.1|  proteasome subunit, beta type 8                        177   2e-51    
dbj|BAH29625.1|  proteasome subunit, beta type 8                        177   2e-51    
dbj|BAH29645.1|  proteasome subunit, beta type 8                        177   2e-51    
gb|KIV81807.1|  proteasome subunit beta type-5                          177   2e-51    
dbj|BAH29703.1|  proteasome subunit, beta type 8                        176   3e-51    
ref|XP_005279693.1|  PREDICTED: proteasome subunit beta type-8          177   3e-51    
dbj|BAH29657.1|  proteasome subunit, beta type 8                        176   3e-51    
ref|XP_003954551.1|  PREDICTED: LOW QUALITY PROTEIN: proteasome s...    174   3e-51    
emb|CAD62626.1|  unnamed protein product                                174   3e-51    
dbj|BAH05051.1|  proteasome subunit, beta type 8                        176   4e-51    
ref|XP_003260674.1|  PREDICTED: proteasome subunit beta type-5 is...    174   4e-51    
ref|NP_001138404.1|  proteasome subunit beta type-5 isoform 3           174   4e-51    
dbj|BAH05046.1|  proteasome subunit, beta type 8                        177   4e-51    
ref|XP_010887395.1|  PREDICTED: proteasome subunit beta type-5 is...    175   4e-51    
ref|XP_004358358.1|  proteasome subunit beta type 5                     177   5e-51    
ref|NP_001171881.1|  proteasome subunit beta type-8                     176   5e-51    
gb|ABI31729.1|  low molecular mass protein 7                            176   5e-51    
ref|XP_006997103.1|  PREDICTED: proteasome subunit beta type-8          176   5e-51    
dbj|BAH05049.1|  proteasome subunit, beta type 8                        175   6e-51    
ref|XP_005751451.1|  PREDICTED: proteasome subunit beta type-8-like     176   6e-51    
dbj|BAH05030.1|  proteasome subunit, beta type 8                        176   6e-51    
ref|XP_010887405.1|  PREDICTED: proteasome subunit beta type-5 is...    173   6e-51    
gb|EGW09109.1|  Proteasome subunit beta type-8                          175   6e-51    
dbj|BAH29697.1|  proteasome subunit, beta type 8                        176   6e-51    
gb|AAW24786.1|  SJCHGC05978 protein                                     176   7e-51    
ref|XP_008718323.1|  hypothetical protein HMPREF1541_05764              176   8e-51    
ref|NP_999100.1|  proteasome subunit beta type-8                        176   8e-51    
dbj|BAH05031.1|  proteasome subunit, beta type 8                        175   8e-51    
emb|CAN13318.1|  proteasome (prosome, macropain) subunit, beta ty...    174   8e-51    



>ref|XP_009783836.1| PREDICTED: proteasome subunit beta type-5-like [Nicotiana sylvestris]
 ref|XP_009783895.1| PREDICTED: proteasome subunit beta type-5-like [Nicotiana sylvestris]
Length=273

 Score =   340 bits (873),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 161/173 (93%), Positives = 168/173 (97%), Gaps = 0/173 (0%)
 Frame = +2

Query  38   MVRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTL  217
            M++IDFSGLE TAP+RGESSELFD+IP  PSFQIPN T+FDGFQK+AIQMVKPAKGTTTL
Sbjct  1    MMKIDFSGLEPTAPLRGESSELFDDIPSSPSFQIPNTTNFDGFQKEAIQMVKPAKGTTTL  60

Query  218  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  397
            AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCR
Sbjct  61   AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCR  120

Query  398  LHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            LHELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE
Sbjct  121  LHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  173



>ref|XP_009596640.1| PREDICTED: proteasome subunit beta type-5-like [Nicotiana tomentosiformis]
Length=273

 Score =   333 bits (855),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 158/173 (91%), Positives = 166/173 (96%), Gaps = 0/173 (0%)
 Frame = +2

Query  38   MVRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTL  217
            M++IDFSGLE +AP+RGESSELFD IP  PSFQIP+  +FDGFQK+AIQMVKPAKGTTTL
Sbjct  1    MMKIDFSGLEPSAPLRGESSELFDGIPSSPSFQIPDTANFDGFQKEAIQMVKPAKGTTTL  60

Query  218  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  397
            AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCR
Sbjct  61   AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCR  120

Query  398  LHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            LHELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE
Sbjct  121  LHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  173



>ref|XP_009780639.1| PREDICTED: proteasome subunit beta type-5-like [Nicotiana sylvestris]
Length=273

 Score =   329 bits (844),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 159/173 (92%), Positives = 165/173 (95%), Gaps = 0/173 (0%)
 Frame = +2

Query  38   MVRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTL  217
            M++IDFSGLE TAPI+GESSEL D I   PSFQIPN T+FDGFQK+AIQMVKPAKGTTTL
Sbjct  1    MMKIDFSGLEPTAPIKGESSELCDGILSSPSFQIPNATNFDGFQKEAIQMVKPAKGTTTL  60

Query  218  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  397
            AFIFK GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCR
Sbjct  61   AFIFKGGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCR  120

Query  398  LHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            LHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE
Sbjct  121  LHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  173



>ref|XP_009619742.1| PREDICTED: proteasome subunit beta type-5-like [Nicotiana tomentosiformis]
Length=273

 Score =   328 bits (842),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 158/173 (91%), Positives = 165/173 (95%), Gaps = 0/173 (0%)
 Frame = +2

Query  38   MVRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTL  217
            M++IDFSGLE TAP++GESSEL D I   PSFQIPN T+FDGFQK+AIQMVKPAKGTTTL
Sbjct  1    MMKIDFSGLEPTAPLKGESSELCDGILSSPSFQIPNATNFDGFQKEAIQMVKPAKGTTTL  60

Query  218  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  397
            AFIFK GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCR
Sbjct  61   AFIFKGGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCR  120

Query  398  LHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            LHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE
Sbjct  121  LHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  173



>ref|XP_006363770.1| PREDICTED: proteasome subunit beta type-5-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006363771.1| PREDICTED: proteasome subunit beta type-5-like isoform X2 [Solanum 
tuberosum]
Length=273

 Score =   328 bits (840),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 155/173 (90%), Positives = 163/173 (94%), Gaps = 0/173 (0%)
 Frame = +2

Query  38   MVRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTL  217
            M++IDFSGLE +AP+RGESSELFD I   PSF +PN  +FDGFQK+AIQMVKPAKGTTTL
Sbjct  1    MMKIDFSGLEPSAPLRGESSELFDGISNSPSFHLPNTANFDGFQKEAIQMVKPAKGTTTL  60

Query  218  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  397
            AFIFK GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCR
Sbjct  61   AFIFKGGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCR  120

Query  398  LHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            LHELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE
Sbjct  121  LHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  173



>ref|XP_004239661.1| PREDICTED: proteasome subunit beta type-5 [Solanum lycopersicum]
 ref|XP_010321315.1| PREDICTED: proteasome subunit beta type-5 [Solanum lycopersicum]
Length=273

 Score =   327 bits (839),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 155/173 (90%), Positives = 163/173 (94%), Gaps = 0/173 (0%)
 Frame = +2

Query  38   MVRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTL  217
            M++IDFSGLE +AP+RGESSELFD I   PSF +PN  +FDGFQK+AIQMVKPAKGTTTL
Sbjct  1    MMKIDFSGLEPSAPLRGESSELFDGISNSPSFHLPNTANFDGFQKEAIQMVKPAKGTTTL  60

Query  218  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  397
            AFIFK GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCR
Sbjct  61   AFIFKGGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCR  120

Query  398  LHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            LHELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE
Sbjct  121  LHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  173



>ref|XP_006345787.1| PREDICTED: proteasome subunit beta type-5-like [Solanum tuberosum]
Length=273

 Score =   326 bits (836),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 155/173 (90%), Positives = 162/173 (94%), Gaps = 0/173 (0%)
 Frame = +2

Query  38   MVRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTL  217
            M++IDFSGLE  AP+RGESSELFD I   PSF +PN  +FDGFQK+AIQMVKPAKGTTTL
Sbjct  1    MMKIDFSGLEPRAPLRGESSELFDGISNSPSFHLPNTANFDGFQKEAIQMVKPAKGTTTL  60

Query  218  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  397
            AFIFK GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCR
Sbjct  61   AFIFKGGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCR  120

Query  398  LHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            LHELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE
Sbjct  121  LHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  173



>ref|XP_002264828.1| PREDICTED: proteasome subunit beta type-5 [Vitis vinifera]
 ref|XP_010655500.1| PREDICTED: proteasome subunit beta type-5 [Vitis vinifera]
 emb|CBI27591.3| unnamed protein product [Vitis vinifera]
Length=272

 Score =   316 bits (809),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 150/172 (87%), Positives = 158/172 (92%), Gaps = 0/172 (0%)
 Frame = +2

Query  41   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  220
            +++D SGLEST P+ G +SEL       PSF++PN TDFDGFQKDAIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGLESTVPLFGANSELLGGFSAAPSFELPNTTDFDGFQKDAIQMVKPAKGTTTLA  60

Query  221  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  400
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  401  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSE
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSE  172



>emb|CDP13326.1| unnamed protein product [Coffea canephora]
Length=339

 Score =   316 bits (809),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 149/175 (85%), Positives = 160/175 (91%), Gaps = 0/175 (0%)
 Frame = +2

Query  32   VTMVRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTT  211
            VTM++IDFSGLE  + +RG  +EL   +   P FQIPN  DFDGFQK+++QMVKPAKGTT
Sbjct  66   VTMMKIDFSGLEPNSLLRGNPNELLSGLSTAPEFQIPNTNDFDGFQKESVQMVKPAKGTT  125

Query  212  TLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVK  391
            TLAFIFKEGV+VAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+K
Sbjct  126  TLAFIFKEGVIVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIK  185

Query  392  CRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            CRLHELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE
Sbjct  186  CRLHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  240



>gb|KHG05622.1| Proteasome subunit beta type-5 [Gossypium arboreum]
Length=272

 Score =   313 bits (802),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 149/172 (87%), Positives = 156/172 (91%), Gaps = 0/172 (0%)
 Frame = +2

Query  41   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  220
            +++D SGLE  AP+ G  SEL D     PSF +PN TDFDGFQK+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGLEPAAPVSGAPSELVDGFSAAPSFDLPNTTDFDGFQKEAIQMVKPAKGTTTLA  60

Query  221  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  400
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  401  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSE
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSE  172



>gb|KJB15718.1| hypothetical protein B456_002G192400 [Gossypium raimondii]
 gb|KJB15719.1| hypothetical protein B456_002G192400 [Gossypium raimondii]
 gb|KJB15720.1| hypothetical protein B456_002G192400 [Gossypium raimondii]
Length=272

 Score =   313 bits (802),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 150/172 (87%), Positives = 157/172 (91%), Gaps = 0/172 (0%)
 Frame = +2

Query  41   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  220
            +++D SGLES AP+ G  SEL D     PSF +PN TDFDGFQK+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGLESAAPVWGAPSELVDGFSAGPSFDLPNTTDFDGFQKEAIQMVKPAKGTTTLA  60

Query  221  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  400
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  401  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSE
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSE  172



>ref|XP_011071212.1| PREDICTED: proteasome subunit beta type-5-like [Sesamum indicum]
Length=287

 Score =   313 bits (802),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 147/173 (85%), Positives = 161/173 (93%), Gaps = 0/173 (0%)
 Frame = +2

Query  38   MVRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTL  217
            M++IDF GL+ +AP++G + +L +EI   PSF++P   DFDGFQK A+QMVKPAKGTTTL
Sbjct  1    MMKIDFGGLDPSAPLKGNTDDLHNEILAAPSFKLPITADFDGFQKAAVQMVKPAKGTTTL  60

Query  218  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  397
            AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCR
Sbjct  61   AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCR  120

Query  398  LHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            LHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDE+GPGLYYVDSE
Sbjct  121  LHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEQGPGLYYVDSE  173



>gb|KDP26783.1| hypothetical protein JCGZ_17941 [Jatropha curcas]
Length=270

 Score =   312 bits (799),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 148/172 (86%), Positives = 158/172 (92%), Gaps = 0/172 (0%)
 Frame = +2

Query  41   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  220
            +++D SGLES AP+ G + ELF+     PSF++P  TDFDGFQK+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGLESAAPLFGATGELFNGFSTAPSFELPVTTDFDGFQKEAIQMVKPAKGTTTLA  60

Query  221  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  400
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  401  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSE
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSE  172



>ref|XP_008340194.1| PREDICTED: proteasome subunit beta type-5 [Malus domestica]
Length=272

 Score =   312 bits (799),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 148/172 (86%), Positives = 157/172 (91%), Gaps = 0/172 (0%)
 Frame = +2

Query  41   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  220
            +R+D SGLES AP+ GESS   D +   PSF++P   DFDGFQK+AIQMVKPAKGTTTLA
Sbjct  1    MRLDTSGLESXAPLFGESSGFLDGVSAPPSFEVPTTNDFDGFQKEAIQMVKPAKGTTTLA  60

Query  221  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  400
            FIFK+GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKDGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  401  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSE
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSE  172



>gb|KHG25400.1| Proteasome subunit beta type-5 [Gossypium arboreum]
Length=272

 Score =   312 bits (799),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 146/172 (85%), Positives = 158/172 (92%), Gaps = 0/172 (0%)
 Frame = +2

Query  41   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  220
            +++D +G+ES AP+ G  +EL D     PSF++PN TDFDGFQK+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTTGMESAAPVWGSHNELVDGFSAAPSFELPNTTDFDGFQKEAIQMVKPAKGTTTLA  60

Query  221  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  400
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  401  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVD+E
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDNE  172



>ref|XP_007045045.1| N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily 
protein isoform 3, partial [Theobroma cacao]
 gb|EOY00877.1| N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily 
protein isoform 3, partial [Theobroma cacao]
Length=213

 Score =   310 bits (793),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 147/172 (85%), Positives = 156/172 (91%), Gaps = 0/172 (0%)
 Frame = +2

Query  41   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  220
            +++D SGLES  P+    +EL D     PSF++PN TDFDGFQK+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGLESAEPVWATFNELADGFSAAPSFELPNTTDFDGFQKEAIQMVKPAKGTTTLA  60

Query  221  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  400
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  401  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSE
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSE  172



>ref|XP_009372313.1| PREDICTED: proteasome subunit beta type-5 [Pyrus x bretschneideri]
Length=272

 Score =   311 bits (798),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 148/172 (86%), Positives = 157/172 (91%), Gaps = 0/172 (0%)
 Frame = +2

Query  41   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  220
            +R+D SGLES AP+ GESS   D +   PSF++P   DFDGFQK+AIQMVKPAKGTTTLA
Sbjct  1    MRLDTSGLESHAPLFGESSGFLDGVSAPPSFEVPTTNDFDGFQKEAIQMVKPAKGTTTLA  60

Query  221  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  400
            FIFK+GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKDGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  401  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSE
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSE  172



>ref|XP_004144192.1| PREDICTED: proteasome subunit beta type-5-like [Cucumis sativus]
 ref|XP_004171974.1| PREDICTED: proteasome subunit beta type-5-like [Cucumis sativus]
 gb|KGN47623.1| hypothetical protein Csa_6G365720 [Cucumis sativus]
Length=272

 Score =   311 bits (797),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 148/172 (86%), Positives = 159/172 (92%), Gaps = 0/172 (0%)
 Frame = +2

Query  41   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  220
            +++D SGL++TAP+ G + E  +     PSF+IPN +DFDGFQKDAIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGLQTTAPLFGPTMEAMEGFAAAPSFEIPNSSDFDGFQKDAIQMVKPAKGTTTLA  60

Query  221  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  400
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  120

Query  401  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            H+LANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSE
Sbjct  121  HKLANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSE  172



>gb|KJB78067.1| hypothetical protein B456_012G175200 [Gossypium raimondii]
Length=272

 Score =   311 bits (797),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 146/172 (85%), Positives = 157/172 (91%), Gaps = 0/172 (0%)
 Frame = +2

Query  41   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  220
            +++D +G+ES AP+ G  +EL D     PSF++PN TDFDGFQK+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTTGMESAAPVWGSHNELVDGFSAAPSFELPNTTDFDGFQKEAIQMVKPAKGTTTLA  60

Query  221  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  400
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGTKCRL  120

Query  401  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVD+E
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDNE  172



>gb|EPS61043.1| hypothetical protein M569_13757, partial [Genlisea aurea]
Length=274

 Score =   310 bits (795),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 146/174 (84%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = +2

Query  35   TMVRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  214
             M++ID SGL+  AP++G S +L DEI   PSF++P   DFDGFQK A+QMVKPAKGTTT
Sbjct  1    AMMKIDLSGLDPLAPVKGNSDDLDDEIMAAPSFKLPTTVDFDGFQKAAVQMVKPAKGTTT  60

Query  215  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  394
            LAFIF +GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFDKGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  395  RLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            RLHELANKRRISVAGASKLL NILYSYRGMGLSVGTMIAGWDE+GPGLYYVDSE
Sbjct  121  RLHELANKRRISVAGASKLLGNILYSYRGMGLSVGTMIAGWDEQGPGLYYVDSE  174



>ref|XP_008222076.1| PREDICTED: proteasome subunit beta type-5 [Prunus mume]
Length=272

 Score =   310 bits (794),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 147/172 (85%), Positives = 155/172 (90%), Gaps = 0/172 (0%)
 Frame = +2

Query  41   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  220
            +++D SGLES AP+ G SS   D     PSF++P   DFDGFQK+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGLESAAPLVGASSGFLDGFADAPSFEVPTTNDFDGFQKEAIQMVKPAKGTTTLA  60

Query  221  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  400
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  401  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSE
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSE  172



>ref|XP_008445492.1| PREDICTED: proteasome subunit beta type-5 [Cucumis melo]
Length=272

 Score =   309 bits (792),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 148/172 (86%), Positives = 157/172 (91%), Gaps = 0/172 (0%)
 Frame = +2

Query  41   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  220
            +++D SGL++TAP+ G   E  +     PSF+IPN +DFDGFQKDAIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGLQTTAPMFGPRMEALEGFAAAPSFEIPNSSDFDGFQKDAIQMVKPAKGTTTLA  60

Query  221  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  400
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR 
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRR  120

Query  401  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSE
Sbjct  121  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSE  172



>ref|XP_007045043.1| N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily 
protein isoform 1 [Theobroma cacao]
 ref|XP_007045044.1| N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY00875.1| N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY00876.1| N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily 
protein isoform 1 [Theobroma cacao]
Length=272

 Score =   309 bits (792),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 147/172 (85%), Positives = 156/172 (91%), Gaps = 0/172 (0%)
 Frame = +2

Query  41   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  220
            +++D SGLES  P+    +EL D     PSF++PN TDFDGFQK+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGLESAEPVWATFNELADGFSAAPSFELPNTTDFDGFQKEAIQMVKPAKGTTTLA  60

Query  221  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  400
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  401  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSE
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSE  172



>ref|XP_007222598.1| hypothetical protein PRUPE_ppa009896mg [Prunus persica]
 gb|EMJ23797.1| hypothetical protein PRUPE_ppa009896mg [Prunus persica]
Length=272

 Score =   308 bits (790),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 146/172 (85%), Positives = 155/172 (90%), Gaps = 0/172 (0%)
 Frame = +2

Query  41   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  220
            +++D SGLES AP+ G SS   D     PSF++P   DFDGFQK+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGLESAAPLVGASSGFLDGFADAPSFEVPTTNDFDGFQKEAIQMVKPAKGTTTLA  60

Query  221  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  400
            FIFK+GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKDGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  401  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSE
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSE  172



>ref|XP_010682823.1| PREDICTED: proteasome subunit beta type-5 [Beta vulgaris subsp. 
vulgaris]
Length=272

 Score =   308 bits (790),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 146/172 (85%), Positives = 158/172 (92%), Gaps = 0/172 (0%)
 Frame = +2

Query  41   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  220
            +++D SGLESTAP+   S+ +FD +   PSF++PN  DFDGFQKDAIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGLESTAPLFRSSNVIFDGLQMTPSFELPNALDFDGFQKDAIQMVKPAKGTTTLA  60

Query  221  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  400
            FIFK GV+VAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKHGVIVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  401  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            HELANKRRISV GASKLLANILY+YRGMGLSVGTMIAGWDE GPGLYYVDSE
Sbjct  121  HELANKRRISVTGASKLLANILYNYRGMGLSVGTMIAGWDETGPGLYYVDSE  172



>gb|KCW61971.1| hypothetical protein EUGRSUZ_H04655 [Eucalyptus grandis]
Length=201

 Score =   305 bits (782),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 144/172 (84%), Positives = 156/172 (91%), Gaps = 0/172 (0%)
 Frame = +2

Query  41   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  220
            +++D SGLEST P+ G + ELF+     P+F+IP   DFD FQK+A+QMVKPAKGTTTLA
Sbjct  1    MKLDTSGLESTMPVFGVNKELFEGFSAAPAFEIPGACDFDNFQKEAVQMVKPAKGTTTLA  60

Query  221  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  400
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINP+MLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPHMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  401  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSE
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSE  172



>sp|O24361.1|PSB5_SPIOL RecName: Full=Proteasome subunit beta type-5; AltName: Full=20S 
proteasome subunit E; AltName: Full=Proteasome epsilon chain; 
Flags: Precursor [Spinacia oleracea]
 dbj|BAA21650.1| 26S proteasome beta subunit [Spinacia oleracea]
Length=272

 Score =   308 bits (788),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 147/172 (85%), Positives = 157/172 (91%), Gaps = 0/172 (0%)
 Frame = +2

Query  41   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  220
            +++D SGLESTAPI   S  +FD +   PSF +PN TDFDGFQK+A+QMVKPAKGTTTLA
Sbjct  1    MKLDTSGLESTAPIFRRSDFVFDGLQMTPSFDLPNPTDFDGFQKEAVQMVKPAKGTTTLA  60

Query  221  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  400
            FIFK GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKHGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  401  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            HELANKRRISV GASKLLANILY+YRGMGLSVGTMIAGWDE GPGLYYVDSE
Sbjct  121  HELANKRRISVTGASKLLANILYNYRGMGLSVGTMIAGWDETGPGLYYVDSE  172



>ref|XP_010025332.1| PREDICTED: proteasome subunit beta type-5-B [Eucalyptus grandis]
 ref|XP_010025333.1| PREDICTED: proteasome subunit beta type-5-B [Eucalyptus grandis]
 gb|KCW61970.1| hypothetical protein EUGRSUZ_H04655 [Eucalyptus grandis]
Length=273

 Score =   305 bits (782),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 144/172 (84%), Positives = 156/172 (91%), Gaps = 0/172 (0%)
 Frame = +2

Query  41   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  220
            +++D SGLEST P+ G + ELF+     P+F+IP   DFD FQK+A+QMVKPAKGTTTLA
Sbjct  1    MKLDTSGLESTMPVFGVNKELFEGFSAAPAFEIPGACDFDNFQKEAVQMVKPAKGTTTLA  60

Query  221  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  400
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINP+MLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPHMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  401  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSE
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSE  172



>ref|XP_008381840.1| PREDICTED: proteasome subunit beta type-5-like [Malus domestica]
Length=270

 Score =   305 bits (780),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 147/173 (85%), Positives = 157/173 (91%), Gaps = 1/173 (1%)
 Frame = +2

Query  41   VRIDFSGLESTAP-IRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTL  217
            +++D SGLES AP + GESS   D +   PSF++P   DFDGFQK+AIQMVKPAKGTTTL
Sbjct  1    MKLDTSGLESHAPHLFGESSGFLDGVSGPPSFEVPTTNDFDGFQKEAIQMVKPAKGTTTL  60

Query  218  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  397
            AFIFK+GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCR
Sbjct  61   AFIFKDGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCR  120

Query  398  LHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            LHELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSE
Sbjct  121  LHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSE  173



>ref|XP_006395566.1| hypothetical protein EUTSA_v10004762mg [Eutrema salsugineum]
 gb|ESQ32852.1| hypothetical protein EUTSA_v10004762mg [Eutrema salsugineum]
Length=273

 Score =   305 bits (781),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 145/174 (83%), Positives = 158/174 (91%), Gaps = 2/174 (1%)
 Frame = +2

Query  41   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  214
            +++D SG E+T P+   G SSE+ D    VPSF +P  TDFDGFQK+A+QMVKPAKGTTT
Sbjct  1    MKLDTSGFETTMPMIGFGSSSEMLDGFSSVPSFDLPRTTDFDGFQKEAVQMVKPAKGTTT  60

Query  215  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  394
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  395  RLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAGWDE GPGLYYVD+E
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGWDETGPGLYYVDNE  174



>ref|XP_009376552.1| PREDICTED: proteasome subunit beta type-5-like [Pyrus x bretschneideri]
Length=270

 Score =   303 bits (777),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 146/173 (84%), Positives = 157/173 (91%), Gaps = 1/173 (1%)
 Frame = +2

Query  41   VRIDFSGLESTAP-IRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTL  217
            +++D SGLES AP + GESS   D +   P+F++P   DFDGFQK+AIQMVKPAKGTTTL
Sbjct  1    MKLDTSGLESHAPHLFGESSGFLDGVSGPPAFEVPTTNDFDGFQKEAIQMVKPAKGTTTL  60

Query  218  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  397
            AFIFK+GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCR
Sbjct  61   AFIFKDGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCR  120

Query  398  LHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            LHELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSE
Sbjct  121  LHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSE  173



>gb|EYU42103.1| hypothetical protein MIMGU_mgv1a011714mg [Erythranthe guttata]
Length=273

 Score =   303 bits (777),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 142/173 (82%), Positives = 158/173 (91%), Gaps = 0/173 (0%)
 Frame = +2

Query  38   MVRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTL  217
            M++ID SGL+ +AP++  + +L +EI   PSF +P   DFDGFQK +IQMVKPA+GTTTL
Sbjct  1    MMKIDLSGLDPSAPMKRNTDDLDNEILATPSFALPTTVDFDGFQKASIQMVKPARGTTTL  60

Query  218  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  397
            AFIFK GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCR
Sbjct  61   AFIFKGGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCR  120

Query  398  LHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            LHELANKRRIS+AGASK+LANILYSYRGMGLSVGTMIAGWDE+GPGLYYVDSE
Sbjct  121  LHELANKRRISIAGASKMLANILYSYRGMGLSVGTMIAGWDEQGPGLYYVDSE  173



>ref|XP_010105786.1| Proteasome subunit beta type-5 [Morus notabilis]
 gb|EXC06139.1| Proteasome subunit beta type-5 [Morus notabilis]
Length=272

 Score =   303 bits (777),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 144/172 (84%), Positives = 155/172 (90%), Gaps = 0/172 (0%)
 Frame = +2

Query  41   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  220
            +++D SGLESTA + G S+E  D +   PSF +P+  D DGF K+A+QMVKPAKGTTTLA
Sbjct  1    MKLDTSGLESTASLFGASNEFHDGLSTAPSFDLPSNVDLDGFLKEAVQMVKPAKGTTTLA  60

Query  221  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  400
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  401  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSE
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSE  172



>ref|XP_011029673.1| PREDICTED: proteasome subunit beta type-5-B-like [Populus euphratica]
Length=272

 Score =   303 bits (776),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 145/173 (84%), Positives = 157/173 (91%), Gaps = 1/173 (1%)
 Frame = +2

Query  41   VRIDFSGLESTAPIRGES-SELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTL  217
            ++ D SGLESTA + G + SEL D     P+F++P  TDFDGFQK+A+QMVKPAKGTTTL
Sbjct  1    MKFDTSGLESTASVFGTAGSELVDGFSAAPAFELPTTTDFDGFQKEAVQMVKPAKGTTTL  60

Query  218  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  397
            AFIFK+GV+VAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCR
Sbjct  61   AFIFKDGVIVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCR  120

Query  398  LHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            LHELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSE
Sbjct  121  LHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSE  173



