BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002F04

Length=548
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009338145.1|  PREDICTED: proliferation-associated protein ...    189   1e-57   
ref|XP_004137704.1|  PREDICTED: proliferation-associated protein ...    194   1e-56   Cucumis sativus [cucumbers]
ref|XP_004156612.1|  PREDICTED: LOW QUALITY PROTEIN: proliferatio...    193   3e-56   
ref|XP_008350687.1|  PREDICTED: proliferation-associated protein ...    187   4e-56   
ref|XP_008442393.1|  PREDICTED: proliferation-associated protein ...    192   7e-56   Cucumis melo [Oriental melon]
ref|XP_007205303.1|  hypothetical protein PRUPE_ppa006778mg             192   1e-55   
ref|XP_009789408.1|  PREDICTED: proliferation-associated protein ...    192   1e-55   Nicotiana sylvestris
ref|XP_002262986.2|  PREDICTED: proliferation-associated protein 2G4    192   1e-55   Vitis vinifera
ref|XP_006381246.1|  hypothetical protein POPTR_0006s10320g             188   1e-55   
ref|XP_010037691.1|  PREDICTED: proliferation-associated protein 2G4    191   2e-55   Eucalyptus grandis [rose gum]
ref|XP_008366899.1|  PREDICTED: proliferation-associated protein ...    189   3e-55   
ref|XP_009599246.1|  PREDICTED: proliferation-associated protein ...    191   4e-55   Nicotiana tomentosiformis
ref|XP_009376423.1|  PREDICTED: proliferation-associated protein ...    189   7e-55   Pyrus x bretschneideri [bai li]
ref|XP_009773246.1|  PREDICTED: proliferation-associated protein ...    189   7e-55   Nicotiana sylvestris
ref|XP_004242516.1|  PREDICTED: proliferation-associated protein ...    189   7e-55   Solanum lycopersicum
ref|XP_009376419.1|  PREDICTED: proliferation-associated protein ...    189   8e-55   Pyrus x bretschneideri [bai li]
ref|XP_008388270.1|  PREDICTED: proliferation-associated protein ...    189   8e-55   
ref|XP_008388269.1|  PREDICTED: proliferation-associated protein ...    189   8e-55   Malus domestica [apple tree]
gb|KDP22867.1|  hypothetical protein JCGZ_00454                         189   1e-54   Jatropha curcas
ref|XP_009599304.1|  PREDICTED: proliferation-associated protein ...    189   1e-54   Nicotiana tomentosiformis
gb|ACU19222.1|  unknown                                                 184   2e-54   Glycine max [soybeans]
gb|ABK95017.1|  unknown                                                 189   2e-54   Populus trichocarpa [western balsam poplar]
ref|XP_002308228.2|  hypothetical protein POPTR_0006s10320g             188   2e-54   
ref|XP_004240407.1|  PREDICTED: proliferation-associated protein ...    188   2e-54   Solanum lycopersicum
ref|XP_006344058.1|  PREDICTED: proliferation-associated protein ...    188   2e-54   Solanum tuberosum [potatoes]
ref|XP_010321752.1|  PREDICTED: proliferation-associated protein ...    188   3e-54   Solanum lycopersicum
ref|XP_004489059.1|  PREDICTED: proliferation-associated protein ...    188   3e-54   Cicer arietinum [garbanzo]
ref|XP_006344057.1|  PREDICTED: proliferation-associated protein ...    188   3e-54   Solanum tuberosum [potatoes]
ref|XP_008362268.1|  PREDICTED: proliferation-associated protein ...    188   3e-54   Malus domestica [apple tree]
ref|XP_009599303.1|  PREDICTED: proliferation-associated protein ...    189   4e-54   Nicotiana tomentosiformis
ref|XP_003516956.1|  PREDICTED: proliferation-associated protein 2G4    187   4e-54   Glycine max [soybeans]
gb|ABF66654.1|  EBP1                                                    187   5e-54   Ammopiptanthus mongolicus
ref|XP_010650887.1|  PREDICTED: proliferation-associated protein ...    187   6e-54   
ref|XP_002530504.1|  proliferation-associated 2g4, putative             187   6e-54   Ricinus communis
ref|NP_001275188.1|  EBP1                                               187   6e-54   Solanum tuberosum [potatoes]
ref|XP_002278744.2|  PREDICTED: proliferation-associated protein ...    187   7e-54   Vitis vinifera
ref|XP_010264591.1|  PREDICTED: proliferation-associated protein ...    187   9e-54   Nelumbo nucifera [Indian lotus]
ref|XP_006576221.1|  PREDICTED: uncharacterized protein LOC100784...    187   1e-53   
ref|NP_001242070.1|  uncharacterized protein LOC100784176               186   1e-53   
gb|KDO56711.1|  hypothetical protein CISIN_1g016183mg                   186   1e-53   Citrus sinensis [apfelsine]
ref|XP_009384793.1|  PREDICTED: proliferation-associated protein ...    186   2e-53   Musa acuminata subsp. malaccensis [pisang utan]
gb|KEH38647.1|  proliferation-associated 2G4-like protein               186   2e-53   Medicago truncatula
ref|XP_006429434.1|  hypothetical protein CICLE_v10011909mg             186   2e-53   
ref|XP_010553237.1|  PREDICTED: proliferation-associated protein ...    186   2e-53   Tarenaya hassleriana [spider flower]
gb|KHN42848.1|  Proliferation-associated protein 2G4                    186   2e-53   Glycine soja [wild soybean]
ref|XP_004489058.1|  PREDICTED: proliferation-associated protein ...    188   2e-53   
ref|XP_007026647.1|  Metallopeptidase M24 family protein isoform 2      183   2e-53   
emb|CDP09213.1|  unnamed protein product                                186   2e-53   Coffea canephora [robusta coffee]
ref|XP_010529897.1|  PREDICTED: proliferation-associated protein ...    186   2e-53   Tarenaya hassleriana [spider flower]
ref|XP_011046861.1|  PREDICTED: proliferation-associated protein ...    185   5e-53   Populus euphratica
ref|XP_008464212.1|  PREDICTED: proliferation-associated protein ...    186   6e-53   Cucumis melo [Oriental melon]
gb|ACJ85304.1|  unknown                                                 184   7e-53   Medicago truncatula
ref|XP_003623305.1|  Proliferation-associated protein 2G4               184   8e-53   Medicago truncatula
gb|EYU26681.1|  hypothetical protein MIMGU_mgv1a007877mg                184   1e-52   Erythranthe guttata [common monkey flower]
gb|KJB17056.1|  hypothetical protein B456_002G262700                    181   1e-52   Gossypium raimondii
ref|XP_011019082.1|  PREDICTED: proliferation-associated protein ...    184   1e-52   Populus euphratica
gb|KHN39558.1|  Proliferation-associated protein 2G4                    184   1e-52   Glycine soja [wild soybean]
ref|XP_004492468.1|  PREDICTED: proliferation-associated protein ...    184   1e-52   Cicer arietinum [garbanzo]
ref|XP_003529167.1|  PREDICTED: proliferation-associated protein 2G4    184   1e-52   Glycine max [soybeans]
ref|XP_007140243.1|  hypothetical protein PHAVU_008G095900g             184   1e-52   Phaseolus vulgaris [French bean]
gb|AHA84129.1|  DNA-binding protein GBP16                               184   2e-52   Phaseolus vulgaris [French bean]
ref|NP_001241588.1|  uncharacterized protein LOC100781302               183   2e-52   Glycine max [soybeans]
ref|XP_007140242.1|  hypothetical protein PHAVU_008G095800g             183   2e-52   Phaseolus vulgaris [French bean]
gb|AEY75257.1|  putative DNA binding protein                            183   3e-52   Atriplex canescens [shadscale]
ref|XP_010676777.1|  PREDICTED: proliferation-associated protein 2G4    183   3e-52   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007026646.1|  Metallopeptidase M24 family protein isoform 1      182   4e-52   
gb|KJB36946.1|  hypothetical protein B456_006G183700                    182   5e-52   Gossypium raimondii
gb|KJB36944.1|  hypothetical protein B456_006G183700                    182   5e-52   Gossypium raimondii
gb|AGV54689.1|  proliferation-associated protein 2G4-like protein       182   5e-52   Phaseolus vulgaris [French bean]
gb|AAF91445.1|AF281652_1  putative DNA binding protein                  182   6e-52   Atriplex hortensis
gb|KJB17053.1|  hypothetical protein B456_002G262700                    181   1e-51   Gossypium raimondii
gb|EYU41925.1|  hypothetical protein MIMGU_mgv1a007938mg                181   1e-51   Erythranthe guttata [common monkey flower]
ref|XP_008805004.1|  PREDICTED: proliferation-associated protein ...    181   1e-51   Phoenix dactylifera
ref|XP_008656355.1|  PREDICTED: proliferation-associated protein ...    175   2e-51   
ref|XP_009402229.1|  PREDICTED: proliferation-associated protein ...    181   2e-51   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002322994.2|  hypothetical protein POPTR_0016s12720g             180   2e-51   
ref|XP_010937887.1|  PREDICTED: proliferation-associated protein ...    180   4e-51   Elaeis guineensis
gb|ABR26103.1|  proliferation-associated protein 2g4                    175   4e-51   Oryza sativa Indica Group [Indian rice]
gb|KHG01253.1|  Proliferation-associated 2G4                            180   4e-51   Gossypium arboreum [tree cotton]
gb|KHG25370.1|  Proliferation-associated 2G4                            180   4e-51   Gossypium arboreum [tree cotton]
ref|XP_010920808.1|  PREDICTED: proliferation-associated protein ...    180   5e-51   Elaeis guineensis
gb|EPS71863.1|  hypothetical protein M569_02886                         179   5e-51   Genlisea aurea
ref|XP_006843644.1|  hypothetical protein AMTR_s00007p00167240          177   7e-51   
ref|XP_010920804.1|  PREDICTED: proliferation-associated protein ...    179   1e-50   
ref|XP_008789134.1|  PREDICTED: proliferation-associated protein ...    177   3e-50   Phoenix dactylifera
ref|XP_010092793.1|  Proliferation-associated protein 2G4               178   3e-50   
ref|XP_009123761.1|  PREDICTED: proliferation-associated protein ...    177   6e-50   Brassica rapa
ref|XP_010515611.1|  PREDICTED: proliferation-associated protein ...    176   1e-49   Camelina sativa [gold-of-pleasure]
emb|CDX73690.1|  BnaC08g23130D                                          176   1e-49   
ref|XP_009136636.1|  PREDICTED: proliferation-associated protein ...    176   1e-49   Brassica rapa
emb|CDY33263.1|  BnaA01g19300D                                          176   1e-49   Brassica napus [oilseed rape]
emb|CDX90633.1|  BnaA03g41480D                                          176   1e-49   
ref|XP_004962368.1|  PREDICTED: proliferation-associated protein ...    176   2e-49   Setaria italica
ref|XP_009115883.1|  PREDICTED: proliferation-associated protein ...    175   2e-49   Brassica rapa
ref|XP_009115882.1|  PREDICTED: proliferation-associated protein ...    175   2e-49   Brassica rapa
ref|XP_010907411.1|  PREDICTED: proliferation-associated protein ...    175   2e-49   Elaeis guineensis
ref|XP_010426749.1|  PREDICTED: proliferation-associated protein ...    175   2e-49   Camelina sativa [gold-of-pleasure]
gb|KFK34423.1|  hypothetical protein AALP_AA5G142900                    175   2e-49   Arabis alpina [alpine rockcress]
ref|XP_004302550.1|  PREDICTED: proliferation-associated protein 2G4    175   2e-49   Fragaria vesca subsp. vesca
gb|AAB80919.1|  DNA-binding protein GBP16                               175   2e-49   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002440927.1|  hypothetical protein SORBIDRAFT_09g016610          175   3e-49   Sorghum bicolor [broomcorn]
emb|CDY16291.1|  BnaC01g23260D                                          175   3e-49   Brassica napus [oilseed rape]
gb|EAY97646.1|  hypothetical protein OsI_19569                          175   3e-49   Oryza sativa Indica Group [Indian rice]
ref|NP_001055274.1|  Os05g0350500                                       175   4e-49   
ref|XP_003568643.1|  PREDICTED: proliferation-associated protein 2G4    174   5e-49   Brachypodium distachyon [annual false brome]
ref|XP_006403880.1|  hypothetical protein EUTSA_v10010435mg             174   6e-49   Eutrema salsugineum [saltwater cress]
gb|ADK78215.1|  methionine aminopeptiase                                174   9e-49   Hordeum vulgare [barley]
emb|CDX78041.1|  BnaA09g32360D                                          174   1e-48   
ref|XP_010503881.1|  PREDICTED: proliferation-associated protein ...    173   2e-48   Camelina sativa [gold-of-pleasure]
ref|XP_008792800.1|  PREDICTED: proliferation-associated protein ...    173   2e-48   Phoenix dactylifera
dbj|BAH19507.1|  AT3G51800                                              172   2e-48   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001190060.1|  putative nuclear DNA-binding protein G2p           172   2e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006654286.1|  PREDICTED: proliferation-associated protein ...    172   2e-48   Oryza brachyantha
ref|XP_002877825.1|  hypothetical protein ARALYDRAFT_906530             172   3e-48   Arabidopsis lyrata subsp. lyrata
ref|NP_190748.1|  putative nuclear DNA-binding protein G2p              172   3e-48   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001149216.1|  proliferation-associated protein 2G4               172   4e-48   Zea mays [maize]
ref|NP_850679.1|  putative nuclear DNA-binding protein G2p              172   5e-48   Arabidopsis thaliana [mouse-ear cress]
emb|CDY29047.1|  BnaC07g32530D                                          171   5e-48   Brassica napus [oilseed rape]
gb|EMT31637.1|  Proliferation-associated protein 2G4                    173   6e-48   
gb|AFG29445.1|  Erb3 binding protein                                    171   7e-48   Nervilia fordii
gb|AAK25936.1|AF360226_1  putative nuclear DNA-binding protein G2p      171   1e-47   Arabidopsis thaliana [mouse-ear cress]
gb|EMS60472.1|  Proliferation-associated protein 2G4                    173   1e-47   Triticum urartu
ref|XP_006291295.1|  hypothetical protein CARUB_v10017431mg             170   1e-47   
ref|XP_011095038.1|  PREDICTED: proliferation-associated protein ...    169   4e-47   Sesamum indicum [beniseed]
ref|XP_011077533.1|  PREDICTED: proliferation-associated protein ...    168   2e-46   Sesamum indicum [beniseed]
ref|XP_010253797.1|  PREDICTED: proliferation-associated protein ...    167   2e-46   Nelumbo nucifera [Indian lotus]
gb|ABK24337.1|  unknown                                                 166   6e-46   Picea sitchensis
gb|EEE63363.1|  hypothetical protein OsJ_18175                          155   6e-42   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001779761.1|  predicted protein                                  155   6e-42   
ref|XP_001769950.1|  predicted protein                                  153   4e-41   
ref|XP_002963479.1|  hypothetical protein SELMODRAFT_79780              147   1e-38   
ref|XP_002988189.1|  hypothetical protein SELMODRAFT_127648             146   1e-38   
ref|XP_010920806.1|  PREDICTED: proliferation-associated protein ...    137   9e-35   
ref|XP_008792832.1|  PREDICTED: proliferation-associated protein ...    132   3e-33   
ref|XP_009799003.1|  PREDICTED: LOW QUALITY PROTEIN: proliferatio...    129   4e-32   Nicotiana sylvestris
gb|KJB36945.1|  hypothetical protein B456_006G183700                    127   1e-31   Gossypium raimondii
ref|XP_001765994.1|  predicted protein                                  122   2e-29   
gb|KHN18040.1|  Proliferation-associated protein 2G4                    110   7e-27   Glycine soja [wild soybean]
ref|XP_002947167.1|  hypothetical protein VOLCADRAFT_79596              114   1e-26   Volvox carteri f. nagariensis
ref|XP_002775231.1|  proliferation-associated protein 2G4 metallo...    111   8e-26   Perkinsus marinus ATCC 50983
gb|KHN20321.1|  Proliferation-associated protein 2G4                    107   1e-25   Glycine soja [wild soybean]
ref|XP_004148633.1|  PREDICTED: LOW QUALITY PROTEIN: proliferatio...    108   4e-25   
ref|XP_002772853.1|  Curved DNA-binding protein, putative               107   7e-25   Perkinsus marinus ATCC 50983
ref|XP_001699126.1|  hypothetical protein CHLREDRAFT_139416             106   5e-24   Chlamydomonas reinhardtii
ref|XP_002772849.1|  proliferation-associated protein 2G4 metallo...    106   6e-24   Perkinsus marinus ATCC 50983
ref|XP_007253393.1|  PREDICTED: proliferation-associated protein ...    106   7e-24   Astyanax mexicanus [blind cave fish]
ref|XP_002423336.1|  Proliferation-associated protein 2G4, putative     106   8e-24   Pediculus humanus corporis [human body lice]
ref|XP_003062941.1|  predicted protein                                  104   2e-23   Micromonas pusilla CCMP1545
ref|NP_001002070.1|  proliferation-associated 2G4, a                    104   3e-23   Danio rerio [leopard danio]
gb|KIZ00762.1|  hypothetical protein MNEG_7198                          103   6e-23   Monoraphidium neglectum
gb|ADX97052.1|  proliferation-associated protein 2g4                    103   6e-23   Perca flavescens
ref|XP_002508417.1|  predicted protein                                  102   1e-22   Micromonas commoda
ref|XP_002047403.1|  GJ11948                                            102   2e-22   Drosophila virilis