>ref|XP_002312631.2| 20S proteasome beta subunit family protein [Populus trichocarpa]
 gb|EEE89998.2| 20S proteasome beta subunit family protein [Populus trichocarpa]
Length=272

 Score =   303 bits (776),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 145/173 (84%), Positives = 157/173 (91%), Gaps = 1/173 (1%)
 Frame = +2

Query  41   VRIDFSGLESTAPIRGES-SELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTL  217
            ++ D SGLESTA + G + SEL D     P+F++P  TDFDGFQK+A+QMVKPAKGTTTL
Sbjct  1    MKFDTSGLESTASVFGTAGSELVDGFSAAPAFELPTTTDFDGFQKEAVQMVKPAKGTTTL  60

Query  218  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  397
            AFIFK+GV+VAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCR
Sbjct  61   AFIFKDGVIVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCR  120

Query  398  LHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            LHELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSE
Sbjct  121  LHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSE  173



>ref|XP_006291670.1| hypothetical protein CARUB_v10017828mg [Capsella rubella]
 gb|EOA24568.1| hypothetical protein CARUB_v10017828mg [Capsella rubella]
Length=272

 Score =   302 bits (773),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 143/174 (82%), Positives = 157/174 (90%), Gaps = 2/174 (1%)
 Frame = +2

Query  41   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  214
            +++D SG E+T P+   G SSE+ D    VPSF +P  TDFDGFQK +++MVKPAKGTTT
Sbjct  1    MKLDTSGFETTMPVIGFGSSSEMLDGFSSVPSFDLPRTTDFDGFQKKSVEMVKPAKGTTT  60

Query  215  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  394
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  395  RLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAGWDE GPGLYYVD+E
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGWDETGPGLYYVDNE  174



>ref|XP_010538272.1| PREDICTED: proteasome subunit beta type-5-B-like [Tarenaya hassleriana]
Length=271

 Score =   302 bits (773),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 144/174 (83%), Positives = 158/174 (91%), Gaps = 2/174 (1%)
 Frame = +2

Query  41   VRIDFSGLESTAPIRGES--SELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  214
            +++D SGLES  P+ G +  SE+ D +  VPSF +P   DFDGFQK+A+QMVKPAKGTTT
Sbjct  1    MKLDTSGLESNVPMFGRNCESEMLDGLSDVPSFDLPLANDFDGFQKEAVQMVKPAKGTTT  60

Query  215  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  394
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  395  RLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAGWDE GPGLYYVD+E
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGWDETGPGLYYVDNE  174



>ref|NP_189265.1| proteasome subunit beta type-5-B [Arabidopsis thaliana]
 sp|Q9LIP2.1|PSB5B_ARATH RecName: Full=Proteasome subunit beta type-5-B; AltName: Full=20S 
proteasome beta subunit E-2; AltName: Full=Proteasome epsilon-2 
chain; Flags: Precursor [Arabidopsis thaliana]
 gb|AAL27514.1|AF439846_1 AT3g26340/F20C19_6 [Arabidopsis thaliana]
 dbj|BAB02194.1| proteasome epsilon chain precursor [Arabidopsis thaliana]
 gb|AAM62897.1| 26S proteasome beta subunit, putative [Arabidopsis thaliana]
 gb|AAM78079.1| AT3g26340/F20C19_6 [Arabidopsis thaliana]
 gb|AEE77147.1| proteasome subunit beta type-5-B [Arabidopsis thaliana]
Length=273

 Score =   302 bits (773),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 143/174 (82%), Positives = 157/174 (90%), Gaps = 2/174 (1%)
 Frame = +2

Query  41   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  214
            +++D SGLE+T P+   G +SE+ D     PSF +P  TDFDGFQK A++MVKPAKGTTT
Sbjct  1    MKLDTSGLETTMPVIGFGSNSEMLDGFSSAPSFDLPRTTDFDGFQKKAVEMVKPAKGTTT  60

Query  215  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  394
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  395  RLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAGWDE GPGLYYVD+E
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGWDETGPGLYYVDNE  174



>ref|XP_010425347.1| PREDICTED: proteasome subunit beta type-5-B [Camelina sativa]
Length=272

 Score =   302 bits (773),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 142/174 (82%), Positives = 158/174 (91%), Gaps = 2/174 (1%)
 Frame = +2

Query  41   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  214
            +++D SG E+T P+   G +SE+ D +  VPSF +P  TDFDGFQK +++MVKPAKGTTT
Sbjct  1    MKLDTSGFETTMPVIGFGSNSEMLDGVSSVPSFDLPRTTDFDGFQKKSVEMVKPAKGTTT  60

Query  215  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  394
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  395  RLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAGWDE GPGLYYVD+E
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGWDETGPGLYYVDNE  174



>ref|XP_010250770.1| PREDICTED: proteasome subunit beta type-5 [Nelumbo nucifera]
Length=272

 Score =   302 bits (773),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 145/172 (84%), Positives = 154/172 (90%), Gaps = 0/172 (0%)
 Frame = +2

Query  41   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  220
            ++ID SGLES  P+ G  +EL D     PSF++P  TDFDGFQK+A Q +KPAKGTTTLA
Sbjct  1    MKIDLSGLESAFPLFGGGNELSDGFSAAPSFELPCSTDFDGFQKEAKQTLKPAKGTTTLA  60

Query  221  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  400
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  401  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSE
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSE  172



>ref|XP_010514289.1| PREDICTED: proteasome subunit beta type-5-B-like [Camelina sativa]
Length=272

 Score =   300 bits (769),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 141/174 (81%), Positives = 158/174 (91%), Gaps = 2/174 (1%)
 Frame = +2

Query  41   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  214
            +++D SG E++ P+   G +SE+ D +  VPSF +P  TDFDGFQK +++MVKPAKGTTT
Sbjct  1    MKLDTSGFETSMPVIGFGSNSEMLDGVSSVPSFDLPRTTDFDGFQKKSVEMVKPAKGTTT  60

Query  215  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  394
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  395  RLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAGWDE GPGLYYVD+E
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGWDETGPGLYYVDNE  174



>emb|CDY26610.1| BnaA09g46670D [Brassica napus]
Length=274

 Score =   300 bits (769),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 142/174 (82%), Positives = 157/174 (90%), Gaps = 2/174 (1%)
 Frame = +2

Query  41   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  214
            +++D SG E++ P    G S+++ D    VPSF +P  TDFDGFQK+A+QMVKPAKGTTT
Sbjct  1    MKLDTSGFETSMPTIGFGSSNDMLDGFSTVPSFDLPRTTDFDGFQKEAVQMVKPAKGTTT  60

Query  215  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  394
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  395  RLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAGWDE GPGLYYVD+E
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGWDETGPGLYYVDNE  174



>emb|CDY21081.1| BnaA08g24440D [Brassica napus]
Length=274

 Score =   300 bits (768),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 142/174 (82%), Positives = 157/174 (90%), Gaps = 2/174 (1%)
 Frame = +2

Query  41   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  214
            +++D SG E++ P    G S+++ D    VPSF +P  TDFDGFQK+A+QMVKPAKGTTT
Sbjct  1    MKLDTSGFETSMPTIGFGSSNDMLDGFSTVPSFDLPRTTDFDGFQKEAVQMVKPAKGTTT  60

Query  215  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  394
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  395  RLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAGWDE GPGLYYVD+E
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGWDETGPGLYYVDNE  174



>emb|CDY34594.1| BnaC03g56940D [Brassica napus]
Length=274

 Score =   300 bits (767),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 142/174 (82%), Positives = 157/174 (90%), Gaps = 2/174 (1%)
 Frame = +2

Query  41   VRIDFSGLESTAPIRG--ESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  214
            +++D SG E++ P  G   S+++ D    VPSF +P  TDFDGFQK+A+QMVKPAKGTTT
Sbjct  1    MKLDTSGFETSMPTIGFESSNDMLDGFSTVPSFDLPRTTDFDGFQKEAVQMVKPAKGTTT  60

Query  215  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  394
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  395  RLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAGWDE GPGLYYVD+E
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGWDETGPGLYYVDNE  174



>ref|XP_010540655.1| PREDICTED: proteasome subunit beta type-5-B [Tarenaya hassleriana]
Length=271

 Score =   300 bits (767),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 143/174 (82%), Positives = 156/174 (90%), Gaps = 2/174 (1%)
 Frame = +2

Query  41   VRIDFSGLESTAPIRG--ESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  214
            +++D SG EST P+ G    +E+ D +  VPSF +P   DFDGFQK+A+QMVKPAKGTTT
Sbjct  1    MKLDTSGFESTLPMFGGNTETEMLDGLSSVPSFDLPFTKDFDGFQKEAVQMVKPAKGTTT  60

Query  215  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  394
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  395  RLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            RLHELANKRRISV GASKLLAN+LYSYRGMGLSVGTMIAGWDE GPGLYYVD+E
Sbjct  121  RLHELANKRRISVPGASKLLANMLYSYRGMGLSVGTMIAGWDETGPGLYYVDNE  174



>emb|CDY16054.1| BnaC08g40690D [Brassica napus]
Length=274

 Score =   300 bits (767),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 142/174 (82%), Positives = 157/174 (90%), Gaps = 2/174 (1%)
 Frame = +2

Query  41   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  214
            +++D SG E++ P    G S+++ D    VPSF +P  TDFDGFQK+A+QMVKPAKGTTT
Sbjct  1    MKLDTSGFETSMPTIGFGSSNDMLDGFSTVPSFDLPRTTDFDGFQKEAVQMVKPAKGTTT  60

Query  215  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  394
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  395  RLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAGWDE GPGLYYVD+E
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGWDETGPGLYYVDNE  174



>ref|XP_009110603.1| PREDICTED: proteasome subunit beta type-5-B [Brassica rapa]
Length=274

 Score =   300 bits (767),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 142/174 (82%), Positives = 157/174 (90%), Gaps = 2/174 (1%)
 Frame = +2

Query  41   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  214
            +++D SG E++ P    G S+++ D    VPSF +P  TDFDGFQK+A+QMVKPAKGTTT
Sbjct  1    MKLDTSGFETSMPTIGFGSSNDMLDGFTTVPSFDLPRTTDFDGFQKEAVQMVKPAKGTTT  60

Query  215  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  394
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  395  RLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAGWDE GPGLYYVD+E
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGWDETGPGLYYVDNE  174



>emb|CDX98014.1| BnaA06g07650D [Brassica napus]
Length=274

 Score =   300 bits (767),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 142/174 (82%), Positives = 157/174 (90%), Gaps = 2/174 (1%)
 Frame = +2

Query  41   VRIDFSGLESTAPIRG--ESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  214
            +++D SG E++ P  G   S+++ D    VPSF +P  TDFDGFQK+A+QMVKPAKGTTT
Sbjct  1    MKLDTSGFETSMPTVGFGSSNDMLDGFSTVPSFDLPRTTDFDGFQKEAVQMVKPAKGTTT  60

Query  215  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  394
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  395  RLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAGWDE GPGLYYVD+E
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGWDETGPGLYYVDNE  174



>ref|XP_009148547.1| PREDICTED: proteasome subunit beta type-5-B-like [Brassica rapa]
Length=274

 Score =   300 bits (767),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 142/174 (82%), Positives = 157/174 (90%), Gaps = 2/174 (1%)
 Frame = +2

Query  41   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  214
            +++D SG E++ P    G S+++ D    VPSF +P  TDFDGFQK+A+QMVKPAKGTTT
Sbjct  1    MKLDTSGFETSMPTIGFGSSNDMLDGFSTVPSFDLPRTTDFDGFQKEAVQMVKPAKGTTT  60

Query  215  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  394
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  395  RLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAGWDE GPGLYYVD+E
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGWDETGPGLYYVDNE  174



>ref|XP_008810773.1| PREDICTED: proteasome subunit beta type-5-like [Phoenix dactylifera]
Length=272

 Score =   298 bits (764),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 142/172 (83%), Positives = 154/172 (90%), Gaps = 0/172 (0%)
 Frame = +2

Query  41   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  220
            +++D SGLES  P+     +L  ++   P+F +P   DFDGFQKDAIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGLESFVPLSAPIDDLCPDLSAPPTFDLPRSADFDGFQKDAIQMVKPAKGTTTLA  60

Query  221  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  400
            FIFKEGVMVAADSRASMGGYISSQ+VKKIIEINPYM+GTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQTVKKIIEINPYMIGTMAGGAADCQFWHRNLGIKCRL  120

Query  401  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSE
Sbjct  121  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSE  172



>ref|XP_009416647.1| PREDICTED: proteasome subunit beta type-5-like [Musa acuminata 
subsp. malaccensis]
Length=273

 Score =   298 bits (764),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 145/173 (84%), Positives = 158/173 (91%), Gaps = 1/173 (1%)
 Frame = +2

Query  41   VRIDFSGLESTAPIRGESSE-LFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTL  217
            +++D SGL+S   I G + + L +++   PSFQ+P  +DFDGFQKDAIQMVKPAKGTTTL
Sbjct  1    MKLDLSGLQSFTSIPGGAVDGLGEDLFAAPSFQLPACSDFDGFQKDAIQMVKPAKGTTTL  60

Query  218  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  397
            AFIFKEGV+VAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCR
Sbjct  61   AFIFKEGVIVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCR  120

Query  398  LHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            LHELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE
Sbjct  121  LHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  173



>emb|CDY19402.1| BnaC05g09110D [Brassica napus]
Length=274

 Score =   298 bits (764),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 141/174 (81%), Positives = 157/174 (90%), Gaps = 2/174 (1%)
 Frame = +2

Query  41   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  214
            +++D SG E++ P    G S+++ D    VPSF +P  TDFDGFQK+A+QMVKPA+GTTT
Sbjct  1    MKLDTSGFETSMPTIGFGSSNDMLDGFSTVPSFDLPRTTDFDGFQKEAVQMVKPARGTTT  60

Query  215  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  394
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  395  RLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAGWDE GPGLYYVD+E
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGWDETGPGLYYVDNE  174



>ref|XP_006417162.1| hypothetical protein EUTSA_v10008454mg [Eutrema salsugineum]
 gb|ESQ35515.1| hypothetical protein EUTSA_v10008454mg [Eutrema salsugineum]
Length=274

 Score =   298 bits (764),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 141/174 (81%), Positives = 157/174 (90%), Gaps = 2/174 (1%)
 Frame = +2

Query  41   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  214
            +++D SG E++ P+   G S+++ D    VPSF +P  TDFDGFQK+A+QMVKPAKGTTT
Sbjct  1    MKLDTSGFETSMPLIGFGSSNDMLDGFSSVPSFDLPRTTDFDGFQKEAVQMVKPAKGTTT  60

Query  215  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  394
            LAFIFK GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKGGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  395  RLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAGWDE GPGLYYVD+E
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGWDETGPGLYYVDNE  174



>ref|XP_010502548.1| PREDICTED: proteasome subunit beta type-5-B-like [Camelina sativa]
Length=272

 Score =   298 bits (763),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 139/174 (80%), Positives = 158/174 (91%), Gaps = 2/174 (1%)
 Frame = +2

Query  41   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  214
            +++D SG E++ P+   G +SE+ D +  VPSF +P  TDFDGFQK +++MVKPAKGTTT
Sbjct  1    MKLDTSGFETSMPVIGFGSNSEMLDGVSSVPSFDLPRTTDFDGFQKKSVEMVKPAKGTTT  60

Query  215  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  394
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLG+MAGG+ADCQFWHRNLG+KC
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGSMAGGSADCQFWHRNLGIKC  120

Query  395  RLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAGWDE GPGLYYVD+E
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGWDETGPGLYYVDNE  174



>ref|XP_010251768.1| PREDICTED: proteasome subunit beta type-5-like [Nelumbo nucifera]
Length=272

 Score =   298 bits (762),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 141/172 (82%), Positives = 152/172 (88%), Gaps = 0/172 (0%)
 Frame = +2

Query  41   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  220
            +++D SGLES +P+    +E  +     PSF++P  TDFDGFQKDA Q +KPAKGTTTLA
Sbjct  1    MKLDLSGLESASPLFAVGNEFSNGFSAAPSFELPCTTDFDGFQKDAKQTLKPAKGTTTLA  60

Query  221  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  400
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  401  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            HELANKRRISV GASKLL NILYSYRGMGLSVGTMIAGWDE GPGLYYVDSE
Sbjct  121  HELANKRRISVTGASKLLTNILYSYRGMGLSVGTMIAGWDETGPGLYYVDSE  172



>ref|XP_006842100.1| hypothetical protein AMTR_s00078p00083100 [Amborella trichopoda]
 gb|ERN03775.1| hypothetical protein AMTR_s00078p00083100 [Amborella trichopoda]
Length=276

 Score =   298 bits (762),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 142/172 (83%), Positives = 153/172 (89%), Gaps = 0/172 (0%)
 Frame = +2

Query  41   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  220
            +R+D SGL S AP    + EL +    +PSFQ+PN  DFD FQK A+QMVKPAKGTTTLA
Sbjct  6    MRLDTSGLNSLAPAHVVNDELCEGFMSLPSFQLPNSADFDTFQKKAVQMVKPAKGTTTLA  65

Query  221  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  400
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPY++GT+AGGAADCQFWHRNLG+KCRL
Sbjct  66   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYLIGTLAGGAADCQFWHRNLGIKCRL  125

Query  401  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSE
Sbjct  126  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSE  177



>ref|XP_002876966.1| hypothetical protein ARALYDRAFT_484397 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53225.1| hypothetical protein ARALYDRAFT_484397 [Arabidopsis lyrata subsp. 
lyrata]
Length=274

 Score =   296 bits (759),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 143/175 (82%), Positives = 157/175 (90%), Gaps = 3/175 (2%)
 Frame = +2

Query  41   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  214
            +++D SGLE+T P+   G +SE+ D    VPSF +P  TDFDGFQK A++MVKPAKGTTT
Sbjct  1    MKLDTSGLETTMPVIGFGSNSEMLDGFSSVPSFDLPRTTDFDGFQKKAVEMVKPAKGTTT  60

Query  215  LAFIFKEGVMVAADSRASMGGYIS-SQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVK  391
            LAFIFKEGVMVAADSRASMGGYI  SQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+K
Sbjct  61   LAFIFKEGVMVAADSRASMGGYICMSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIK  120

Query  392  CRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            CRLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAGWDE GPGLYYVD+E
Sbjct  121  CRLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGWDETGPGLYYVDNE  175



>ref|XP_003526966.1| PREDICTED: proteasome subunit beta type-5-like [Glycine max]
 gb|KHN23280.1| Proteasome subunit beta type-5 [Glycine soja]
Length=272

 Score =   296 bits (759),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 141/172 (82%), Positives = 153/172 (89%), Gaps = 0/172 (0%)
 Frame = +2

Query  41   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  220
            +++D +GLES   +    +++  E+   PSF +PN  DFDGF K+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTTGLESFPTLLAPQNDVVGELSAAPSFDLPNSNDFDGFVKEAIQMVKPAKGTTTLA  60

Query  221  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  400
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  401  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSE
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSE  172



>gb|KDO81953.1| hypothetical protein CISIN_1g022125mg [Citrus sinensis]
Length=212

 Score =   294 bits (753),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 142/172 (83%), Positives = 150/172 (87%), Gaps = 0/172 (0%)
 Frame = +2

Query  41   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  220
            +++D SGLEST+P  G   EL  E+   PSF +P  TDFD FQKD    +K AKGTTTLA
Sbjct  1    MKLDTSGLESTSPFFGSGDELCPELSAAPSFSLPLSTDFDEFQKDTKATLKHAKGTTTLA  60

Query  221  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  400
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  401  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSE
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSE  172



>ref|XP_007137929.1| hypothetical protein PHAVU_009G167300g [Phaseolus vulgaris]
 gb|ESW09923.1| hypothetical protein PHAVU_009G167300g [Phaseolus vulgaris]
Length=272

 Score =   295 bits (755),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 141/172 (82%), Positives = 152/172 (88%), Gaps = 0/172 (0%)
 Frame = +2

Query  41   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  220
            +++D +GLES   +    S++   +   PSF +PN  DFDGF K+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTTGLESFPSLLAPQSDVVGALSAAPSFDLPNSNDFDGFLKEAIQMVKPAKGTTTLA  60

Query  221  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  400
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  401  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSE
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSE  172



>ref|XP_010905449.1| PREDICTED: proteasome subunit beta type-5-like [Elaeis guineensis]
Length=272

 Score =   295 bits (755),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 139/172 (81%), Positives = 155/172 (90%), Gaps = 0/172 (0%)
 Frame = +2

Query  41   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  220
            +++D SG ES AP+ G   ++  ++     F +PN +DFDGFQK+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGFESFAPLSGSIDDVCSDLSAHQFFDLPNCSDFDGFQKNAIQMVKPAKGTTTLA  60

Query  221  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  400
            F+FKEGV+VAADSRASMGGYISSQ+VKKIIEINPYM+GTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FVFKEGVIVAADSRASMGGYISSQTVKKIIEINPYMIGTMAGGAADCQFWHRNLGIKCRL  120

Query  401  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSE
Sbjct  121  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSE  172



>gb|KHN31904.1| Proteasome subunit beta type-5 [Glycine soja]
Length=272

 Score =   295 bits (755),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 141/172 (82%), Positives = 152/172 (88%), Gaps = 0/172 (0%)
 Frame = +2

Query  41   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  220
            +++D + LES   +    +++  E+   PSF +PN  DFDGF KDAIQMVKPAKGTTTLA
Sbjct  1    MKLDTTSLESFPTLIAPQNDVAGELSAAPSFDLPNSNDFDGFLKDAIQMVKPAKGTTTLA  60

Query  221  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  400
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  401  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSE
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSE  172



>gb|ABK25888.1| unknown [Picea sitchensis]
Length=271

 Score =   295 bits (755),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 141/172 (82%), Positives = 151/172 (88%), Gaps = 0/172 (0%)
 Frame = +2

Query  41   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  220
            +++D SGLE     +  +  L D     PSF+IPN  DFDGFQK A+QMVKPAKGTTTLA
Sbjct  1    MKLDLSGLEPATLHQLSNDNLCDVFSPTPSFEIPNDADFDGFQKAAVQMVKPAKGTTTLA  60

Query  221  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  400
            FIFKEG+MVAADSRASMGGYISSQSVKKIIEINPY+LGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGIMVAADSRASMGGYISSQSVKKIIEINPYLLGTMAGGAADCQFWHRNLGIKCRL  120

Query  401  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSE
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSE  172



>gb|ACU23791.1| unknown [Glycine max]
Length=272

 Score =   295 bits (754),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 140/172 (81%), Positives = 153/172 (89%), Gaps = 0/172 (0%)
 Frame = +2

Query  41   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  220
            +++D +GLES   +    +++  E+   PSF +PN  DFDGF K+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTTGLESFPTLLAPQNDVVGELSAAPSFDLPNSNDFDGFVKEAIQMVKPAKGTTTLA  60

Query  221  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  400
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGT+AGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTVAGGAADCQFWHRNLGIKCRL  120

Query  401  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSE
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSE  172



>gb|ACP43315.1| 20S proteasome beta subunit 5 [Citrus maxima]
 gb|KDO81952.1| hypothetical protein CISIN_1g022125mg [Citrus sinensis]
Length=272

 Score =   294 bits (752),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 142/172 (83%), Positives = 150/172 (87%), Gaps = 0/172 (0%)
 Frame = +2

Query  41   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  220
            +++D SGLEST+P  G   EL  E+   PSF +P  TDFD FQKD    +K AKGTTTLA
Sbjct  1    MKLDTSGLESTSPFFGSGDELCPELSAAPSFSLPLSTDFDEFQKDTKATLKHAKGTTTLA  60

Query  221  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  400
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  401  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSE
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSE  172



>ref|XP_006484070.1| PREDICTED: proteasome subunit beta type-5-B-like isoform X2 [Citrus 
sinensis]
Length=272

 Score =   294 bits (752),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 142/172 (83%), Positives = 150/172 (87%), Gaps = 0/172 (0%)
 Frame = +2

Query  41   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  220
            +++D SGLEST+P  G   EL  E+   PSF +P  TDFD FQKD    +K AKGTTTLA
Sbjct  1    MKLDTSGLESTSPFFGSGDELCPELSAAPSFALPLSTDFDEFQKDTKATLKHAKGTTTLA  60

Query  221  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  400
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  401  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSE
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSE  172



>ref|XP_002315619.1| 20S proteasome beta subunit family protein [Populus trichocarpa]
 gb|EEF01790.1| 20S proteasome beta subunit family protein [Populus trichocarpa]
Length=274

 Score =   294 bits (752),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 142/175 (81%), Positives = 155/175 (89%), Gaps = 3/175 (2%)
 Frame = +2

Query  41   VRIDFSGLESTAPIRGESS-ELFD--EIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTT  211
            ++ D SGLEST+ + G +  EL D       P+F++P   DFDGFQK+A+QMVKPAKGTT
Sbjct  1    MKFDTSGLESTSSVFGTAGRELVDGFSAAAAPAFELPTTKDFDGFQKEAVQMVKPAKGTT  60

Query  212  TLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVK  391
            TLAFIFKEGV+VAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+K
Sbjct  61   TLAFIFKEGVIVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIK  120

Query  392  CRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            CRLHELANKRRISV GASKLLANIL+SYRGMGLSVGTMIAGWDE GPGLYYVDSE
Sbjct  121  CRLHELANKRRISVTGASKLLANILFSYRGMGLSVGTMIAGWDETGPGLYYVDSE  175



>gb|AFK46055.1| unknown [Lotus japonicus]
Length=270

 Score =   293 bits (750),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 139/172 (81%), Positives = 153/172 (89%), Gaps = 0/172 (0%)
 Frame = +2

Query  41   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  220
            +++D +GLES   +    +++  E    PSF++PN  DFDGF K+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTTGLESFPKLVAPGNDVVGEFTAPPSFELPNSNDFDGFVKEAIQMVKPAKGTTTLA  60

Query  221  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  400
            FIFK+GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKDGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  401  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            HELANKRRISV GASK+LANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSE
Sbjct  121  HELANKRRISVTGASKMLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSE  172



>ref|XP_006438069.1| hypothetical protein CICLE_v10032238mg [Citrus clementina]
 gb|ESR51309.1| hypothetical protein CICLE_v10032238mg [Citrus clementina]
Length=272

 Score =   293 bits (750),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 142/172 (83%), Positives = 150/172 (87%), Gaps = 0/172 (0%)
 Frame = +2

Query  41   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  220
            +++D SGLEST+P  G   EL  E+   PSF +P  TDFD FQKD    +K AKGTTTLA
Sbjct  1    MKLDTSGLESTSPFFGSGDELCPELLAAPSFALPLSTDFDEFQKDTKATLKHAKGTTTLA  60

Query  221  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  400
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  401  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSE
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSE  172



>gb|ABK25785.1| unknown [Picea sitchensis]
Length=271

 Score =   293 bits (750),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 140/172 (81%), Positives = 151/172 (88%), Gaps = 0/172 (0%)
 Frame = +2

Query  41   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  220
            +++D SGLE     +     L D     PSF+IPN TDFDGFQK A+QMVKPAKGTTTLA
Sbjct  1    MKLDLSGLEPATLHQRSDDNLCDVFSPSPSFKIPNDTDFDGFQKAALQMVKPAKGTTTLA  60

Query  221  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  400
            FIFKEG+MVAADSRASMGGYISSQSVKKIIEINP++LGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGIMVAADSRASMGGYISSQSVKKIIEINPHLLGTMAGGAADCQFWHRNLGIKCRL  120

Query  401  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            HELANKRRISV GASKLLANILYSYRGMGLS+GTMIAGWDE GPGLYYVDSE
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSIGTMIAGWDETGPGLYYVDSE  172



>ref|XP_008806245.1| PREDICTED: proteasome subunit beta type-5-like [Phoenix dactylifera]
Length=272

 Score =   293 bits (750),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 140/172 (81%), Positives = 154/172 (90%), Gaps = 0/172 (0%)
 Frame = +2

Query  41   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  220
            +++D SG ES AP  G   ++  ++     F +PN +DFDGFQK+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGFESFAPRSGLIDDVCSDLSAQQFFDLPNCSDFDGFQKNAIQMVKPAKGTTTLA  60

Query  221  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  400
            FIFKEGV+VAADSRASMGGYISSQ+VKKIIEINPYM+GTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVIVAADSRASMGGYISSQTVKKIIEINPYMIGTMAGGAADCQFWHRNLGIKCRL  120

Query  401  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSE
Sbjct  121  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSE  172



>ref|XP_006438071.1| hypothetical protein CICLE_v10032238mg [Citrus clementina]
 gb|ESR51311.1| hypothetical protein CICLE_v10032238mg [Citrus clementina]
Length=271

 Score =   293 bits (750),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 142/172 (83%), Positives = 150/172 (87%), Gaps = 0/172 (0%)
 Frame = +2

Query  41   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  220
            +++D SGLEST+P  G   EL  E+   PSF +P  TDFD FQKD    +K AKGTTTLA
Sbjct  1    MKLDTSGLESTSPFFGSGDELCPELLAAPSFALPLSTDFDEFQKDTKATLKHAKGTTTLA  60

Query  221  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  400
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  401  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSE
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSE  172



>ref|XP_004135309.1| PREDICTED: proteasome subunit beta type-5-like [Cucumis sativus]
 ref|XP_004159677.1| PREDICTED: proteasome subunit beta type-5-like [Cucumis sativus]
Length=272

 Score =   293 bits (749),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 142/173 (82%), Positives = 151/173 (87%), Gaps = 1/173 (1%)
 Frame = +2

Query  41   VRIDFSGLESTAPIRGE-SSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTL  217
            +++D SGLES   + G  S+EL D +   PSF IPN  +FDGFQK+AIQMVKPAKGTTTL
Sbjct  1    MKLDTSGLESATFLSGAGSTELLDGLSSAPSFGIPNARNFDGFQKEAIQMVKPAKGTTTL  60

Query  218  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  397
            AF FKEGVMVAADSRASMGGYISSQS KKIIEIN YMLGTMAGGAADCQFWHRNLG+KCR
Sbjct  61   AFTFKEGVMVAADSRASMGGYISSQSAKKIIEINSYMLGTMAGGAADCQFWHRNLGIKCR  120

Query  398  LHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
             HEL NKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSE
Sbjct  121  RHELENKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSE  173



>ref|XP_011041516.1| PREDICTED: proteasome subunit beta type-5-B-like [Populus euphratica]
 ref|XP_011041517.1| PREDICTED: proteasome subunit beta type-5-B-like [Populus euphratica]
 ref|XP_011041518.1| PREDICTED: proteasome subunit beta type-5-B-like [Populus euphratica]
 ref|XP_011041519.1| PREDICTED: proteasome subunit beta type-5-B-like [Populus euphratica]
Length=274

 Score =   293 bits (749),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 140/175 (80%), Positives = 153/175 (87%), Gaps = 3/175 (2%)
 Frame = +2

Query  41   VRIDFSGLESTAPIRGESSELFDE---IPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTT  211
            ++ D SGLESTA + G +   F +       P+F++P   DFDGFQK+A+QMVKPAKGTT
Sbjct  1    MKFDTSGLESTASVFGTAGREFVDGFSAAAAPAFELPTTKDFDGFQKEAVQMVKPAKGTT  60

Query  212  TLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVK  391
            TLAFIFKEGV+VAADSRASMGGYISSQSVKKIIEINPYMLGTMAGG ADCQFWHRNLG+K
Sbjct  61   TLAFIFKEGVIVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGGADCQFWHRNLGIK  120

Query  392  CRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            CRLHELANKRRISV GASKLLANIL+SYRGMGLSVGTMIAGWDE GPGLYYVDSE
Sbjct  121  CRLHELANKRRISVTGASKLLANILFSYRGMGLSVGTMIAGWDETGPGLYYVDSE  175



>ref|XP_010912107.1| PREDICTED: proteasome subunit beta type-5-like [Elaeis guineensis]
Length=272

 Score =   292 bits (748),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 139/172 (81%), Positives = 153/172 (89%), Gaps = 0/172 (0%)
 Frame = +2

Query  41   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  220
            +++D SGL+S  P+     +L  ++   P+F +P   DFDGFQKDAIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGLQSFVPLSAPIDDLCPDLSAPPTFDLPRSADFDGFQKDAIQMVKPAKGTTTLA  60

Query  221  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  400
            FIFKEGV+VAADSRASMGGYISSQ+VKKIIEINPYM+GTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVIVAADSRASMGGYISSQTVKKIIEINPYMIGTMAGGAADCQFWHRNLGIKCRL  120

Query  401  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDE G GLYYVDSE
Sbjct  121  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDETGAGLYYVDSE  172



>ref|XP_003523139.1| PREDICTED: proteasome subunit beta type-5-like isoform X1 [Glycine 
max]
 ref|XP_006578699.1| PREDICTED: proteasome subunit beta type-5-like isoform X2 [Glycine 
max]
 ref|XP_006578700.1| PREDICTED: proteasome subunit beta type-5-like isoform X3 [Glycine 
max]
Length=272

 Score =   292 bits (748),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 140/172 (81%), Positives = 151/172 (88%), Gaps = 0/172 (0%)
 Frame = +2

Query  41   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  220
            +++D + LES   +    +++  E+   P F +PN  DFDGF KDAIQMVKPAKGTTTLA
Sbjct  1    MKLDTTSLESFPTLIAPQNDVAGELSAAPFFDLPNSNDFDGFLKDAIQMVKPAKGTTTLA  60

Query  221  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  400
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  401  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSE
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSE  172



>gb|KGN51684.1| hypothetical protein Csa_5G590010 [Cucumis sativus]
Length=288

 Score =   293 bits (749),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 142/173 (82%), Positives = 151/173 (87%), Gaps = 1/173 (1%)
 Frame = +2

Query  41   VRIDFSGLESTAPIRGE-SSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTL  217
            +++D SGLES   + G  S+EL D +   PSF IPN  +FDGFQK+AIQMVKPAKGTTTL
Sbjct  17   MKLDTSGLESATFLSGAGSTELLDGLSSAPSFGIPNARNFDGFQKEAIQMVKPAKGTTTL  76

Query  218  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  397
            AF FKEGVMVAADSRASMGGYISSQS KKIIEIN YMLGTMAGGAADCQFWHRNLG+KCR
Sbjct  77   AFTFKEGVMVAADSRASMGGYISSQSAKKIIEINSYMLGTMAGGAADCQFWHRNLGIKCR  136

Query  398  LHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
             HEL NKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSE
Sbjct  137  RHELENKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSE  189



>ref|XP_009118034.1| PREDICTED: proteasome subunit beta type-5-B-like [Brassica rapa]
Length=274

 Score =   292 bits (748),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 139/174 (80%), Positives = 154/174 (89%), Gaps = 2/174 (1%)
 Frame = +2

Query  41   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  214
            +++D SG E++ P    G S+++ D    VPSF +P  TDFDGFQK+A+QMVKPAKGTTT
Sbjct  1    MKLDTSGFETSMPTIGFGSSNDMLDGFSTVPSFDLPRTTDFDGFQKEAVQMVKPAKGTTT  60

Query  215  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  394
            LAFIF EG MVAA SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFIEGAMVAAASRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  395  RLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAGWDE GPGLYYVD+E
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGWDETGPGLYYVDNE  174



>ref|XP_010476293.1| PREDICTED: proteasome subunit beta type-5-A-like [Camelina sativa]
Length=274

 Score =   292 bits (747),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 138/174 (79%), Positives = 155/174 (89%), Gaps = 2/174 (1%)
 Frame = +2

Query  41   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  214
            +++D SG E++ P    G SS++ DE+  VPSF +P+  +FDGFQK A+ M+K AKGTTT
Sbjct  1    MKLDTSGFETSVPTIGFGSSSDMLDELSSVPSFDLPHTKEFDGFQKKAVDMLKHAKGTTT  60

Query  215  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  394
            LAFIFK GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKGGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  395  RLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAGWDE GPGLYYVD+E
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGWDETGPGLYYVDNE  174



>ref|XP_010458748.1| PREDICTED: proteasome subunit beta type-5-A-like [Camelina sativa]
Length=274

 Score =   291 bits (746),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 138/174 (79%), Positives = 155/174 (89%), Gaps = 2/174 (1%)
 Frame = +2

Query  41   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  214
            +++D SG E++ P    G SS++ DE+  VPSF +P+  +FDGFQK A+ M+K AKGTTT
Sbjct  1    MKLDTSGFETSVPTIGFGSSSDMLDELSSVPSFDLPHTKEFDGFQKKAVDMLKHAKGTTT  60

Query  215  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  394
            LAFIFK GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKGGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  395  RLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAGWDE GPGLYYVD+E
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGWDETGPGLYYVDNE  174



>ref|XP_011457464.1| PREDICTED: proteasome subunit beta type-5-like [Fragaria vesca 
subsp. vesca]
Length=277

 Score =   291 bits (746),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 142/177 (80%), Positives = 153/177 (86%), Gaps = 4/177 (2%)
 Frame = +2

Query  38   MVRIDFSGLESTAPIRGESSELFDEIP----RVPSFQIPNITDFDGFQKDAIQMVKPAKG  205
            M ++DFS L++TAP+ G+SS      P      PSF++P   DFDGFQK+A  MVK  KG
Sbjct  1    MRQLDFSSLQTTAPLLGDSSGFSGGFPGDFSAAPSFEVPVTDDFDGFQKEARDMVKSKKG  60

Query  206  TTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG  385
            TTTLAFIFK+GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG
Sbjct  61   TTTLAFIFKDGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG  120

Query  386  VKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            +KCRLHELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSE
Sbjct  121  IKCRLHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSE  177



>ref|XP_003602092.1| Proteasome subunit beta type [Medicago truncatula]
 gb|AES72343.1| proteasome-alpha-type-5 protein [Medicago truncatula]
Length=271

 Score =   291 bits (745),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 141/170 (83%), Positives = 148/170 (87%), Gaps = 0/170 (0%)
 Frame = +2

Query  47   IDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFI  226
            +D + LES   +      +  EI   PSFQ+PN  DFDGF K+ IQMVKPAKGTTTLAFI
Sbjct  2    LDTTALESFPSLISHGINVAGEISAPPSFQLPNSNDFDGFVKETIQMVKPAKGTTTLAFI  61

Query  227  FKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHE  406
            FKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHE
Sbjct  62   FKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHE  121

Query  407  LANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            LANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSE
Sbjct  122  LANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSE  171



>ref|XP_010494920.1| PREDICTED: proteasome subunit beta type-5-A [Camelina sativa]
Length=274

 Score =   291 bits (745),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 138/174 (79%), Positives = 155/174 (89%), Gaps = 2/174 (1%)
 Frame = +2

Query  41   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  214
            +++D SG E++ P    G SS++ DE+  VPSF +P+  +FDGFQK A+ M+K AKGTTT
Sbjct  1    MKLDTSGFETSMPTIGFGSSSDMLDELSSVPSFDLPHTKEFDGFQKKAVDMLKHAKGTTT  60

Query  215  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  394
            LAFIFK GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKGGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  395  RLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAGWDE GPGLYYVD+E
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGWDETGPGLYYVDNE  174



>ref|XP_006305519.1| hypothetical protein CARUB_v10009991mg [Capsella rubella]
 gb|EOA38417.1| hypothetical protein CARUB_v10009991mg [Capsella rubella]
Length=274

 Score =   291 bits (745),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 138/174 (79%), Positives = 155/174 (89%), Gaps = 2/174 (1%)
 Frame = +2

Query  41   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  214
            +++D SG E++ P    G SS++ DE+  VPSF +P+  +FDGFQK+A  M+K AKGTTT
Sbjct  1    MKLDTSGFETSMPTIGFGSSSDMLDELSSVPSFDLPHTKEFDGFQKEASNMLKHAKGTTT  60

Query  215  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  394
            LAFIFK GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKGGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  395  RLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAGWDE GPGLYYVD+E
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGWDETGPGLYYVDNE  174



>ref|XP_002889982.1| hypothetical protein ARALYDRAFT_471459 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66241.1| hypothetical protein ARALYDRAFT_471459 [Arabidopsis lyrata subsp. 
lyrata]
Length=274

 Score =   290 bits (743),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 138/174 (79%), Positives = 155/174 (89%), Gaps = 2/174 (1%)
 Frame = +2

Query  41   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  214
            +++D SG E++ P+   G SS++ DE+  VPSF +P   +FDGFQK+A  M+K AKGTTT
Sbjct  1    MKLDTSGFETSMPMIGFGSSSDMLDELSSVPSFDLPRTKEFDGFQKEAKDMLKHAKGTTT  60

Query  215  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  394
            LAFIFK GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKGGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  395  RLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAGWDE GPGLYYVD+E
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGWDETGPGLYYVDNE  174



>gb|AFK34329.1| unknown [Medicago truncatula]
Length=271

 Score =   289 bits (740),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 140/170 (82%), Positives = 147/170 (86%), Gaps = 0/170 (0%)
 Frame = +2

Query  47   IDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFI  226
            +D + LES   +      +  EI   PSFQ+PN  DFDGF K+ IQMVKPAKGTTTLAFI
Sbjct  2    LDTTALESFPSLISHGINVAGEISAPPSFQLPNSNDFDGFVKETIQMVKPAKGTTTLAFI  61

Query  227  FKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHE  406
            FKEGVMVAADSRASMGGYISS SVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHE
Sbjct  62   FKEGVMVAADSRASMGGYISSHSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHE  121

Query  407  LANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            LANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSE
Sbjct  122  LANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSE  171



>gb|ACJ85344.1| unknown [Medicago truncatula]
Length=262

 Score =   289 bits (740),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 140/170 (82%), Positives = 147/170 (86%), Gaps = 0/170 (0%)
 Frame = +2

Query  47   IDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFI  226
            +D + LES   +      +  EI   PSFQ+PN  DFDGF K+ IQMVKPAKGTTTLAFI
Sbjct  2    LDTTALESFPSLISHGINVAGEISAPPSFQLPNSNDFDGFVKETIQMVKPAKGTTTLAFI  61

Query  227  FKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHE  406
            FKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHE
Sbjct  62   FKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHE  121

Query  407  LANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            LANKRRISV GASKLLANILYSYRGMG SVGTMIAGWDE GPGLYYVDSE
Sbjct  122  LANKRRISVTGASKLLANILYSYRGMGSSVGTMIAGWDETGPGLYYVDSE  171



>ref|NP_172765.1| 20S proteasome beta subunit E1 [Arabidopsis thaliana]
 sp|O23717.1|PSB5A_ARATH RecName: Full=Proteasome subunit beta type-5-A; AltName: Full=20S 
proteasome beta subunit E-1; AltName: Full=Proteasome component 
E; AltName: Full=Proteasome epsilon-1 chain; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAD31059.1|AC007357_8 Identical to gb|Y13695 multicatalytic endopeptidase complex, 
proteasome precursor, beta subunit (prce) from Arabidopsis thaliana. 
ESTs gb|Y09360, gb|F13852, gb|T20555, gb|T44620, gb|AI099779 
and gb|AA586183 come from this gene [Arabidopsis thaliana]
 gb|AAK15550.1|AF348579_1 putative proteasome epsilon chain precursor [Arabidopsis thaliana]
 emb|CAA74029.1| multicatalytic endopeptidase complex, proteasome precursor, beta 
subunit [Arabidopsis thaliana]
 gb|AAC32072.1| 20S proteasome beta subunit PBE1 [Arabidopsis thaliana]
 gb|AAN12998.1| proteasome epsilon chain precursor [Arabidopsis thaliana]
 gb|AEE28965.1| 20S proteasome beta subunit E1 [Arabidopsis thaliana]
Length=274

 Score =   290 bits (741),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 138/174 (79%), Positives = 154/174 (89%), Gaps = 2/174 (1%)
 Frame = +2

Query  41   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  214
            +++D SG E++ P+   G SS++ DE+  VPSF +P   +FDGFQK A  M+K AKGTTT
Sbjct  1    MKLDTSGFETSMPMIGFGSSSDMLDELSSVPSFDLPRTKEFDGFQKKAKDMLKHAKGTTT  60

Query  215  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  394
            LAFIFK GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKGGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  395  RLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAGWDE GPGLYYVD+E
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGWDETGPGLYYVDNE  174



>gb|AFK38197.1| unknown [Medicago truncatula]
Length=271

 Score =   289 bits (739),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 140/170 (82%), Positives = 147/170 (86%), Gaps = 0/170 (0%)
 Frame = +2

Query  47   IDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFI  226
            +D + LES   +      +  EI   PSFQ+PN  DFDGF K+ IQMVKPAKGTTTLAFI
Sbjct  2    LDTTALESFPSLISHGINVAGEISAPPSFQLPNSNDFDGFVKETIQMVKPAKGTTTLAFI  61

Query  227  FKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHE  406
            FKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHE
Sbjct  62   FKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHE  121

Query  407  LANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            LANKRRISV GASKLLANILYSYRGMG SVGTMIAGWDE GPGLYYVDSE
Sbjct  122  LANKRRISVTGASKLLANILYSYRGMGSSVGTMIAGWDETGPGLYYVDSE  171



>ref|XP_002514943.1| proteasome subunit beta type 5,8, putative [Ricinus communis]
 gb|EEF47497.1| proteasome subunit beta type 5,8, putative [Ricinus communis]
Length=249

 Score =   288 bits (737),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 139/174 (80%), Positives = 153/174 (88%), Gaps = 2/174 (1%)
 Frame = +2

Query  41   VRIDFSGLESTAPIRG--ESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  214
            +++D SG ESTAP+ G   SSE+ +      SF++P  +DFDGFQ +A Q +K AKGTTT
Sbjct  1    MKLDTSGFESTAPLFGASSSSEMVNGFSAPASFELPVTSDFDGFQSEAKQTLKHAKGTTT  60

Query  215  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  394
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  395  RLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            RLHELANKRRISV GASKLLANILY+YRGMGLSVGTM+AGWDE GPGLYYVDSE
Sbjct  121  RLHELANKRRISVTGASKLLANILYNYRGMGLSVGTMVAGWDETGPGLYYVDSE  174



>gb|AAK92808.1| putative proteasome epsilon chain precursor [Arabidopsis thaliana]
Length=274

 Score =   289 bits (739),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 138/174 (79%), Positives = 154/174 (89%), Gaps = 2/174 (1%)
 Frame = +2

Query  41   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  214
            +++D SG E++ P+   G SS++ DE+  VPSF +P   +FDGFQK A  M+K AKGTTT
Sbjct  1    MKLDTSGFETSMPMIGFGSSSDVLDELSSVPSFDLPRTKEFDGFQKKAKDMLKHAKGTTT  60

Query  215  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  394
            LAFIFK GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKGGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  395  RLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAGWDE GPGLYYVD+E
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGWDETGPGLYYVDNE  174



>ref|NP_001184978.1| 20S proteasome beta subunit E1 [Arabidopsis thaliana]
 gb|AEE28966.1| 20S proteasome beta subunit E1 [Arabidopsis thaliana]
Length=298

 Score =   277 bits (708),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 138/198 (70%), Positives = 154/198 (78%), Gaps = 26/198 (13%)
 Frame = +2

Query  41   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  214
            +++D SG E++ P+   G SS++ DE+  VPSF +P   +FDGFQK A  M+K AKGTTT
Sbjct  1    MKLDTSGFETSMPMIGFGSSSDMLDELSSVPSFDLPRTKEFDGFQKKAKDMLKHAKGTTT  60

Query  215  LAFIFKEGVMVAADSRASMGGYIS------------------------SQSVKKIIEINP  322
            LAFIFK GVMVAADSRASMGGYIS                        SQSVKKIIEINP
Sbjct  61   LAFIFKGGVMVAADSRASMGGYISVSSLKNSSKNMHPFDIVDFGRNTTSQSVKKIIEINP  120

Query  323  YMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGT  502
            YMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGT
Sbjct  121  YMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVSGASKLLANMLYSYRGMGLSVGT  180

Query  503  MIAGWDEKGPGLYYVDSE  556
            MIAGWDE GPGLYYVD+E
Sbjct  181  MIAGWDETGPGLYYVDNE  198



>gb|KDO81951.1| hypothetical protein CISIN_1g022125mg [Citrus sinensis]
Length=302

 Score =   274 bits (701),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 132/161 (82%), Positives = 140/161 (87%), Gaps = 0/161 (0%)
 Frame = +2

Query  41   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  220
            +++D SGLEST+P  G   EL  E+   PSF +P  TDFD FQKD    +K AKGTTTLA
Sbjct  1    MKLDTSGLESTSPFFGSGDELCPELSAAPSFSLPLSTDFDEFQKDTKATLKHAKGTTTLA  60

Query  221  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  400
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  401  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDE  523
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDE
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDE  161



>ref|XP_006655798.1| PREDICTED: proteasome subunit beta type-5-A-like [Oryza brachyantha]
Length=276

 Score =   273 bits (698),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 130/176 (74%), Positives = 152/176 (86%), Gaps = 4/176 (2%)
 Frame = +2

Query  41   VRIDFSGLESTAPIR--GESSE--LFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGT  208
            +++D S +E+   +R  GE  +  +F     +P+ ++P   DFDGFQK+A +++K  KGT
Sbjct  1    MKLDVSAMENNFAVRCGGEDDDGGIFGAGADLPAMELPTCADFDGFQKEAKELMKNKKGT  60

Query  209  TTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGV  388
            TTLAFIF +GV+VAADSRASMGGYISSQ+V+KIIEINPYMLGTMAGGAADCQFWHRNLG+
Sbjct  61   TTLAFIFDKGVIVAADSRASMGGYISSQTVRKIIEINPYMLGTMAGGAADCQFWHRNLGI  120

Query  389  KCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            KCRLHELANKRRISVAGASKLLANILYSYRGMGLS+GTMIAGWDEKGPGLYYVDSE
Sbjct  121  KCRLHELANKRRISVAGASKLLANILYSYRGMGLSIGTMIAGWDEKGPGLYYVDSE  176



>ref|XP_006484069.1| PREDICTED: proteasome subunit beta type-5-B-like isoform X1 [Citrus 
sinensis]
Length=302

 Score =   273 bits (699),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 132/161 (82%), Positives = 140/161 (87%), Gaps = 0/161 (0%)
 Frame = +2

Query  41   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  220
            +++D SGLEST+P  G   EL  E+   PSF +P  TDFD FQKD    +K AKGTTTLA
Sbjct  1    MKLDTSGLESTSPFFGSGDELCPELSAAPSFALPLSTDFDEFQKDTKATLKHAKGTTTLA  60

Query  221  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  400
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  401  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDE  523
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDE
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDE  161



>gb|AFW85805.1| hypothetical protein ZEAMMB73_646691 [Zea mays]
Length=203

 Score =   269 bits (688),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 130/177 (73%), Positives = 147/177 (83%), Gaps = 3/177 (2%)
 Frame = +2

Query  26   LVVTMVRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKG  205
            L ++ +  +F+ L ++A   G+ +    E P VPS  +P   DFDGFQ     MVK  KG
Sbjct  5    LDMSALETNFANLTASA---GDDTYFSAEAPDVPSMVLPICDDFDGFQAATKDMVKNKKG  61

Query  206  TTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG  385
            TTTLAFIF +GV+VAADSRASMGGYISSQ+V+KIIEINPYMLGTMAGGAADCQFWHRNLG
Sbjct  62   TTTLAFIFDKGVIVAADSRASMGGYISSQTVRKIIEINPYMLGTMAGGAADCQFWHRNLG  121

Query  386  VKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
             KCRLHEL+NKRRIS+AGASKLLANILYSYRGMGLS+GTMIAGWDEKGPGLYYVDSE
Sbjct  122  TKCRLHELSNKRRISIAGASKLLANILYSYRGMGLSIGTMIAGWDEKGPGLYYVDSE  178



>ref|XP_006438070.1| hypothetical protein CICLE_v10032238mg [Citrus clementina]
 gb|ESR51310.1| hypothetical protein CICLE_v10032238mg [Citrus clementina]
Length=302

 Score =   272 bits (696),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 132/161 (82%), Positives = 140/161 (87%), Gaps = 0/161 (0%)
 Frame = +2

Query  41   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  220
            +++D SGLEST+P  G   EL  E+   PSF +P  TDFD FQKD    +K AKGTTTLA
Sbjct  1    MKLDTSGLESTSPFFGSGDELCPELLAAPSFALPLSTDFDEFQKDTKATLKHAKGTTTLA  60

Query  221  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  400
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  401  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDE  523
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDE
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDE  161



>ref|XP_010912828.1| PREDICTED: proteasome subunit beta type-5-like [Elaeis guineensis]
Length=272

 Score =   271 bits (693),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 127/172 (74%), Positives = 149/172 (87%), Gaps = 0/172 (0%)
 Frame = +2

Query  41   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  220
            +++D +GLES AP+ G   +L  E+   PSF +P   DFDGFQK+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTTGLESFAPLHGGMDDLHGELWAPPSFDLPVCADFDGFQKNAIQMVKPAKGTTTLA  60

Query  221  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  400
            F+FKEG++VAA+SR SMGGY++SQ+VKKI+EINP+M+ T+AGGAADC FWHRNLGVKCRL
Sbjct  61   FVFKEGIIVAAESRTSMGGYVASQNVKKIVEINPHMIATVAGGAADCIFWHRNLGVKCRL  120

Query  401  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            +EL NKRRISVAGASKLL N+LYSYRGM LSVGTMIAGWDE GP LYYVDSE
Sbjct  121  YELENKRRISVAGASKLLTNMLYSYRGMELSVGTMIAGWDEMGPSLYYVDSE  172



>gb|AFW85803.1| hypothetical protein ZEAMMB73_646691 [Zea mays]
Length=263

 Score =   269 bits (687),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 130/177 (73%), Positives = 147/177 (83%), Gaps = 3/177 (2%)
 Frame = +2

Query  26   LVVTMVRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKG  205
            L ++ +  +F+ L ++A   G+ +    E P VPS  +P   DFDGFQ     MVK  KG
Sbjct  5    LDMSALETNFANLTASA---GDDTYFSAEAPDVPSMVLPICDDFDGFQAATKDMVKNKKG  61

Query  206  TTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG  385
            TTTLAFIF +GV+VAADSRASMGGYISSQ+V+KIIEINPYMLGTMAGGAADCQFWHRNLG
Sbjct  62   TTTLAFIFDKGVIVAADSRASMGGYISSQTVRKIIEINPYMLGTMAGGAADCQFWHRNLG  121

Query  386  VKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
             KCRLHEL+NKRRIS+AGASKLLANILYSYRGMGLS+GTMIAGWDEKGPGLYYVDSE
Sbjct  122  TKCRLHELSNKRRISIAGASKLLANILYSYRGMGLSIGTMIAGWDEKGPGLYYVDSE  178



>ref|NP_001132821.1| uncharacterized protein LOC100194311 [Zea mays]
 gb|ACF81829.1| unknown [Zea mays]
 gb|ACF86108.1| unknown [Zea mays]
 gb|ACG33811.1| proteasome subunit beta type 5 precursor [Zea mays]
 gb|AFW85804.1| proteasome subunit beta type [Zea mays]
Length=280

 Score =   269 bits (687),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 130/177 (73%), Positives = 147/177 (83%), Gaps = 3/177 (2%)
 Frame = +2

Query  26   LVVTMVRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKG  205
            L ++ +  +F+ L ++A   G+ +    E P VPS  +P   DFDGFQ     MVK  KG
Sbjct  5    LDMSALETNFANLTASA---GDDTYFSAEAPDVPSMVLPICDDFDGFQAATKDMVKNKKG  61

Query  206  TTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG  385
            TTTLAFIF +GV+VAADSRASMGGYISSQ+V+KIIEINPYMLGTMAGGAADCQFWHRNLG
Sbjct  62   TTTLAFIFDKGVIVAADSRASMGGYISSQTVRKIIEINPYMLGTMAGGAADCQFWHRNLG  121