ref|XP_008294311.1|  PREDICTED: proliferation-associated protein 2G4    102   2e-22   Stegastes partitus
ref|XP_004544946.1|  PREDICTED: proliferation-associated protein ...    102   2e-22   Maylandia zebra
ref|XP_010747198.1|  PREDICTED: proliferation-associated protein 2G4    102   2e-22   Larimichthys crocea [croceine croaker]
ref|XP_003448224.1|  PREDICTED: proliferation-associated protein ...    101   3e-22   Oreochromis niloticus
ref|XP_003441515.1|  PREDICTED: proliferation-associated protein ...    101   4e-22   Oreochromis niloticus
ref|XP_004558839.1|  PREDICTED: proliferation-associated protein ...    101   4e-22   Maylandia zebra
ref|XP_001984453.1|  GH15010                                            101   4e-22   Drosophila grimshawi
ref|XP_006807648.1|  PREDICTED: proliferation-associated protein ...    101   4e-22   Neolamprologus brichardi [lyretail cichlid]
ref|XP_004085494.1|  PREDICTED: proliferation-associated protein ...    101   5e-22   Oryzias latipes [Japanese rice fish]
emb|CAG06775.1|  unnamed protein product                                100   5e-22   Tetraodon nigroviridis
ref|XP_008318205.1|  PREDICTED: proliferation-associated protein ...    100   6e-22   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_010764812.1|  PREDICTED: proliferation-associated protein 2G4    100   6e-22   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_001957516.1|  GF10449                                            100   7e-22   Drosophila ananassae
ref|XP_005741395.1|  PREDICTED: proliferation-associated protein ...    100   8e-22   Pundamilia nyererei
ref|XP_008317097.1|  PREDICTED: proliferation-associated protein ...    100   8e-22   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_002007862.1|  GI13173                                          99.4    2e-21   Drosophila mojavensis
ref|XP_008877833.1|  DNA-binding protein, 42 kDa                      99.4    2e-21   Aphanomyces invadans
ref|XP_002062021.1|  GK16873                                          99.4    3e-21   Drosophila willistoni
ref|XP_003741970.1|  PREDICTED: proliferation-associated protein ...  99.0    3e-21   Galendromus occidentalis
ref|XP_003973252.1|  PREDICTED: proliferation-associated protein ...  99.0    3e-21   
gb|AAH44287.1|  Pa2g4 protein                                         99.0    3e-21   Xenopus laevis [clawed frog]
ref|XP_001353865.1|  GA10407                                          99.0    3e-21   Drosophila pseudoobscura pseudoobscura
emb|CBK24689.2|  unnamed protein product                              99.0    3e-21   Blastocystis hominis
ref|XP_005311138.1|  PREDICTED: LOW QUALITY PROTEIN: proliferatio...  99.0    3e-21   Chrysemys picta bellii
ref|XP_005533908.1|  PREDICTED: proliferation-associated protein 2G4  99.0    3e-21   Pseudopodoces humilis [Tibetan ground-jay]
gb|AFM85909.1|  proliferation-associated 2G4                          98.6    4e-21   Callorhinchus milii [Australian ghost shark]
ref|XP_008279469.1|  PREDICTED: proliferation-associated protein ...  98.6    4e-21   Stegastes partitus
gb|AFM86347.1|  proliferation-associated 2G4                          98.2    5e-21   Callorhinchus milii [Australian ghost shark]
ref|XP_969584.1|  PREDICTED: proliferation-associated protein 2G4     98.2    5e-21   Tribolium castaneum [rust-red flour beetle]
ref|XP_010907413.1|  PREDICTED: proliferation-associated protein ...  97.8    5e-21   
ref|NP_001279838.1|  proliferation-associated 2G4, 38kDa              98.2    5e-21   Callorhinchus milii [Australian ghost shark]
ref|XP_006629280.1|  PREDICTED: proliferation-associated protein ...  98.2    6e-21   Lepisosteus oculatus
ref|XP_005650680.1|  proliferation-associated protein 1               97.8    7e-21   Coccomyxa subellipsoidea C-169
ref|XP_007556640.1|  PREDICTED: proliferation-associated protein ...  97.8    8e-21   Poecilia formosa
gb|EFX72560.1|  hypothetical protein DAPPUDRAFT_308181                97.8    8e-21   Daphnia pulex
ref|XP_004348044.1|  proliferation-associated 2G4,b                   97.8    8e-21   Capsaspora owczarzaki ATCC 30864
ref|XP_010782747.1|  PREDICTED: proliferation-associated protein ...  97.4    9e-21   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_005801435.1|  PREDICTED: proliferation-associated protein ...  97.4    9e-21   Xiphophorus maculatus
ref|XP_011400941.1|  Proliferation-associated protein A               97.4    9e-21   Auxenochlorella protothecoides
gb|ELT89178.1|  hypothetical protein CAPTEDRAFT_136142                94.0    1e-20   Capitella teleta
gb|KDO24965.1|  hypothetical protein SPRG_20806                       96.7    1e-20   Saprolegnia parasitica CBS 223.65
ref|XP_011180648.1|  PREDICTED: proliferation-associated protein 2G4  97.4    1e-20   Zeugodacus cucurbitae [melon fruit fly]
ref|XP_001363571.1|  PREDICTED: proliferation-associated protein 2G4  97.1    1e-20   Monodelphis domestica
gb|KDO19442.1|  DNA-binding protein                                   97.1    1e-20   Saprolegnia parasitica CBS 223.65
ref|XP_008619458.1|  hypothetical protein SDRG_15074                  97.1    1e-20   Saprolegnia diclina VS20
gb|ETE68956.1|  Proliferation-associated protein 2G4                  96.7    1e-20   Ophiophagus hannah
ref|XP_009041985.1|  hypothetical protein AURANDRAFT_55591            97.1    2e-20   Aureococcus anophagefferens
ref|XP_011209005.1|  PREDICTED: proliferation-associated protein 2G4  97.1    2e-20   Bactrocera dorsalis [papaya fruit fly]
gb|ACI67880.1|  Proliferation-associated protein 2G4                  92.8    2e-20   Salmo salar
ref|XP_009011773.1|  hypothetical protein HELRODRAFT_156370           96.7    2e-20   Helobdella robusta
ref|XP_008411912.1|  PREDICTED: proliferation-associated protein ...  96.7    2e-20   Poecilia reticulata
ref|XP_009839077.1|  DNA-binding protein, 42 kDa                      96.3    2e-20   Aphanomyces astaci
gb|AAV36985.2|  LD30448p                                              96.3    2e-20   Drosophila melanogaster
ref|XP_003880798.1|  methionine aminopeptidase,related                96.7    2e-20   Neospora caninum Liverpool
ref|XP_002083760.1|  GD13178                                          96.3    3e-20   Drosophila simulans
ref|XP_002035467.1|  GM13901                                          96.3    3e-20   Drosophila sechellia
ref|XP_002093823.1|  GE20541                                          96.3    3e-20   Drosophila yakuba
ref|XP_001972015.1|  GG14116                                          96.3    3e-20   Drosophila erecta
ref|NP_647984.1|  CG10576, isoform A                                  96.3    3e-20   Drosophila melanogaster
ref|XP_003223249.1|  PREDICTED: proliferation-associated protein 2G4  96.3    3e-20   Anolis carolinensis [Carolina anole]
ref|XP_004525166.1|  PREDICTED: proliferation-associated protein ...  96.3    3e-20   Ceratitis capitata [medfly]
emb|CDQ89185.1|  unnamed protein product                              95.9    3e-20   Oncorhynchus mykiss
emb|CAJ82581.1|  proliferation-associated 2G4                         95.5    4e-20   Xenopus tropicalis [western clawed frog]
gb|KFB44440.1|  AGAP005108-PA-like protein                            96.3    4e-20   Anopheles sinensis
ref|NP_001008439.1|  ErbB3-binding protein 1                          95.5    5e-20   Xenopus tropicalis [western clawed frog]
gb|ACI33074.1|  Proliferation-associated protein 2G4                  95.5    5e-20   Salmo salar
ref|NP_001083993.1|  proliferation-associated 2G4, 38kD               95.5    5e-20   Xenopus laevis [clawed frog]
gb|EFA84439.1|  proliferation associated protein                      95.5    5e-20   Heterostelium album PN500
ref|XP_313985.4|  AGAP005108-PA                                       95.5    5e-20   Anopheles gambiae str. PEST
ref|XP_007238523.1|  PREDICTED: proliferation-associated protein ...  94.4    6e-20   
emb|CDQ74715.1|  unnamed protein product                              95.1    7e-20   Oncorhynchus mykiss
ref|XP_005184671.1|  PREDICTED: proliferation-associated protein 2G4  95.1    8e-20   Musca domestica
ref|XP_780193.1|  PREDICTED: proliferation-associated protein 2G4...  95.1    8e-20   Strongylocentrotus purpuratus [purple urchin]
ref|XP_006011099.1|  PREDICTED: proliferation-associated protein ...  95.1    8e-20   
ref|XP_002182273.1|  predicted protein                                94.7    1e-19   Phaeodactylum tricornutum CCAP 1055/1
ref|XP_010745944.1|  PREDICTED: proliferation-associated protein ...  94.7    1e-19   Larimichthys crocea [croceine croaker]
ref|NP_001085830.1|  ErbB3-binding protein 1                          94.7    1e-19   Xenopus laevis [clawed frog]
gb|ACI68772.1|  Proliferation-associated protein 2G4                  93.6    1e-19   Salmo salar
ref|XP_004070502.1|  PREDICTED: proliferation-associated protein ...  94.4    1e-19   Oryzias latipes [Japanese rice fish]
emb|CDQ85755.1|  unnamed protein product                              94.4    1e-19   Oncorhynchus mykiss
ref|XP_005655650.1|  PREDICTED: proliferation-associated protein 2G4  91.7    1e-19   
ref|XP_002605416.1|  hypothetical protein BRAFLDRAFT_278505           94.0    1e-19   Branchiostoma floridae
ref|XP_010879916.1|  PREDICTED: proliferation-associated protein ...  94.4    1e-19   Esox lucius
gb|ACI33868.1|  Proliferation-associated protein 2G4                  94.0    2e-19   Salmo salar
emb|CAG07405.1|  unnamed protein product                              94.4    2e-19   Tetraodon nigroviridis
ref|XP_005335677.1|  PREDICTED: proliferation-associated protein 2G4  94.0    2e-19   Ictidomys tridecemlineatus
gb|AEE62360.1|  unknown                                               94.0    2e-19   Dendroctonus ponderosae
ref|XP_003963121.1|  PREDICTED: proliferation-associated protein ...  94.0    2e-19   Takifugu rubripes [tiger puffer]
gb|EGT51094.1|  hypothetical protein CAEBREN_32580                    91.7    2e-19   Caenorhabditis brenneri
gb|ENN76413.1|  hypothetical protein YQE_07074                        93.6    2e-19   Dendroctonus ponderosae
ref|XP_009039553.1|  hypothetical protein AURANDRAFT_54512            93.6    2e-19   Aureococcus anophagefferens
emb|CDQ78322.1|  unnamed protein product                              94.0    2e-19   Oncorhynchus mykiss
ref|XP_005371237.1|  PREDICTED: proliferation-associated protein 2G4  93.6    2e-19   Microtus ochrogaster [prairie voles]
gb|ELT99251.1|  hypothetical protein CAPTEDRAFT_152656                93.6    2e-19   Capitella teleta
ref|XP_008472310.1|  PREDICTED: proliferation-associated protein 2G4  93.6    2e-19   Diaphorina citri
ref|XP_011059200.1|  PREDICTED: proliferation-associated protein 2G4  93.6    3e-19   Acromyrmex echinatior
ref|XP_003383390.1|  PREDICTED: proliferation-associated protein ...  93.6    3e-19   Amphimedon queenslandica
ref|XP_011173347.1|  PREDICTED: proliferation-associated protein 2G4  93.2    3e-19   Solenopsis invicta [imported red fire ant]
ref|XP_003689614.1|  PREDICTED: proliferation-associated protein ...  93.2    3e-19   Apis florea [dwarf honeybee]
ref|XP_003703942.1|  PREDICTED: proliferation-associated protein ...  93.2    4e-19   Megachile rotundata
ref|XP_007533407.1|  PREDICTED: proliferation-associated protein 2G4  92.8    4e-19   Erinaceus europaeus [common hedgehog]
emb|CDJ02959.1|  Proliferation associated protein 2G4                 92.8    4e-19   
gb|ELR50756.1|  Proliferation-associated protein 2G4                  92.8    4e-19   Bos mutus
gb|EFZ09337.1|  hypothetical protein SINV_15911                       93.2    4e-19   
ref|XP_011263181.1|  PREDICTED: proliferation-associated protein 2G4  92.8    4e-19   Camponotus floridanus
ref|XP_002163189.2|  PREDICTED: proliferation-associated protein ...  92.8    4e-19   Hydra vulgaris
emb|CDS15413.1|  Proliferation associated protein 2G4                 92.8    5e-19   Echinococcus granulosus
ref|XP_011340977.1|  PREDICTED: proliferation-associated protein 2G4  92.4    5e-19   Ooceraea biroi
ref|WP_028832180.1|  hypothetical protein                             92.4    6e-19   
ref|XP_008408124.1|  PREDICTED: proliferation-associated protein 2G4  92.0    7e-19   Poecilia reticulata
ref|XP_008887722.1|  proliferation-associated protein 2G4, putative   93.2    8e-19   
ref|XP_006615964.1|  PREDICTED: proliferation-associated protein ...  92.0    8e-19   Apis dorsata [rock honeybee]
ref|XP_003485618.1|  PREDICTED: proliferation-associated protein ...  92.0    8e-19   Bombus impatiens
ref|XP_005799891.1|  PREDICTED: proliferation-associated protein ...  92.0    8e-19   Xiphophorus maculatus
ref|XP_007559711.1|  PREDICTED: proliferation-associated protein 2G4  92.0    8e-19   Poecilia formosa
ref|XP_003394756.1|  PREDICTED: proliferation-associated protein ...  92.0    9e-19   Bombus terrestris [large earth bumblebee]
gb|EPZ31276.1|  Peptidase M24, structural domain-containing protein   91.7    1e-18   Rozella allomycis CSF55
ref|XP_005680429.1|  PREDICTED: proliferation-associated protein ...  91.3    1e-18   Capra hircus [domestic goat]
ref|XP_006560659.1|  PREDICTED: proliferation-associated protein ...  91.7    1e-18   Apis mellifera [bee]
gb|KFH72903.1|  hypothetical protein MVEG_00128                       91.7    1e-18   Mortierella verticillata NRRL 6337
gb|AAC34392.1|  PAS1                                                  91.7    1e-18   Takifugu rubripes [tiger puffer]
gb|ERL94099.1|  hypothetical protein D910_11381                       94.0    1e-18   Dendroctonus ponderosae
gb|ACO10060.1|  Proliferation-associated protein 2G4                  91.3    1e-18   Osmerus mordax
ref|XP_006179892.1|  PREDICTED: proliferation-associated protein 2G4  91.3    1e-18   Camelus ferus
ref|XP_004274221.1|  PREDICTED: proliferation-associated protein 2G4  91.3    2e-18   
ref|XP_006908945.1|  PREDICTED: proliferation-associated protein 2G4  91.3    2e-18   Pteropus alecto
ref|XP_004006644.1|  PREDICTED: proliferation-associated protein 2G4  91.3    2e-18   
ref|XP_001504854.1|  PREDICTED: proliferation-associated protein ...  91.3    2e-18   
ref|NP_001029871.1|  proliferation-associated protein 2G4             91.3    2e-18   
ref|XP_005876787.1|  PREDICTED: proliferation-associated protein 2G4  91.3    2e-18   
ref|XP_002371979.1|  proliferation-associated protein 2G4, putative   91.7    2e-18   
ref|XP_001134549.1|  proliferation associated protein                 90.9    2e-18   
gb|EPR57248.1|  putative proliferation-associated protein 2G4         91.7    2e-18   
gb|KDR23244.1|  Proliferation-associated protein 2G4                  90.9    2e-18   
ref|XP_002141587.1|  proliferation-associated protein 2G4             90.5    3e-18   
ref|XP_005088325.1|  PREDICTED: proliferation-associated protein ...  87.8    3e-18   
ref|XP_010865536.1|  PREDICTED: proliferation-associated protein ...  90.5    3e-18   
ref|XP_004029906.1|  hypothetical protein IMG5_170920                 90.5    3e-18   
gb|KIK41978.1|  hypothetical protein CY34DRAFT_805412                 90.5    3e-18   
gb|KIK93612.1|  hypothetical protein PAXRUDRAFT_144694                90.1    4e-18   
gb|EPT01440.1|  hypothetical protein FOMPIDRAFT_1023315               90.1    4e-18   
ref|XP_004931156.1|  PREDICTED: proliferation-associated protein ...  90.1    4e-18   
ref|XP_003284133.1|  hypothetical protein DICPUDRAFT_52698            90.1    4e-18   
ref|XP_006602676.1|  PREDICTED: proliferation-associated protein ...  85.5    5e-18   
gb|KIJ13451.1|  hypothetical protein PAXINDRAFT_170516                89.7    6e-18   
ref|XP_002675553.1|  methionyl aminopeptidase                         89.4    6e-18   
emb|CCM00103.1|  predicted protein                                    89.7    6e-18   
ref|XP_009225656.1|  curved DNA-binding protein                       89.7    8e-18   
gb|EJK49958.1|  hypothetical protein THAOC_31113                      90.1    8e-18   
ref|XP_004992055.1|  proliferation-associated protein 2G4             89.0    9e-18   
ref|XP_005095772.1|  PREDICTED: proliferation-associated protein ...  89.0    1e-17   
emb|CCI48095.1|  unnamed protein product                              89.0    1e-17   
ref|XP_011502791.1|  PREDICTED: proliferation-associated protein 2G4  88.6    1e-17   
gb|KIJ66985.1|  hypothetical protein HYDPIDRAFT_108958                88.6    1e-17   
ref|XP_011306002.1|  PREDICTED: proliferation-associated protein 2G4  88.6    2e-17   
gb|EHH20847.1|  Cell cycle protein p38-2G4-like protein               88.6    2e-17   