Query  386  VKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
             KCRLHEL+NKRRIS+AGASKLLANILYSYRGMGLS+GTMIAGWDEKGPGLYYVDSE
Sbjct  122  TKCRLHELSNKRRISIAGASKLLANILYSYRGMGLSIGTMIAGWDEKGPGLYYVDSE  178



>ref|XP_004964820.1| PREDICTED: proteasome subunit beta type-5-A-like [Setaria italica]
Length=280

 Score =   268 bits (684),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 130/176 (74%), Positives = 144/176 (82%), Gaps = 4/176 (2%)
 Frame = +2

Query  41   VRIDFSGLESTAPI----RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGT  208
            +++D S LE+   +     G+      E P VPS  +P   DFDGFQ     MVK  KGT
Sbjct  3    MKLDMSALETNFAVPCGDDGDGMYFSAEAPDVPSMVLPTCADFDGFQAATKDMVKNKKGT  62

Query  209  TTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGV  388
            TTLAFIF +GV+VAADSRASMGGYISSQ+V+KIIEINPYMLGTMAGGAADCQFWHRNLG 
Sbjct  63   TTLAFIFDKGVIVAADSRASMGGYISSQTVRKIIEINPYMLGTMAGGAADCQFWHRNLGN  122

Query  389  KCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            KCRLHEL+NKRRIS+AGASKLLANILYSYRGMGLS+GTMIAGWDEKGPGLYYVDSE
Sbjct  123  KCRLHELSNKRRISIAGASKLLANILYSYRGMGLSIGTMIAGWDEKGPGLYYVDSE  178



>gb|ACU51028.1| 20S proteasome beta5 subunit [Conocephalum conicum]
Length=280

 Score =   268 bits (684),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 127/177 (72%), Positives = 143/177 (81%), Gaps = 5/177 (3%)
 Frame = +2

Query  41   VRIDFSGLESTAPIRGESSE-----LFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKG  205
            +R+DF+GL+     R  S +      +D I   PSF +P + D DGF+K A+ MVKP  G
Sbjct  1    MRLDFAGLDPVTLRRPSSGDGGFDVAYDSIGSAPSFNLPAVADLDGFEKAAVDMVKPLHG  60

Query  206  TTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG  385
            TTTLAF+FKEGV+VAADSRASMG YISSQ VKKI+EINPY+LGTMAGGAADCQFW RNLG
Sbjct  61   TTTLAFVFKEGVIVAADSRASMGNYISSQDVKKILEINPYLLGTMAGGAADCQFWQRNLG  120

Query  386  VKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
             +CRLHEL NKRRISV GASKLLAN LYSYRGMGLS+GTMIAGWDE GPGLYYVDSE
Sbjct  121  TRCRLHELGNKRRISVTGASKLLANTLYSYRGMGLSMGTMIAGWDETGPGLYYVDSE  177



>ref|XP_001759925.1| predicted protein [Physcomitrella patens]
 gb|EDQ75429.1| predicted protein [Physcomitrella patens]
Length=269

 Score =   267 bits (682),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 123/144 (85%), Positives = 133/144 (92%), Gaps = 0/144 (0%)
 Frame = +2

Query  125  PSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKK  304
            PSF++P + D DGFQK A+QMVKPAKGTTTLAF+FK GV+VAADSRASMG YISSQSVKK
Sbjct  27   PSFELPAVADLDGFQKAAVQMVKPAKGTTTLAFVFKHGVIVAADSRASMGNYISSQSVKK  86

Query  305  IIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGM  484
            I+EINPY+LGTMAGGAADCQFW RNLG +CRLHELANKRRISV GASKLLAN LYSYRGM
Sbjct  87   ILEINPYLLGTMAGGAADCQFWQRNLGTRCRLHELANKRRISVTGASKLLANTLYSYRGM  146

Query  485  GLSVGTMIAGWDEKGPGLYYVDSE  556
            GLS+GTMIAGWDE GPGLYYVDSE
Sbjct  147  GLSMGTMIAGWDETGPGLYYVDSE  170



>dbj|BAA96838.1| beta 5 subunit of 20S proteasome [Oryza sativa Japonica Group]
Length=277

 Score =   267 bits (682),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 129/177 (73%), Positives = 149/177 (84%), Gaps = 5/177 (3%)
 Frame = +2

Query  41   VRIDFSGLEST----APIRGESSELFDEIPRVPSFQIPNI-TDFDGFQKDAIQMVKPAKG  205
            +++D S +E+     A  R +   LF     +P+ ++P    DFDGFQK+  +M+K  KG
Sbjct  1    MKLDVSAMENNFAAHAAGREDDGGLFGAGADLPAMELPTCPADFDGFQKETKEMLKHKKG  60

Query  206  TTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG  385
            TTTLAFIF +GV+VAADSRASMGGYISSQ+V+KIIEINPYMLGTMAGGAADCQFWHRNLG
Sbjct  61   TTTLAFIFDKGVIVAADSRASMGGYISSQTVRKIIEINPYMLGTMAGGAADCQFWHRNLG  120

Query  386  VKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            +KCRLHELANKRRIS+AGASKLLANILYSYRGMGLS+GTMIAGWDEKGPGLYYVDSE
Sbjct  121  IKCRLHELANKRRISIAGASKLLANILYSYRGMGLSIGTMIAGWDEKGPGLYYVDSE  177



>ref|XP_002437853.1| hypothetical protein SORBIDRAFT_10g003770 [Sorghum bicolor]
 gb|EER89220.1| hypothetical protein SORBIDRAFT_10g003770 [Sorghum bicolor]
Length=280

 Score =   266 bits (681),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 131/177 (74%), Positives = 145/177 (82%), Gaps = 6/177 (3%)
 Frame = +2

Query  41   VRIDFSGLES-----TAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKG  205
            +++D S LE+     T P   + +      P VPS  +P   DFDGFQ D   MVK  KG
Sbjct  3    MKVDMSALETNFANMTFPAS-DDTYFSAGAPDVPSMVLPTCDDFDGFQADTKAMVKNKKG  61

Query  206  TTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG  385
            TTTLAFIF +GV+VAADSRASMGGYISSQ+V+KIIEINPYMLGTMAGGAADCQFWHRNLG
Sbjct  62   TTTLAFIFDKGVIVAADSRASMGGYISSQTVRKIIEINPYMLGTMAGGAADCQFWHRNLG  121

Query  386  VKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
             KCRLHEL+NKRRIS+AGASKLLANILYSYRGMGLS+GTMIAGWDEKGPGLYYVDSE
Sbjct  122  NKCRLHELSNKRRISIAGASKLLANILYSYRGMGLSIGTMIAGWDEKGPGLYYVDSE  178



>ref|XP_008791726.1| PREDICTED: proteasome subunit beta type-5-like [Phoenix dactylifera]
Length=272

 Score =   266 bits (680),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 125/172 (73%), Positives = 147/172 (85%), Gaps = 0/172 (0%)
 Frame = +2

Query  41   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  220
            +++D +GLES A   GE  +L  E    PSF +P   DFDGFQK+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTTGLESFASFHGEMDDLHGEFWAPPSFDLPVCADFDGFQKNAIQMVKPAKGTTTLA  60

Query  221  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  400
            F+FKEG++VAA+SR SMGGY++SQ+VKKI+EINPYM+ T+AGGAADC FWHRNLG+KCRL
Sbjct  61   FVFKEGIIVAAESRTSMGGYVASQNVKKIVEINPYMIATVAGGAADCIFWHRNLGMKCRL  120

Query  401  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            +EL NKRRISVAGASKLL N+LYSYRGMGLS+GTM+AG DE GP LYYVDSE
Sbjct  121  YELENKRRISVAGASKLLTNMLYSYRGMGLSIGTMVAGCDEMGPSLYYVDSE  172



>gb|EEE65108.1| hypothetical protein OsJ_20167 [Oryza sativa Japonica Group]
Length=277

 Score =   266 bits (679),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 128/177 (72%), Positives = 148/177 (84%), Gaps = 5/177 (3%)
 Frame = +2

Query  41   VRIDFSGLESTAPIRGESSE----LFDEIPRVPSFQIPNI-TDFDGFQKDAIQMVKPAKG  205
            +++D S +E+    +    E    LF     +P+ ++P    DFDGFQK+  +M+K  KG
Sbjct  1    MKLDVSAMENNFAAQAAGGEDDGGLFGAGADLPAMELPTCPADFDGFQKETKEMLKHKKG  60

Query  206  TTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG  385
            TTTLAFIF +GV+VAADSRASMGGYISSQ+V+KIIEINPYMLGTMAGGAADCQFWHRNLG
Sbjct  61   TTTLAFIFDKGVIVAADSRASMGGYISSQTVRKIIEINPYMLGTMAGGAADCQFWHRNLG  120

Query  386  VKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            +KCRLHELANKRRIS+AGASKLLANILYSYRGMGLS+GTMIAGWDEKGPGLYYVDSE
Sbjct  121  IKCRLHELANKRRISIAGASKLLANILYSYRGMGLSIGTMIAGWDEKGPGLYYVDSE  177



>ref|NP_001056842.1| Os06g0153800 [Oryza sativa Japonica Group]
 dbj|BAD69286.1| beta 5 subunit of 20S proteasome [Oryza sativa Japonica Group]
 dbj|BAF18756.1| Os06g0153800 [Oryza sativa Japonica Group]
 dbj|BAG96622.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96749.1| unnamed protein product [Oryza sativa Japonica Group]
Length=277

 Score =   265 bits (678),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/177 (72%), Positives = 147/177 (83%), Gaps = 5/177 (3%)
 Frame = +2

Query  41   VRIDFSGLESTAPIRGESSE----LFDEIPRVPSFQIPNI-TDFDGFQKDAIQMVKPAKG  205
            +++D S +E+         E    LF     +P+ ++P    DFDGFQK+  +M+K  KG
Sbjct  1    MKLDVSAMENNFAAHAAGGEDDGGLFGAGADLPAMELPTCPADFDGFQKETKEMLKHKKG  60

Query  206  TTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG  385
            TTTLAFIF +GV+VAADSRASMGGYISSQ+V+KIIEINPYMLGTMAGGAADCQFWHRNLG
Sbjct  61   TTTLAFIFDKGVIVAADSRASMGGYISSQTVRKIIEINPYMLGTMAGGAADCQFWHRNLG  120

Query  386  VKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            +KCRLHELANKRRIS+AGASKLLANILYSYRGMGLS+GTMIAGWDEKGPGLYYVDSE
Sbjct  121  IKCRLHELANKRRISIAGASKLLANILYSYRGMGLSIGTMIAGWDEKGPGLYYVDSE  177



>gb|EEC80034.1| hypothetical protein OsI_21721 [Oryza sativa Indica Group]
Length=277

 Score =   265 bits (678),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/177 (72%), Positives = 147/177 (83%), Gaps = 5/177 (3%)
 Frame = +2

Query  41   VRIDFSGLESTAPIRGESSE----LFDEIPRVPSFQIPNI-TDFDGFQKDAIQMVKPAKG  205
            +++D S +E+         E    LF     +P+ ++P    DFDGFQK+  +M+K  KG
Sbjct  1    MKLDVSAMENNFAAHAAGGEDDGGLFGAGADLPAMELPTCPADFDGFQKETKEMLKHKKG  60

Query  206  TTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG  385
            TTTLAFIF +GV+VAADSRASMGGYISSQ+V+KIIEINPYMLGTMAGGAADCQFWHRNLG
Sbjct  61   TTTLAFIFDKGVIVAADSRASMGGYISSQTVRKIIEINPYMLGTMAGGAADCQFWHRNLG  120

Query  386  VKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            +KCRLHELANKRRIS+AGASKLLANILYSYRGMGLS+GTMIAGWDEKGPGLYYVDSE
Sbjct  121  IKCRLHELANKRRISIAGASKLLANILYSYRGMGLSIGTMIAGWDEKGPGLYYVDSE  177



>ref|XP_010440898.1| PREDICTED: proteasome subunit beta type-5-B-like [Camelina sativa]
Length=160

 Score =   260 bits (665),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 123/146 (84%), Positives = 135/146 (92%), Gaps = 1/146 (1%)
 Frame = +2

Query  86   GESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRA  265
            G ++E+FD +  VPSF +P  TDFDGFQK +++MVKPAKGTTTLAFIFKEGVMVAADSRA
Sbjct  7    GSNNEMFDGVSSVPSFDLPRTTDFDGFQKKSVEMVKPAKGTTTLAFIFKEGVMVAADSRA  66

Query  266  SMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGAS  445
            SMGGYISS S+K IIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV+GAS
Sbjct  67   SMGGYISSPSMK-IIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVSGAS  125

Query  446  KLLANILYSYRGMGLSVGTMIAGWDE  523
            KLLAN+LYSYRGM LSVGTMIAGWDE
Sbjct  126  KLLANMLYSYRGMRLSVGTMIAGWDE  151



>ref|XP_002972642.1| hypothetical protein SELMODRAFT_270977 [Selaginella moellendorffii]
 gb|EFJ25863.1| hypothetical protein SELMODRAFT_270977 [Selaginella moellendorffii]
Length=277

 Score =   254 bits (648),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 122/170 (72%), Positives = 139/170 (82%), Gaps = 0/170 (0%)
 Frame = +2

Query  47   IDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFI  226
            +DFSGLE  +  +   S+         SF +P + D DGFQK A+ ++KPA GTTTLAF 
Sbjct  5    LDFSGLEPASLRQHSYSDPAAHWEPQCSFPLPKVADLDGFQKAAVDLLKPAHGTTTLAFE  64

Query  227  FKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHE  406
            F+ G++VAADSRASMG YISSQSVKKI+EINPY+LGTMAGGAADCQFW RNLG +CRLHE
Sbjct  65   FQGGIIVAADSRASMGQYISSQSVKKILEINPYLLGTMAGGAADCQFWQRNLGTRCRLHE  124

Query  407  LANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            LANKRRISVAGASKLLAN LYSYRGMGLS+GTMIAGWDE GP L+YVDSE
Sbjct  125  LANKRRISVAGASKLLANTLYSYRGMGLSMGTMIAGWDETGPALFYVDSE  174



>ref|XP_002994143.1| hypothetical protein SELMODRAFT_272351 [Selaginella moellendorffii]
 gb|EFJ04804.1| hypothetical protein SELMODRAFT_272351 [Selaginella moellendorffii]
Length=275

 Score =   254 bits (648),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 122/170 (72%), Positives = 139/170 (82%), Gaps = 0/170 (0%)
 Frame = +2

Query  47   IDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFI  226
            +DFSGLE  +  +   S+         SF +P + D DGFQK A+ ++KPA GTTTLAF 
Sbjct  3    LDFSGLEPASLRQHSYSDPAAHWEPQCSFPLPKVADLDGFQKAAVDLLKPAHGTTTLAFE  62

Query  227  FKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHE  406
            F+ G++VAADSRASMG YISSQSVKKI+EINPY+LGTMAGGAADCQFW RNLG +CRLHE
Sbjct  63   FQGGIIVAADSRASMGQYISSQSVKKILEINPYLLGTMAGGAADCQFWQRNLGTRCRLHE  122

Query  407  LANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            LANKRRISVAGASKLLAN LYSYRGMGLS+GTMIAGWDE GP L+YVDSE
Sbjct  123  LANKRRISVAGASKLLANTLYSYRGMGLSMGTMIAGWDETGPALFYVDSE  172



>ref|XP_003564317.1| PREDICTED: proteasome subunit beta type-5-A-like [Brachypodium 
distachyon]
Length=277

 Score =   253 bits (647),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 140/175 (80%), Gaps = 3/175 (2%)
 Frame = +2

Query  41   VRIDFSGLES---TAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTT  211
            +R+D S LE+    AP       +F       + + P   DFDGFQK    MV   KGTT
Sbjct  1    MRLDVSALENHHFAAPGNEFGGGVFAADTEELAMEFPTCNDFDGFQKATKDMVNNKKGTT  60

Query  212  TLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVK  391
            TL+FIF +GV+VAADSRASMGGYISSQ+V+KIIEINPYMLGTMAGGAADCQFWHRNLG K
Sbjct  61   TLSFIFDKGVIVAADSRASMGGYISSQTVRKIIEINPYMLGTMAGGAADCQFWHRNLGTK  120

Query  392  CRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            CRLHELANKRRIS+AG+SK+LANILYSYRGMGLS+GTMIAG+DE GPGLYYVDSE
Sbjct  121  CRLHELANKRRISIAGSSKMLANILYSYRGMGLSIGTMIAGFDETGPGLYYVDSE  175



>gb|AAU82107.1| 20S proteasome beta 5 subunit [Triticum aestivum]
Length=279

 Score =   252 bits (643),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 117/143 (82%), Positives = 129/143 (90%), Gaps = 0/143 (0%)
 Frame = +2

Query  128  SFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKI  307
            + + P   DFDGFQK   +MV   KGTTTL+FIF +GV+VAADSRASMGGYISSQ+V+KI
Sbjct  35   ALEFPTCNDFDGFQKATKEMVNNKKGTTTLSFIFDKGVIVAADSRASMGGYISSQTVRKI  94

Query  308  IEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMG  487
            IEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRIS+AG+SK LANILYSYRGMG
Sbjct  95   IEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISIAGSSKTLANILYSYRGMG  154

Query  488  LSVGTMIAGWDEKGPGLYYVDSE  556
            LS+GTMIAG+DE GPGLYYVDSE
Sbjct  155  LSIGTMIAGFDETGPGLYYVDSE  177



>dbj|BAJ97061.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=279

 Score =   250 bits (639),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 117/143 (82%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = +2

Query  128  SFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKI  307
            + + P   DFDGFQK    MV   KGTTTL+FIF +GV+VAADSRASMGGYISSQ+V+KI
Sbjct  35   ALEFPTCDDFDGFQKATKAMVNNKKGTTTLSFIFDKGVIVAADSRASMGGYISSQTVRKI  94

Query  308  IEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMG  487
            IEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRIS+AG+SK LANILYSYRGMG
Sbjct  95   IEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISIAGSSKTLANILYSYRGMG  154

Query  488  LSVGTMIAGWDEKGPGLYYVDSE  556
            LS+GTMIAG+DE GPGLYYVDSE
Sbjct  155  LSIGTMIAGFDETGPGLYYVDSE  177



>gb|AAT44125.1| 20S proteasome beta subunit E [Saussurea medusa]
Length=150

 Score =   245 bits (626),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 130/146 (89%), Gaps = 1/146 (1%)
 Frame = +2

Query  41   VRIDFSGLESTAPIRGESSE-LFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTL  217
            +++DF GLES+AP+ G + + L D     PSF +P  +DFDGFQK +IQMVKPAKGTTTL
Sbjct  1    MKLDFGGLESSAPLYGGNDDVLSDGFSTAPSFDLPVTSDFDGFQKSSIQMVKPAKGTTTL  60

Query  218  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  397
            AFIFKEGVMVAA+SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCR
Sbjct  61   AFIFKEGVMVAANSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCR  120

Query  398  LHELANKRRISVAGASKLLANILYSY  475
            LHELANKRRISV GASKLLANILYSY
Sbjct  121  LHELANKRRISVTGASKLLANILYSY  146



>dbj|BAG92607.1| unnamed protein product [Oryza sativa Japonica Group]
Length=224

 Score =   241 bits (615),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 113/124 (91%), Positives = 121/124 (98%), Gaps = 0/124 (0%)
 Frame = +2

Query  185  MVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQ  364
            M+K  KGTTTLAFIF +GV+VAADSRASMGGYISSQ+V+KIIEINPYMLGTMAGGAADCQ
Sbjct  1    MLKHKKGTTTLAFIFDKGVIVAADSRASMGGYISSQTVRKIIEINPYMLGTMAGGAADCQ  60

Query  365  FWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYY  544
            FWHRNLG+KCRLHELANKRRIS+AGASKLLANILYSYRGMGLS+GTMIAGWDEKGPGLYY
Sbjct  61   FWHRNLGIKCRLHELANKRRISIAGASKLLANILYSYRGMGLSIGTMIAGWDEKGPGLYY  120

Query  545  VDSE  556
            VDSE
Sbjct  121  VDSE  124



>ref|XP_001751936.1| predicted protein [Physcomitrella patens]
 gb|EDQ83371.1| predicted protein, partial [Physcomitrella patens]
Length=236

 Score =   241 bits (616),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 113/134 (84%), Positives = 121/134 (90%), Gaps = 0/134 (0%)
 Frame = +2

Query  155  FDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLG  334
             DGFQK A+Q+VKPAKGTTTLAF+FK GV+VAADS ASMG  ISSQSVKKI+EINPY+LG
Sbjct  1    LDGFQKAAVQLVKPAKGTTTLAFVFKHGVIVAADSSASMGNSISSQSVKKILEINPYLLG  60

Query  335  TMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAG  514
            TMAGGAADCQFW RNLG +CRLHELANKR ISV GASKLLAN LYSYRGMGL +GTMIAG
Sbjct  61   TMAGGAADCQFWQRNLGTRCRLHELANKRHISVTGASKLLANTLYSYRGMGLFMGTMIAG  120

Query  515  WDEKGPGLYYVDSE  556
            WDE GPGLYYVDSE
Sbjct  121  WDETGPGLYYVDSE  134



>gb|AAT80906.1| 26S proteasome beta subunit [Lemna minor]
Length=116

 Score =   233 bits (595),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 110/116 (95%), Positives = 114/116 (98%), Gaps = 0/116 (0%)
 Frame = +2

Query  188  VKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQF  367
            VKPAKGTTTLAFIFKEGV+V+ADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQF
Sbjct  1    VKPAKGTTTLAFIFKEGVIVSADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQF  60

Query  368  WHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPG  535
            WHRNLG+KCRLHELANKRRISV GASKLLANILYSYRGMGLS+GTMIAGWDE GPG
Sbjct  61   WHRNLGIKCRLHELANKRRISVTGASKLLANILYSYRGMGLSIGTMIAGWDETGPG  116



>gb|EMS57921.1| Proteasome subunit beta type-5 [Triticum urartu]
Length=226

 Score =   231 bits (590),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 109/124 (88%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = +2

Query  185  MVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQ  364
            MV   KGTTTL+FIF +GV+VAADSRASMGGYISSQ+V+KIIEINPYMLGTMAGGAADCQ
Sbjct  1    MVNNKKGTTTLSFIFDKGVIVAADSRASMGGYISSQTVRKIIEINPYMLGTMAGGAADCQ  60

Query  365  FWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYY  544
            FWHRNLGVKCRLHELANKRRIS+AG+SK LANILYSYRGMGLS+GTMIAG+DE GPGLYY
Sbjct  61   FWHRNLGVKCRLHELANKRRISIAGSSKTLANILYSYRGMGLSIGTMIAGFDETGPGLYY  120

Query  545  VDSE  556
            VDSE
Sbjct  121  VDSE  124



>ref|XP_003061052.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH54702.1| predicted protein [Micromonas pusilla CCMP1545]
Length=286

 Score =   231 bits (589),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 109/176 (62%), Positives = 138/176 (78%), Gaps = 4/176 (2%)
 Frame = +2

Query  41   VRIDFSGLES-TAPIRGESSELFDEIP---RVPSFQIPNITDFDGFQKDAIQMVKPAKGT  208
            +++DFS L++ T  I  E +E   EI       +F++P + ++D FQ++ +  VKP  GT
Sbjct  1    MKLDFSVLDAPTRKIDAEIAECAAEINSDVHAQNFKLPMVENYDSFQREVVDYVKPNHGT  60

Query  209  TTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGV  388
            TTL FIF+ GV++A DSRAS G YISSQ+VKK+IEINPY+LGTMAGGAADCQFW RNLG+
Sbjct  61   TTLGFIFEHGVVIAVDSRASQGPYISSQTVKKVIEINPYLLGTMAGGAADCQFWQRNLGI  120

Query  389  KCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            +CRLHEL N +RISV+GASKLL+N LY YRG GLS+GTM+AGWD  GPGLYYVDS+
Sbjct  121  QCRLHELENGKRISVSGASKLLSNTLYGYRGQGLSMGTMVAGWDLNGPGLYYVDSD  176



>ref|XP_001421201.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO99494.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=297

 Score =   231 bits (590),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 113/178 (63%), Positives = 137/178 (77%), Gaps = 10/178 (6%)
 Frame = +2

Query  47   IDFSGLESTAPIRG--------ESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAK  202
            +DFS L++TA  RG        ES +  D      +F+ P + DF+GFQ++ I  VKP  
Sbjct  6    LDFSFLDATA--RGSMASKHVDESLDAIDGNMHECNFKAPAVEDFEGFQREVINYVKPNH  63

Query  203  GTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNL  382
            GTTTLAFIF+ G++VA DSRAS G YISSQ+VKK+IEINP++LGTMAGGAADCQFW RNL
Sbjct  64   GTTTLAFIFEHGIVVAVDSRASQGPYISSQTVKKVIEINPFLLGTMAGGAADCQFWQRNL  123

Query  383  GVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            G++CRLHEL N +RI+V  ASKLLAN LYSY+G GLS+GTM+AGWD  GPGLYYVDSE
Sbjct  124  GIQCRLHELENGKRITVRAASKLLANTLYSYKGKGLSMGTMVAGWDLNGPGLYYVDSE  181



>ref|XP_002506817.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO68075.1| predicted protein [Micromonas sp. RCC299]
Length=291

 Score =   230 bits (586),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 107/176 (61%), Positives = 136/176 (77%), Gaps = 4/176 (2%)
 Frame = +2

Query  41   VRIDFSGLES----TAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGT  208
            +++D+S L++    T  I  + +          +F++P + ++D FQ++ +  VKP  GT
Sbjct  4    LKLDYSVLDAPQRATDRIEADCAREIHGDVHAQNFKLPMVENYDEFQREVVDYVKPNHGT  63

Query  209  TTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGV  388
            TTL FIF+ GV++A DSRAS G YISSQ+VKK+IEINPY+LGTMAGGAADCQFW RNLG+
Sbjct  64   TTLGFIFEHGVVIAVDSRASQGPYISSQTVKKVIEINPYLLGTMAGGAADCQFWQRNLGI  123

Query  389  KCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            +CRLHEL N +RISVAGASKLLAN LY YRG GLS+GTM+AGWD KGPGLYYVDS+
Sbjct  124  QCRLHELENGKRISVAGASKLLANTLYGYRGQGLSMGTMVAGWDLKGPGLYYVDSD  179



>gb|EMT01588.1| Proteasome subunit beta type-5-A [Aegilops tauschii]
Length=1520

 Score =   245 bits (626),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 115/134 (86%), Positives = 125/134 (93%), Gaps = 0/134 (0%)
 Frame = +2

Query  155   FDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLG  334
             FDGFQK   +MV   KGTTTL+FIF +GV+VAADSRASMGGYISSQ+V+KIIEINPYMLG
Sbjct  1285  FDGFQKATKEMVNNKKGTTTLSFIFDKGVIVAADSRASMGGYISSQTVRKIIEINPYMLG  1344

Query  335   TMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAG  514
             TMAGGAADCQFWHRNLGVKCRLHELANKRRIS+AG+SK LANILYSYRGMGLS+GTMIAG
Sbjct  1345  TMAGGAADCQFWHRNLGVKCRLHELANKRRISIAGSSKTLANILYSYRGMGLSIGTMIAG  1404

Query  515   WDEKGPGLYYVDSE  556
             +DE GPGLYYVDSE
Sbjct  1405  FDETGPGLYYVDSE  1418



>ref|XP_007514496.1| predicted protein [Bathycoccus prasinos]
 emb|CCO14736.1| predicted protein [Bathycoccus prasinos]
Length=311

 Score =   229 bits (584),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 109/184 (59%), Positives = 135/184 (73%), Gaps = 11/184 (6%)
 Frame = +2

Query  32   VTMVRIDFSGLESTAPIRGESSELFDEIP---------RVPSFQIPNITDFDGFQKDAIQ  184
            +T + +DFS L+   P+R E+ EL   +              F IP + DF  FQKD ++
Sbjct  1    MTSLNLDFSVLDR--PVRKEADELTSTLENDVLCGINTHDQYFTIPRVEDFSRFQKDVVE  58