ref|XP_004861453.1|  PREDICTED: proliferation-associated protein 2G4  87.4    2e-17   
ref|XP_002734317.1|  PREDICTED: proliferation-associated protein ...  88.6    2e-17   
ref|XP_005705833.1|  DNA binding protein                              88.6    2e-17   
ref|XP_009533169.1|  methionine aminopeptidase, merops subfamily M24  88.6    2e-17   
gb|ELK15270.1|  Proliferation-associated protein 2G4                  90.5    2e-17   
gb|EQB77766.1|  hypothetical protein CB1_000449019                    90.1    2e-17   
ref|XP_002634083.1|  Hypothetical protein CBG01629                    88.2    2e-17   
emb|CEG00817.1|  Peptidase M24, methionine aminopeptidase             87.8    2e-17   
dbj|BAM19228.1|  proliferation-associated 2g4                         87.8    2e-17   
gb|AAB03665.1|  PrlA                                                  87.8    2e-17   
gb|EDL84837.1|  proliferation-associated 2G4, isoform CRA_b           87.4    3e-17   
ref|XP_007318509.1|  hypothetical protein SERLADRAFT_467890           88.2    3e-17   
emb|CCA18784.1|  proliferationassociated protein putative             87.8    3e-17   
dbj|GAM23516.1|  hypothetical protein SAMD00019534_066910             87.8    3e-17   
gb|ACO15498.1|  Proliferation-associated protein 2G4                  87.4    3e-17   
ref|XP_003506238.1|  PREDICTED: proliferation-associated protein 2G4  87.8    3e-17   
ref|XP_006987432.1|  PREDICTED: proliferation-associated protein 2G4  87.4    3e-17   
emb|CDO70649.1|  hypothetical protein BN946_scf184756.g16             87.8    3e-17   
dbj|BAF84485.1|  unnamed protein product                              87.4    3e-17   
ref|XP_008066667.1|  PREDICTED: proliferation-associated protein 2G4  87.4    3e-17   
gb|AAH03777.1|  Pa2g4 protein                                         87.4    3e-17   
ref|XP_005397344.1|  PREDICTED: proliferation-associated protein 2G4  87.8    3e-17   
gb|AAH32111.1|  PA2G4 protein                                         87.4    3e-17   
gb|ETO03829.1|  aminopeptidase/ metalloexopeptidase                   85.5    4e-17   
ref|XP_001865752.1|  proliferation-associated 2g4                     88.2    4e-17   
ref|XP_004700624.1|  PREDICTED: proliferation-associated protein 2G4  87.4    4e-17   
ref|XP_001662411.1|  AAEL012312-PA                                    88.2    4e-17   
ref|XP_003084394.1|  putative DNA-binding protein GBP16 (ISS)         87.0    4e-17   
ref|XP_007393682.1|  hypothetical protein PHACADRAFT_252626           87.4    4e-17   
ref|NP_035249.1|  proliferation-associated protein 2G4                87.4    4e-17   
ref|NP_997806.1|  proliferation-associated 2G4-like                   87.4    4e-17   
ref|XP_011154366.1|  PREDICTED: proliferation-associated protein 2G4  87.4    4e-17   
ref|XP_007869056.1|  proliferation-associated protein 1               87.4    4e-17   
ref|XP_002752647.1|  PREDICTED: proliferation-associated protein 2G4  87.4    4e-17   
ref|XP_009179195.1|  PREDICTED: proliferation-associated protein 2G4  87.0    4e-17   
ref|XP_008846918.1|  PREDICTED: proliferation-associated protein 2G4  87.4    5e-17   
ref|XP_006897700.1|  PREDICTED: proliferation-associated protein 2G4  87.4    5e-17   
ref|XP_002711114.1|  PREDICTED: proliferation-associated protein 2G4  87.4    5e-17   
ref|XP_004589712.1|  PREDICTED: proliferation-associated protein 2G4  87.4    5e-17   
ref|XP_006165654.1|  PREDICTED: proliferation-associated protein 2G4  87.4    5e-17   
ref|NP_001004206.1|  proliferation-associated protein 2G4             87.4    5e-17   
ref|NP_001271715.1|  uncharacterized protein LOC101867185             87.4    5e-17   
ref|XP_010643016.1|  PREDICTED: proliferation-associated protein 2G4  87.4    5e-17   
ref|XP_004601656.1|  PREDICTED: proliferation-associated protein 2G4  87.4    5e-17   
dbj|BAE25986.1|  unnamed protein product                              87.4    5e-17   
ref|XP_004093117.1|  PREDICTED: LOW QUALITY PROTEIN: proliferatio...  87.4    5e-17   
ref|XP_003476243.1|  PREDICTED: proliferation-associated protein 2G4  87.4    5e-17   
ref|NP_006182.2|  proliferation-associated protein 2G4                87.4    5e-17   
ref|NP_001124717.1|  proliferation-associated protein 2G4             87.4    5e-17   
ref|XP_004379999.1|  PREDICTED: proliferation-associated protein 2G4  87.0    5e-17   
ref|XP_010348255.1|  PREDICTED: proliferation-associated protein 2G4  87.0    5e-17   
ref|XP_006859475.1|  PREDICTED: proliferation-associated protein 2G4  87.0    5e-17   
gb|AAB91536.1|  cell cycle protein p38-2G4 homolog                    87.0    5e-17   
ref|XP_003405168.1|  PREDICTED: proliferation-associated protein 2G4  87.0    5e-17   
gb|KDQ14341.1|  hypothetical protein BOTBODRAFT_55496                 87.0    5e-17   
gb|KII67501.1|  Proliferation-associated protein 2G4                  87.0    5e-17   
ref|XP_007953297.1|  PREDICTED: proliferation-associated protein 2G4  87.0    5e-17   
pdb|2Q8K|A  Chain A, The Crystal Structure Of Ebp1                    87.0    5e-17   
ref|XP_001880628.1|  predicted protein                                87.0    6e-17   
ref|XP_004466155.1|  PREDICTED: LOW QUALITY PROTEIN: proliferatio...  87.0    6e-17   
emb|CDS30134.1|  Proliferation associated protein 2G4                 86.7    7e-17   
gb|KIK19701.1|  hypothetical protein PISMIDRAFT_682876                86.7    7e-17   
gb|KIK10054.1|  hypothetical protein K443DRAFT_81565                  87.0    7e-17   
ref|XP_008549132.1|  PREDICTED: proliferation-associated protein 2G4  86.7    7e-17   
ref|XP_005537086.1|  probable DNA binding protein                     87.4    7e-17   
gb|KIK63001.1|  hypothetical protein GYMLUDRAFT_41305                 86.7    7e-17   
gb|KIM39953.1|  hypothetical protein M413DRAFT_446862                 86.7    8e-17   
ref|XP_001647519.1|  predicted protein                                86.7    8e-17   
gb|KDQ24453.1|  hypothetical protein PLEOSDRAFT_1067285               86.7    9e-17   
ref|XP_007262711.1|  proliferation-associated protein 1               86.3    1e-16   
ref|XP_003108289.1|  hypothetical protein CRE_10205                   86.3    1e-16   
ref|XP_002116398.1|  hypothetical protein TRIADDRAFT_64279            86.3    1e-16   
gb|ADT71645.1|  proliferation associated 2G4                          86.3    1e-16   
ref|XP_007362719.1|  proliferation-associated protein 1               86.3    1e-16   
ref|XP_003243126.1|  PREDICTED: proliferation-associated protein ...  85.1    1e-16   
gb|KIO15241.1|  hypothetical protein M404DRAFT_120195                 85.9    1e-16   
ref|XP_004692692.1|  PREDICTED: proliferation-associated protein 2G4  85.9    1e-16   
gb|ETL29090.1|  DNA-binding protein, 42 kDa                           85.9    1e-16   
ref|XP_008912890.1|  DNA-binding protein, 42 kDa                      85.9    2e-16   
gb|ACO12262.1|  Proliferation-associated protein 2G4                  85.9    2e-16   
gb|KDQ57326.1|  hypothetical protein JAAARDRAFT_35952                 85.9    2e-16   
emb|CDW84742.1|  proliferation-associated protein 2g4                 85.5    2e-16   
ref|XP_001010313.1|  metallopeptidase family M24 containing protein   85.1    2e-16   
ref|XP_007299448.1|  proliferation-associated protein 1               85.5    2e-16   
gb|EHJ70953.1|  hypothetical protein KGM_14785                        85.1    3e-16   
ref|XP_009266396.1|  Proliferation-associated protein 2G4             84.7    3e-16   
ref|XP_004355743.1|  proliferation associated protein                 84.7    3e-16   
gb|AAX27414.2|  SJCHGC05984 protein                                   84.7    3e-16   
ref|XP_765891.1|  proliferation-associated protein 2g4                84.7    3e-16   
emb|CAX74794.1|  Proliferation-associated protein 2G4                 84.7    4e-16   
gb|EJU04924.1|  Creatinase/aminopeptidase                             84.7    4e-16   
ref|XP_001422365.1|  predicted protein                                84.3    4e-16   
emb|CAX83116.1|  Proliferation-associated protein 2G4                 84.3    4e-16   
ref|XP_011419861.1|  PREDICTED: proliferation-associated protein ...  84.3    4e-16   
ref|XP_007723115.1|  methionyl aminopeptidase                         85.1    4e-16   
ref|XP_004649070.1|  PREDICTED: LOW QUALITY PROTEIN: proliferatio...  84.7    4e-16   
gb|KFO24578.1|  Proliferation-associated protein 2G4                  86.3    5e-16   
gb|EGT53148.1|  hypothetical protein CAEBREN_04692                    84.3    5e-16   
gb|EGT46940.1|  hypothetical protein CAEBREN_29895                    84.3    5e-16   
gb|ACE74541.1|  p45                                                   84.0    5e-16   
ref|XP_009160571.1|  methionyl aminopeptidase                         84.7    5e-16   
gb|KIM67543.1|  hypothetical protein SCLCIDRAFT_21074                 84.3    5e-16   
ref|XP_001951269.1|  PREDICTED: proliferation-associated protein 2G4  84.3    5e-16   
pdb|2V6C|A  Chain A, Crystal Structure Of Erbb3 Binding Protein 1...  83.6    6e-16   
gb|ERZ97185.1|  hypothetical protein GLOINDRAFT_340272                84.3    6e-16   
ref|XP_007910879.1|  putative curved dna-binding protein              84.3    6e-16   
gb|EJT47335.1|  hypothetical protein A1Q1_03881                       83.6    6e-16   
gb|EKD03418.1|  hypothetical protein A1Q2_02273                       83.6    7e-16   
gb|KEQ99626.1|  hypothetical protein AUEXF2481DRAFT_35538             84.0    8e-16   
ref|XP_007880322.1|  hypothetical protein PFL1_04605                  84.0    8e-16   
ref|XP_004031065.1|  hypothetical protein IMG5_148130                 83.6    8e-16   
ref|NP_500311.1|  Protein W08E12.7                                    83.6    1e-15   
ref|XP_008597452.1|  DNA-binding protein                              84.0    1e-15   
gb|ERT00738.1|  DNA-binding protein, 42 kDa                           84.0    1e-15   
ref|XP_001744838.1|  hypothetical protein                             83.6    1e-15   
gb|ETN66740.1|  proliferation-associated 2g4                          84.0    1e-15   
gb|EHB17641.1|  Proliferation-associated protein 2G4                  80.9    1e-15   
dbj|BAJ87032.1|  predicted protein                                    83.6    1e-15   
gb|EUB65031.1|  Proliferation-associated protein 2G4                  83.6    1e-15   
gb|KJA26400.1|  hypothetical protein HYPSUDRAFT_36719                 83.2    1e-15   
gb|KFG83101.1|  hypothetical protein MANI_006615                      83.2    1e-15   
ref|XP_002900555.1|  proliferation-associated protein, metallopro...  83.2    2e-15   
gb|KEQ89790.1|  Creatinase/aminopeptidase                             83.2    2e-15   
ref|XP_007822009.1|  Peptidase M24, structural domain protein         83.2    2e-15   
dbj|GAN05953.1|  conserved hypothetical protein                       82.8    2e-15   
gb|EPB82512.1|  hypothetical protein HMPREF1544_10765                 82.8    2e-15   
emb|CCW71514.1|  unnamed protein product                              82.8    2e-15   
gb|EGT51482.1|  hypothetical protein CAEBREN_28512                    83.2    2e-15   
gb|AAF04629.2|AF099106_1  p45                                         82.4    2e-15   
gb|KID80031.1|  Peptidase M24, structural domain protein              83.2    2e-15   
gb|KDD75813.1|  hypothetical protein H632_c489p2                      82.4    2e-15   
ref|XP_007410291.1|  hypothetical protein MELLADRAFT_116549           82.8    2e-15   
gb|KIM73267.1|  hypothetical protein PILCRDRAFT_829280                82.4    2e-15   
ref|XP_007383044.1|  proliferation-associated protein 1               82.4    3e-15   
gb|EIE82306.1|  hypothetical protein RO3G_07011                       82.0    3e-15   
emb|CDH53178.1|  proliferation-associated protein 1                   82.0    3e-15   
emb|CCX11103.1|  Similar to Curved DNA-binding protein; acc. no. ...  82.4    3e-15   
gb|EMD34055.1|  hypothetical protein CERSUDRAFT_117563                82.0    3e-15   
ref|XP_006956574.1|  Creatinase/aminopeptidase                        82.0    3e-15   
gb|KIW05574.1|  DNA-binding protein, 42 kDa                           82.0    4e-15   
ref|XP_008084685.1|  Creatinase/aminopeptidase                        82.0    4e-15   
ref|XP_666677.1|  nuclear DNA-binding protein G2p -related            82.0    4e-15   
gb|EFX84375.1|  hypothetical protein DAPPUDRAFT_46898                 82.0    4e-15   
ref|XP_626802.1|  proliferation-associated protein 2G4 metallopro...  81.6    4e-15   
emb|CCG84903.1|  unnamed protein product                              82.0    4e-15   
ref|XP_680568.1|  hypothetical protein AN7299.2                       82.0    4e-15   
emb|CCO30365.1|  Curved DNA-binding protein AltName: Full=42 kDa ...  80.5    4e-15   
ref|XP_007780740.1|  methionyl aminopeptidase                         82.0    4e-15   
ref|XP_006961234.1|  predicted protein                                82.0    5e-15   
emb|CEP13275.1|  hypothetical protein                                 82.0    5e-15   
ref|XP_007342936.1|  proliferation-associated protein 1               82.0    5e-15   
gb|KGQ12825.1|  Curved DNA-binding protein                            82.0    5e-15   
ref|XP_954371.1|  proliferation-associated protein 2g4                81.6    5e-15   
emb|CDS14136.1|  hypothetical protein LRAMOSA06306                    81.3    6e-15   
gb|AAH19222.1|  PA2G4 protein                                         81.6    6e-15   
gb|EHK24663.1|  hypothetical protein TRIVIDRAFT_71961                 81.6    7e-15   
ref|XP_009052849.1|  hypothetical protein LOTGIDRAFT_115903           80.9    7e-15   
gb|KIL90871.1|  methionyl aminopeptidase                              81.3    7e-15   
ref|XP_004829893.1|  proliferation-associated 2g4, putative           81.3    7e-15   
ref|XP_003717269.1|  curved DNA-binding protein                       81.3    8e-15   
gb|EIE80522.1|  DNA-binding protein                                   80.9    8e-15   
emb|CBY43099.1|  unnamed protein product                              77.0    8e-15   
gb|EFX62733.1|  hypothetical protein DAPPUDRAFT_67763                 81.3    8e-15   
gb|EUC64968.1|  42 kDa curved DNA-binding protein                     81.3    8e-15   
gb|EFX83265.1|  hypothetical protein DAPPUDRAFT_315717                80.9    8e-15   
gb|KEP52663.1|  42 kDa curved DNA-binding protein                     81.3    9e-15   
ref|XP_003874194.1|  metallo-peptidase, Clan MG, Family M24           80.9    9e-15   
gb|KIH92167.1|  methionyl aminopeptidase                              81.3    9e-15   
gb|KHN22549.1|  Proliferation-associated protein 2G4                  80.1    9e-15   
ref|XP_003392419.1|  metallo-peptidase, Clan MG, Family M24           80.9    1e-14   
gb|EJY79371.1|  Metallopeptidase family M24 containing protein        80.9    1e-14   
ref|XP_008039729.1|  proliferation-associated protein 1               80.9    1e-14   
gb|KIY67278.1|  proliferation-associated protein 1                    80.9    1e-14   
ref|XP_001402244.1|  curved DNA-binding protein                       80.9    1e-14   
gb|KEQ71987.1|  curved DNA-binding protein-like protein               80.9    1e-14   
gb|KEQ67804.1|  curved DNA-binding protein                            80.9    1e-14   
tpg|DAA34047.1|  TPA: metallopeptidase                                80.1    1e-14   
ref|XP_002290444.1|  DNA-binding protein                              79.7    1e-14   
gb|KFX45625.1|  Curved DNA-binding protein                            80.9    1e-14   
ref|XP_007729945.1|  methionyl aminopeptidase                         80.9    1e-14   
gb|KIO34306.1|  hypothetical protein M407DRAFT_240636                 80.9    1e-14   
gb|KFY73724.1|  hypothetical protein V499_06201                       80.1    1e-14   
ref|XP_007275522.1|  curved dna-binding protein (42 kda protein)      80.5    1e-14   
gb|ELR08951.1|  hypothetical protein GMDG_00569                       80.1    1e-14   
emb|CEL55239.1|  Curved DNA-binding protein OS=Schizosaccharomyce...  80.5    1e-14   
gb|EGU78845.1|  hypothetical protein FOXB_10634                       80.1    2e-14   
ref|XP_007873749.1|  hypothetical protein PNEG_01781                  80.1    2e-14   
emb|CEF70564.1|  Proliferation-associated protein 2G4                 80.1    2e-14   
ref|XP_009689164.1|  proliferation-associated protein 2g4             80.1    2e-14   
gb|EJW79849.1|  DNA-binding protein                                   78.6    2e-14   
gb|EHK47914.1|  hypothetical protein TRIATDRAFT_298169                80.1    2e-14   



>ref|XP_009338145.1| PREDICTED: proliferation-associated protein 2G4-like, partial 
[Pyrus x bretschneideri]
Length=160

 Score =   189 bits (481),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 87/102 (85%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MSDEEREEKELDL+SPEVVTKYKSAAEI+NKAL+LV+S+CKP A++VD+CEKGD++IREQ
Sbjct  1    MSDEEREEKELDLTSPEVVTKYKSAAEIINKALQLVISECKPKAKIVDLCEKGDSYIREQ  60

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            TGN+YKNVKKKIERGVAFPTCISVNNTVCHFSPL++DE+VLE
Sbjct  61   TGNVYKNVKKKIERGVAFPTCISVNNTVCHFSPLASDESVLE  102



>ref|XP_004137704.1| PREDICTED: proliferation-associated protein 2G4-like [Cucumis 
sativus]
 gb|KGN58739.1| EBP1 [Cucumis sativus]
Length=393

 Score =   194 bits (493),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 90/102 (88%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MSDEEREEKELDL+SPEVVTKYKSAAEI NKAL+LV+S+CKP A++VDICEKGD+FIREQ
Sbjct  2    MSDEEREEKELDLTSPEVVTKYKSAAEIANKALQLVISECKPKAKIVDICEKGDSFIREQ  61

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            TGNMYKNVKKKIERGVAFPTCISVNNT+CHFSPLS+DE VLE
Sbjct  62   TGNMYKNVKKKIERGVAFPTCISVNNTICHFSPLSSDETVLE  103



>ref|XP_004156612.1| PREDICTED: LOW QUALITY PROTEIN: proliferation-associated protein 
2G4-like [Cucumis sativus]
Length=395

 Score =   193 bits (490),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 89/102 (87%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MSDEEREEKELDL+SPEVVTKYKSAAEI NKAL+LV+S+CKP A++VDICEKGD+FIREQ
Sbjct  2    MSDEEREEKELDLTSPEVVTKYKSAAEIANKALQLVISECKPKAKIVDICEKGDSFIREQ  61

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            TGNMYKNVKKKIERGVAFPTCISVNNT+CHFSPLS+DE +LE
Sbjct  62   TGNMYKNVKKKIERGVAFPTCISVNNTICHFSPLSSDETLLE  103



>ref|XP_008350687.1| PREDICTED: proliferation-associated protein 2G4-like [Malus domestica]
Length=199

 Score =   187 bits (475),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 86/102 (84%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MSD+EREEKELDL+SPEVVTKYKSAAEI+NKAL+LV+S+CKP A++VD+CEKGD++IREQ
Sbjct  1    MSDDEREEKELDLTSPEVVTKYKSAAEIVNKALQLVISECKPKAKIVDLCEKGDSYIREQ  60

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            TGNMYKN KKKIERGVAFPTCISVNNTVCHFSPL +DE+VLE
Sbjct  61   TGNMYKNAKKKIERGVAFPTCISVNNTVCHFSPLGSDESVLE  102



>ref|XP_008442393.1| PREDICTED: proliferation-associated protein 2G4-like [Cucumis 
melo]
Length=396

 Score =   192 bits (489),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 89/102 (87%), Positives = 98/102 (96%), Gaps = 0/102 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MSDEEREEKELDL+SPEVVTKYKSAAEI NKAL+LV+S+CKP  ++VDICEKGD+FIREQ
Sbjct  2    MSDEEREEKELDLTSPEVVTKYKSAAEIANKALQLVISECKPKTKIVDICEKGDSFIREQ  61

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            TGNMYKNVKKKIERGVAFPTCISVNNT+CHFSPLS+DE VLE
Sbjct  62   TGNMYKNVKKKIERGVAFPTCISVNNTICHFSPLSSDETVLE  103



>ref|XP_007205303.1| hypothetical protein PRUPE_ppa006778mg [Prunus persica]
 ref|XP_007205304.1| hypothetical protein PRUPE_ppa006778mg [Prunus persica]
 ref|XP_008243362.1| PREDICTED: proliferation-associated protein 2G4 [Prunus mume]
 gb|EMJ06502.1| hypothetical protein PRUPE_ppa006778mg [Prunus persica]
 gb|EMJ06503.1| hypothetical protein PRUPE_ppa006778mg [Prunus persica]
Length=395

 Score =   192 bits (487),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 88/102 (86%), Positives = 100/102 (98%), Gaps = 0/102 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MSD+EREEKELDLSSPEVVTKYKSAAEI+NKAL+LV+S+CKP A++VD+CEKGD++IREQ
Sbjct  1    MSDDEREEKELDLSSPEVVTKYKSAAEIVNKALQLVISECKPKAKIVDLCEKGDSYIREQ  60

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPL++DE VLE
Sbjct  61   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLASDETVLE  102



>ref|XP_009789408.1| PREDICTED: proliferation-associated protein 2G4-like [Nicotiana 
sylvestris]
Length=394

 Score =   192 bits (487),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/102 (87%), Positives = 100/102 (98%), Gaps = 0/102 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MSD+EREEKELDL+SPEVVTKYK+AAEI+NKAL+LVVS+CKP A++VD+CEKGDAFI+EQ
Sbjct  1    MSDDEREEKELDLTSPEVVTKYKNAAEIVNKALQLVVSECKPKAKIVDLCEKGDAFIKEQ  60

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLS+DE VLE
Sbjct  61   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSSDETVLE  102



>ref|XP_002262986.2| PREDICTED: proliferation-associated protein 2G4 [Vitis vinifera]
 ref|XP_010653323.1| PREDICTED: proliferation-associated protein 2G4 [Vitis vinifera]
 emb|CBI18248.3| unnamed protein product [Vitis vinifera]
Length=394

 Score =   192 bits (487),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/102 (87%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MSD+EREEKELDL+SPEVVTKYKSAAEI NKAL+LV+S+CKP A++VDICEKGD+FIREQ
Sbjct  1    MSDDEREEKELDLTSPEVVTKYKSAAEIANKALQLVLSECKPKAKIVDICEKGDSFIREQ  60

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPL++DE VLE
Sbjct  61   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLASDETVLE  102



>ref|XP_006381246.1| hypothetical protein POPTR_0006s10320g [Populus trichocarpa]
 gb|ERP59043.1| hypothetical protein POPTR_0006s10320g [Populus trichocarpa]
Length=284

 Score =   188 bits (478),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 84/101 (83%), Positives = 100/101 (99%), Gaps = 0/101 (0%)
 Frame = +3

Query  246  SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQT  425
            SD+EREE+ELDL+SPEV+TKYKSAAEI+NKAL+LV+S+CKP A++VDICEKGD+FIREQT
Sbjct  3    SDDEREERELDLTSPEVITKYKSAAEIVNKALQLVISECKPKAKIVDICEKGDSFIREQT  62

Query  426  GNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            GNMYKNVKKKIERGVAFPTC+SVNNT+CHFSPL++DE+VLE
Sbjct  63   GNMYKNVKKKIERGVAFPTCVSVNNTICHFSPLASDESVLE  103



>ref|XP_010037691.1| PREDICTED: proliferation-associated protein 2G4 [Eucalyptus grandis]
 gb|KCW49439.1| hypothetical protein EUGRSUZ_K02971 [Eucalyptus grandis]
Length=392

 Score =   191 bits (486),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/102 (86%), Positives = 100/102 (98%), Gaps = 0/102 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MSD+EREEKELDL+SP+VVTKYKSAAEI+NKAL+LV+S+CKP A+VVD+CEKGD+FIREQ
Sbjct  1    MSDDEREEKELDLTSPDVVTKYKSAAEIVNKALQLVISECKPKAKVVDVCEKGDSFIREQ  60

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPL++DE VLE
Sbjct  61   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLASDETVLE  102



>ref|XP_008366899.1| PREDICTED: proliferation-associated protein 2G4-like [Malus domestica]
Length=352

 Score =   189 bits (481),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 86/102 (84%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MSD+EREEKELDL+SPEVVTKYKSAAEI+NKAL+LV+S+CKP A++VD+CEKGD++IREQ
Sbjct  1    MSDDEREEKELDLTSPEVVTKYKSAAEIVNKALQLVISECKPKAKIVDLCEKGDSYIREQ  60

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            TGNMYKN KKKIERGVAFPTCISVNNTVCHFSPL +DE+VLE
Sbjct  61   TGNMYKNAKKKIERGVAFPTCISVNNTVCHFSPLGSDESVLE  102



>ref|XP_009599246.1| PREDICTED: proliferation-associated protein 2G4-like [Nicotiana 
tomentosiformis]
Length=394

 Score =   191 bits (484),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 88/102 (86%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MSD+EREEKELDL+SPEVVTKYK AAEI+NKAL+LVVS+CKP +++VD+CEKGDAFI+EQ
Sbjct  1    MSDDEREEKELDLTSPEVVTKYKGAAEIVNKALQLVVSECKPKSKIVDLCEKGDAFIKEQ  60

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLS+DE VLE
Sbjct  61   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSSDETVLE  102



>ref|XP_009376423.1| PREDICTED: proliferation-associated protein 2G4 isoform X2 [Pyrus 
x bretschneideri]
Length=387

 Score =   189 bits (481),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 86/102 (84%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MSD+EREEKELDL+SPEVVTKYKSAAEI+NKAL+LV+S+CKP A++V++CEKGD++IREQ
Sbjct  1    MSDDEREEKELDLTSPEVVTKYKSAAEIVNKALQLVISECKPKAKIVELCEKGDSYIREQ  60

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPL++DE+VLE
Sbjct  61   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLASDESVLE  102



>ref|XP_009773246.1| PREDICTED: proliferation-associated protein 2G4-like [Nicotiana 
sylvestris]
 ref|XP_009773247.1| PREDICTED: proliferation-associated protein 2G4-like [Nicotiana 
sylvestris]
 ref|XP_009773248.1| PREDICTED: proliferation-associated protein 2G4-like [Nicotiana 
sylvestris]
Length=387

 Score =   189 bits (481),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 87/102 (85%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MSD+EREE+E DL+SPEVVTKYKSAAEI+NKAL+LV+S+CKP A++VD+CEKGDAFI+EQ
Sbjct  1    MSDDEREEREFDLTSPEVVTKYKSAAEIVNKALQLVLSECKPKAKIVDLCEKGDAFIKEQ  60

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLS+DE VLE
Sbjct  61   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSSDETVLE  102



>ref|XP_004242516.1| PREDICTED: proliferation-associated protein 2G4-like [Solanum 
lycopersicum]
Length=387

 Score =   189 bits (481),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 87/102 (85%), Positives = 100/102 (98%), Gaps = 0/102 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MSD+EREEKELDL+SPEVVTKYKSAAEI+NKAL+LV+S+CKP A++VD+CEKGDAFI+EQ
Sbjct  1    MSDDEREEKELDLTSPEVVTKYKSAAEIVNKALQLVLSECKPKAKIVDLCEKGDAFIKEQ  60

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPL++DE V+E
Sbjct  61   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLASDETVVE  102



>ref|XP_009376419.1| PREDICTED: proliferation-associated protein 2G4 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009376420.1| PREDICTED: proliferation-associated protein 2G4 isoform X1 [Pyrus 
x bretschneideri]
Length=394

 Score =   189 bits (481),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 86/102 (84%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MSD+EREEKELDL+SPEVVTKYKSAAEI+NKAL+LV+S+CKP A++V++CEKGD++IREQ
Sbjct  1    MSDDEREEKELDLTSPEVVTKYKSAAEIVNKALQLVISECKPKAKIVELCEKGDSYIREQ  60

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPL++DE+VLE
Sbjct  61   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLASDESVLE  102



>ref|XP_008388270.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X2 [Malus domestica]
Length=388

 Score =   189 bits (481),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 86/102 (84%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MSD+EREEKELDL+SPEVVTKYKSAAEI+NKAL+LV+S+CKP A++VD+CEKGD++IREQ
Sbjct  1    MSDDEREEKELDLTSPEVVTKYKSAAEIVNKALQLVISECKPKAKIVDLCEKGDSYIREQ  60

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            TGNMYKN KKKIERGVAFPTCISVNNTVCHFSPL +DE+VLE
Sbjct  61   TGNMYKNAKKKIERGVAFPTCISVNNTVCHFSPLGSDESVLE  102



>ref|XP_008388269.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X1 [Malus domestica]
Length=395

 Score =   189 bits (481),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 86/102 (84%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MSD+EREEKELDL+SPEVVTKYKSAAEI+NKAL+LV+S+CKP A++VD+CEKGD++IREQ
Sbjct  1    MSDDEREEKELDLTSPEVVTKYKSAAEIVNKALQLVISECKPKAKIVDLCEKGDSYIREQ  60

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            TGNMYKN KKKIERGVAFPTCISVNNTVCHFSPL +DE+VLE
Sbjct  61   TGNMYKNAKKKIERGVAFPTCISVNNTVCHFSPLGSDESVLE  102



>gb|KDP22867.1| hypothetical protein JCGZ_00454 [Jatropha curcas]
Length=396

 Score =   189 bits (480),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 86/102 (84%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MSD+EREEKELDL+SPEVVTKYKSAAEI+NKAL+LV+S CKP A++VD+CEKGD +IREQ
Sbjct  1    MSDDEREEKELDLTSPEVVTKYKSAAEIVNKALQLVISGCKPKAKIVDLCEKGDTYIREQ  60

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            TGNMYKNVKKKIERGVAFPTC+SVNNTVCHFSPL++DE+VLE
Sbjct  61   TGNMYKNVKKKIERGVAFPTCVSVNNTVCHFSPLASDESVLE  102



>ref|XP_009599304.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X2 [Nicotiana tomentosiformis]
 ref|XP_009599305.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X2 [Nicotiana tomentosiformis]
Length=387

 Score =   189 bits (479),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 87/102 (85%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MSD+EREE+ELDL+SPEVVTKYKSAAEI+NKAL+LV+S+CKP A++VD+CEKGDAFI+EQ
Sbjct  1    MSDDEREERELDLTSPEVVTKYKSAAEIVNKALQLVLSECKPKAKIVDLCEKGDAFIKEQ  60

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLS+DE  LE
Sbjct  61   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSSDETSLE  102



>gb|ACU19222.1| unknown [Glycine max]
Length=219

 Score =   184 bits (466),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 84/102 (82%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MSD+EREEKELDLSS EVVTKYK+AAEI+NKAL+LV+S+CKP A++VDICEKGD++IREQ
Sbjct  1    MSDDEREEKELDLSSAEVVTKYKTAAEIVNKALKLVISECKPKAKIVDICEKGDSYIREQ  60