Query  185  MVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQ  364
             VKP  GTTTL FIF+ G+++A DSRAS G YISSQ+VKK+IEINP++LGTMAGGAADCQ
Sbjct  59   HVKPQHGTTTLGFIFEHGIIIAVDSRASQGPYISSQTVKKVIEINPFLLGTMAGGAADCQ  118

Query  365  FWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYY  544
            FW RNLG++CRLHEL   +RI+V GASKLLAN LY YRG GLS+GTM+AGWD  GPGL+Y
Sbjct  119  FWQRNLGIQCRLHELETGKRITVTGASKLLANTLYGYRGRGLSMGTMVAGWDTTGPGLFY  178

Query  545  VDSE  556
            VDS+
Sbjct  179  VDSD  182



>ref|XP_003083185.1| 20S proteasome, regulatory subunit beta type PSMB3/PUP3 (ISS) 
[Ostreococcus tauri]
 emb|CAL57460.1| Proteasome B-type subunit [Ostreococcus tauri]
Length=294

 Score =   228 bits (582),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 109/178 (61%), Positives = 130/178 (73%), Gaps = 6/178 (3%)
 Frame = +2

Query  41   VRIDFSGLEST------APIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAK  202
            V +D S L  T         R E+ +         +F  P + DFD FQ++ I  VKPA 
Sbjct  3    VNLDLSFLHDTERGAASTKYRDEALQGVSNSVHASNFTAPAVEDFDAFQREVINYVKPAH  62

Query  203  GTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNL  382
            GTTTL FIF+ G+++A DSRAS G YISSQ+VKK+IEINP++LGTMAGGAADCQFW RNL
Sbjct  63   GTTTLGFIFEHGIVIAVDSRASQGPYISSQTVKKVIEINPFLLGTMAGGAADCQFWQRNL  122

Query  383  GVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            G++CRLHEL N +RI+V  ASKLLAN LYSY+G GLS+GTMIAGWD  GPGLYYVDSE
Sbjct  123  GIQCRLHELENGKRITVRAASKLLANTLYSYKGRGLSMGTMIAGWDLNGPGLYYVDSE  180



>ref|XP_005851025.1| hypothetical protein CHLNCDRAFT_56983 [Chlorella variabilis]
 gb|EFN58923.1| hypothetical protein CHLNCDRAFT_56983 [Chlorella variabilis]
Length=275

 Score =   226 bits (575),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 109/176 (62%), Positives = 135/176 (77%), Gaps = 3/176 (2%)
 Frame = +2

Query  38   MVRIDFSGLESTAPIRGESSELFD---EIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGT  208
            M+++D S LE  A    E   L         V SF +P + D D F+++ ++ VKP  GT
Sbjct  1    MMKLDLSCLEPAAGAGREPCGLEAAGVSGVAVDSFPLPAVADIDSFEREVVEYVKPNHGT  60

Query  209  TTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGV  388
            TTL FIF+ GV++A DSRAS G YISSQ+VKK+IEINP++LGTMAGGAADCQFW RNLG 
Sbjct  61   TTLGFIFQGGVIIAVDSRASQGSYISSQTVKKVIEINPHLLGTMAGGAADCQFWERNLGR  120

Query  389  KCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            +CRL+ELAN +RI+V GASKLLAN ++SYRGMGLS+GTM+AGWDE GPGLYYVDS+
Sbjct  121  QCRLYELANGKRITVRGASKLLANTMFSYRGMGLSMGTMVAGWDEAGPGLYYVDSD  176



>gb|ABD61730.2| 26S proteasome beta subunit [Lupinus albus]
Length=127

 Score =   217 bits (552),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 103/110 (94%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +2

Query  209  TTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGV  388
            +TLAFIFK+GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+
Sbjct  1    STLAFIFKDGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGI  60

Query  389  KCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGL  538
            KCRLHELANKRRISV GASKLLANILYSYR MG SVGTMIAGWDE GPGL
Sbjct  61   KCRLHELANKRRISVTGASKLLANILYSYRRMGYSVGTMIAGWDETGPGL  110



>ref|XP_002950006.1| hypothetical protein VOLCADRAFT_74437 [Volvox carteri f. nagariensis]
 gb|EFJ49109.1| hypothetical protein VOLCADRAFT_74437 [Volvox carteri f. nagariensis]
Length=272

 Score =   221 bits (563),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 102/173 (59%), Positives = 135/173 (78%), Gaps = 3/173 (2%)
 Frame = +2

Query  44   RIDFSGLESTAPIRGES--SELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTL  217
            ++D   LE  A  +G     +L  ++P   SF +P + D D F+++ ++MVKP  GTTTL
Sbjct  4    KLDLGILEPNAGRKGPGLGPDLQLDVP-TASFPLPAVQDLDKFEREVVEMVKPCHGTTTL  62

Query  218  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  397
             FIF+ GV++A DSRA+MG +ISSQ+VKK+IEIN +++GTMAGGAADCQFW RNLG++CR
Sbjct  63   GFIFQHGVIIAVDSRATMGSFISSQTVKKVIEINKHLIGTMAGGAADCQFWQRNLGMRCR  122

Query  398  LHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            L+EL N +RI+V  ASKLLAN ++SYRGMGLS+GTM+AGWD  GPGLYYVDS+
Sbjct  123  LYELNNGKRITVCAASKLLANTMFSYRGMGLSMGTMVAGWDSTGPGLYYVDSD  175



>ref|XP_005643539.1| 20S proteasome beta subunit E, type beta 5 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE18995.1| 20S proteasome beta subunit E, type beta 5 [Coccomyxa subellipsoidea 
C-169]
Length=276

 Score =   221 bits (562),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 106/177 (60%), Positives = 135/177 (76%), Gaps = 5/177 (3%)
 Frame = +2

Query  38   MVRIDFSGLESTAPIRGESSELFDEIPRVPS----FQIPNITDFDGFQKDAIQMVKPAKG  205
            M ++DFS L S  P+  +S    +++  + S    F +P + D D F+ + +  VKP  G
Sbjct  1    MDKLDFSALCSR-PLSEKSGACVEDVASITSAVQDFPLPQVQDVDRFENEVMSYVKPNHG  59

Query  206  TTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG  385
            TTTL FIFK GV++A DSRASMG YISSQ+VKK+IEINPY+LGTMAGGAADCQFW RNLG
Sbjct  60   TTTLGFIFKYGVIIAVDSRASMGSYISSQTVKKVIEINPYLLGTMAGGAADCQFWQRNLG  119

Query  386  VKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
             +CRL+EL N +RISV  ASKLLAN+++SY+G GLS+GTM+AG+D  GPGLYYVDS+
Sbjct  120  QQCRLYELNNGKRISVRAASKLLANVMFSYKGYGLSMGTMVAGYDPTGPGLYYVDSD  176



>ref|XP_001698605.1| 20S proteasome beta subunit E, type beta 5 [Chlamydomonas reinhardtii]
 gb|EDP08098.1| 20S proteasome beta subunit E, type beta 5 [Chlamydomonas reinhardtii]
Length=273

 Score =   221 bits (562),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 96/143 (67%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = +2

Query  128  SFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKI  307
            SF +P + D D F+++ ++MVKP  GTTTL FIF+ GV++A DSRA+MG YISSQ+VKK+
Sbjct  34   SFPLPAVQDVDKFEREVVEMVKPCHGTTTLGFIFQHGVIIAVDSRATMGAYISSQTVKKV  93

Query  308  IEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMG  487
            IEIN ++LGTMAGGAADCQFW RNLG++CRL+EL N +RI+V  ASKLL+N+++SYRGMG
Sbjct  94   IEINKFLLGTMAGGAADCQFWQRNLGMQCRLYELNNGKRITVRAASKLLSNVMFSYRGMG  153

Query  488  LSVGTMIAGWDEKGPGLYYVDSE  556
            LS+GTM+AGWD  GPGLYYVDS+
Sbjct  154  LSMGTMVAGWDPTGPGLYYVDSD  176



>ref|XP_011396916.1| Proteasome subunit beta type-5-B [Auxenochlorella protothecoides]
 gb|KFM24035.1| Proteasome subunit beta type-5-B [Auxenochlorella protothecoides]
Length=277

 Score =   218 bits (555),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 123/148 (83%), Gaps = 3/148 (2%)
 Frame = +2

Query  122  VPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVK  301
            + +F +P + D D F+K+ ++ VKP+ GTTTL FIF+ GV+VA DSRAS G YISSQ+VK
Sbjct  31   IDAFPLPAVADLDSFEKEVVEYVKPSHGTTTLGFIFQGGVIVAVDSRASQGSYISSQTVK  90

Query  302  KIIEINPYMLGTMAGGAADCQFWHRNLG---VKCRLHELANKRRISVAGASKLLANILYS  472
            K+IEINP++LGTMAGGAADCQFW RNLG   V CRL+EL N +RI+V GASKLLAN ++S
Sbjct  91   KVIEINPFLLGTMAGGAADCQFWERNLGRQVVWCRLYELNNGKRITVRGASKLLANTMFS  150

Query  473  YRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            YRGMGLS+GTM+AGWD  GPGLYYVDS+
Sbjct  151  YRGMGLSMGTMVAGWDVAGPGLYYVDSD  178



>ref|NP_001265983.1| proteasome subunit beta type-5-like [Cicer arietinum]
 emb|CAA09603.1| 20S proteasome beta subunit [Cicer arietinum]
Length=238

 Score =   213 bits (542),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 108/172 (63%), Positives = 119/172 (69%), Gaps = 34/172 (20%)
 Frame = +2

Query  41   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  220
            +++D SGLES   +    +++  E    PSF++PN  DFDGF K+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGLESFPSLISHGNDVVGEFEAPPSFELPNSNDFDGFLKEAIQMVKPAKGTTTLA  60

Query  221  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  400
            FIFKEGVMVAAD                                  CQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAAD----------------------------------CQFWHRNLGIKCRL  86

Query  401  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSE
Sbjct  87   HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSE  138



>gb|KDD75121.1| proteasome subunit protein [Helicosporidium sp. ATCC 50920]
Length=241

 Score =   210 bits (534),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 95/134 (71%), Positives = 114/134 (85%), Gaps = 0/134 (0%)
 Frame = +2

Query  155  FDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLG  334
             DGF++  ++ VKP+ GTTTL FIF+ GV++A DSRAS G Y+SSQ+VKK+IEINPY+LG
Sbjct  9    LDGFERSVVEYVKPSHGTTTLGFIFQGGVIIAVDSRASQGSYLSSQTVKKVIEINPYLLG  68

Query  335  TMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAG  514
            TMAGGAADCQFW RNLG +CRL+EL   RRI+V  ASKLLAN ++SYRGMGLS+GTMIAG
Sbjct  69   TMAGGAADCQFWERNLGRQCRLYELKEGRRITVKAASKLLANTMFSYRGMGLSMGTMIAG  128

Query  515  WDEKGPGLYYVDSE  556
            WD  GPGLYYVDS+
Sbjct  129  WDIGGPGLYYVDSD  142



>gb|AAL26914.1|AF323592_1 putative 20S proteasome beta subunit 5, partial [Prunus persica]
Length=201

 Score =   205 bits (521),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 99/101 (98%), Gaps = 0/101 (0%)
 Frame = +2

Query  254  DSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISV  433
            +SRASMGGYISSQSV+KIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV
Sbjct  1    NSRASMGGYISSQSVEKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISV  60

Query  434  AGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
             GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSE
Sbjct  61   TGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSE  101



>emb|CAC43326.1| putative beta5 proteasome subunit [Nicotiana tabacum]
Length=174

 Score =   204 bits (518),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 96/98 (98%), Positives = 97/98 (99%), Gaps = 0/98 (0%)
 Frame = +2

Query  263  ASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGA  442
            ASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRR SVAGA
Sbjct  1    ASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRTSVAGA  60

Query  443  SKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            SKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE
Sbjct  61   SKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  98



>gb|ABE68720.1| 20S proteasome beta subunit [Arachis hypogaea]
Length=223

 Score =   202 bits (514),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 100/114 (88%), Positives = 101/114 (89%), Gaps = 8/114 (7%)
 Frame = +2

Query  239  VMVAADSR--------ASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  394
            VM AA  R        ASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  10   VMAAAGFRLADTFHTGASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  69

Query  395  RLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            RLHELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSE
Sbjct  70   RLHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSE  123



>gb|EIE77859.1| proteasome component PRE2 [Rhizopus delemar RA 99-880]
Length=277

 Score =   202 bits (514),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 96/150 (64%), Positives = 117/150 (78%), Gaps = 6/150 (4%)
 Frame = +2

Query  125  PSFQIPNITDFDGFQKDAIQ------MVKPAKGTTTLAFIFKEGVMVAADSRASMGGYIS  286
            PSF +P I +   F ++          +K   GTTTLAF F+ GV+VA DSRA+MG YIS
Sbjct  37   PSFDVPAIHNPVDFLRNVTDEESPEYKIKIQHGTTTLAFQFQGGVVVAVDSRATMGNYIS  96

Query  287  SQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANIL  466
            SQ+VKK+IEINPY+LGTMAGGAADCQ+W R LG +CRLHEL NK RISVA ASKLLAN++
Sbjct  97   SQTVKKVIEINPYLLGTMAGGAADCQYWERELGRRCRLHELRNKERISVAAASKLLANMV  156

Query  467  YSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            YSY+GMGLS+GTM+ GWD+ GP L+YVDS+
Sbjct  157  YSYKGMGLSMGTMVTGWDKTGPNLFYVDSD  186



>gb|EPB87271.1| proteasome component PRE2 [Mucor circinelloides f. circinelloides 
1006PhL]
Length=277

 Score =   200 bits (509),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 97/154 (63%), Positives = 117/154 (76%), Gaps = 14/154 (9%)
 Frame = +2

Query  125  PSFQIP----------NITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMG  274
            PSF IP          N+TD    +K A   +K   GTTTLAF F+ GV+VA DSRA+MG
Sbjct  37   PSFDIPAIHNPVDFLRNVTD----EKSADYKIKIQHGTTTLAFQFQGGVIVAVDSRATMG  92

Query  275  GYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLL  454
             YI SQ+VKK+IEINPY+LGTMAGGAADC +W R LG +CRLHEL NK RISVA ASKLL
Sbjct  93   NYIGSQTVKKVIEINPYLLGTMAGGAADCSYWERELGRRCRLHELRNKERISVAAASKLL  152

Query  455  ANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            AN++Y+Y+GMGLS+GTM+ GWD+ GP L+YVDS+
Sbjct  153  ANMVYAYKGMGLSMGTMVTGWDKSGPNLFYVDSD  186



>dbj|GAN10935.1| 20S proteasome subunit [Mucor ambiguus]
Length=277

 Score =   200 bits (509),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 97/154 (63%), Positives = 117/154 (76%), Gaps = 14/154 (9%)
 Frame = +2

Query  125  PSFQIP----------NITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMG  274
            PSF IP          N+TD    +K A   +K   GTTTLAF F+ GV+VA DSRA+MG
Sbjct  37   PSFDIPAIHNPVDFLRNVTD----EKSADYKIKIQHGTTTLAFQFQGGVIVAVDSRATMG  92

Query  275  GYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLL  454
             YI SQ+VKK+IEINPY+LGTMAGGAADC +W R LG +CRLHEL NK RISVA ASKLL
Sbjct  93   NYIGSQTVKKVIEINPYLLGTMAGGAADCSYWERELGRRCRLHELRNKERISVAAASKLL  152

Query  455  ANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            AN++Y+Y+GMGLS+GTM+ GWD+ GP L+YVDS+
Sbjct  153  ANMVYAYKGMGLSMGTMVTGWDKSGPNLFYVDSD  186



>emb|CBY21147.1| unnamed protein product [Oikopleura dioica]
 emb|CBY40350.1| unnamed protein product [Oikopleura dioica]
Length=287

 Score =   201 bits (510),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 95/143 (66%), Positives = 110/143 (77%), Gaps = 0/143 (0%)
 Frame = +2

Query  125  PSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKK  304
            P F  P +     F  D    +K   GTT LAF FK GVMVA DSRA+ GGYI+SQ VKK
Sbjct  52   PPFSNPQLHLDQNFGDDKPVKIKFNHGTTCLAFKFKHGVMVATDSRATAGGYIASQEVKK  111

Query  305  IIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGM  484
            +IEINPY+LGTMAGGAADCQFW R L ++CRL+EL NK RISVA ASKLLAN++Y Y+GM
Sbjct  112  VIEINPYLLGTMAGGAADCQFWERVLAMECRLYELRNKERISVAAASKLLANMVYQYKGM  171

Query  485  GLSVGTMIAGWDEKGPGLYYVDS  553
            GLS+GTM+ GWD+KGPGLYYVD 
Sbjct  172  GLSMGTMVCGWDKKGPGLYYVDD  194



>emb|CEP17612.1| hypothetical protein [Parasitella parasitica]
Length=277

 Score =   200 bits (508),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 96/154 (62%), Positives = 117/154 (76%), Gaps = 14/154 (9%)
 Frame = +2

Query  125  PSFQIP----------NITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMG  274
            P+F IP          N+TD    +K A   +K   GTTTLAF F+ GV+VA DSRA+MG
Sbjct  37   PAFDIPAIHNPVDFLRNVTD----EKSADYKIKIQHGTTTLAFQFQHGVIVAVDSRATMG  92

Query  275  GYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLL  454
             YI SQ+VKK+IEINPY+LGTMAGGAADC +W R LG +CRLHEL NK RISVA ASKLL
Sbjct  93   NYIGSQTVKKVIEINPYLLGTMAGGAADCSYWERELGRRCRLHELRNKERISVAAASKLL  152

Query  455  ANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            AN++Y+Y+GMGLS+GTM+ GWD+ GP L+YVDS+
Sbjct  153  ANMVYAYKGMGLSMGTMVTGWDKSGPNLFYVDSD  186



>gb|AAS01050.1| putative proteasome 20S beta5 subunit [Brassica napus]
Length=150

 Score =   196 bits (497),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 92/98 (94%), Positives = 96/98 (98%), Gaps = 0/98 (0%)
 Frame = +2

Query  263  ASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGA  442
            ASMGGYISSQSVKKIIEINPYMLGTMAGGAAD QFWHRNLG+KCRLHELANKRRISV+GA
Sbjct  1    ASMGGYISSQSVKKIIEINPYMLGTMAGGAADRQFWHRNLGIKCRLHELANKRRISVSGA  60

Query  443  SKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            SKLLAN+LYSYRGMGLSVGTMIAGWDE GPGLYYVD+E
Sbjct  61   SKLLANMLYSYRGMGLSVGTMIAGWDETGPGLYYVDNE  98



>emb|CEG76258.1| Putative Proteasome subunit beta type [Rhizopus microsporus]
Length=246

 Score =   198 bits (504),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 92/150 (61%), Positives = 117/150 (78%), Gaps = 6/150 (4%)
 Frame = +2

Query  125  PSFQIPNITDFDGFQKDAIQ------MVKPAKGTTTLAFIFKEGVMVAADSRASMGGYIS  286
            P+F +P + +   F ++          +K   GTTTLAF F+ GV+VA DSRA+MG YI+
Sbjct  37   PTFDVPAVHNPVDFLRNVTDEESPEYKIKIQHGTTTLAFQFQGGVVVAVDSRATMGNYIA  96

Query  287  SQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANIL  466
            SQ+VKK+IEINPY+LGT+AGGAADCQ+W R LG +CRLHEL NK RISVA ASKLLAN++
Sbjct  97   SQTVKKVIEINPYLLGTLAGGAADCQYWERELGRRCRLHELRNKERISVAAASKLLANMV  156

Query  467  YSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            YSY+GMGLS+GTM+ GWD+ GP L+YVDS+
Sbjct  157  YSYKGMGLSMGTMVTGWDKTGPNLFYVDSD  186



>emb|CEG76257.1| Putative Proteasome subunit beta type [Rhizopus microsporus]
Length=277

 Score =   198 bits (504),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 92/150 (61%), Positives = 116/150 (77%), Gaps = 6/150 (4%)
 Frame = +2

Query  125  PSFQIPNITDFDGFQKDAIQMVKP------AKGTTTLAFIFKEGVMVAADSRASMGGYIS  286
            P+F +P + +   F ++      P        GTTTLAF F+ GV+VA DSRA+MG YI+
Sbjct  37   PTFDVPAVHNPVDFLRNVTDEESPEYKIKIQHGTTTLAFQFQGGVVVAVDSRATMGNYIA  96

Query  287  SQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANIL  466
            SQ+VKK+IEINPY+LGT+AGGAADCQ+W R LG +CRLHEL NK RISVA ASKLLAN++
Sbjct  97   SQTVKKVIEINPYLLGTLAGGAADCQYWERELGRRCRLHELRNKERISVAAASKLLANMV  156

Query  467  YSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            YSY+GMGLS+GTM+ GWD+ GP L+YVDS+
Sbjct  157  YSYKGMGLSMGTMVTGWDKTGPNLFYVDSD  186



>emb|CEJ04297.1| Putative Proteasome subunit beta type [Rhizopus microsporus]
Length=206

 Score =   196 bits (498),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 91/140 (65%), Positives = 114/140 (81%), Gaps = 4/140 (3%)
 Frame = +2

Query  137  IPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEI  316
            + N+TD    ++     +K   GTTTLAF F+ GV+VA DSRA+MG YI+SQ+VKK+IEI
Sbjct  11   LRNVTD----EESPEYKIKIQHGTTTLAFQFQGGVVVAVDSRATMGNYIASQTVKKVIEI  66

Query  317  NPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSV  496
            NPY+LGT+AGGAADCQ+W R LG +CRLHEL NK RISVA ASKLLAN++YSY+GMGLS+
Sbjct  67   NPYLLGTLAGGAADCQYWERELGRRCRLHELRNKERISVAAASKLLANMVYSYKGMGLSM  126

Query  497  GTMIAGWDEKGPGLYYVDSE  556
            GTM+ GWD+ GP L+YVDS+
Sbjct  127  GTMVTGWDKTGPNLFYVDSD  146



>ref|XP_002111558.1| hypothetical protein TRIADDRAFT_55706 [Trichoplax adhaerens]
 gb|EDV25525.1| hypothetical protein TRIADDRAFT_55706 [Trichoplax adhaerens]
Length=276

 Score =   198 bits (503),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 100/158 (63%), Positives = 119/158 (75%), Gaps = 6/158 (4%)
 Frame = +2

Query  98   ELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAK-----GTTTLAFIFKEGVMVAADSR  262
            EL   + +  SFQ+P + D   F K   +     K     GTTTLAF FK GV+VAADSR
Sbjct  34   ELRTHLSKELSFQVPPM-DPQVFLKSINERENGVKIQFLHGTTTLAFKFKNGVIVAADSR  92

Query  263  ASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGA  442
            ASMG YI SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA A
Sbjct  93   ASMGSYIGSQTVKKVIEINPYLLGTMAGGAADCSFWERVLAERCRVYELRNKERISVAAA  152

Query  443  SKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            SKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDS+
Sbjct  153  SKLLANMVYYYKGMGLSMGTMICGWDKRGPGLYYVDSD  190



>ref|XP_002162379.2| PREDICTED: proteasome subunit beta type-5-like [Hydra vulgaris]
Length=277

 Score =   198 bits (503),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 115/146 (79%), Gaps = 3/146 (2%)
 Frame = +2

Query  128  SFQIPNITDFDGFQKDAIQ---MVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSV  298
            +F +PN++D   F  +       ++   GTTTLAF FK GV+VA DSRAS G YI+SQ+V
Sbjct  44   NFPLPNVSDVSQFLNEYTNGDTKIQFHHGTTTLAFKFKHGVIVAVDSRASAGSYIASQTV  103

Query  299  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  478
            KK+IEINPY+LGTMAGGAADC FW R L  +CRL++L NK RISVA ASKLLAN++Y Y+
Sbjct  104  KKVIEINPYLLGTMAGGAADCAFWQRVLAKECRLYQLRNKERISVAAASKLLANMVYQYK  163

Query  479  GMGLSVGTMIAGWDEKGPGLYYVDSE  556
            GMGLS+GTMI GWD++GPGLYYVDS+
Sbjct  164  GMGLSMGTMICGWDKRGPGLYYVDSD  189



>gb|ACP43316.1| 20S proteasome beta subunit 5 [Citrus maxima]
Length=194

 Score =   195 bits (496),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 91/94 (97%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +2

Query  275  GYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLL  454
            GYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV GASKLL
Sbjct  1    GYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLL  60

Query  455  ANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            ANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSE
Sbjct  61   ANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSE  94



>ref|XP_002889983.1| hypothetical protein ARALYDRAFT_888660 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66242.1| hypothetical protein ARALYDRAFT_888660 [Arabidopsis lyrata subsp. 
lyrata]
Length=132

 Score =   192 bits (489),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 90/94 (96%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +2

Query  242  MVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKR  421
            MVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLH LANKR
Sbjct  1    MVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHALANKR  60

Query  422  RISVAGASKLLANILYSYRGMGLSVGTMIAGWDE  523
            RISV+GASKLLAN+LYSYRGMGLSVGTMIAGWDE
Sbjct  61   RISVSGASKLLANMLYSYRGMGLSVGTMIAGWDE  94



>gb|AAM18885.1|AF391293_2 unknown [Branchiostoma floridae]
Length=275

 Score =   197 bits (500),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 95/161 (59%), Positives = 122/161 (76%), Gaps = 5/161 (3%)
 Frame = +2

Query  89   ESSELFDEIPRVPSFQIPNITDFDGFQK-----DAIQMVKPAKGTTTLAFIFKEGVMVAA  253
            + S++ + +  +  F IP +TD   F K     +    ++   GTTTLAF F+ GV+VA 
Sbjct  28   DESDVLNNLWSLDKFSIPAVTDPAEFLKPFTTGEGNVKIEFDHGTTTLAFKFQHGVIVAV  87

Query  254  DSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISV  433
            DSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISV
Sbjct  88   DSRATAGSYIASQTVKKVIEINPYLLGTMAGGAADCSFWERVLAEQCRIYELRNKERISV  147

Query  434  AGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            A ASKLLANI+Y+Y+GMGLS+GTMI GWD++GPGLYYVDS+
Sbjct  148  AAASKLLANIVYNYKGMGLSMGTMIVGWDKRGPGLYYVDSD  188



>ref|XP_002290272.1| proteasome subunit beta type 5 precursor [Thalassiosira pseudonana 
CCMP1335]
 gb|EED92024.1| proteasome subunit beta type 5 precursor [Thalassiosira pseudonana 
CCMP1335]
Length=276

 Score =   196 bits (499),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 113/142 (80%), Gaps = 8/142 (6%)
 Frame = +2

Query  131  FQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKII  310
            F++PN+ D  G        VK AKGTTTLAF F  G++V+ DSR++MG YI+S +VKK+I
Sbjct  50   FEVPNVADVSG--------VKFAKGTTTLAFKFNGGIIVSVDSRSTMGAYIASGTVKKVI  101

Query  311  EINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGL  490
            EINP++LGTMAGGAADC FW RNLG++CRL+EL NK+RI+VA ASKLLAN + SYRG GL
Sbjct  102  EINPFLLGTMAGGAADCSFWERNLGMQCRLYELRNKKRITVASASKLLANTMSSYRGYGL  161

Query  491  SVGTMIAGWDEKGPGLYYVDSE  556
            S+GTMI GWDE GP LYYVD +
Sbjct  162  SMGTMITGWDETGPQLYYVDDD  183



>ref|XP_001730616.1| hypothetical protein MGL_2412 [Malassezia globosa CBS 7966]
 gb|EDP43402.1| hypothetical protein MGL_2412 [Malassezia globosa CBS 7966]
Length=295

 Score =   197 bits (500),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/144 (66%), Positives = 114/144 (79%), Gaps = 2/144 (1%)
 Frame = +2