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            TGN+YKNVK+KIERGVAFPTC+SVNN VCHFSPL++DEAVLE
Sbjct  61   TGNVYKNVKRKIERGVAFPTCLSVNNVVCHFSPLASDEAVLE  102



>gb|ABK95017.1| unknown [Populus trichocarpa]
Length=396

 Score =   189 bits (479),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 84/101 (83%), Positives = 100/101 (99%), Gaps = 0/101 (0%)
 Frame = +3

Query  246  SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQT  425
            SD+EREE+ELDL+SPEV+TKYKSAAEI+NKAL+LV+S+CKP A++VDICEKGD+FIREQT
Sbjct  3    SDDEREERELDLTSPEVITKYKSAAEIVNKALQLVISECKPKAKIVDICEKGDSFIREQT  62

Query  426  GNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            GNMYKNVKKKIERGVAFPTC+SVNNT+CHFSPL++DE+VLE
Sbjct  63   GNMYKNVKKKIERGVAFPTCVSVNNTICHFSPLASDESVLE  103



>ref|XP_002308228.2| hypothetical protein POPTR_0006s10320g [Populus trichocarpa]
 gb|EEE91751.2| hypothetical protein POPTR_0006s10320g [Populus trichocarpa]
Length=398

 Score =   188 bits (478),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 84/101 (83%), Positives = 100/101 (99%), Gaps = 0/101 (0%)
 Frame = +3

Query  246  SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQT  425
            SD+EREE+ELDL+SPEV+TKYKSAAEI+NKAL+LV+S+CKP A++VDICEKGD+FIREQT
Sbjct  3    SDDEREERELDLTSPEVITKYKSAAEIVNKALQLVISECKPKAKIVDICEKGDSFIREQT  62

Query  426  GNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            GNMYKNVKKKIERGVAFPTC+SVNNT+CHFSPL++DE+VLE
Sbjct  63   GNMYKNVKKKIERGVAFPTCVSVNNTICHFSPLASDESVLE  103



>ref|XP_004240407.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X2 [Solanum lycopersicum]
Length=390

 Score =   188 bits (478),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/102 (86%), Positives = 98/102 (96%), Gaps = 0/102 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MSD+EREEKELDL+SPEVVTKYK AAEI+NKAL+LVVS+CK  A++VD+CEKGDAFI+EQ
Sbjct  1    MSDDEREEKELDLTSPEVVTKYKGAAEIVNKALQLVVSECKAKAKIVDLCEKGDAFIKEQ  60

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLS+DE VLE
Sbjct  61   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSSDETVLE  102



>ref|XP_006344058.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X2 [Solanum tuberosum]
Length=390

 Score =   188 bits (478),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/102 (85%), Positives = 98/102 (96%), Gaps = 0/102 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MSD+EREEKELDL+S EVVTKYK AAEI+NKAL+LVVS+CKP A++VD+CEKGDAFI+EQ
Sbjct  1    MSDDEREEKELDLTSSEVVTKYKGAAEIVNKALQLVVSECKPKAKIVDLCEKGDAFIKEQ  60

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLS+DE +LE
Sbjct  61   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSSDETILE  102



>ref|XP_010321752.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X1 [Solanum lycopersicum]
Length=391

 Score =   188 bits (478),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 88/102 (86%), Positives = 98/102 (96%), Gaps = 0/102 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MSD+EREEKELDL+SPEVVTKYK AAEI+NKAL+LVVS+CK  A++VD+CEKGDAFI+EQ
Sbjct  1    MSDDEREEKELDLTSPEVVTKYKGAAEIVNKALQLVVSECKAKAKIVDLCEKGDAFIKEQ  60

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLS+DE VLE
Sbjct  61   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSSDETVLE  102



>ref|XP_004489059.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X2 [Cicer arietinum]
Length=394

 Score =   188 bits (478),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 85/102 (83%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MSD+EREEKELDL+SP+VVTKYKSAAEI+NKAL+L++S+CKP  +VV+ICEKGD+FIREQ
Sbjct  1    MSDDEREEKELDLTSPDVVTKYKSAAEIVNKALQLIISECKPKVKVVEICEKGDSFIREQ  60

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            TGNMYKNVKKKIERGVAFPTCIS+NNTVCHFSPL++DE VLE
Sbjct  61   TGNMYKNVKKKIERGVAFPTCISINNTVCHFSPLASDETVLE  102



>ref|XP_006344057.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X1 [Solanum tuberosum]
Length=391

 Score =   188 bits (477),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 87/102 (85%), Positives = 98/102 (96%), Gaps = 0/102 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MSD+EREEKELDL+S EVVTKYK AAEI+NKAL+LVVS+CKP A++VD+CEKGDAFI+EQ
Sbjct  1    MSDDEREEKELDLTSSEVVTKYKGAAEIVNKALQLVVSECKPKAKIVDLCEKGDAFIKEQ  60

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLS+DE +LE
Sbjct  61   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSSDETILE  102



>ref|XP_008362268.1| PREDICTED: proliferation-associated protein 2G4-like [Malus domestica]
Length=394

 Score =   188 bits (477),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 85/102 (83%), Positives = 100/102 (98%), Gaps = 0/102 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MSD+EREEKELDL+SPEVVTKYKSAAEI+NKAL+LV+S+CKP A++V++CEKGD++IREQ
Sbjct  1    MSDDEREEKELDLTSPEVVTKYKSAAEIVNKALQLVISECKPKAKIVELCEKGDSYIREQ  60

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            TGNMYKN KKKIERGVAFPTCISVNNTVCHFSPL++DE+VLE
Sbjct  61   TGNMYKNAKKKIERGVAFPTCISVNNTVCHFSPLASDESVLE  102



>ref|XP_009599303.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X1 [Nicotiana tomentosiformis]
Length=427

 Score =   189 bits (479),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 87/102 (85%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MSD+EREE+ELDL+SPEVVTKYKSAAEI+NKAL+LV+S+CKP A++VD+CEKGDAFI+EQ
Sbjct  41   MSDDEREERELDLTSPEVVTKYKSAAEIVNKALQLVLSECKPKAKIVDLCEKGDAFIKEQ  100

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLS+DE  LE
Sbjct  101  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSSDETSLE  142



>ref|XP_003516956.1| PREDICTED: proliferation-associated protein 2G4 [Glycine max]
Length=390

 Score =   187 bits (476),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 84/102 (82%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MSD+EREEKELDL+SPEVVTKYKSAAEI+NKAL+LV+S+CKP  ++VD+CEKGD++IREQ
Sbjct  1    MSDDEREEKELDLTSPEVVTKYKSAAEIVNKALQLVISECKPKTKIVDLCEKGDSYIREQ  60

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            TGNMYKNVK+KIERGVAFPTC+SVNNTVCHFSPL++DE VLE
Sbjct  61   TGNMYKNVKRKIERGVAFPTCVSVNNTVCHFSPLASDETVLE  102



>gb|ABF66654.1| EBP1 [Ammopiptanthus mongolicus]
 gb|ABQ23586.1| EBP1 [Ammopiptanthus mongolicus]
Length=395

 Score =   187 bits (476),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 85/102 (83%), Positives = 100/102 (98%), Gaps = 0/102 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MSD+EREEKELDLSSPEVVTKYK+AAEI+NKAL+LV+S+CKP A++VD+CEKGD++IREQ
Sbjct  1    MSDDEREEKELDLSSPEVVTKYKTAAEIVNKALKLVISECKPKAKIVDLCEKGDSYIREQ  60

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            TGN+YKNVK+KIERGVAFPTCISVNNTVCHFSPL++DE VLE
Sbjct  61   TGNVYKNVKRKIERGVAFPTCISVNNTVCHFSPLASDETVLE  102



>ref|XP_010650887.1| PREDICTED: proliferation-associated protein 2G4 isoform X2 [Vitis 
vinifera]
Length=384

 Score =   187 bits (475),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 85/102 (83%), Positives = 100/102 (98%), Gaps = 0/102 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MSD+EREE+ELDL+SPEVVTKYK+AAEI+NKAL++V+S+CKP A++VD+CEKGDAFIREQ
Sbjct  1    MSDDEREERELDLTSPEVVTKYKTAAEIVNKALQVVLSECKPKAKIVDVCEKGDAFIREQ  60

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            TGN+YKNVKKKIERGVAFPTCISVNNTVCHFSPLS+DE +LE
Sbjct  61   TGNVYKNVKKKIERGVAFPTCISVNNTVCHFSPLSSDETLLE  102



>ref|XP_002530504.1| proliferation-associated 2g4, putative [Ricinus communis]
 gb|EEF31888.1| proliferation-associated 2g4, putative [Ricinus communis]
Length=394

 Score =   187 bits (475),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 86/102 (84%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MSD+EREEKELDL+SPEVVTKYKSAAEI+NKAL+LV+S+CKP A++VD+CEKGDAFIREQ
Sbjct  1    MSDDEREEKELDLTSPEVVTKYKSAAEIVNKALQLVISECKPKAKIVDLCEKGDAFIREQ  60

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            TGNMYKNVKKKIERGVAFPTC+SVNNTVCH SPL++DE +LE
Sbjct  61   TGNMYKNVKKKIERGVAFPTCVSVNNTVCHCSPLASDETLLE  102



>ref|NP_001275188.1| EBP1 [Solanum tuberosum]
 gb|ABJ97690.1| EBP1 [Solanum tuberosum]
Length=387

 Score =   187 bits (475),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 85/102 (83%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MSD+EREEKELDL+SPEVVTKYKSAAEI+NKAL+LV+S+CKP  ++VD+CEKGDAFI+EQ
Sbjct  1    MSDDEREEKELDLTSPEVVTKYKSAAEIVNKALQLVLSECKPKVKIVDLCEKGDAFIKEQ  60

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPL++DE ++E
Sbjct  61   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLASDETIVE  102



>ref|XP_002278744.2| PREDICTED: proliferation-associated protein 2G4 isoform X1 [Vitis 
vinifera]
 emb|CBI15928.3| unnamed protein product [Vitis vinifera]
Length=391

 Score =   187 bits (475),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 85/102 (83%), Positives = 100/102 (98%), Gaps = 0/102 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MSD+EREE+ELDL+SPEVVTKYK+AAEI+NKAL++V+S+CKP A++VD+CEKGDAFIREQ
Sbjct  1    MSDDEREERELDLTSPEVVTKYKTAAEIVNKALQVVLSECKPKAKIVDVCEKGDAFIREQ  60

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            TGN+YKNVKKKIERGVAFPTCISVNNTVCHFSPLS+DE +LE
Sbjct  61   TGNVYKNVKKKIERGVAFPTCISVNNTVCHFSPLSSDETLLE  102



>ref|XP_010264591.1| PREDICTED: proliferation-associated protein 2G4-like [Nelumbo 
nucifera]
Length=397

 Score =   187 bits (474),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 88/103 (85%), Positives = 100/103 (97%), Gaps = 1/103 (1%)
 Frame = +3

Query  243  MSDEE-REEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIRE  419
            MSDEE +EEKELDL+SPEVVTKYKSAAEI+NKAL+LV+S+CKP A++VD+CEKGDAFIRE
Sbjct  1    MSDEETKEEKELDLTSPEVVTKYKSAAEIVNKALQLVLSECKPKAKIVDLCEKGDAFIRE  60

Query  420  QTGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            QTGNMYKNVK+KIERGVAFPTCISVNNTVCHFSPL++DE VLE
Sbjct  61   QTGNMYKNVKRKIERGVAFPTCISVNNTVCHFSPLASDETVLE  103



>ref|XP_006576221.1| PREDICTED: uncharacterized protein LOC100784176 isoform X1 [Glycine 
max]
Length=390

 Score =   187 bits (474),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 83/102 (81%), Positives = 100/102 (98%), Gaps = 0/102 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MSD+EREEKELDL+SPEVVTKYKSAAEI+N+AL+LV+S+CKP A++VD+CEKGD++IREQ
Sbjct  1    MSDDEREEKELDLTSPEVVTKYKSAAEIVNRALQLVISECKPKAKIVDLCEKGDSYIREQ  60

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            TG+MYKNVK+KIERGVAFPTC+SVNNTVCHFSPL++DE VLE
Sbjct  61   TGSMYKNVKRKIERGVAFPTCVSVNNTVCHFSPLASDETVLE  102



>ref|NP_001242070.1| uncharacterized protein LOC100784176 [Glycine max]
 gb|ACU23134.1| unknown [Glycine max]
Length=390

 Score =   186 bits (473),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 83/102 (81%), Positives = 100/102 (98%), Gaps = 0/102 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MSD+EREEKELDL+SPEVVTKYKSAAEI+N+AL+LV+S+CKP A++VD+CEKGD++IREQ
Sbjct  1    MSDDEREEKELDLTSPEVVTKYKSAAEIVNRALQLVISECKPKAKIVDLCEKGDSYIREQ  60

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            TG+MYKNVK+KIERGVAFPTC+SVNNTVCHFSPL++DE VLE
Sbjct  61   TGSMYKNVKRKIERGVAFPTCVSVNNTVCHFSPLASDETVLE  102



>gb|KDO56711.1| hypothetical protein CISIN_1g016183mg [Citrus sinensis]
 gb|KDO56712.1| hypothetical protein CISIN_1g016183mg [Citrus sinensis]
Length=394

 Score =   186 bits (473),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 84/102 (82%), Positives = 98/102 (96%), Gaps = 0/102 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MSD+EREEKELDL+SPEVVTKYKSAAEI NKAL+LVVS+CKP  ++VD+CEKGD+FIREQ
Sbjct  1    MSDDEREEKELDLTSPEVVTKYKSAAEIANKALQLVVSECKPGVKIVDLCEKGDSFIREQ  60

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            TGNMYKNVKKKIERGVAFP+C+SVNNT+CHFSPL++DE VL+
Sbjct  61   TGNMYKNVKKKIERGVAFPSCVSVNNTLCHFSPLASDETVLQ  102



>ref|XP_009384793.1| PREDICTED: proliferation-associated protein 2G4-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009384794.1| PREDICTED: proliferation-associated protein 2G4-like [Musa acuminata 
subsp. malaccensis]
Length=395

 Score =   186 bits (472),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/103 (84%), Positives = 99/103 (96%), Gaps = 1/103 (1%)
 Frame = +3

Query  243  MSDEE-REEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIRE  419
            MSD+E REEKELDL+SP+VVTKYKSAAEI+NKAL+LVVS+CKP A++VD+CEKGDAFIRE
Sbjct  1    MSDDEAREEKELDLTSPDVVTKYKSAAEIVNKALQLVVSECKPKAKIVDLCEKGDAFIRE  60

Query  420  QTGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            QTGNMYKNVK+KIERGV FPTC+SVNNTVCHFSPL +DEAVLE
Sbjct  61   QTGNMYKNVKRKIERGVGFPTCVSVNNTVCHFSPLGSDEAVLE  103



>gb|KEH38647.1| proliferation-associated 2G4-like protein [Medicago truncatula]
Length=391

 Score =   186 bits (472),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 84/102 (82%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MSD+ER+EKELDL+SP+VVTKYKSAAEI+NKAL+LV+S+CKP+ ++VDICEKGD+FIREQ
Sbjct  1    MSDDERDEKELDLTSPDVVTKYKSAAEIVNKALQLVISECKPDVKIVDICEKGDSFIREQ  60

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            TG +YKNVKKKIERGVAFPTCISVNNTVCHFSPL++DE VLE
Sbjct  61   TGKLYKNVKKKIERGVAFPTCISVNNTVCHFSPLASDETVLE  102



>ref|XP_006429434.1| hypothetical protein CICLE_v10011909mg [Citrus clementina]
 ref|XP_006429435.1| hypothetical protein CICLE_v10011909mg [Citrus clementina]
 ref|XP_006481067.1| PREDICTED: proliferation-associated protein 2G4-like [Citrus 
sinensis]
 gb|ESR42674.1| hypothetical protein CICLE_v10011909mg [Citrus clementina]
 gb|ESR42675.1| hypothetical protein CICLE_v10011909mg [Citrus clementina]
Length=394

 Score =   186 bits (472),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 84/102 (82%), Positives = 98/102 (96%), Gaps = 0/102 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MSD+EREEKELDL+SPEVVTKYKSAAEI NKAL+LVVS+CKP  ++VD+CEKGD+FIREQ
Sbjct  1    MSDDEREEKELDLTSPEVVTKYKSAAEIANKALQLVVSECKPGVKIVDLCEKGDSFIREQ  60

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            TGNMYKNVKKKIERGVAFP+C+SVNNT+CHFSPL++DE VL+
Sbjct  61   TGNMYKNVKKKIERGVAFPSCVSVNNTLCHFSPLASDETVLQ  102



>ref|XP_010553237.1| PREDICTED: proliferation-associated protein 2G4-like [Tarenaya 
hassleriana]
Length=389

 Score =   186 bits (472),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/101 (86%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = +3

Query  246  SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQT  425
            SD+EREEKELDL+S +VVTKYKSAAEI+NKAL LVVS+CKP A++VDICEKGDAFIREQT
Sbjct  3    SDDEREEKELDLTSSDVVTKYKSAAEIINKALHLVVSECKPKAKIVDICEKGDAFIREQT  62

Query  426  GNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            GNMYKNVKKKIERG+AFPTCISVNNTVCHFSPL++DE VLE
Sbjct  63   GNMYKNVKKKIERGLAFPTCISVNNTVCHFSPLASDETVLE  103



>gb|KHN42848.1| Proliferation-associated protein 2G4 [Glycine soja]
Length=390

 Score =   186 bits (472),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 83/102 (81%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MSD+ERE+KELDL+SPEVVTKYKSAAEI+NKAL+LV+S+CKP  ++VD+CEKGD++IREQ
Sbjct  1    MSDDEREKKELDLTSPEVVTKYKSAAEIVNKALQLVISECKPKTKIVDLCEKGDSYIREQ  60

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            TGNMYKNVK+KIERGVAFPTC+SVNNTVCHFSPL++DE VLE
Sbjct  61   TGNMYKNVKRKIERGVAFPTCVSVNNTVCHFSPLASDETVLE  102



>ref|XP_004489058.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X1 [Cicer arietinum]
Length=482

 Score =   188 bits (477),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/102 (83%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MSD+EREEKELDL+SP+VVTKYKSAAEI+NKAL+L++S+CKP  +VV+ICEKGD+FIREQ
Sbjct  1    MSDDEREEKELDLTSPDVVTKYKSAAEIVNKALQLIISECKPKVKVVEICEKGDSFIREQ  60

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            TGNMYKNVKKKIERGVAFPTCIS+NNTVCHFSPL++DE VLE
Sbjct  61   TGNMYKNVKKKIERGVAFPTCISINNTVCHFSPLASDETVLE  102



>ref|XP_007026647.1| Metallopeptidase M24 family protein isoform 2 [Theobroma cacao]
 gb|EOY07149.1| Metallopeptidase M24 family protein isoform 2 [Theobroma cacao]
Length=286

 Score =   183 bits (464),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/102 (83%), Positives = 95/102 (93%), Gaps = 0/102 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MSD+EREEKELDL+SPEVVTKYKSAAEI+NKAL+LVV  CKP A++VDICEKGD FIREQ
Sbjct  1    MSDDEREEKELDLTSPEVVTKYKSAAEIVNKALQLVVKDCKPKAKIVDICEKGDVFIREQ  60

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            TGNMYKNVK+KIERGVAFPTCISVNNTVCH SPL++D + LE
Sbjct  61   TGNMYKNVKRKIERGVAFPTCISVNNTVCHISPLASDTSELE  102



>emb|CDP09213.1| unnamed protein product [Coffea canephora]
Length=394

 Score =   186 bits (472),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/102 (83%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MSD+EREE+ELDL+SPEVVTKYKSAAEI+NKAL+LV+S+CKP  ++VD+CEKGDAFI+EQ
Sbjct  1    MSDDEREERELDLTSPEVVTKYKSAAEIVNKALQLVLSECKPATKIVDLCEKGDAFIKEQ  60

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            TGNMYKNVKKKIERGVAFPTCISVNNTVCH SPL++DEAVL+
Sbjct  61   TGNMYKNVKKKIERGVAFPTCISVNNTVCHVSPLASDEAVLQ  102



>ref|XP_010529897.1| PREDICTED: proliferation-associated protein 2G4-like [Tarenaya 
hassleriana]
Length=394

 Score =   186 bits (472),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 86/101 (85%), Positives = 98/101 (97%), Gaps = 0/101 (0%)
 Frame = +3

Query  246  SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQT  425
            SD+EREEKELDL+S EVVTKYKSAAEI+NKAL+LVVS+CKP A++VDICEKGDAFIREQT
Sbjct  3    SDDEREEKELDLTSSEVVTKYKSAAEIVNKALQLVVSECKPKAKIVDICEKGDAFIREQT  62

Query  426  GNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            GNMYKNVKKKIERG+AFPTCISVNNTVCHFSPL++D+ +LE
Sbjct  63   GNMYKNVKKKIERGIAFPTCISVNNTVCHFSPLASDDTLLE  103



>ref|XP_011046861.1| PREDICTED: proliferation-associated protein 2G4-like [Populus 
euphratica]
Length=396

 Score =   185 bits (469),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 99/101 (98%), Gaps = 0/101 (0%)
 Frame = +3

Query  246  SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQT  425
            SD+EREE+ELDL+SPEVVTKYKSAAEI+NKAL+L +S+CKP A++VDICEKGD++IREQ+
Sbjct  3    SDDEREERELDLTSPEVVTKYKSAAEIVNKALQLAISECKPKAKIVDICEKGDSYIREQS  62

Query  426  GNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            GNMYKNVKKKIERGVAFPTC+SVNNTVCHFSPL++DE+VLE
Sbjct  63   GNMYKNVKKKIERGVAFPTCVSVNNTVCHFSPLASDESVLE  103



>ref|XP_008464212.1| PREDICTED: proliferation-associated protein 2G4-like [Cucumis 
melo]
Length=454

 Score =   186 bits (472),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 86/101 (85%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = +3

Query  246  SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQT  425
            SD+EREE ELDLSSP+VVTKYKSAAEI+NKAL+LV+SQCKP A++VDICEKGD+FIREQT
Sbjct  60   SDDEREEMELDLSSPDVVTKYKSAAEIINKALQLVISQCKPKAKIVDICEKGDSFIREQT  119

Query  426  GNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            GNMYKNVKKKIERGVAFPTCISVNNTV HFSPL++DE V+E
Sbjct  120  GNMYKNVKKKIERGVAFPTCISVNNTVGHFSPLASDETVME  160



>gb|ACJ85304.1| unknown [Medicago truncatula]
 gb|AFK40979.1| unknown [Medicago truncatula]
Length=394

 Score =   184 bits (468),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 84/102 (82%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MSD+EREEKELDL+SP+VVTKYK+AAEI+NKAL+LV+S+CKP A+VVDICEKGD+FIREQ
Sbjct  1    MSDDEREEKELDLTSPDVVTKYKTAAEIVNKALKLVISECKPKAKVVDICEKGDSFIREQ  60

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            T N+YKNVKKKIERGVAFPTCISVNNT+CHFSPL++DE VL+
Sbjct  61   TSNVYKNVKKKIERGVAFPTCISVNNTICHFSPLASDETVLD  102



>ref|XP_003623305.1| Proliferation-associated protein 2G4 [Medicago truncatula]
 gb|AES79523.1| proliferation-associated 2G4-like protein [Medicago truncatula]
Length=394

 Score =   184 bits (468),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 84/102 (82%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MSD+EREEKELDL+SP+VVTKYK+AAEI+NKAL+LV+S+CKP A+VVDICEKGD+FIREQ
Sbjct  1    MSDDEREEKELDLTSPDVVTKYKTAAEIVNKALKLVISECKPKAKVVDICEKGDSFIREQ  60

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            T N+YKNVKKKIERGVAFPTCISVNNT+CHFSPL++DE VL+
Sbjct  61   TSNVYKNVKKKIERGVAFPTCISVNNTICHFSPLASDETVLD  102



>gb|EYU26681.1| hypothetical protein MIMGU_mgv1a007877mg [Erythranthe guttata]
Length=392

 Score =   184 bits (467),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/102 (82%), Positives = 97/102 (95%), Gaps = 0/102 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MSDE+ EEKELDL+SPEVVTKYKSAAEI+NKAL+LV+S+CKP A++VD+CEKGD +IRE 
Sbjct  1    MSDEDMEEKELDLTSPEVVTKYKSAAEIVNKALQLVLSECKPKAKIVDLCEKGDVYIREH  60

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            +GNMYKNVKKKIERGVAFPTCISVNNTVCHFSPL++DE VLE
Sbjct  61   SGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLASDETVLE  102



>gb|KJB17056.1| hypothetical protein B456_002G262700 [Gossypium raimondii]
 gb|KJB17057.1| hypothetical protein B456_002G262700 [Gossypium raimondii]
Length=286

 Score =   181 bits (459),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/102 (83%), Positives = 95/102 (93%), Gaps = 0/102 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MSD+EREEKELDLSS EVVTKYK AAEI+NKAL+LVV +CKP A++VDICEKGDAFIREQ
Sbjct  1    MSDDEREEKELDLSSSEVVTKYKGAAEIVNKALQLVVKECKPKAKIVDICEKGDAFIREQ  60

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            TGNMYKN KKKIERGVAFPTC+SVNNTVCHFSPL++D + LE
Sbjct  61   TGNMYKNSKKKIERGVAFPTCLSVNNTVCHFSPLASDTSELE  102



>ref|XP_011019082.1| PREDICTED: proliferation-associated protein 2G4-like [Populus 
euphratica]
Length=396

 Score =   184 bits (467),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 98/101 (97%), Gaps = 0/101 (0%)
 Frame = +3

Query  246  SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQT  425
            SD+EREE+ELDL+S EVVTKYKSAAEI+NKAL+LV+S+CKP A++VDICEKGD+FIREQ+
Sbjct  3    SDDEREERELDLTSSEVVTKYKSAAEIVNKALQLVISECKPKAKIVDICEKGDSFIREQS  62

Query  426  GNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            GNMYKNVKKKIERGVAFPTC+SVNNT+CHFSPL++DE VLE
Sbjct  63   GNMYKNVKKKIERGVAFPTCVSVNNTICHFSPLASDETVLE  103



>gb|KHN39558.1| Proliferation-associated protein 2G4 [Glycine soja]
Length=394

 Score =   184 bits (467),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/102 (82%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MSD+EREEKELDLSS EVVTKYK+AAEI+NKAL+LV+S+CKP A++VDICEKGD++IREQ
Sbjct  1    MSDDEREEKELDLSSAEVVTKYKTAAEIVNKALKLVISECKPKAKIVDICEKGDSYIREQ  60

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            TGN+YKNVK+KIERGVAFPTC+SVNN VCHFSPL++DEAVLE
Sbjct  61   TGNVYKNVKRKIERGVAFPTCLSVNNVVCHFSPLASDEAVLE  102



>ref|XP_004492468.1| PREDICTED: proliferation-associated protein 2G4-like [Cicer arietinum]
Length=394

 Score =   184 bits (466),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/102 (83%), Positives = 98/102 (96%), Gaps = 0/102 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MSD+EREEKELDLSS EVVTKYK+AAEI+NKAL+LV+S+CKP A++VDICEKGD+FIREQ
Sbjct  1    MSDDEREEKELDLSSSEVVTKYKTAAEIVNKALKLVISECKPKAKIVDICEKGDSFIREQ  60

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            T N+YKNVKKKIERGVAFPTCISVNNT+CHFSPL++DE VLE
Sbjct  61   TSNVYKNVKKKIERGVAFPTCISVNNTICHFSPLASDETVLE  102



>ref|XP_003529167.1| PREDICTED: proliferation-associated protein 2G4 [Glycine max]
Length=394

 Score =   184 bits (466),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/102 (82%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MSD+EREEKELDLSS EVVTKYK+AAEI+NKAL+LV+S+CKP A++VDICEKGD++IREQ
Sbjct  1    MSDDEREEKELDLSSAEVVTKYKTAAEIVNKALKLVISECKPKAKIVDICEKGDSYIREQ  60

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            TGN+YKNVK+KIERGVAFPTC+SVNN VCHFSPL++DEAVLE
Sbjct  61   TGNVYKNVKRKIERGVAFPTCLSVNNVVCHFSPLASDEAVLE  102



>ref|XP_007140243.1| hypothetical protein PHAVU_008G095900g [Phaseolus vulgaris]
 gb|ESW12237.1| hypothetical protein PHAVU_008G095900g [Phaseolus vulgaris]
Length=392

 Score =   184 bits (466),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/102 (82%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MSDEEREEKELDLSS EVVTKYK+AAEI+NKAL+LV+S+CKP A++VD+CEKGD++IREQ
Sbjct  1    MSDEEREEKELDLSSAEVVTKYKTAAEIVNKALKLVISECKPKAKIVDLCEKGDSYIREQ  60

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            TGN+YKNVK+KIERGVAFPTC+SVNN VCHFSPL++DEAVLE
Sbjct  61   TGNVYKNVKRKIERGVAFPTCLSVNNLVCHFSPLASDEAVLE  102



>gb|AHA84129.1| DNA-binding protein GBP16 [Phaseolus vulgaris]
Length=394

 Score =   184 bits (466),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/102 (82%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MSDEEREEKELDLSS EVVTKYK+AAEI+NKAL+LV+S+CKP A++VD+CEKGD++IREQ
Sbjct  1    MSDEEREEKELDLSSAEVVTKYKTAAEIVNKALKLVISECKPKAKIVDLCEKGDSYIREQ  60

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            TGN+YKNVK+KIERGVAFPTC+SVNN VCHFSPL++DEAVLE
Sbjct  61   TGNVYKNVKRKIERGVAFPTCLSVNNLVCHFSPLASDEAVLE  102



>ref|NP_001241588.1| uncharacterized protein LOC100781302 [Glycine max]
 gb|ACU19677.1| unknown [Glycine max]
Length=394

 Score =   183 bits (465),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/102 (81%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MSD+EREEKELDLSS EVVTKYK+AAEI+NKAL+LV+S+CKP A++VDICEKGD++IREQ
Sbjct  1    MSDDEREEKELDLSSAEVVTKYKTAAEIVNKALKLVISECKPKAKIVDICEKGDSYIREQ  60

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            TGN+YKNVK+KIERGVAFPTC+S+NN VCHFSPL++DEAVLE
Sbjct  61   TGNVYKNVKRKIERGVAFPTCLSINNVVCHFSPLASDEAVLE  102



>ref|XP_007140242.1| hypothetical protein PHAVU_008G095800g [Phaseolus vulgaris]
 gb|ESW12236.1| hypothetical protein PHAVU_008G095800g [Phaseolus vulgaris]
Length=394

 Score =   183 bits (464),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/102 (81%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MSD+EREEKELDLSS EVVTKYK+AAEI+NKAL+LV+S+CKP A+VVDICEKGD++IREQ
Sbjct  1    MSDDEREEKELDLSSAEVVTKYKTAAEIVNKALKLVISECKPKAKVVDICEKGDSYIREQ  60

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            TGN+YKNVK+KIERG+AFPTC+SVNN +CHFSPL++DEAVLE
Sbjct  61   TGNVYKNVKRKIERGIAFPTCLSVNNVICHFSPLASDEAVLE  102



>gb|AEY75257.1| putative DNA binding protein [Atriplex canescens]
Length=396

 Score =   183 bits (464),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 98/102 (96%), Gaps = 0/102 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MSD+EREEKELDLS PEVVTKYKSAA+I+N+AL+LVV++CKP A++VD+CEKGD FIREQ
Sbjct  1    MSDDEREEKELDLSYPEVVTKYKSAADIVNRALQLVVAECKPKAKIVDLCEKGDNFIREQ  60

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            TGNMYKNVKKKIERGVAFPTC+S+NN VCHFSPL++D++VLE
Sbjct  61   TGNMYKNVKKKIERGVAFPTCLSINNVVCHFSPLASDDSVLE  102



>ref|XP_010676777.1| PREDICTED: proliferation-associated protein 2G4 [Beta vulgaris 
subsp. vulgaris]
Length=395

 Score =   183 bits (464),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MSD+EREE+ELDL+ PEVVTKYKSAA+I+N+AL+LVV++CKP A++VDICEKGD++IREQ
Sbjct  1    MSDDEREEQELDLTYPEVVTKYKSAADIVNRALQLVVAECKPKAKIVDICEKGDSYIREQ  60

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            +GNMYKNVKKKIERGVAFPTCISVNN VCHFSPL++DE+VLE
Sbjct  61   SGNMYKNVKKKIERGVAFPTCISVNNVVCHFSPLASDESVLE  102



>ref|XP_007026646.1| Metallopeptidase M24 family protein isoform 1 [Theobroma cacao]
 gb|EOY07148.1| Metallopeptidase M24 family protein isoform 1 [Theobroma cacao]
Length=393

 Score =   182 bits (463),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 85/102 (83%), Positives = 95/102 (93%), Gaps = 0/102 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MSD+EREEKELDL+SPEVVTKYKSAAEI+NKAL+LVV  CKP A++VDICEKGD FIREQ
Sbjct  1    MSDDEREEKELDLTSPEVVTKYKSAAEIVNKALQLVVKDCKPKAKIVDICEKGDVFIREQ  60

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            TGNMYKNVK+KIERGVAFPTCISVNNTVCH SPL++D + LE
Sbjct  61   TGNMYKNVKRKIERGVAFPTCISVNNTVCHISPLASDTSELE  102



>gb|KJB36946.1| hypothetical protein B456_006G183700 [Gossypium raimondii]
Length=371

 Score =   182 bits (461),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 83/102 (81%), Positives = 96/102 (94%), Gaps = 0/102 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MSD+EREEKELDL+SPEVVTKYKSAAEI+NKAL+LVV +CKP  ++VDICEKGDAFIREQ
Sbjct  1    MSDDEREEKELDLTSPEVVTKYKSAAEIVNKALQLVVKECKPKTKIVDICEKGDAFIREQ  60

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            TGNMYKN K+KIERGVAFPTC+SVNNTVCHFSPL++D + L+
Sbjct  61   TGNMYKNAKRKIERGVAFPTCLSVNNTVCHFSPLASDTSELQ  102