Query  125  PSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKK  304
            PS  +   TD D  + DA   +K   GTTTLAF +K GV+VA DSRAS G YI+S SVKK
Sbjct  37   PSRFLAQYTDVDSTRPDA--RIKLNHGTTTLAFRYKGGVVVAVDSRASAGSYIASGSVKK  94

Query  305  IIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGM  484
            +IEINPY+LGTMAGGAADCQ+W   LG++CRLHEL NK RISVA ASK+L+N++YSY+GM
Sbjct  95   VIEINPYLLGTMAGGAADCQYWETYLGIQCRLHELRNKERISVAAASKILSNLVYSYKGM  154

Query  485  GLSVGTMIAGWDEKGPGLYYVDSE  556
            GLS+GTMI GWD+ GP +YYVDSE
Sbjct  155  GLSMGTMICGWDKSGPAIYYVDSE  178



>ref|XP_005537552.1| 20S core proteasome subunit beta 5 [Cyanidioschyzon merolae strain 
10D]
 dbj|BAM81516.1| 20S core proteasome subunit beta 5 [Cyanidioschyzon merolae strain 
10D]
Length=299

 Score =   197 bits (500),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/149 (64%), Positives = 119/149 (80%), Gaps = 2/149 (1%)
 Frame = +2

Query  110  EIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISS  289
             +PR  S   P + D    ++++  +VK   GTTTLAF+F++G++VA DSRASMG YI S
Sbjct  41   RVPRGASIA-PRLRDVLRDEQNS-SLVKFLHGTTTLAFVFRDGIIVAVDSRASMGQYIGS  98

Query  290  QSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILY  469
             +VKKIIEINPY+LGTMAGGAADC FW R LG++CRLHEL ++ RISVA ASKLLANI+Y
Sbjct  99   GTVKKIIEINPYLLGTMAGGAADCSFWERYLGMRCRLHELQHRERISVAAASKLLANIVY  158

Query  470  SYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
             Y+GMGLS+GTMIAGWD+ GP L+YVDS+
Sbjct  159  EYKGMGLSMGTMIAGWDKTGPQLFYVDSD  187



>ref|XP_002730946.1| PREDICTED: proteasome subunit beta type-5-like [Saccoglossus 
kowalevskii]
Length=277

 Score =   196 bits (498),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 97/173 (56%), Positives = 126/173 (73%), Gaps = 15/173 (9%)
 Frame = +2

Query  53   FSGLESTAPIRGESSELFDEIPRVPSFQIPNITD----FDGFQK-DAIQMVKPAKGTTTL  217
            F  L++  P      E ++E    P F +P + D       F+K D+   ++   GTTTL
Sbjct  26   FEALDNVEP------EFYNE----PKFTLPQVADPAEYLKQFEKEDSDVKIRFHHGTTTL  75

Query  218  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  397
            AF F+ GV+VA DSRA+ G +I+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR
Sbjct  76   AFKFQHGVIVAVDSRATAGPFIASQTVKKVIEINPYLLGTMAGGAADCSFWERVLSQQCR  135

Query  398  LHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            ++EL NK RISVA ASKLLAN++Y+Y+GMGLS+GTMI GWD++GPGLYYVDS+
Sbjct  136  IYELRNKERISVAAASKLLANMVYNYKGMGLSMGTMICGWDKRGPGLYYVDSD  188



>ref|XP_003801967.1| PREDICTED: proteasome subunit beta type-5 [Otolemur garnettii]
Length=263

 Score =   196 bits (497),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 97/158 (61%), Positives = 122/158 (77%), Gaps = 4/158 (3%)
 Frame = +2

Query  86   GESSELFDEIPRVPSFQIPNITDFDGF-QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSR  262
            G  ++L D  P+ PS  +  +    G  ++  I+M+    GTTTLAF F+ GV+VAADSR
Sbjct  22   GGRADLLDLGPKSPSDGLSLVAPSWGVPEEPGIEMLH---GTTTLAFKFRHGVIVAADSR  78

Query  263  ASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGA  442
            A+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA A
Sbjct  79   ATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAA  138

Query  443  SKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            SKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSE
Sbjct  139  SKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSE  176



>gb|ELT88834.1| hypothetical protein CAPTEDRAFT_150903 [Capitella teleta]
Length=275

 Score =   196 bits (497),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/152 (62%), Positives = 119/152 (78%), Gaps = 8/152 (5%)
 Frame = +2

Query  122  VPSFQIP-------NITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  280
              +F+IP       ++  F     D I+ ++ A GTTTLAF FK GV+VA DSRA+ G +
Sbjct  38   TETFEIPQNFNPGEDLKQFTEGNDDNIK-IRIAHGTTTLAFKFKHGVIVAVDSRATAGDW  96

Query  281  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLAN  460
            I+SQ+VKK+IEINPY+LGTMAGGAADCQ+W R +  +CR++EL NK RISVA ASKLLAN
Sbjct  97   IASQTVKKVIEINPYLLGTMAGGAADCQYWERVVARQCRIYELRNKERISVAAASKLLAN  156

Query  461  ILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            I+Y+Y+GMGLS+GTMI GWD+KGPGLYYVDS+
Sbjct  157  IVYNYKGMGLSMGTMICGWDKKGPGLYYVDSD  188



>emb|CDH56820.1| 20s proteasome subunit [Lichtheimia corymbifera JMRC:FSU:9682]
 emb|CDS14360.1| Putative Proteasome subunit beta type [Absidia idahoensis var. 
thermophila]
Length=277

 Score =   196 bits (498),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/150 (62%), Positives = 115/150 (77%), Gaps = 6/150 (4%)
 Frame = +2

Query  125  PSFQIPNITDFDGFQKDAIQ------MVKPAKGTTTLAFIFKEGVMVAADSRASMGGYIS  286
            P+F IP++ +   F +           +K   GTTTLAF F+ GV+VA DSRA+MG YI 
Sbjct  37   PTFDIPDVHNPVDFLRSVTDEDSPDYKIKIQHGTTTLAFQFQGGVIVAVDSRATMGNYIG  96

Query  287  SQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANIL  466
            SQ+VKK+IEINPY+LGTMAGGAADCQ+W R LG +CRL+EL NK RISVA ASKLL N++
Sbjct  97   SQTVKKVIEINPYLLGTMAGGAADCQYWERELGRRCRLYELRNKERISVAAASKLLGNMV  156

Query  467  YSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            YSY+GMGLS+GTMI GWD+ GP L+YVDS+
Sbjct  157  YSYKGMGLSMGTMITGWDKTGPNLFYVDSD  186



>ref|XP_009038619.1| hypothetical protein AURANDRAFT_28593 [Aureococcus anophagefferens]
 gb|EGB06876.1| hypothetical protein AURANDRAFT_28593 [Aureococcus anophagefferens]
Length=287

 Score =   196 bits (498),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 109/132 (83%), Gaps = 0/132 (0%)
 Frame = +2

Query  161  GFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTM  340
            G+  D  Q VK AKGTTTLAF F  GV+++ DSR++MG YI+SQ+VKK+IEINP++LGTM
Sbjct  53   GYGTDHHQDVKFAKGTTTLAFKFNGGVIISVDSRSTMGPYIASQTVKKVIEINPFLLGTM  112

Query  341  AGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWD  520
            AGGAADC FW RNLG +CR+ EL NKRR+SVA ASK+LAN +YSYRG GLS+GTM+ GWD
Sbjct  113  AGGAADCSFWERNLGTQCRMFELRNKRRVSVAAASKMLANTMYSYRGRGLSMGTMVCGWD  172

Query  521  EKGPGLYYVDSE  556
            E GP LYYVD +
Sbjct  173  ETGPQLYYVDDD  184



>gb|ELU16739.1| hypothetical protein CAPTEDRAFT_41193, partial [Capitella teleta]
Length=131

 Score =   191 bits (484),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 87/118 (74%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = +2

Query  203  GTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNL  382
            GTTTLAF FK GV+VA DSRA+ G +I+SQ+VKK+IEINPY+LGTMAGGAADCQ+W R +
Sbjct  2    GTTTLAFKFKHGVIVAVDSRATAGDWIASQTVKKVIEINPYLLGTMAGGAADCQYWERVV  61

Query  383  GVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
              +CR++EL NK RISVA ASKLLANI+Y+Y+GMGLS+GTMI GWD+KGPGLYYVDS+
Sbjct  62   ARQCRIYELRNKERISVAAASKLLANIVYNYKGMGLSMGTMICGWDKKGPGLYYVDSD  119



>ref|XP_004474611.1| PREDICTED: proteasome subunit beta type-5 [Dasypus novemcinctus]
Length=262

 Score =   195 bits (495),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 98/161 (61%), Positives = 121/161 (75%), Gaps = 10/161 (6%)
 Frame = +2

Query  86   GESSELFDEIPRVPS----FQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAA  253
            G  ++L D  P  PS       PN+   D  ++  I+M+    GTTTLAF F+ GV+VA 
Sbjct  22   GGRADLLDLGPGSPSDGMSLAAPNL---DVSEEPGIEMLH---GTTTLAFKFRHGVIVAV  75

Query  254  DSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISV  433
            DSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISV
Sbjct  76   DSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISV  135

Query  434  AGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            A ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSE
Sbjct  136  AAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSE  176



>ref|XP_005875924.1| PREDICTED: proteasome subunit beta type-5-like [Myotis brandtii]
 gb|EPQ13719.1| Proteasome subunit beta type-5 [Myotis brandtii]
Length=263

 Score =   195 bits (495),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 100/172 (58%), Positives = 123/172 (72%), Gaps = 9/172 (5%)
 Frame = +2

Query  62   LESTAPIR-------GESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  220
            LES+ P+        G  ++L D  P  PS  +       G  ++    ++   GTTTLA
Sbjct  7    LESSVPVNRHGFFGLGGRADLLDLGPGSPSDGLSLAAPSWGVPEE--PRIEILHGTTTLA  64

Query  221  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  400
            F F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR+
Sbjct  65   FKFQHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRI  124

Query  401  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            +EL NK RISVA ASKLL N+LY Y+GMGLSVGTMI GWD++GPGLYYVDSE
Sbjct  125  YELRNKERISVAAASKLLVNMLYQYKGMGLSVGTMICGWDKRGPGLYYVDSE  176



>gb|KFH71396.1| 20S proteasome subunit beta 5 [Mortierella verticillata NRRL 
6337]
Length=278

 Score =   195 bits (495),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 94/150 (63%), Positives = 117/150 (78%), Gaps = 5/150 (3%)
 Frame = +2

Query  122  VPSFQIP---NITDFDGFQKDAI--QMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYIS  286
            +P+F IP   N TDF     DA     ++   GTTTLAF F+ G++VA DSRAS G YI+
Sbjct  38   LPAFDIPMVANPTDFLRAHTDASAENRIRIQHGTTTLAFKFQGGIIVAVDSRASGGSYIA  97

Query  287  SQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANIL  466
            SQ+VKK+IEINPY+LGTMAGGAADCQ+W R LG +CRL+EL NK RISVA ASK+L+N++
Sbjct  98   SQTVKKVIEINPYLLGTMAGGAADCQYWERELGRRCRLYELRNKERISVAAASKILSNMV  157

Query  467  YSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            Y Y+GMGLS+GTMI GWD+ GP L+YVDS+
Sbjct  158  YDYKGMGLSMGTMITGWDKTGPALFYVDSD  187



>ref|XP_004694702.1| PREDICTED: proteasome subunit beta type-5 isoform X2 [Condylura 
cristata]
Length=208

 Score =   192 bits (489),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = +2

Query  200  KGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRN  379
             GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R 
Sbjct  3    HGTTTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERL  62

Query  380  LGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSE
Sbjct  63   LARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSE  121



>ref|XP_005338834.1| PREDICTED: proteasome subunit beta type-5 [Ictidomys tridecemlineatus]
Length=208

 Score =   192 bits (489),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = +2

Query  200  KGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRN  379
             GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R 
Sbjct  3    HGTTTLAFKFQHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERL  62

Query  380  LGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSE
Sbjct  63   LARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSE  121



>dbj|BAA06097.1| proteasome subunit X [Homo sapiens]
 gb|AAP35423.1| proteasome (prosome, macropain) subunit, beta type, 5 [Homo sapiens]
 gb|AIC59195.1| hypothetical protein, partial [synthetic construct]
Length=208

 Score =   192 bits (489),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = +2

Query  200  KGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRN  379
             GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R 
Sbjct  3    HGTTTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERL  62

Query  380  LGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSE
Sbjct  63   LARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSE  121



>gb|AAP36588.1| Homo sapiens proteasome (prosome, macropain) subunit, beta type, 
5 [synthetic construct]
Length=209

 Score =   192 bits (489),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = +2

Query  200  KGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRN  379
             GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R 
Sbjct  3    HGTTTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERL  62

Query  380  LGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSE
Sbjct  63   LARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSE  121



>ref|XP_004313402.1| PREDICTED: proteasome subunit beta type-5 isoform 2 [Tursiops 
truncatus]
Length=208

 Score =   192 bits (489),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = +2

Query  200  KGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRN  379
             GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R 
Sbjct  3    HGTTTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERL  62

Query  380  LGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSE
Sbjct  63   LARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSE  121



>ref|XP_008564788.1| PREDICTED: proteasome subunit beta type-5 [Galeopterus variegatus]
Length=263

 Score =   194 bits (493),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 100/171 (58%), Positives = 123/171 (72%), Gaps = 18/171 (11%)
 Frame = +2

Query  44   RIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAF  223
            R D   L   +PI G S          PS+ +P        ++  I+M+    GTTTLAF
Sbjct  24   RTDLLDLGPGSPIDGLSLA-------APSWGVP--------EEPGIEMLH---GTTTLAF  65

Query  224  IFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLH  403
             F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++
Sbjct  66   KFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIY  125

Query  404  ELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSE
Sbjct  126  ELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSE  176



>ref|XP_008065987.1| PREDICTED: proteasome subunit beta type-5 [Tarsius syrichta]
Length=263

 Score =   194 bits (493),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 98/158 (62%), Positives = 121/158 (77%), Gaps = 4/158 (3%)
 Frame = +2

Query  86   GESSELFDEIPRVPSFQIPNITDFDGF-QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSR  262
            G  ++L D  P  PS  +   T   G  ++  I+M+    GTTTLAF F+ GV+VAADSR
Sbjct  22   GGRADLLDLGPGNPSDGLSLATPSWGVPEEPGIEMLH---GTTTLAFKFRHGVIVAADSR  78

Query  263  ASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGA  442
            A+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA A
Sbjct  79   ATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAA  138

Query  443  SKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            SKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSE
Sbjct  139  SKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSE  176



>ref|XP_006957104.1| 20S proteasome subunit, partial [Wallemia sebi CBS 633.66]
 gb|EIM23071.1| 20S proteasome subunit, partial [Wallemia sebi CBS 633.66]
Length=288

 Score =   195 bits (495),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 97/173 (56%), Positives = 121/173 (70%), Gaps = 14/173 (8%)
 Frame = +2

Query  80   IRGESSELFD-------EIPRVPSFQIPNITDFDGF-------QKDAIQMVKPAKGTTTL  217
            + G +S L D       E   +P+  +PN  D  GF       Q+D    +K   GTTTL
Sbjct  8    LNGATSSLDDMFEGNSIEKHGIPTLDLPNTADPTGFLRTYTDDQQDPSCRIKINHGTTTL  67

Query  218  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  397
            AF FK GV+VA DSRA+ G Y++S +VKK+IEINPY+LGTMAGGAADCQ+W   LG++CR
Sbjct  68   AFKFKGGVIVAVDSRATAGSYVASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGIQCR  127

Query  398  LHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            LHEL NK RISVA ASK L+NI YSY+G GLS+GTMI GWD+ GP ++YVDS+
Sbjct  128  LHELRNKERISVAAASKYLSNITYSYKGKGLSMGTMICGWDKGGPAIWYVDSD  180



>ref|XP_002678668.1| predicted protein [Naegleria gruberi]
 gb|EFC45924.1| predicted protein [Naegleria gruberi]
Length=300

 Score =   195 bits (496),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 116/144 (81%), Gaps = 3/144 (2%)
 Frame = +2

Query  131  FQIPNITDFDGF--QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKK  304
            F +P   +  GF  QK+ ++    AKGTTTL F+F +G+++A DSRASMG YISSQ+VKK
Sbjct  59   FALPPSLNNSGFIHQKEKLEKTY-AKGTTTLGFVFNKGIVIAVDSRASMGNYISSQNVKK  117

Query  305  IIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGM  484
            +IEINPY+LGTMAGGAADCQFW R LG++CRL+EL NKRRISVA ASKLL+NI+Y Y+  
Sbjct  118  VIEINPYLLGTMAGGAADCQFWERYLGMQCRLYELRNKRRISVAAASKLLSNIVYQYKDH  177

Query  485  GLSVGTMIAGWDEKGPGLYYVDSE  556
            GLS+GTMIAGWD  GP L+ VD++
Sbjct  178  GLSMGTMIAGWDHTGPNLFMVDND  201



>ref|XP_009061521.1| hypothetical protein LOTGIDRAFT_166223 [Lottia gigantea]
 gb|ESO87922.1| hypothetical protein LOTGIDRAFT_166223 [Lottia gigantea]
Length=263

 Score =   194 bits (493),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 94/158 (59%), Positives = 116/158 (73%), Gaps = 2/158 (1%)
 Frame = +2

Query  83   RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSR  262
            +GE ++LF+         +     F   + D    +    GTTTLAF FK G +VA DSR
Sbjct  18   QGERNQLFNNCGGNYGRPLETRNSFTNEKSDV--KIHFDHGTTTLAFKFKHGCIVAVDSR  75

Query  263  ASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGA  442
            A+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R+L  +CRL+EL NK RISVA A
Sbjct  76   ATAGSYIASQTVKKVIEINPYLLGTMAGGAADCSFWERHLAKECRLYELRNKERISVAAA  135

Query  443  SKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            SKLLAN +Y+Y+GMGLS+GTMI GWD+KGPGLYYVDS+
Sbjct  136  SKLLANTVYNYKGMGLSMGTMIVGWDKKGPGLYYVDSD  173



>ref|XP_007100517.1| PREDICTED: proteasome subunit beta type-5 isoform X1 [Physeter 
catodon]
Length=263

 Score =   194 bits (492),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 98/158 (62%), Positives = 121/158 (77%), Gaps = 4/158 (3%)
 Frame = +2

Query  86   GESSELFDEIPRVPSFQIPNITDFDGFQKDA-IQMVKPAKGTTTLAFIFKEGVMVAADSR  262
            G  ++L D  P  PS  +  I    G  ++  I+M+    GTTTLAF F+ GV+VAADSR
Sbjct  22   GGRADLLDLGPGSPSDGLSLIAPSWGVPEEPRIEMLH---GTTTLAFKFRHGVIVAADSR  78

Query  263  ASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGA  442
            A+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA A
Sbjct  79   ATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAA  138

Query  443  SKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            SKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSE
Sbjct  139  SKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSE  176



>gb|EJU05281.1| proteasome-domain-containing protein [Dacryopinax sp. DJM-731 
SS1]
Length=315

 Score =   195 bits (496),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 91/152 (60%), Positives = 117/152 (77%), Gaps = 7/152 (5%)
 Frame = +2

Query  122  VPSFQIPNITDFDGFQK-------DAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  280
            +PSF++P++ D   F +       D    +K   GTTTLAF FK G++VA DSRA+ G Y
Sbjct  49   IPSFKVPSLADPSAFLRMHTDDYADPSCRIKIQHGTTTLAFRFKGGIIVAVDSRATAGSY  108

Query  281  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLAN  460
            I+S +VKK+IEINPY+LGTMAGGAADCQ+W   LG++CRLHEL N+ RISVA ASK L+N
Sbjct  109  IASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGIECRLHELRNRERISVAAASKFLSN  168

Query  461  ILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            ++YSY+GMGLS+GTMI GWD+ GP L+YVDS+
Sbjct  169  LVYSYKGMGLSMGTMICGWDKTGPALFYVDSD  200



>ref|XP_006776843.1| PREDICTED: proteasome subunit beta type-5 [Myotis davidii]
Length=263

 Score =   194 bits (492),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 99/172 (58%), Positives = 124/172 (72%), Gaps = 9/172 (5%)
 Frame = +2

Query  62   LESTAPIR-------GESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  220
            LE++ P+        G  ++L D  P  PS  +       G  ++    ++   GTTTLA
Sbjct  7    LETSVPVNRHGFFGLGGRADLLDLGPGSPSDGLSLAAPSWGVPEE--PRIEILHGTTTLA  64

Query  221  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  400
            F FK GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR+
Sbjct  65   FKFKHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRI  124

Query  401  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            +EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSE
Sbjct  125  YELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSE  176



>ref|XP_006100131.1| PREDICTED: proteasome subunit beta type-5 [Myotis lucifugus]
Length=263

 Score =   194 bits (492),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 99/172 (58%), Positives = 124/172 (72%), Gaps = 9/172 (5%)
 Frame = +2

Query  62   LESTAPIR-------GESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  220
            LES+ P+        G  ++L D  P  PS  +       G  ++    ++   GTTTLA
Sbjct  7    LESSVPVNRHGFFGLGGRADLLDLGPGSPSDGLSLAAPSWGVPEE--PRIEILHGTTTLA  64

Query  221  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  400
            F F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR+
Sbjct  65   FKFQHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRI  124

Query  401  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            +EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSE
Sbjct  125  YELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSE  176



>ref|XP_004283228.1| PREDICTED: proteasome subunit beta type-5 isoform 1 [Orcinus 
orca]
Length=263

 Score =   193 bits (491),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 97/158 (61%), Positives = 121/158 (77%), Gaps = 4/158 (3%)
 Frame = +2

Query  86   GESSELFDEIPRVPSFQIPNITDFDGFQKDA-IQMVKPAKGTTTLAFIFKEGVMVAADSR  262
            G  ++L D  P  PS  +  +    G  ++  I+M+    GTTTLAF F+ GV+VAADSR
Sbjct  22   GGRADLLDLGPGSPSDGLSLVAPSWGVPEEPRIEMLH---GTTTLAFKFRHGVIVAADSR  78

Query  263  ASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGA  442
            A+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA A
Sbjct  79   ATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAA  138

Query  443  SKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            SKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSE
Sbjct  139  SKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSE  176



>ref|XP_008156742.1| PREDICTED: proteasome subunit beta type-5 isoform X1 [Eptesicus 
fuscus]
Length=263

 Score =   193 bits (491),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 99/172 (58%), Positives = 124/172 (72%), Gaps = 9/172 (5%)
 Frame = +2

Query  62   LESTAPIR-------GESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  220
            LES+ P+        G  ++L D  P  PS  +       G  ++    ++   GTTTLA
Sbjct  7    LESSVPVNRHGFFGLGGRADLLDLGPGSPSDGLSLAAPSWGVPEE--PKIEILHGTTTLA  64

Query  221  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  400
            F F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR+
Sbjct  65   FKFQHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRI  124

Query  401  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            +EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSE
Sbjct  125  YELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSE  176



>ref|XP_004313401.1| PREDICTED: proteasome subunit beta type-5 isoform 1 [Tursiops 
truncatus]
Length=263

 Score =   193 bits (491),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 97/158 (61%), Positives = 121/158 (77%), Gaps = 4/158 (3%)
 Frame = +2

Query  86   GESSELFDEIPRVPSFQIPNITDFDGFQKDA-IQMVKPAKGTTTLAFIFKEGVMVAADSR  262
            G  ++L D  P  PS  +  +    G  ++  I+M+    GTTTLAF F+ GV+VAADSR
Sbjct  22   GGRADLLDLGPGSPSDGLSLVAPSWGVPEEPRIEMLH---GTTTLAFKFRHGVIVAADSR  78

Query  263  ASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGA  442
            A+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA A
Sbjct  79   ATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAA  138

Query  443  SKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            SKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSE
Sbjct  139  SKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSE  176



>ref|XP_007449602.1| PREDICTED: proteasome subunit beta type-5 isoform X1 [Lipotes 
vexillifer]
Length=263

 Score =   193 bits (491),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 97/158 (61%), Positives = 121/158 (77%), Gaps = 4/158 (3%)
 Frame = +2

Query  86   GESSELFDEIPRVPSFQIPNITDFDGFQKDA-IQMVKPAKGTTTLAFIFKEGVMVAADSR  262
            G  ++L D  P  PS  +  +    G  ++  I+M+    GTTTLAF F+ GV+VAADSR
Sbjct  22   GGRADLLDLGPGSPSDGLSLVAPSWGVPEEPRIEMLH---GTTTLAFKFRHGVIVAADSR  78

Query  263  ASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGA  442
            A+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA A
Sbjct  79   ATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAA  138

Query  443  SKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            SKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSE
Sbjct  139  SKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSE  176



>ref|XP_006144566.1| PREDICTED: proteasome subunit beta type-5 [Tupaia chinensis]
 gb|ELW69249.1| Proteasome subunit beta type-5 [Tupaia chinensis]
Length=263

 Score =   193 bits (491),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 115/144 (80%), Gaps = 11/144 (8%)
 Frame = +2

Query  125  PSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKK  304
            PS+ +P        ++  I+M+    GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK
Sbjct  44   PSWDVP--------EEPRIEMLH---GTTTLAFKFRHGVIVAADSRATAGAYIASQTVKK  92

Query  305  IIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGM  484
            +IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GM
Sbjct  93   VIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGM  152

Query  485  GLSVGTMIAGWDEKGPGLYYVDSE  556
            GLS+GTMI GWD++GPGLYYVDSE
Sbjct  153  GLSMGTMICGWDKRGPGLYYVDSE  176



>ref|XP_004565403.1| PREDICTED: proteasome subunit beta type-5-like [Maylandia zebra]
Length=271

 Score =   193 bits (491),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 115/146 (79%), Gaps = 7/146 (5%)
 Frame = +2

Query  128  SFQIPN---ITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSV  298
            SF + N   + D DG ++     ++   GTTTLAF F+ GV+VA DSRA+ G YI+SQ+V
Sbjct  44   SFSVKNPLCVGDDDGVERK----IEFLHGTTTLAFKFQHGVIVAVDSRATAGSYIASQTV  99

Query  299  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  478
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  100  KKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYK  159

Query  479  GMGLSVGTMIAGWDEKGPGLYYVDSE  556
            GMGLS+GTM+ GWD++GPGLYYVDSE
Sbjct  160  GMGLSMGTMVCGWDKRGPGLYYVDSE  185



>ref|XP_007006996.1| hypothetical protein TREMEDRAFT_34309 [Tremella mesenterica DSM 
1558]
 gb|EIW67092.1| hypothetical protein TREMEDRAFT_34309 [Tremella mesenterica DSM 
1558]
Length=287

 Score =   194 bits (493),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/159 (58%), Positives = 116/159 (73%), Gaps = 8/159 (5%)
 Frame = +2

Query  104  FDEIPRVPSFQIPNITD--------FDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADS  259
             DE+ R+   QIP + D         D    +    +K A GTTTLAF FK G++VA DS
Sbjct  28   LDEMGRIKGMQIPRVPDPTAFLNLYTDSMSSNPEAKIKLAHGTTTLAFRFKGGIIVAVDS  87

Query  260  RASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAG  439
            RA+ G YI+S +VKK+IEINPY+LGTMAGGAADCQ+W   LG++CRL+EL NK RISVA 
Sbjct  88   RATAGSYIASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGMRCRLYELRNKERISVAA  147

Query  440  ASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            ASK+L+NI+Y Y+G GLS+GTMI GWD+ GP L+YVDSE
Sbjct  148  ASKILSNIVYGYKGRGLSMGTMICGWDKTGPALFYVDSE  186



>ref|XP_003332961.2| 20S proteasome subunit beta 5 [Puccinia graminis f. sp. tritici 
CRL 75-36-700-3]
 gb|EFP88542.2| 20S proteasome subunit beta 5 [Puccinia graminis f. sp. tritici 
CRL 75-36-700-3]
Length=289

 Score =   194 bits (493),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/151 (61%), Positives = 114/151 (75%), Gaps = 6/151 (4%)
 Frame = +2