>gb|KJB36944.1| hypothetical protein B456_006G183700 [Gossypium raimondii]
 gb|KJB36947.1| hypothetical protein B456_006G183700 [Gossypium raimondii]
 gb|KJB36948.1| hypothetical protein B456_006G183700 [Gossypium raimondii]
Length=392

 Score =   182 bits (462),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 83/102 (81%), Positives = 96/102 (94%), Gaps = 0/102 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MSD+EREEKELDL+SPEVVTKYKSAAEI+NKAL+LVV +CKP  ++VDICEKGDAFIREQ
Sbjct  1    MSDDEREEKELDLTSPEVVTKYKSAAEIVNKALQLVVKECKPKTKIVDICEKGDAFIREQ  60

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            TGNMYKN K+KIERGVAFPTC+SVNNTVCHFSPL++D + L+
Sbjct  61   TGNMYKNAKRKIERGVAFPTCLSVNNTVCHFSPLASDTSELQ  102



>gb|AGV54689.1| proliferation-associated protein 2G4-like protein [Phaseolus 
vulgaris]
Length=394

 Score =   182 bits (462),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 83/102 (81%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MSD+EREEKELDLSS EVVTKYK+AAEI+NKAL+LV+S+CKP A+VVDICEKGD++IREQ
Sbjct  1    MSDDEREEKELDLSSAEVVTKYKTAAEIVNKALKLVISECKPKAKVVDICEKGDSYIREQ  60

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            TGN+YKNVK+KIERG+AFPTC+SVNN +CHFSPL++DEAVLE
Sbjct  61   TGNVYKNVKRKIERGIAFPTCLSVNNVICHFSPLASDEAVLE  102



>gb|AAF91445.1|AF281652_1 putative DNA binding protein [Atriplex hortensis]
Length=397

 Score =   182 bits (462),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 97/102 (95%), Gaps = 0/102 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MSD+EREEKELDLS PEVVTKYKSAA+I+N+AL+LVV +CKP A++VD+CEKGD FIREQ
Sbjct  1    MSDDEREEKELDLSYPEVVTKYKSAADIVNRALQLVVGECKPKAKIVDLCEKGDNFIREQ  60

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            TGNMYKNVKKKIERGVAFPTC+S+NN VCHFSPL++D++VLE
Sbjct  61   TGNMYKNVKKKIERGVAFPTCLSINNVVCHFSPLASDDSVLE  102



>gb|KJB17053.1| hypothetical protein B456_002G262700 [Gossypium raimondii]
 gb|KJB17054.1| hypothetical protein B456_002G262700 [Gossypium raimondii]
 gb|KJB17055.1| hypothetical protein B456_002G262700 [Gossypium raimondii]
Length=393

 Score =   181 bits (460),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/102 (83%), Positives = 95/102 (93%), Gaps = 0/102 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MSD+EREEKELDLSS EVVTKYK AAEI+NKAL+LVV +CKP A++VDICEKGDAFIREQ
Sbjct  1    MSDDEREEKELDLSSSEVVTKYKGAAEIVNKALQLVVKECKPKAKIVDICEKGDAFIREQ  60

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            TGNMYKN KKKIERGVAFPTC+SVNNTVCHFSPL++D + LE
Sbjct  61   TGNMYKNSKKKIERGVAFPTCLSVNNTVCHFSPLASDTSELE  102



>gb|EYU41925.1| hypothetical protein MIMGU_mgv1a007938mg [Erythranthe guttata]
Length=390

 Score =   181 bits (459),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/103 (83%), Positives = 98/103 (95%), Gaps = 1/103 (1%)
 Frame = +3

Query  243  MSDEEREE-KELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIRE  419
            M+DE REE +ELDLSSPEVVTKYKSAAEI+NKAL+LV+SQCKP  ++VD+CE GDAFIRE
Sbjct  1    MADEIREENEELDLSSPEVVTKYKSAAEIVNKALQLVLSQCKPKVKIVDLCEAGDAFIRE  60

Query  420  QTGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            QTGNMYKNVKKKIE+GVAFPTC+SVNNTVCHFSPL++DE+VLE
Sbjct  61   QTGNMYKNVKKKIEKGVAFPTCVSVNNTVCHFSPLASDESVLE  103



>ref|XP_008805004.1| PREDICTED: proliferation-associated protein 2G4-like [Phoenix 
dactylifera]
 ref|XP_008805005.1| PREDICTED: proliferation-associated protein 2G4-like [Phoenix 
dactylifera]
Length=396

 Score =   181 bits (459),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/102 (82%), Positives = 96/102 (94%), Gaps = 0/102 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MSD+E +E+ELDL+S +VVTKYKSAAEI+NKAL+LV+S+CKP A++VDICEKGDAFIREQ
Sbjct  1    MSDDEAKEEELDLTSSDVVTKYKSAAEIVNKALQLVLSECKPKAKIVDICEKGDAFIREQ  60

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
             GNMYKNVKKKIERGVAFPTCISVNNTVCHFSPL+ DE VLE
Sbjct  61   AGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLAGDETVLE  102



>ref|XP_008656355.1| PREDICTED: proliferation-associated protein A-like [Zea mays]
Length=188

 Score =   175 bits (443),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  249  DEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTG  428
            DE REEKELDLSS +VVTKYK+AAEILN AL+LVVS+CKP A++VD+CEKGD+FIREQTG
Sbjct  5    DEVREEKELDLSSNDVVTKYKTAAEILNNALKLVVSECKPKAKIVDLCEKGDSFIREQTG  64

Query  429  NMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            N+YKN K+KIERG+AFPTC+SVNNTVCHFSPL+ D+AVLE
Sbjct  65   NVYKNAKRKIERGIAFPTCVSVNNTVCHFSPLTTDDAVLE  104



>ref|XP_009402229.1| PREDICTED: proliferation-associated protein 2G4-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009402230.1| PREDICTED: proliferation-associated protein 2G4-like [Musa acuminata 
subsp. malaccensis]
Length=395

 Score =   181 bits (458),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/103 (82%), Positives = 99/103 (96%), Gaps = 1/103 (1%)
 Frame = +3

Query  243  MSDEE-REEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIRE  419
            MSD+E REEKELDL+SP+VVTKYKSAAEI+NKAL+LV S+CKP A++VD+CE+GDAFIRE
Sbjct  1    MSDDEAREEKELDLTSPDVVTKYKSAAEIVNKALQLVTSKCKPKAKIVDLCEQGDAFIRE  60

Query  420  QTGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            Q GN+YKNVK+KIERGVAFPTCISVNNTVCHFSPL++D+AVLE
Sbjct  61   QAGNIYKNVKRKIERGVAFPTCISVNNTVCHFSPLASDDAVLE  103



>ref|XP_002322994.2| hypothetical protein POPTR_0016s12720g [Populus trichocarpa]
 gb|EEF04755.2| hypothetical protein POPTR_0016s12720g [Populus trichocarpa]
Length=375

 Score =   180 bits (457),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = +3

Query  246  SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQT  425
            SD+EREE+ELDL+SPEVVTKYKSAAEI+NKAL+L +S+CKP  ++VDICEK D++IREQ+
Sbjct  3    SDDEREERELDLTSPEVVTKYKSAAEIVNKALQLAISECKPKVKIVDICEKADSYIREQS  62

Query  426  GNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            GNMYKNVKKKIERGVAFPTC+SVNNTVCHFSPL++DE+VLE
Sbjct  63   GNMYKNVKKKIERGVAFPTCVSVNNTVCHFSPLASDESVLE  103



>ref|XP_010937887.1| PREDICTED: proliferation-associated protein 2G4-like [Elaeis 
guineensis]
Length=397

 Score =   180 bits (457),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 86/103 (83%), Positives = 96/103 (93%), Gaps = 1/103 (1%)
 Frame = +3

Query  243  MSDEE-REEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIRE  419
            MSD+E REEKELDL+SP+VVTKYK AAEILNKAL+LVVS+CKP A +VDICEKGDAFI+E
Sbjct  1    MSDDEAREEKELDLTSPDVVTKYKCAAEILNKALQLVVSECKPKANIVDICEKGDAFIKE  60

Query  420  QTGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            QTGN+YKNVKKKIE+G+AFPTCISVNNTVCHFSPL  DE VLE
Sbjct  61   QTGNVYKNVKKKIEKGIAFPTCISVNNTVCHFSPLGGDETVLE  103



>gb|ABR26103.1| proliferation-associated protein 2g4 [Oryza sativa Indica Group]
Length=231

 Score =   175 bits (444),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  249  DEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTG  428
            DE REEKELDLSS +VVTKYK AA+I+N AL+LVVS CKP A++VDICEKGD++IREQTG
Sbjct  5    DEVREEKELDLSSSDVVTKYKDAADIINNALKLVVSLCKPKAKIVDICEKGDSYIREQTG  64

Query  429  NMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            N+YKNVK+KIERGVAFPTC+SVNNTVCHFSPL+ DEAVLE
Sbjct  65   NIYKNVKRKIERGVAFPTCVSVNNTVCHFSPLATDEAVLE  104



>gb|KHG01253.1| Proliferation-associated 2G4 [Gossypium arboreum]
Length=392

 Score =   180 bits (456),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 95/102 (93%), Gaps = 0/102 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MSD+EREEKELDL+SPEVVTKYKSAAEI+NKAL+LVV +CKP  ++VDICEKGDAFIREQ
Sbjct  1    MSDDEREEKELDLTSPEVVTKYKSAAEIVNKALQLVVKECKPKTKIVDICEKGDAFIREQ  60

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            TGNMYKN K+KIERGVAFPTC+SVNN VCHFSPL++D + L+
Sbjct  61   TGNMYKNAKRKIERGVAFPTCLSVNNIVCHFSPLASDTSELQ  102



>gb|KHG25370.1| Proliferation-associated 2G4 [Gossypium arboreum]
Length=393

 Score =   180 bits (456),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 84/102 (82%), Positives = 95/102 (93%), Gaps = 0/102 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MSD+EREEKELDL+S EVVTKYKSAAEI+NKAL+LVV +CKP  ++VDICEKGDAFIREQ
Sbjct  1    MSDDEREEKELDLTSSEVVTKYKSAAEIVNKALQLVVKECKPKVKIVDICEKGDAFIREQ  60

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            TGNMYKN KKKIERGVAFPTC+SVNNTVCHFSPL++D + LE
Sbjct  61   TGNMYKNSKKKIERGVAFPTCLSVNNTVCHFSPLASDTSELE  102



>ref|XP_010920808.1| PREDICTED: proliferation-associated protein 2G4 isoform X3 [Elaeis 
guineensis]
Length=397

 Score =   180 bits (456),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 87/103 (84%), Positives = 97/103 (94%), Gaps = 1/103 (1%)
 Frame = +3

Query  243  MSDEE-REEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIRE  419
            MSD+E +EEKELDLS P+VVTKYK AAEILNKAL+LVVS+CKP A++VDICEKGD FI+E
Sbjct  1    MSDDEAKEEKELDLSFPDVVTKYKCAAEILNKALQLVVSECKPKAKIVDICEKGDTFIKE  60

Query  420  QTGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            Q+GN+YKNVKKKIERGVAFPTCISVNNTVCHFSPLS DEAVLE
Sbjct  61   QSGNVYKNVKKKIERGVAFPTCISVNNTVCHFSPLSGDEAVLE  103



>gb|EPS71863.1| hypothetical protein M569_02886, partial [Genlisea aurea]
Length=369

 Score =   179 bits (454),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 95/102 (93%), Gaps = 0/102 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MSDEEREEKELDL+S EVV KYKSAAEI+N+AL+ V+S+CKP A++VD+CEKGD+FIREQ
Sbjct  1    MSDEEREEKELDLTSSEVVMKYKSAAEIVNRALQSVLSECKPKAKIVDLCEKGDSFIREQ  60

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            +GNMYKN KKKIERGVAFPTCISVNNTVCHFSPL++DE  LE
Sbjct  61   SGNMYKNAKKKIERGVAFPTCISVNNTVCHFSPLASDETTLE  102



>ref|XP_006843644.1| hypothetical protein AMTR_s00007p00167240 [Amborella trichopoda]
 gb|ERN05319.1| hypothetical protein AMTR_s00007p00167240 [Amborella trichopoda]
Length=318

 Score =   177 bits (449),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 84/102 (82%), Positives = 97/102 (95%), Gaps = 1/102 (1%)
 Frame = +3

Query  243  MSDEE-REEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIRE  419
            MSD+E +EE+ELDL+SP+VVTKYK+AAEILNKAL+LVVS+CKP A+VVDICEKGDAFIRE
Sbjct  1    MSDDEAKEERELDLTSPDVVTKYKTAAEILNKALQLVVSECKPKAKVVDICEKGDAFIRE  60

Query  420  QTGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVL  545
            QTG++YKN KKKIERGVAFPTCISVNNTVCHFSPL++DE  L
Sbjct  61   QTGSVYKNAKKKIERGVAFPTCISVNNTVCHFSPLASDETTL  102



>ref|XP_010920804.1| PREDICTED: proliferation-associated protein 2G4 isoform X1 [Elaeis 
guineensis]
 ref|XP_010920805.1| PREDICTED: proliferation-associated protein 2G4 isoform X1 [Elaeis 
guineensis]
Length=431

 Score =   179 bits (455),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/103 (84%), Positives = 97/103 (94%), Gaps = 1/103 (1%)
 Frame = +3

Query  243  MSDEE-REEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIRE  419
            MSD+E +EEKELDLS P+VVTKYK AAEILNKAL+LVVS+CKP A++VDICEKGD FI+E
Sbjct  1    MSDDEAKEEKELDLSFPDVVTKYKCAAEILNKALQLVVSECKPKAKIVDICEKGDTFIKE  60

Query  420  QTGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            Q+GN+YKNVKKKIERGVAFPTCISVNNTVCHFSPLS DEAVLE
Sbjct  61   QSGNVYKNVKKKIERGVAFPTCISVNNTVCHFSPLSGDEAVLE  103



>ref|XP_008789134.1| PREDICTED: proliferation-associated protein 2G4-like [Phoenix 
dactylifera]
Length=397

 Score =   177 bits (450),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 84/103 (82%), Positives = 97/103 (94%), Gaps = 1/103 (1%)
 Frame = +3

Query  243  MSDEE-REEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIRE  419
            MSD+E REEKELDL+SP+VVTKYK AAEI+NKAL+LVVS+CKP A++VDICEKGDAFI+E
Sbjct  1    MSDDEAREEKELDLTSPDVVTKYKCAAEIVNKALQLVVSECKPKAKIVDICEKGDAFIKE  60

Query  420  QTGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            QTG +YKNVKKKIE+G+AFPTCISVNNTVCHFSPL +DE VLE
Sbjct  61   QTGTVYKNVKKKIEKGIAFPTCISVNNTVCHFSPLGSDETVLE  103



>ref|XP_010092793.1| Proliferation-associated protein 2G4 [Morus notabilis]
 gb|EXB52379.1| Proliferation-associated protein 2G4 [Morus notabilis]
Length=424

 Score =   178 bits (452),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 85/116 (73%), Positives = 101/116 (87%), Gaps = 14/116 (12%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILN--------------KALELVVSQCKPNARV  380
            MSD+EREEKELDL+SPEVVTKYKSAAEI+N              +AL+LV+S+CKP A++
Sbjct  1    MSDDEREEKELDLTSPEVVTKYKSAAEIVNSIFVVYNLGIGKNEEALQLVLSECKPKAKI  60

Query  381  VDICEKGDAFIREQTGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            VD+CEKGD++IREQTGNMYKNVKKKIERGVAFPTC+SVNNTVCHFSPL++DE+VLE
Sbjct  61   VDLCEKGDSYIREQTGNMYKNVKKKIERGVAFPTCVSVNNTVCHFSPLASDESVLE  116



>ref|XP_009123761.1| PREDICTED: proliferation-associated protein 2G4-like [Brassica 
rapa]
Length=393

 Score =   177 bits (448),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 80/101 (79%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = +3

Query  246  SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQT  425
            SD+ER+EKELDL+SPEVVTKYKSAAEI+NKAL++V+S+CKP A++VDICEKGDAFI+EQT
Sbjct  3    SDDERDEKELDLTSPEVVTKYKSAAEIVNKALQVVLSECKPKAKIVDICEKGDAFIKEQT  62

Query  426  GNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            G+MYKN KKKI+RGVAFPTC+SVNNTV HFSPL++DE +LE
Sbjct  63   GSMYKNAKKKIDRGVAFPTCVSVNNTVGHFSPLASDETLLE  103



>ref|XP_010515611.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X1 [Camelina sativa]
 ref|XP_010515612.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X2 [Camelina sativa]
Length=393

 Score =   176 bits (446),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/101 (79%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +3

Query  246  SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQT  425
            SD+ER+EKEL L+SPEVVTKYK AAEI+NKAL++V+++CKP A++VDICEKGDAFI+EQT
Sbjct  3    SDDERDEKELSLTSPEVVTKYKGAAEIVNKALQVVLAECKPKAKIVDICEKGDAFIKEQT  62