Query  122  VPSFQIPNITDFDGF------QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYI  283
            VP F +P + D   F       + A   +K   GTTTLAF F+ G++VA DSRA+ G YI
Sbjct  41   VPRFDLPGVKDPVSFLRTHTDDRSADAKIKIKHGTTTLAFRFQHGIIVAVDSRATAGSYI  100

Query  284  SSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANI  463
            +S +VKK+IEINP++LGTMAGGAADCQ+W   LG++CRLHEL NK RISVA ASK L+N+
Sbjct  101  ASGTVKKVIEINPFLLGTMAGGAADCQYWETYLGIQCRLHELRNKSRISVAAASKYLSNL  160

Query  464  LYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            +YSY+GMGLS+GTMI GWD  GPGLYYVDS+
Sbjct  161  VYSYKGMGLSMGTMICGWDGAGPGLYYVDSD  191



>ref|XP_005740284.1| PREDICTED: proteasome subunit beta type-5-like [Pundamilia nyererei]
Length=281

 Score =   194 bits (492),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 115/146 (79%), Gaps = 7/146 (5%)
 Frame = +2

Query  128  SFQIPN---ITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSV  298
            SF + N   + D DG ++     ++   GTTTLAF F+ GV+VA DSRA+ G YI+SQ+V
Sbjct  54   SFSVKNPLCVGDDDGVERK----IEFLHGTTTLAFKFQHGVIVAVDSRATAGSYIASQTV  109

Query  299  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  478
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  110  KKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYK  169

Query  479  GMGLSVGTMIAGWDEKGPGLYYVDSE  556
            GMGLS+GTM+ GWD++GPGLYYVDSE
Sbjct  170  GMGLSMGTMVCGWDKRGPGLYYVDSE  195



>ref|XP_005933706.1| PREDICTED: proteasome subunit beta type-5-like [Haplochromis 
burtoni]
Length=281

 Score =   194 bits (492),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 115/146 (79%), Gaps = 7/146 (5%)
 Frame = +2

Query  128  SFQIPN---ITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSV  298
            SF + N   + D DG ++     ++   GTTTLAF F+ GV+VA DSRA+ G YI+SQ+V
Sbjct  54   SFSVKNPLCVGDDDGVERK----IEFLHGTTTLAFKFQHGVIVAVDSRATAGSYIASQTV  109

Query  299  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  478
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  110  KKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYK  169

Query  479  GMGLSVGTMIAGWDEKGPGLYYVDSE  556
            GMGLS+GTM+ GWD++GPGLYYVDSE
Sbjct  170  GMGLSMGTMVCGWDKRGPGLYYVDSE  195



>ref|XP_003987515.1| PREDICTED: proteasome subunit beta type-5 [Felis catus]
 ref|XP_007098030.1| PREDICTED: proteasome subunit beta type-5 [Panthera tigris altaica]
Length=263

 Score =   193 bits (490),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 96/155 (62%), Positives = 119/155 (77%), Gaps = 4/155 (3%)
 Frame = +2

Query  95   SELFDEIPRVPSFQIPNITDFDGFQKDA-IQMVKPAKGTTTLAFIFKEGVMVAADSRASM  271
            ++L D  P  PS  +       G  ++  I+M+    GTTTLAF F+ GV+VAADSRA+ 
Sbjct  25   ADLLDLGPGSPSDGLSLAAPHRGVPEEPRIEMLH---GTTTLAFKFQHGVIVAADSRATA  81

Query  272  GGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKL  451
            G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKL
Sbjct  82   GAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKL  141

Query  452  LANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            LAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSE
Sbjct  142  LANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSE  176



>ref|XP_010781265.1| PREDICTED: proteasome subunit beta type-5 [Notothenia coriiceps]
Length=271

 Score =   193 bits (491),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 97/161 (60%), Positives = 120/161 (75%), Gaps = 8/161 (5%)
 Frame = +2

Query  86   GESSELFDEIP-RVPSFQIPN---ITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAA  253
            G+S   FD  P    SF + N     D DG ++     ++   GTTTLAF F+ GV+VA 
Sbjct  29   GQSGLGFDATPGDGLSFSVRNPLCAVDEDGVERK----IEFLHGTTTLAFKFQHGVIVAV  84

Query  254  DSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISV  433
            DSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISV
Sbjct  85   DSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISV  144

Query  434  AGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            A ASKLLAN++Y Y+GMGLS+GTM+ GWD++GPGLYYVDSE
Sbjct  145  AAASKLLANMVYQYKGMGLSMGTMVCGWDKRGPGLYYVDSE  185



>ref|XP_003924370.1| PREDICTED: proteasome subunit beta type-5 [Saimiri boliviensis 
boliviensis]
Length=263

 Score =   193 bits (490),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/145 (64%), Positives = 115/145 (79%), Gaps = 11/145 (8%)
 Frame = +2

Query  122  VPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVK  301
            VP + +P        ++  I+M+    GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VK
Sbjct  43   VPGWGVP--------EEPGIEMLH---GTTTLAFKFRHGVIVAADSRATAGAYIASQTVK  91

Query  302  KIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRG  481
            K+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+G
Sbjct  92   KVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKG  151

Query  482  MGLSVGTMIAGWDEKGPGLYYVDSE  556
            MGLS+GTMI GWD++GPGLYYVDSE
Sbjct  152  MGLSMGTMICGWDKRGPGLYYVDSE  176



>pdb|4R3O|L Chain L, Human Constitutive 20s Proteasome
 pdb|4R3O|Z Chain Z, Human Constitutive 20s Proteasome
 pdb|4R67|L Chain L, Human Constitutive 20s Proteasome In Complex With Carfilzomib
 pdb|4R67|Z Chain Z, Human Constitutive 20s Proteasome In Complex With Carfilzomib
 pdb|4R67|NN Chain n, Human Constitutive 20s Proteasome In Complex With Carfilzomib
 pdb|4R67|3 Chain 3, Human Constitutive 20s Proteasome In Complex With Carfilzomib
Length=201

 Score =   191 bits (485),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 87/117 (74%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = +2

Query  206  TTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG  385
            TTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L 
Sbjct  1    TTTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLA  60

Query  386  VKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
             +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSE
Sbjct  61   RQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSE  117



>ref|XP_005978060.1| PREDICTED: proteasome subunit beta type-5 isoform X1 [Pantholops 
hodgsonii]
Length=263

 Score =   193 bits (490),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 115/144 (80%), Gaps = 11/144 (8%)
 Frame = +2

Query  125  PSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKK  304
            PS+ +P        ++  I+M+    GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK
Sbjct  44   PSWGVP--------EEPRIEMLH---GTTTLAFKFRHGVIVAADSRATAGAYIASQTVKK  92

Query  305  IIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGM  484
            +IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GM
Sbjct  93   VIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGM  152

Query  485  GLSVGTMIAGWDEKGPGLYYVDSE  556
            GLS+GTMI GWD++GPGLYYVDSE
Sbjct  153  GLSMGTMICGWDKRGPGLYYVDSE  176



>ref|XP_003457456.2| PREDICTED: proteasome subunit beta type-5-like [Oreochromis niloticus]
Length=281

 Score =   193 bits (491),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 115/146 (79%), Gaps = 7/146 (5%)
 Frame = +2

Query  128  SFQIPN---ITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSV  298
            SF + N   + D DG ++     ++   GTTTLAF F+ GV+VA DSRA+ G YI+SQ+V
Sbjct  54   SFSVKNPLCVGDDDGVERK----IEFLHGTTTLAFKFQHGVIVAVDSRATAGSYIASQTV  109

Query  299  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  478
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  110  KKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYK  169

Query  479  GMGLSVGTMIAGWDEKGPGLYYVDSE  556
            GMGLS+GTM+ GWD++GPGLYYVDSE
Sbjct  170  GMGLSMGTMVCGWDKRGPGLYYVDSE  195



>ref|XP_009021669.1| hypothetical protein HELRODRAFT_83371 [Helobdella robusta]
 gb|ESO00235.1| hypothetical protein HELRODRAFT_83371 [Helobdella robusta]
Length=245

 Score =   192 bits (488),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/152 (64%), Positives = 120/152 (79%), Gaps = 5/152 (3%)
 Frame = +2

Query  104  FDEIPRVPSFQIPNITDFDGFQKDAIQM-VKPAKGTTTLAFIFKEGVMVAADSRASMGGY  280
            F+ +P+  SFQ P++  F+    D  ++ +    GTTTL+F +K GV+VA DSRA+ G +
Sbjct  11   FNLVPK--SFQ-PSL-HFNKESNDESKIKIHFDHGTTTLSFKYKNGVIVAVDSRATAGPW  66

Query  281  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLAN  460
            I+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  KCRL+EL NK RISVA ASKLLAN
Sbjct  67   IASQNVKKVIEINPYLLGTMAGGAADCSFWQRFLAEKCRLYELRNKERISVAAASKLLAN  126

Query  461  ILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            ILY Y+GMGLSVGTMI GWD++GPGLYYVDS+
Sbjct  127  ILYGYKGMGLSVGTMIVGWDKRGPGLYYVDSD  158



>ref|XP_002718121.1| PREDICTED: proteasome subunit beta type-5 isoform X1 [Oryctolagus 
cuniculus]
Length=263

 Score =   193 bits (490),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 100/173 (58%), Positives = 125/173 (72%), Gaps = 11/173 (6%)
 Frame = +2

Query  62   LESTAPIR-------GESSELFDEIPRVPSFQIPNITDFDGF-QKDAIQMVKPAKGTTTL  217
            LE+  P+        G  ++L D  P  PS  +       G  ++  I+M+    GTTTL
Sbjct  7    LETPLPVNQRGFFGLGGRTDLLDLGPGSPSDGLSLTAPGWGVPEEPGIEMLH---GTTTL  63

Query  218  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  397
            AF F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR
Sbjct  64   AFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCR  123

Query  398  LHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            ++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSE
Sbjct  124  IYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSE  176



>ref|XP_005882305.1| PREDICTED: proteasome subunit beta type-5 [Myotis brandtii]
Length=263

 Score =   193 bits (490),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 98/172 (57%), Positives = 124/172 (72%), Gaps = 9/172 (5%)
 Frame = +2

Query  62   LESTAPIR-------GESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  220
            LES+ P+        G  ++L D  P  PS  +       G  ++    ++   GTTTLA
Sbjct  7    LESSVPVNRHGFFGLGGRADLLDLGPGSPSDGLSLAAPSWGVPEE--PRIEILHGTTTLA  64

Query  221  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  400
            F F+ GV+VAADSRA++G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR+
Sbjct  65   FKFQHGVIVAADSRATVGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRI  124

Query  401  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            +EL NK RISVA ASKLL N++Y Y+GMGLS+GTMI GWD++GPGLYYVDSE
Sbjct  125  YELRNKERISVAAASKLLVNMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSE  176



>dbj|BAA08204.1| proteasome subunit RCX [Rattus rattus]
Length=208

 Score =   191 bits (485),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = +2

Query  200  KGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRN  379
             GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R 
Sbjct  3    HGTTTLAFKFQHGVIVAADSRATAGPYIASQTVKKVIEINPYLLGTMAGGAADCSFWERL  62

Query  380  LGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSE
Sbjct  63   LARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSE  121



>ref|XP_004010385.1| PREDICTED: proteasome subunit beta type-5 [Ovis aries]
 ref|XP_005685312.1| PREDICTED: proteasome subunit beta type-5 [Capra hircus]
Length=263

 Score =   192 bits (489),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 115/144 (80%), Gaps = 11/144 (8%)
 Frame = +2

Query  125  PSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKK  304
            PS+ +P        ++  I+M+    GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK
Sbjct  44   PSWGVP--------EEPRIEMLH---GTTTLAFKFRHGVIVAADSRATAGAYIASQTVKK  92

Query  305  IIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGM  484
            +IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GM
Sbjct  93   VIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGM  152

Query  485  GLSVGTMIAGWDEKGPGLYYVDSE  556
            GLS+GTMI GWD++GPGLYYVDSE
Sbjct  153  GLSMGTMICGWDKRGPGLYYVDSE  176



>gb|EJK48257.1| hypothetical protein THAOC_32963 [Thalassiosira oceanica]
Length=248

 Score =   192 bits (488),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 89/128 (70%), Positives = 107/128 (84%), Gaps = 0/128 (0%)
 Frame = +2

Query  173  DAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGA  352
            D  Q VK AKGTTTLAF F  G++V+ DSR++MG YI+S +VKK+IEINP++LGTMAGGA
Sbjct  28   DQGQEVKFAKGTTTLAFKFNGGIIVSVDSRSTMGAYIASGTVKKVIEINPFLLGTMAGGA  87

Query  353  ADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGP  532
            ADC FW RNLG++CR++EL NK+RISVA ASKLLAN + SYRG GLS+GTMI GWDE GP
Sbjct  88   ADCSFWERNLGIQCRMYELRNKKRISVAAASKLLANTMRSYRGYGLSMGTMITGWDETGP  147

Query  533  GLYYVDSE  556
             LYYVD +
Sbjct  148  QLYYVDDD  155



>pdb|1IRU|L Chain L, Crystal Structure Of The Mammalian 20s Proteasome At 
2.75 A Resolution
 pdb|1IRU|Z Chain Z, Crystal Structure Of The Mammalian 20s Proteasome At 
2.75 A Resolution
Length=204

 Score =   191 bits (484),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 87/117 (74%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = +2

Query  206  TTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG  385
            TTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L 
Sbjct  1    TTTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLA  60

Query  386  VKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
             +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSE
Sbjct  61   RQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSE  117



>ref|XP_004694701.1| PREDICTED: proteasome subunit beta type-5 isoform X1 [Condylura 
cristata]
Length=263

 Score =   192 bits (489),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 115/144 (80%), Gaps = 11/144 (8%)
 Frame = +2

Query  125  PSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKK  304
            PS+ +P+        +  I+M+    GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK
Sbjct  44   PSWGVPD--------EPRIEMLH---GTTTLAFKFRHGVIVAADSRATAGAYIASQTVKK  92

Query  305  IIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGM  484
            +IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GM
Sbjct  93   VIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGM  152

Query  485  GLSVGTMIAGWDEKGPGLYYVDSE  556
            GLS+GTMI GWD++GPGLYYVDSE
Sbjct  153  GLSMGTMICGWDKRGPGLYYVDSE  176



>ref|XP_004609529.1| PREDICTED: proteasome subunit beta type-5 [Sorex araneus]
Length=263

 Score =   192 bits (489),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 98/159 (62%), Positives = 121/159 (76%), Gaps = 6/159 (4%)
 Frame = +2

Query  86   GESSELFDEIPRVPSFQIPNIT--DFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADS  259
            G  +EL D  P  PS  + N+    +    +  I+M+    GTTTLAF F+ GV+VAADS
Sbjct  22   GGRAELLDLGPGSPSDGL-NLAAPSWGAPDEPKIEMLH---GTTTLAFKFRHGVIVAADS  77

Query  260  RASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAG  439
            RA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA 
Sbjct  78   RATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAA  137

Query  440  ASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSE
Sbjct  138  ASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSE  176



>ref|XP_008708757.1| PREDICTED: proteasome subunit beta type-5 [Ursus maritimus]
Length=263

 Score =   192 bits (489),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/158 (61%), Positives = 120/158 (76%), Gaps = 10/158 (6%)
 Frame = +2

Query  95   SELFDEIPRVPS----FQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSR  262
            ++L D  P  PS       PN   +   ++  I+M+    GTTTLAF F+ GV+VAADSR
Sbjct  25   ADLLDLGPGSPSDGLSLAAPN---WGVAEEPRIEMLH---GTTTLAFKFQHGVIVAADSR  78

Query  263  ASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGA  442
            A+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA A
Sbjct  79   ATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAA  138

Query  443  SKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            SKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSE
Sbjct  139  SKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSE  176



>ref|XP_004584741.1| PREDICTED: proteasome subunit beta type-5 [Ochotona princeps]
Length=263

 Score =   192 bits (489),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/130 (70%), Positives = 110/130 (85%), Gaps = 3/130 (2%)
 Frame = +2

Query  167  QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAG  346
            ++  I+MV    GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAG
Sbjct  50   EEPGIEMVH---GTTTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAG  106

Query  347  GAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEK  526
            GAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI GWD++
Sbjct  107  GAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKR  166

Query  527  GPGLYYVDSE  556
            GPGLYYVDSE
Sbjct  167  GPGLYYVDSE  176



>ref|XP_006988553.1| PREDICTED: proteasome subunit beta type-5 [Peromyscus maniculatus 
bairdii]
Length=263

 Score =   192 bits (489),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 115/144 (80%), Gaps = 11/144 (8%)
 Frame = +2

Query  125  PSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKK  304
            PS+ +P        ++  I+M+    GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK
Sbjct  44   PSWGVP--------EEPKIEMLH---GTTTLAFKFRHGVIVAADSRATAGAYIASQTVKK  92

Query  305  IIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGM  484
            +IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GM
Sbjct  93   VIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGM  152

Query  485  GLSVGTMIAGWDEKGPGLYYVDSE  556
            GLS+GTMI GWD++GPGLYYVDSE
Sbjct  153  GLSMGTMICGWDKRGPGLYYVDSE  176



>ref|XP_009265754.1| Proteasome component PRE2 [Wallemia ichthyophaga EXF-994]
 gb|EOR04743.1| Proteasome component PRE2 [Wallemia ichthyophaga EXF-994]
Length=287

 Score =   193 bits (491),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/169 (56%), Positives = 120/169 (71%), Gaps = 11/169 (7%)
 Frame = +2

Query  83   RGESSELFDEIPR----VPSFQIPNITDFDGF-------QKDAIQMVKPAKGTTTLAFIF  229
            RG  + L D+       +P+ Q+PN  D  GF       Q D    +K   GTTTLAF +
Sbjct  12   RGIDAALHDDFEGGSGGMPTLQLPNTADPTGFLREYTDEQNDPSCRIKINHGTTTLAFKY  71

Query  230  KEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHEL  409
            K GV+VA DSRA+ G Y++S +VKK+IEINPY+LGTMAGGAADCQ+W   LG++CRLHEL
Sbjct  72   KGGVIVAVDSRATAGSYVASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGIQCRLHEL  131

Query  410  ANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
             N+ RISVA ASK L+NI YSY+G GLS+GTMI GWD+ GP ++YVDS+
Sbjct  132  RNRERISVAAASKYLSNITYSYKGKGLSMGTMICGWDKGGPAIWYVDSD  180



>ref|XP_004755394.1| PREDICTED: proteasome subunit beta type-5 isoform X1 [Mustela 
putorius furo]
 ref|XP_004801213.1| PREDICTED: proteasome subunit beta type-5 isoform X1 [Mustela 
putorius furo]
Length=263

 Score =   192 bits (489),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 98/161 (61%), Positives = 121/161 (75%), Gaps = 10/161 (6%)
 Frame = +2

Query  86   GESSELFDEIPRVPS----FQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAA  253
            G  ++L D  P  PS       PN   +   ++  I+M+    GTTTLAF F+ GV+VAA
Sbjct  22   GGRADLLDLGPGSPSDGLTLAAPN---WGVAEEPRIEMLH---GTTTLAFKFQHGVIVAA  75

Query  254  DSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISV  433
            DSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISV
Sbjct  76   DSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISV  135

Query  434  AGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            A ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSE
Sbjct  136  AAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSE  176



>ref|XP_003639276.1| PREDICTED: proteasome subunit beta type-5 [Canis lupus familiaris]
Length=263

 Score =   192 bits (489),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/158 (61%), Positives = 120/158 (76%), Gaps = 4/158 (3%)
 Frame = +2

Query  86   GESSELFDEIPRVPSFQIPNITDFDGFQKD-AIQMVKPAKGTTTLAFIFKEGVMVAADSR  262
            G   +L D  P  PS  +  +    G  ++  I+M+    GTTTLAF F+ GV+VAADSR
Sbjct  22   GGRVDLLDLGPGSPSDGLSLVAPNWGVAEEPGIEMLH---GTTTLAFKFQHGVIVAADSR  78

Query  263  ASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGA  442
            A+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA A
Sbjct  79   ATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAA  138

Query  443  SKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            SKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSE
Sbjct  139  SKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSE  176



>ref|XP_005978061.1| PREDICTED: proteasome subunit beta type-5 isoform X2 [Pantholops 
hodgsonii]
Length=263

 Score =   192 bits (489),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 115/144 (80%), Gaps = 11/144 (8%)
 Frame = +2

Query  125  PSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKK  304
            PS+ +P        ++  I+M+    GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK
Sbjct  44   PSWGVP--------EEPRIEMLH---GTTTLAFKFRHGVIVAADSRATAGAYIASQTVKK  92

Query  305  IIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGM  484
            +IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GM
Sbjct  93   VIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGM  152

Query  485  GLSVGTMIAGWDEKGPGLYYVDSE  556
            GLS+GTMI GWD++GPGLYYVDSE
Sbjct  153  GLSMGTMICGWDKRGPGLYYVDSE  176



>ref|XP_007180616.1| PREDICTED: proteasome subunit beta type-5 [Balaenoptera acutorostrata 
scammoni]
Length=263

 Score =   192 bits (489),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/157 (61%), Positives = 119/157 (76%), Gaps = 2/157 (1%)
 Frame = +2

Query  86   GESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRA  265
            G  ++L D  P  PS  +  +    G  ++    ++   GTTTLAF F+ GV+VAADSRA
Sbjct  22   GGRADLLDLGPGSPSDGLSLVAPSWGVPEE--PRIEILHGTTTLAFKFRHGVIVAADSRA  79

Query  266  SMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGAS  445
            + G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA AS
Sbjct  80   TAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAAS  139

Query  446  KLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            KLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSE
Sbjct  140  KLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSE  176



>ref|XP_002926051.1| PREDICTED: proteasome subunit beta type-5 [Ailuropoda melanoleuca]
 gb|EFB18962.1| hypothetical protein PANDA_015661 [Ailuropoda melanoleuca]
Length=263

 Score =   192 bits (488),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 97/158 (61%), Positives = 120/158 (76%), Gaps = 10/158 (6%)
 Frame = +2

Query  95   SELFDEIPRVPS----FQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSR  262
            ++L D  P  PS       PN   +   ++  I+M+    GTTTLAF F+ GV+VAADSR
Sbjct  25   ADLLDLGPGSPSDGLSLAAPN---WGVTEEPRIEMLH---GTTTLAFKFQHGVIVAADSR  78

Query  263  ASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGA  442
            A+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA A
Sbjct  79   ATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAA  138

Query  443  SKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            SKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSE
Sbjct  139  SKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSE  176



>ref|XP_001494538.2| PREDICTED: proteasome subunit beta type-5 isoform 1 [Equus caballus]
Length=263

 Score =   192 bits (488),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 115/144 (80%), Gaps = 11/144 (8%)
 Frame = +2

Query  125  PSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKK  304
            PS+ +P        ++  I+M+    GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK
Sbjct  44   PSWGVP--------EEPRIEMLH---GTTTLAFKFQHGVIVAADSRATAGAYIASQTVKK  92

Query  305  IIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGM  484
            +IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GM
Sbjct  93   VIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGM  152

Query  485  GLSVGTMIAGWDEKGPGLYYVDSE  556
            GLS+GTMI GWD++GPGLYYVDSE
Sbjct  153  GLSMGTMICGWDKRGPGLYYVDSE  176



>ref|XP_007989004.1| PREDICTED: proteasome subunit beta type-5 isoform X1 [Chlorocebus 
sabaeus]
Length=263

 Score =   192 bits (488),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 97/158 (61%), Positives = 120/158 (76%), Gaps = 4/158 (3%)
 Frame = +2

Query  86   GESSELFDEIPRVPSFQIPNITDFDGF-QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSR  262
            G  ++L D  P  PS  +       G  ++  I+M+    GTTTLAF F+ GV+VAADSR
Sbjct  22   GGRADLLDLGPGSPSDGLSLAAPGWGVPEEPGIEMLH---GTTTLAFKFRHGVIVAADSR  78

Query  263  ASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGA  442
            A+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA A
Sbjct  79   ATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAA  138

Query  443  SKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            SKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSE
Sbjct  139  SKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSE  176



>ref|XP_007418509.1| 20S proteasome subunit [Melampsora larici-populina 98AG31]
 gb|EGF98220.1| 20S proteasome subunit [Melampsora larici-populina 98AG31]
Length=296

 Score =   193 bits (490),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 91/151 (60%), Positives = 114/151 (75%), Gaps = 6/151 (4%)
 Frame = +2

Query  122  VPSFQIPNITDFDGF------QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYI  283
            VP+F+ P + D   F       +     +K   GTTTLAF FK G++VA DSRA+ G YI
Sbjct  44   VPTFEFPAVDDPAAFLRAHTDDRSPDSRIKIRHGTTTLAFRFKHGIVVAVDSRATAGSYI  103

Query  284  SSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANI  463
            +S +VKK+IEINP++LGTMAGGAADCQ+W   LG++CRLHEL NK RISVA ASK L+N+
Sbjct  104  ASGTVKKVIEINPFLLGTMAGGAADCQYWETYLGMQCRLHELRNKSRISVAAASKHLSNL  163

Query  464  LYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            +YSY+GMGLS+GTMI GWD+ GP LYYVDS+
Sbjct  164  VYSYKGMGLSMGTMICGWDKSGPALYYVDSD  194



>ref|XP_008527207.1| PREDICTED: proteasome subunit beta type-5 [Equus przewalskii]
Length=263

 Score =   192 bits (488),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 115/144 (80%), Gaps = 11/144 (8%)
 Frame = +2

Query  125  PSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKK  304
            PS+ +P        ++  I+M+    GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK
Sbjct  44   PSWGVP--------EEPRIEMLH---GTTTLAFKFQHGVIVAADSRATAGAYIASQTVKK  92

Query  305  IIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGM  484
            +IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GM
Sbjct  93   VIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGM  152

Query  485  GLSVGTMIAGWDEKGPGLYYVDSE  556
            GLS+GTMI GWD++GPGLYYVDSE
Sbjct  153  GLSMGTMICGWDKRGPGLYYVDSE  176



>ref|XP_004421295.1| PREDICTED: proteasome subunit beta type-5 [Ceratotherium simum 
simum]
Length=263

 Score =   192 bits (488),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 115/144 (80%), Gaps = 11/144 (8%)
 Frame = +2

Query  125  PSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKK  304
            PS+ +P        ++  I+M+    GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK
Sbjct  44   PSWGVP--------EEPRIEMLH---GTTTLAFKFQHGVIVAADSRATAGAYIASQTVKK  92

Query  305  IIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGM  484
            +IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GM
Sbjct  93   VIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGM  152

Query  485  GLSVGTMIAGWDEKGPGLYYVDSE  556
            GLS+GTMI GWD++GPGLYYVDSE
Sbjct  153  GLSMGTMICGWDKRGPGLYYVDSE  176



>ref|XP_005139397.1| PREDICTED: LOW QUALITY PROTEIN: proteasome (prosome, macropain) 
subunit, beta type, 5 [Mesocricetus auratus]
Length=262

 Score =   192 bits (488),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 115/144 (80%), Gaps = 11/144 (8%)
 Frame = +2

Query  125  PSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKK  304
            PS+ +P        ++  I+M+    GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK
Sbjct  44   PSWGVP--------EEPRIEMLH---GTTTLAFKFRHGVIVAADSRATAGAYIASQTVKK  92

Query  305  IIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGM  484
            +IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GM
Sbjct  93   VIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGM  152

Query  485  GLSVGTMIAGWDEKGPGLYYVDSE  556
            GLS+GTMI GWD++GPGLYYVDSE
Sbjct  153  GLSMGTMICGWDKRGPGLYYVDSE  176



>ref|XP_010376681.1| PREDICTED: proteasome subunit beta type-5 [Rhinopithecus roxellana]
Length=271

 Score =   192 bits (488),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 97/158 (61%), Positives = 120/158 (76%), Gaps = 4/158 (3%)
 Frame = +2

Query  86   GESSELFDEIPRVPSFQIPNITDFDGF-QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSR  262
            G  ++L D  P  PS  +       G  ++  I+M+    GTTTLAF F+ GV+VAADSR
Sbjct  30   GGRADLLDLGPGSPSDGLSLAAPGWGVPEEPGIEMLH---GTTTLAFKFRHGVVVAADSR  86

Query  263  ASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGA  442
            A+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA A
Sbjct  87   ATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAA  146

Query  443  SKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            SKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSE
Sbjct  147  SKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSE  184



>ref|XP_003506173.1| PREDICTED: proteasome subunit beta type-5 [Cricetulus griseus]
 ref|XP_007609296.1| PREDICTED: proteasome subunit beta type-5 [Cricetulus griseus]
 gb|EGV98712.1| Proteasome subunit beta type-5 [Cricetulus griseus]
Length=263

 Score =   192 bits (488),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 115/144 (80%), Gaps = 11/144 (8%)
 Frame = +2

Query  125  PSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKK  304
            PS+ +P        ++  I+M+    GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK
Sbjct  44   PSWGVP--------EEPRIEMLH---GTTTLAFKFRHGVIVAADSRATAGAYIASQTVKK  92

Query  305  IIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGM  484
            +IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GM
Sbjct  93   VIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGM  152

Query  485  GLSVGTMIAGWDEKGPGLYYVDSE  556
            GLS+GTMI GWD++GPGLYYVDSE
Sbjct  153  GLSMGTMICGWDKRGPGLYYVDSE  176



>ref|XP_002753673.3| PREDICTED: proteasome subunit beta type-5 [Callithrix jacchus]
Length=268

 Score =   192 bits (488),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/145 (63%), Positives = 115/145 (79%), Gaps = 11/145 (8%)
 Frame = +2

Query  122  VPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVK  301
            +P + +P        ++  I+M+    GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VK
Sbjct  48   MPGWSVP--------EEPGIEMLH---GTTTLAFKFRHGVIVAADSRATAGAYIASQTVK  96

Query  302  KIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRG  481
            K+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+G
Sbjct  97   KVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKG  156

Query  482  MGLSVGTMIAGWDEKGPGLYYVDSE  556
            MGLS+GTMI GWD++GPGLYYVDSE
Sbjct  157  MGLSMGTMICGWDKRGPGLYYVDSE  181



>ref|NP_001099197.2| proteasome subunit beta type-5 [Rattus norvegicus]
 gb|EDM14180.1| proteasome (prosome, macropain) subunit, beta type 5, isoform 
CRA_a [Rattus norvegicus]
Length=263

 Score =   192 bits (488),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 115/144 (80%), Gaps = 11/144 (8%)
 Frame = +2

Query  125  PSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKK  304
            PS+ +P        ++  I+M+    GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK
Sbjct  44   PSWGVP--------EEPRIEMLH---GTTTLAFKFQHGVIVAADSRATAGAYIASQTVKK  92

Query  305  IIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGM  484
            +IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GM
Sbjct  93   VIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGM  152

Query  485  GLSVGTMIAGWDEKGPGLYYVDSE  556
            GLS+GTMI GWD++GPGLYYVDSE
Sbjct  153  GLSMGTMICGWDKRGPGLYYVDSE  176



>ref|XP_006802789.1| PREDICTED: proteasome subunit beta type-5-like [Neolamprologus 
brichardi]
Length=281

 Score =   192 bits (489),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 115/146 (79%), Gaps = 7/146 (5%)
 Frame = +2

Query  128  SFQIPN---ITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSV  298
            SF + N   + D DG ++     ++   GTTTLAF F+ GV+VA DSRA+ G YI+SQ+V
Sbjct  54   SFSVKNPLCVGDDDGVERK----IEFLHGTTTLAFKFQHGVIVAVDSRATAGSYIASQTV  109

Query  299  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  478
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  110  KKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYK  169

Query  479  GMGLSVGTMIAGWDEKGPGLYYVDSE  556
            GMGLS+GTM+ GWD++GPGLYYVDSE
Sbjct  170  GMGLSMGTMVCGWDKRGPGLYYVDSE  195



>ref|XP_010744420.1| PREDICTED: proteasome subunit beta type-5 [Larimichthys crocea]
Length=273

 Score =   192 bits (488),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 95/155 (61%), Positives = 117/155 (75%), Gaps = 8/155 (5%)
 Frame = +2

Query  104  FDEIP-RVPSFQIPN---ITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASM  271
            FD  P    SF + N     D DG ++     ++   GTTTLAF F+ GV+VA DSRA+ 
Sbjct  35   FDATPGDGLSFSVRNPLCAADDDGVERK----IEFLHGTTTLAFKFQHGVIVAVDSRATA  90

Query  272  GGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKL  451
            G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKL
Sbjct  91   GSYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKL  150

Query  452  LANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            LAN++Y Y+GMGLS+GTM+ GWD++GPGLYYVDSE
Sbjct  151  LANMVYQYKGMGLSMGTMVCGWDKRGPGLYYVDSE  185



>ref|NP_001247774.1| proteasome subunit beta type-5 [Macaca mulatta]
 ref|XP_003901626.1| PREDICTED: proteasome subunit beta type-5 isoform X1 [Papio anubis]
 gb|EHH27742.1| hypothetical protein EGK_18013 [Macaca mulatta]
 gb|EHH63472.1| hypothetical protein EGM_16445 [Macaca fascicularis]
Length=263

 Score =   192 bits (487),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 97/158 (61%), Positives = 120/158 (76%), Gaps = 4/158 (3%)
 Frame = +2

Query  86   GESSELFDEIPRVPSFQIPNITDFDGF-QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSR  262
            G  ++L D  P  PS  +       G  ++  I+M+    GTTTLAF F+ GV+VAADSR
Sbjct  22   GGRADLLDIGPGSPSDGLSLAAPGWGVPEEPGIEMLH---GTTTLAFKFRHGVIVAADSR  78

Query  263  ASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGA  442
            A+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA A
Sbjct  79   ATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAA  138

Query  443  SKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            SKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSE
Sbjct  139  SKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSE  176



>ref|XP_009242876.1| PREDICTED: proteasome subunit beta type-5-like [Pongo abelii]
Length=263

 Score =   192 bits (487),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 89/123 (72%), Positives = 106/123 (86%), Gaps = 0/123 (0%)
 Frame = +2

Query  188  VKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQF  367
            +K   GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC F
Sbjct  54   IKMLHGTTTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSF  113

Query  368  WHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYV  547
            W R L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYV
Sbjct  114  WERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYV  173

Query  548  DSE  556
            DSE
Sbjct  174  DSE  176



>ref|XP_010636092.1| PREDICTED: proteasome subunit beta type-5 [Fukomys damarensis]
 gb|KFO27511.1| Proteasome subunit beta type-5 [Fukomys damarensis]
Length=263

 Score =   192 bits (487),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 96/158 (61%), Positives = 121/158 (77%), Gaps = 4/158 (3%)
 Frame = +2

Query  86   GESSELFDEIPRVPSFQIPNIT-DFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSR  262
            G  ++L D  P  PS  +   +  +   ++  I+M+    GTTTLAF F+ GV+VAADSR
Sbjct  22   GGRADLLDLGPGSPSDGLSLASPSWGAPEEPRIEMLH---GTTTLAFKFRHGVIVAADSR  78

Query  263  ASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGA  442
            A+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA A
Sbjct  79   ATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAA  138

Query  443  SKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            SKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSE
Sbjct  139  SKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSE  176



>ref|XP_008036606.1| proteasome component pts1 [Trametes versicolor FP-101664 SS1]
 gb|EIW60150.1| proteasome component pts1 [Trametes versicolor FP-101664 SS1]
Length=310

 Score =   193 bits (490),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 91/152 (60%), Positives = 115/152 (76%), Gaps = 7/152 (5%)
 Frame = +2

Query  122  VPSFQIPNITDFDGF-------QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  280
            VPSF+IP + D   F         D    +K   GTTTLAF +K GV+VA DSRA+ G Y
Sbjct  48   VPSFKIPAVADPSSFLRMHTDDHADPSCRIKIKHGTTTLAFRYKGGVIVAVDSRATAGSY  107

Query  281  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLAN  460
            ++S +VKK+IEINPY+LGTMAGGAADCQ+W   LG++CRLHEL N+ RISVA ASK L+N
Sbjct  108  VASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGIQCRLHELRNRERISVAAASKYLSN  167

Query  461  ILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            ++YSY+GMGLS+GTMI GWD+ GP ++YVDS+
Sbjct  168  LVYSYKGMGLSMGTMICGWDKTGPAIFYVDSD  199



>gb|KDQ60928.1| hypothetical protein JAAARDRAFT_125152 [Jaapia argillacea MUCL 
33604]
Length=318

 Score =   193 bits (491),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 91/152 (60%), Positives = 115/152 (76%), Gaps = 7/152 (5%)
 Frame = +2

Query  122  VPSFQIPNITDFDGF-------QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  280
            +PSF +P++ D   F         D    +K   GTTTLAF F+ GV+VA DSRA+ G Y
Sbjct  46   IPSFSVPSVHDPTAFLRLHTDDHADPNCRIKIQHGTTTLAFRFQGGVIVAVDSRATAGSY  105

Query  281  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLAN  460
            I+S +VKK+IEINPY+LGTMAGGAADCQ+W   LG++CRLHEL N+ RISVA ASK L+N
Sbjct  106  IASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGIQCRLHELRNRERISVAAASKYLSN  165

Query  461  ILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            ++YSY+GMGLS+GTMI GWD+ GP +YYVDS+
Sbjct  166  LVYSYKGMGLSMGTMICGWDKTGPAVYYVDSD  197



>ref|NP_002788.1| proteasome subunit beta type-5 isoform 1 [Homo sapiens]
 ref|NP_001126063.1| proteasome subunit beta type-5 precursor [Pongo abelii]
 ref|XP_003808166.1| PREDICTED: proteasome subunit beta type-5 [Pan paniscus]
 sp|P28074.3|PSB5_HUMAN RecName: Full=Proteasome subunit beta type-5; AltName: Full=Macropain 
epsilon chain; AltName: Full=Multicatalytic endopeptidase 
complex epsilon chain; AltName: Full=Proteasome chain 
6; AltName: Full=Proteasome epsilon chain; AltName: Full=Proteasome 
subunit MB1; AltName: Full=Proteasome subunit X; Flags: 
Precursor [Homo sapiens]
 sp|Q5R8S2.3|PSB5_PONAB RecName: Full=Proteasome subunit beta type-5; Flags: Precursor 
[Pongo abelii]
 emb|CAA64838.1| proteasome [Homo sapiens]
 gb|AAH57840.1| Proteasome (prosome, macropain) subunit, beta type, 5 [Homo sapiens]
 emb|CAH91838.1| hypothetical protein [Pongo abelii]
 gb|AAI07721.1| Proteasome (prosome, macropain) subunit, beta type, 5 [Homo sapiens]
 gb|EAW66193.1| proteasome (prosome, macropain) subunit, beta type, 5, isoform 
CRA_a [Homo sapiens]
 gb|EAW66195.1| proteasome (prosome, macropain) subunit, beta type, 5, isoform 
CRA_a [Homo sapiens]
 dbj|BAG34836.1| unnamed protein product [Homo sapiens]
 dbj|BAI47149.1| proteasome (prosome, macropain) subunit, beta type, 5 [synthetic 
construct]
 gb|ADQ33015.1| proteasome (prosome, macropain) subunit, beta type, 5 [synthetic 
construct]
Length=263

 Score =   192 bits (487),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 110/130 (85%), Gaps = 3/130 (2%)
 Frame = +2

Query  167  QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAG  346
            ++  I+M+    GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAG
Sbjct  50   EEPGIEMLH---GTTTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAG  106

Query  347  GAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEK  526
            GAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI GWD++
Sbjct  107  GAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKR  166

Query  527  GPGLYYVDSE  556
            GPGLYYVDSE
Sbjct  167  GPGLYYVDSE  176



>ref|XP_007395513.1| hypothetical protein PHACADRAFT_255622 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EKM55176.1| hypothetical protein PHACADRAFT_255622 [Phanerochaete carnosa 
HHB-10118-sp]
Length=300

 Score =   192 bits (489),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 92/152 (61%), Positives = 114/152 (75%), Gaps = 7/152 (5%)
 Frame = +2

Query  122  VPSFQIPNITDFDGFQK-------DAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  280
            VP F IP + D   F +       D    +K   GTTTLAF F+ GV+VA DSRA+ G Y
Sbjct  43   VPKFNIPAVPDPSAFLRLHTDDFADPSCRIKIKHGTTTLAFRFRGGVIVAVDSRATAGSY  102

Query  281  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLAN  460
            I+S +VKK+IEINPY+LGTMAGGAADCQ+W   LG++CRLHEL N+ RISVA ASK L+N
Sbjct  103  IASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGIQCRLHELRNRERISVAAASKYLSN  162

Query  461  ILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            ++YSY+GMGLS+GTMI GWD+ GP +YYVDS+
Sbjct  163  LVYSYKGMGLSMGTMICGWDKTGPAVYYVDSD  194



>gb|AAB87680.1| proteasome subunit X [Danio rerio]
Length=218

 Score =   190 bits (483),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 89/144 (62%), Positives = 114/144 (79%), Gaps = 4/144 (3%)
 Frame = +2

Query  125  PSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKK  304
            P+F +  + + D    +  + ++   GTTTLAF F+ GV+VA DSRA+ G YI+SQ+VKK
Sbjct  29   PNFAVKTLGEDD----EPERKIEFLHGTTTLAFKFQHGVIVAVDSRATAGAYIASQTVKK  84

Query  305  IIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGM  484
            +IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GM
Sbjct  85   VIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGM  144

Query  485  GLSVGTMIAGWDEKGPGLYYVDSE  556
            GLS+GTM+ GWD++GPGLYYVDSE
Sbjct  145  GLSMGTMVCGWDKRGPGLYYVDSE  168



>ref|XP_005809292.1| PREDICTED: proteasome subunit beta type-5-like [Xiphophorus maculatus]
Length=271

 Score =   192 bits (487),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 114/146 (78%), Gaps = 7/146 (5%)
 Frame = +2

Query  128  SFQIPN---ITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSV  298
            SF + N     D DG ++     ++   GTTTLAF F+ GV+VA DSRA+ G YI+SQ+V
Sbjct  44   SFSVKNSLLAGDEDGVERK----IEFLHGTTTLAFKFQHGVIVAVDSRATAGSYIASQTV  99

Query  299  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  478
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  100  KKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYK  159

Query  479  GMGLSVGTMIAGWDEKGPGLYYVDSE  556
            GMGLS+GTM+ GWD++GPGLYYVDSE
Sbjct  160  GMGLSMGTMVCGWDKRGPGLYYVDSE  185



>ref|XP_004054980.1| PREDICTED: proteasome subunit beta type-5 isoform 1 [Gorilla 
gorilla gorilla]
 ref|XP_004054981.1| PREDICTED: proteasome subunit beta type-5 isoform 2 [Gorilla 
gorilla gorilla]
 ref|XP_004054983.1| PREDICTED: proteasome subunit beta type-5 isoform 4 [Gorilla 
gorilla gorilla]
 ref|XP_004054984.1| PREDICTED: proteasome subunit beta type-5 isoform 5 [Gorilla 
gorilla gorilla]
Length=263

 Score =   191 bits (486),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 110/130 (85%), Gaps = 3/130 (2%)
 Frame = +2

Query  167  QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAG  346
            ++  I+M+    GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAG
Sbjct  50   EEPGIEMLH---GTTTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAG  106

Query  347  GAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEK  526
            GAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI GWD++
Sbjct  107  GAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKR  166

Query  527  GPGLYYVDSE  556
            GPGLYYVDSE
Sbjct  167  GPGLYYVDSE  176



>ref|XP_003260670.1| PREDICTED: proteasome subunit beta type-5 isoform 1 [Nomascus 
leucogenys]
 ref|XP_004091952.1| PREDICTED: proteasome subunit beta type-5 [Nomascus leucogenys]
Length=263

 Score =   191 bits (486),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 110/130 (85%), Gaps = 3/130 (2%)
 Frame = +2

Query  167  QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAG  346
            ++  I+M+    GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAG
Sbjct  50   EEPGIEMLH---GTTTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAG  106

Query  347  GAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEK  526
            GAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI GWD++
Sbjct  107  GAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKR  166

Query  527  GPGLYYVDSE  556
            GPGLYYVDSE
Sbjct  167  GPGLYYVDSE  176



>ref|XP_004879937.1| PREDICTED: proteasome subunit beta type-5 [Heterocephalus glaber]
 ref|XP_004864242.1| PREDICTED: proteasome subunit beta type-5 [Heterocephalus glaber]
 gb|EHB00011.1| Proteasome subunit beta type-5 [Heterocephalus glaber]
Length=263

 Score =   191 bits (486),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 96/158 (61%), Positives = 120/158 (76%), Gaps = 4/158 (3%)
 Frame = +2

Query  86   GESSELFDEIPRVPSFQIP-NITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSR  262
            G  ++L D  P  PS  +      +   ++  I+M+    GTTTLAF F+ GV+VAADSR
Sbjct  22   GGRADLLDLGPGSPSDGLSLAAPSWGAPEEPRIEMLH---GTTTLAFKFRHGVIVAADSR  78

Query  263  ASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGA  442
            A+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA A
Sbjct  79   ATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAA  138

Query  443  SKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            SKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSE
Sbjct  139  SKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSE  176



>gb|ELR56586.1| Proteasome subunit beta type-5, partial [Bos mutus]
Length=266

 Score =   191 bits (486),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = +2

Query  200  KGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRN  379
             GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R 
Sbjct  61   HGTTTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERL  120

Query  380  LGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSE
Sbjct  121  LARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSE  179



>gb|ADO27969.1| proteasome subunit beta type-5 [Ictalurus furcatus]
Length=266

 Score =   191 bits (486),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 88/138 (64%), Positives = 111/138 (80%), Gaps = 0/138 (0%)
 Frame = +2

Query  143  NITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINP  322
             +  F+G +    + ++   GTTTLAF F+ GV+VA DSRA+ G YI+SQ+VKK+IEINP
Sbjct  42   TLKHFEGEEGGIERKIEFLHGTTTLAFKFQHGVIVAVDSRATAGSYIASQTVKKVIEINP  101

Query  323  YMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGT  502
            Y+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GT
Sbjct  102  YLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGT  161

Query  503  MIAGWDEKGPGLYYVDSE  556
            M+ GWD++GPGLYYVDSE
Sbjct  162  MVCGWDKRGPGLYYVDSE  179



>ref|XP_005370537.1| PREDICTED: proteasome subunit beta type-5 [Microtus ochrogaster]
Length=263

 Score =   191 bits (486),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 110/130 (85%), Gaps = 3/130 (2%)
 Frame = +2

Query  167  QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAG  346
            ++  I+M+    GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAG
Sbjct  50   EESRIEMLH---GTTTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAG  106

Query  347  GAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEK  526
            GAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI GWD++
Sbjct  107  GAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKR  166

Query  527  GPGLYYVDSE  556
            GPGLYYVDSE
Sbjct  167  GPGLYYVDSE  176



>ref|XP_004402154.1| PREDICTED: proteasome subunit beta type-5 [Odobenus rosmarus 
divergens]
Length=263

 Score =   191 bits (486),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = +2

Query  200  KGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRN  379
             GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R 
Sbjct  58   HGTTTLAFKFQHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERL  117

Query  380  LGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSE
Sbjct  118  LARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSE  176



>emb|CCO27714.1| 20S proteasome subunit beta 5 [Rhizoctonia solani AG-1 IB]
 emb|CEL51643.1| 20S proteasome subunit beta 5 [Rhizoctonia solani AG-1 IB]
Length=302

 Score =   192 bits (489),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 93/152 (61%), Positives = 114/152 (75%), Gaps = 7/152 (5%)
 Frame = +2

Query  122  VPSFQIPNITDFDGF-------QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  280
            VPSF IP + D   F         D    +K   GTTTLAF FK G++VA DSRA+ G Y
Sbjct  45   VPSFTIPRVPDPTAFLRLHTDDHADPSCRIKIQHGTTTLAFRFKGGIIVAVDSRATAGSY  104

Query  281  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLAN  460
            I+S +VKK+IEIN Y+LGTMAGGAADCQ+W   LG++CRLHEL N+ RISVA ASK L+N
Sbjct  105  IASGTVKKVIEINKYLLGTMAGGAADCQYWETYLGIQCRLHELRNRERISVAAASKYLSN  164

Query  461  ILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            ++YSY+GMGLS+GTMIAGWD+ GP L+YVDS+
Sbjct  165  LVYSYKGMGLSMGTMIAGWDKTGPALFYVDSD  196



>emb|CAD97956.1| hypothetical protein [Homo sapiens]
Length=266

 Score =   191 bits (486),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 110/130 (85%), Gaps = 3/130 (2%)
 Frame = +2

Query  167  QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAG  346
            ++  I+M+    GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAG
Sbjct  53   EEPGIEMLH---GTTTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAG  109

Query  347  GAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEK  526
            GAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI GWD++
Sbjct  110  GAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKR  169

Query  527  GPGLYYVDSE  556
            GPGLYYVDSE
Sbjct  170  GPGLYYVDSE  179



>ref|XP_002179855.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC48841.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=283

 Score =   192 bits (488),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 93/151 (62%), Positives = 118/151 (78%), Gaps = 2/151 (1%)
 Frame = +2

Query  110  EIPRVPSFQIPNITDFDGF--QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYI  283
            ++P VP   +   ++F       DA Q VK AKGTTTLAF F  G++V+ DSR++MG YI
Sbjct  41   DVPNVPDPALYCRSNFASACGNADAGQEVKFAKGTTTLAFKFNGGIIVSVDSRSTMGYYI  100

Query  284  SSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANI  463
            +S +VKK+IEINP++LGTMAGGAADC FW RNLG++CRL+EL N RRI+VA ASKLLAN+
Sbjct  101  ASGTVKKVIEINPFLLGTMAGGAADCSFWERNLGMECRLYELRNGRRITVAAASKLLANV  160

Query  464  LYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            + +YRG GLS+GTMI GWDE GP LYYVD++
Sbjct  161  MSAYRGYGLSMGTMITGWDETGPQLYYVDND  191



>emb|CAA66313.1| LMP7-like protein [Botryllus schlosseri]
Length=257

 Score =   191 bits (485),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 98/180 (54%), Positives = 128/180 (71%), Gaps = 14/180 (8%)
 Frame = +2

Query  38   MVRIDFSGLESTAPI-----RGESSELFDEIPRV--PSFQIPNITDFDGFQKDAIQMVKP  196
            M  I+   L++ AP+     R +  E   +IP V  P+  +  +TD         + +K 
Sbjct  1    MAMIEECSLDAFAPLSLKAPRDDGVEF--QIPEVINPALHLRELTD-----SKYGKGIKF  53

Query  197  AKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHR  376
              GTTTLAF F+ GV+VA DSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R
Sbjct  54   NHGTTTLAFKFQHGVVVAVDSRATAGSYIASQTVKKVIEINPYLLGTMAGGAADCMFWER  113

Query  377  NLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
             L  +CR++EL NK RISVA ASK+LAN++Y+Y+GMGLS+GTMI GWD+ GPGL+YVDS+
Sbjct  114  VLAKQCRIYELRNKERISVAAASKILANMVYNYKGMGLSMGTMICGWDKHGPGLFYVDSD  173



>gb|KDE05583.1| proteasome component PRE2 [Microbotryum violaceum p1A1 Lamole]
Length=308

 Score =   193 bits (490),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 91/152 (60%), Positives = 114/152 (75%), Gaps = 7/152 (5%)
 Frame = +2

Query  122  VPSFQIPNITDFDGF-------QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  280
            +PSF +P + D   F         D    +K   GTTTLAF FK G++VA DSRA+ G Y
Sbjct  46   MPSFDLPTLQDPTAFLQLHTDDSSDPSCRIKINHGTTTLAFRFKGGIIVAVDSRATAGSY  105

Query  281  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLAN  460
            I+S +VKK+IEINPY+LGTMAGGAADCQ+W   LG++CRLHEL N+ RISVA ASK L+N
Sbjct  106  IASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGIQCRLHELRNRERISVAAASKYLSN  165

Query  461  ILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            ++YSY+GMGLS+GTMI GWD+ GP L+YVDS+
Sbjct  166  LVYSYKGMGLSMGTMICGWDKTGPALFYVDSD  197



>ref|XP_003474544.1| PREDICTED: proteasome subunit beta type-5 [Cavia porcellus]
Length=263

 Score =   191 bits (486),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = +2

Query  200  KGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRN  379
             GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R 
Sbjct  58   HGTTTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERL  117

Query  380  LGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSE
Sbjct  118  LARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSE  176



>emb|CCU99044.1| unnamed protein product [Malassezia sympodialis ATCC 42132]
Length=268

 Score =   191 bits (486),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 91/144 (63%), Positives = 113/144 (78%), Gaps = 2/144 (1%)
 Frame = +2

Query  125  PSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKK  304
            P   +   TD D   ++A   +K   GTTTLAF +K GV+VA DSRAS G YI+S SVKK
Sbjct  37   PGRFLAQFTDVDSTNQNA--RIKLNHGTTTLAFRYKGGVVVAVDSRASAGSYIASGSVKK  94

Query  305  IIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGM  484
            +IEINPY+LGTMAGGAADCQ+W   LG++CRLHEL NK RISVA ASK+L+N++YSY+GM
Sbjct  95   VIEINPYLLGTMAGGAADCQYWETYLGIQCRLHELRNKERISVAAASKILSNLVYSYKGM  154

Query  485  GLSVGTMIAGWDEKGPGLYYVDSE  556
            GLS+GTMI GWD+ GP ++YVDS+
Sbjct  155  GLSMGTMICGWDKTGPAIFYVDSD  178



>ref|XP_004054982.1| PREDICTED: proteasome subunit beta type-5 isoform 3 [Gorilla 
gorilla gorilla]
Length=268

 Score =   191 bits (486),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 110/130 (85%), Gaps = 3/130 (2%)
 Frame = +2

Query  167  QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAG  346
            ++  I+M+    GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAG
Sbjct  55   EEPGIEMLH---GTTTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAG  111

Query  347  GAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEK  526
            GAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI GWD++
Sbjct  112  GAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKR  171

Query  527  GPGLYYVDSE  556
            GPGLYYVDSE
Sbjct  172  GPGLYYVDSE  181



>ref|NP_001032701.1| proteasome subunit beta type-5 [Bos taurus]
 ref|XP_005895501.1| PREDICTED: proteasome subunit beta type-5 [Bos mutus]
 ref|XP_010829574.1| PREDICTED: proteasome subunit beta type-5 [Bison bison bison]
 sp|Q32KL2.1|PSB5_BOVIN RecName: Full=Proteasome subunit beta type-5; Flags: Precursor 
[Bos taurus]
 gb|AAI10040.1| Proteasome (prosome, macropain) subunit, beta type, 5 [Bos taurus]
 tpg|DAA25764.1| TPA: proteasome subunit beta type-5 precursor [Bos taurus]
Length=263

 Score =   191 bits (486),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = +2

Query  200  KGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRN  379
             GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R 
Sbjct  58   HGTTTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERL  117

Query  380  LGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSE
Sbjct  118  LARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSE  176



>ref|XP_006066544.1| PREDICTED: proteasome subunit beta type-5 [Bubalus bubalis]
Length=263

 Score =   191 bits (486),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = +2

Query  200  KGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRN  379
             GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R 
Sbjct  58   HGTTTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERL  117

Query  380  LGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSE
Sbjct  118  LARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSE  176



>ref|XP_004661842.1| PREDICTED: proteasome subunit beta type-5 [Jaculus jaculus]
Length=263

 Score =   191 bits (485),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = +2

Query  200  KGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRN  379
             GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R 
Sbjct  58   HGTTTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERL  117

Query  380  LGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  556
            L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSE
Sbjct  118  LARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSE  176



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 617525281800