Query  426  GNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            G+MYKN KKKIERGVAFPTCISVNNTV HFSPL++DE VLE
Sbjct  63   GSMYKNAKKKIERGVAFPTCISVNNTVGHFSPLASDETVLE  103



>emb|CDX73690.1| BnaC08g23130D [Brassica napus]
Length=391

 Score =   176 bits (445),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/101 (79%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +3

Query  246  SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQT  425
            SD+ER+EKELDL+SPEVVTKYKSAAEI+NKAL++V+++CKP A++VDICEKGDAFI EQ 
Sbjct  3    SDDERDEKELDLTSPEVVTKYKSAAEIVNKALQVVLAECKPKAKIVDICEKGDAFINEQA  62

Query  426  GNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            G+MYKNVKKKI+RGVAFPTC+SVNNTV HFSPL++DE VLE
Sbjct  63   GSMYKNVKKKIDRGVAFPTCVSVNNTVGHFSPLASDETVLE  103



>ref|XP_009136636.1| PREDICTED: proliferation-associated protein 2G4-like [Brassica 
rapa]
Length=390

 Score =   176 bits (445),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 79/101 (78%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +3

Query  246  SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQT  425
            SD+ER+EKELDL+SPEVVTK+KSAAEI+NKAL++V+++CKP A++VDICEKGDAFI+EQT
Sbjct  3    SDDERDEKELDLTSPEVVTKHKSAAEIVNKALQVVLAECKPGAKIVDICEKGDAFIKEQT  62

Query  426  GNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            GNMYKN KKKI+RGVAFPTC+SVNN V HFSPL+ DE+VLE
Sbjct  63   GNMYKNAKKKIDRGVAFPTCVSVNNVVGHFSPLAGDESVLE  103



>emb|CDY33263.1| BnaA01g19300D [Brassica napus]
Length=393

 Score =   176 bits (445),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 79/101 (78%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = +3

Query  246  SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQT  425
            SD+ER+EKELDL+SPEVVTKYKSAAEI+NKAL++V+++CKP A++VDICEKGDAFI+EQT
Sbjct  3    SDDERDEKELDLTSPEVVTKYKSAAEIVNKALQVVLTECKPKAKIVDICEKGDAFIKEQT  62

Query  426  GNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            G+MYKN KKKI+RGVAFPTC+SVNNTV HFSPL++DE +LE
Sbjct  63   GSMYKNAKKKIDRGVAFPTCVSVNNTVGHFSPLASDETLLE  103



>emb|CDX90633.1| BnaA03g41480D [Brassica napus]
Length=390

 Score =   176 bits (445),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 79/101 (78%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +3

Query  246  SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQT  425
            SD+ER+EKELDL+SPEVVTKYKSAAEI+NKAL++V+++CKP A++VDICEKGDAFI+EQT
Sbjct  3    SDDERDEKELDLTSPEVVTKYKSAAEIVNKALQVVLAECKPGAKIVDICEKGDAFIKEQT  62

Query  426  GNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            G+MYKN KKKI+RGVAFPTC+SVNN V HFSPL+ DE+VLE
Sbjct  63   GSMYKNAKKKIDRGVAFPTCVSVNNVVGHFSPLAGDESVLE  103



>ref|XP_004962368.1| PREDICTED: proliferation-associated protein 2G4-like [Setaria 
italica]
Length=401

 Score =   176 bits (445),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  249  DEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTG  428
            DE REEKELDLSS +VVTKYK+AAEILN AL+LVVS+CKP A++VD+CEKGD+FIREQTG
Sbjct  5    DEVREEKELDLSSNDVVTKYKAAAEILNNALKLVVSECKPKAKIVDLCEKGDSFIREQTG  64

Query  429  NMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            N+YKN K+KIERG+AFPTC+SVNNTVCHFSPL+ DEAVLE
Sbjct  65   NVYKNAKRKIERGIAFPTCVSVNNTVCHFSPLATDEAVLE  104



>ref|XP_009115883.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X2 [Brassica rapa]
Length=390

 Score =   175 bits (444),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 79/101 (78%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +3

Query  246  SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQT  425
            SD+ER+EKELDL+SPEVVTKYKSAAEI+NKAL++V+++CKP A++VDICEKGDAFI+EQ 
Sbjct  3    SDDERDEKELDLTSPEVVTKYKSAAEIVNKALQVVLAECKPKAKIVDICEKGDAFIKEQA  62

Query  426  GNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            G+MYKN KKKI+RGVAFPTC+SVNNTV HFSPL++DE VLE
Sbjct  63   GSMYKNAKKKIDRGVAFPTCVSVNNTVGHFSPLASDETVLE  103



>ref|XP_009115882.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X1 [Brassica rapa]
Length=391

 Score =   175 bits (444),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 79/101 (78%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +3

Query  246  SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQT  425
            SD+ER+EKELDL+SPEVVTKYKSAAEI+NKAL++V+++CKP A++VDICEKGDAFI+EQ 
Sbjct  3    SDDERDEKELDLTSPEVVTKYKSAAEIVNKALQVVLAECKPKAKIVDICEKGDAFIKEQA  62

Query  426  GNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            G+MYKN KKKI+RGVAFPTC+SVNNTV HFSPL++DE VLE
Sbjct  63   GSMYKNAKKKIDRGVAFPTCVSVNNTVGHFSPLASDETVLE  103



>ref|XP_010907411.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X1 [Elaeis guineensis]
 ref|XP_010907412.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X1 [Elaeis guineensis]
Length=394

 Score =   175 bits (444),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 95/102 (93%), Gaps = 0/102 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MSD+E +E+ELDL+SP+VVTKYKSAA+I++KAL+L VS+CKP A++VDICEKGDAFIREQ
Sbjct  1    MSDDEAKEEELDLTSPDVVTKYKSAADIVSKALQLAVSECKPKAKIVDICEKGDAFIREQ  60

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
             GN+YKNVKKKIERG+AFPTCISVNN VCHFSPL+ DE VLE
Sbjct  61   AGNIYKNVKKKIERGLAFPTCISVNNIVCHFSPLAGDETVLE  102



>ref|XP_010426749.1| PREDICTED: proliferation-associated protein 2G4-like [Camelina 
sativa]
Length=393

 Score =   175 bits (444),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 80/101 (79%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +3

Query  246  SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQT  425
            SD+ER+EKEL LSSPEVVTKYK AAEI+NKAL++V+++CKP A++VDICEKGD+FI+EQT
Sbjct  3    SDDERDEKELSLSSPEVVTKYKGAAEIVNKALQVVLAECKPKAKIVDICEKGDSFIKEQT  62

Query  426  GNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            G+MYKN KKKIERGVAFPTCISVNNTV HFSPL++DE VLE
Sbjct  63   GSMYKNAKKKIERGVAFPTCISVNNTVGHFSPLASDETVLE  103



>gb|KFK34423.1| hypothetical protein AALP_AA5G142900 [Arabis alpina]
Length=393

 Score =   175 bits (444),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 79/101 (78%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +3

Query  246  SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQT  425
            SD+ER+EK+LDL+SPEVVTKYKSAAEI+NKAL++V+++CKP A++VDIC+KGDAFI+EQT
Sbjct  3    SDDERDEKQLDLTSPEVVTKYKSAAEIVNKALQVVLAECKPKAKIVDICDKGDAFIKEQT  62

Query  426  GNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            G+MYKN KKKI+RGVAFPTCISVNNTV HFSPL+ DE VLE
Sbjct  63   GSMYKNSKKKIDRGVAFPTCISVNNTVGHFSPLAGDETVLE  103



>ref|XP_004302550.1| PREDICTED: proliferation-associated protein 2G4 [Fragaria vesca 
subsp. vesca]
Length=395

 Score =   175 bits (444),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 80/101 (79%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +3

Query  246  SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQT  425
            SD+EREEKELDL+SPEVVTKYKSAAEI+NKAL+ V+++CKP A++VD+CE GD+FIREQT
Sbjct  3    SDDEREEKELDLTSPEVVTKYKSAAEIVNKALQRVIAECKPKAKIVDVCEIGDSFIREQT  62

Query  426  GNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            GNMYK+ KKKIERGVAFPT ISVNNTVCHFSPL+ DE V E
Sbjct  63   GNMYKSAKKKIERGVAFPTSISVNNTVCHFSPLATDETVFE  103



>gb|AAB80919.1| DNA-binding protein GBP16 [Oryza sativa Japonica Group]
Length=393

 Score =   175 bits (444),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  249  DEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTG  428
            DE REEKELDLSS +VVTKYK AA+I+N AL+LVVS CKP A++VDICEKGD++IREQTG
Sbjct  5    DEVREEKELDLSSSDVVTKYKDAADIINNALKLVVSLCKPKAKIVDICEKGDSYIREQTG  64

Query  429  NMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            N+YKNVK+KIERGVAFPTC+SVNNTVCHFSPL+ DEAVLE
Sbjct  65   NIYKNVKRKIERGVAFPTCVSVNNTVCHFSPLATDEAVLE  104



>ref|XP_002440927.1| hypothetical protein SORBIDRAFT_09g016610 [Sorghum bicolor]
 gb|EES19357.1| hypothetical protein SORBIDRAFT_09g016610 [Sorghum bicolor]
Length=392

 Score =   175 bits (444),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  249  DEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTG  428
            DE REEKELDLSS +VVTKYK+AAEILN AL+LVVS+CKP A++VD+CEKGD+FIREQTG
Sbjct  5    DEVREEKELDLSSNDVVTKYKAAAEILNNALKLVVSECKPKAKIVDLCEKGDSFIREQTG  64

Query  429  NMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            N+YKN K+KIERG+AFPTC+SVNNTVCHFSPL+ D+AVLE
Sbjct  65   NVYKNAKRKIERGIAFPTCVSVNNTVCHFSPLATDDAVLE  104



>emb|CDY16291.1| BnaC01g23260D [Brassica napus]
Length=393

 Score =   175 bits (443),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 79/101 (78%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = +3

Query  246  SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQT  425
            SD+ER+EKELDL+SPEVVTKYKSAAEI+NKAL++V+S+CKP A++VDICEKGDAFI+EQT
Sbjct  3    SDDERDEKELDLTSPEVVTKYKSAAEIVNKALQVVLSECKPKAKIVDICEKGDAFIKEQT  62

Query  426  GNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            G+MYK+ KKKI+RGVAFPTC+SVNNTV HFSPL++DE +LE
Sbjct  63   GSMYKSAKKKIDRGVAFPTCVSVNNTVGHFSPLASDETLLE  103



>gb|EAY97646.1| hypothetical protein OsI_19569 [Oryza sativa Indica Group]
Length=393

 Score =   175 bits (443),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  249  DEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTG  428
            DE REEKELDLSS +VVTKYK AA+I+N AL+LVVS CKP A++VDICEKGD++IREQTG
Sbjct  5    DEVREEKELDLSSSDVVTKYKDAADIINNALKLVVSLCKPKAKIVDICEKGDSYIREQTG  64

Query  429  NMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            N+YKNVK+KIERGVAFPTC+SVNNTVCHFSPL+ DEAVLE
Sbjct  65   NIYKNVKRKIERGVAFPTCVSVNNTVCHFSPLATDEAVLE  104



>ref|NP_001055274.1| Os05g0350500 [Oryza sativa Japonica Group]
 gb|AAV44069.1| putative DNA-binding protein GBP16 [Oryza sativa Japonica Group]
 dbj|BAF17188.1| Os05g0350500 [Oryza sativa Japonica Group]
 dbj|BAG88060.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG95770.1| unnamed protein product [Oryza sativa Japonica Group]
Length=393

 Score =   175 bits (443),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  249  DEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTG  428
            DE REEKELDLSS +VVTKYK AA+I+N AL+LVVS CKP A++VDICEKGD++IREQTG
Sbjct  5    DEVREEKELDLSSSDVVTKYKDAADIINNALKLVVSLCKPKAKIVDICEKGDSYIREQTG  64

Query  429  NMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            N+YKNVK+KIERGVAFPTC+SVNNTVCHFSPL+ DEAVLE
Sbjct  65   NIYKNVKRKIERGVAFPTCVSVNNTVCHFSPLATDEAVLE  104



>ref|XP_003568643.1| PREDICTED: proliferation-associated protein 2G4 [Brachypodium 
distachyon]
Length=394

 Score =   174 bits (442),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  249  DEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTG  428
            DE REEKELDLSS EVVTKYK+AAEI+NKAL+LV+S+CKP A++VDICEKGD FI EQTG
Sbjct  5    DEVREEKELDLSSNEVVTKYKTAAEIINKALKLVLSECKPKAKIVDICEKGDNFITEQTG  64

Query  429  NMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            N+YKNVKKKIERG+AFPTC+SVNNTVCHFSPL+ D+A+LE
Sbjct  65   NVYKNVKKKIERGIAFPTCLSVNNTVCHFSPLATDDAILE  104



>ref|XP_006403880.1| hypothetical protein EUTSA_v10010435mg [Eutrema salsugineum]
 gb|ESQ45333.1| hypothetical protein EUTSA_v10010435mg [Eutrema salsugineum]
Length=393

 Score =   174 bits (441),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 80/101 (79%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +3

Query  246  SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQT  425
            SD+ER+EKELDL+S EVVTKYKSAAEI+NKAL++V+++CKP  ++VDICEKGDAFI+EQT
Sbjct  3    SDDERDEKELDLTSSEVVTKYKSAAEIVNKALQVVLAECKPKTKIVDICEKGDAFIKEQT  62

Query  426  GNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            G+MYKN KKKIERGVAFPTCISVNNTV HFSPL++DE+VLE
Sbjct  63   GSMYKNAKKKIERGVAFPTCISVNNTVGHFSPLASDESVLE  103



>gb|ADK78215.1| methionine aminopeptiase [Hordeum vulgare]
Length=394

 Score =   174 bits (440),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 96/102 (94%), Gaps = 1/102 (1%)
 Frame = +3

Query  246  SDEE-REEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            SDEE REEKELDLSS EVVTKYK+AAEI+NKAL+LV+S+CKP A++VDICEKGD FI EQ
Sbjct  3    SDEEVREEKELDLSSNEVVTKYKTAAEIINKALKLVLSECKPKAKIVDICEKGDNFITEQ  62

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            TGN+YKNVK+KIERG+AFPTC+SVNNTVCHFSPL+ D++VLE
Sbjct  63   TGNVYKNVKRKIERGIAFPTCVSVNNTVCHFSPLATDDSVLE  104



>emb|CDX78041.1| BnaA09g32360D [Brassica napus]
Length=436

 Score =   174 bits (442),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 78/101 (77%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +3

Query  246  SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQT  425
            SD+ER+EKELDL+SPEVVTKYKSAAEI+NKAL++V+++CKP A++VDICEKGDAFI+EQ 
Sbjct  48   SDDERDEKELDLTSPEVVTKYKSAAEIVNKALQVVLAECKPKAKIVDICEKGDAFIKEQA  107

Query  426  GNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            G+MYKN KKKI+RGVAFPTC+SVNNTV HFSPL++DE +LE
Sbjct  108  GSMYKNAKKKIDRGVAFPTCVSVNNTVGHFSPLASDETLLE  148



>ref|XP_010503881.1| PREDICTED: proliferation-associated protein 2G4-like [Camelina 
sativa]
Length=393

 Score =   173 bits (438),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 79/101 (78%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +3

Query  246  SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQT  425
            SD+ER+EKEL L+SPEVVTKYK AAEI+NKAL++V+++CKP A++VDICEKGDAFI+EQT
Sbjct  3    SDDERDEKELSLTSPEVVTKYKGAAEIVNKALQVVLAECKPKAKIVDICEKGDAFIKEQT  62

Query  426  GNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
             +MYKN KKKIERGVAFPTCISVNNTV HFSPL++DE VLE
Sbjct  63   ASMYKNAKKKIERGVAFPTCISVNNTVGHFSPLASDETVLE  103



>ref|XP_008792800.1| PREDICTED: proliferation-associated protein 2G4 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008792807.1| PREDICTED: proliferation-associated protein 2G4 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008792815.1| PREDICTED: proliferation-associated protein 2G4 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008792823.1| PREDICTED: proliferation-associated protein 2G4 isoform X1 [Phoenix 
dactylifera]
Length=397

 Score =   173 bits (438),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/103 (80%), Positives = 96/103 (93%), Gaps = 1/103 (1%)
 Frame = +3

Query  243  MSDEE-REEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIRE  419
            MSD+E +EEKELDL+ P+VVTKYK  AEI+NKAL+LV+S+CKP A++ DICEKGDAFI+E
Sbjct  1    MSDDEAKEEKELDLTFPDVVTKYKCNAEIVNKALQLVISECKPKAKIADICEKGDAFIKE  60

Query  420  QTGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            Q+GN+YKNVKKKIERGVAFPTCISVNNTVCHFSPLS+DE VLE
Sbjct  61   QSGNVYKNVKKKIERGVAFPTCISVNNTVCHFSPLSSDETVLE  103



>dbj|BAH19507.1| AT3G51800 [Arabidopsis thaliana]
Length=362

 Score =   172 bits (435),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 79/101 (78%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +3

Query  246  SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQT  425
            SD+ER+EKEL L+SPEVVTKYKSAAEI+NKAL++V+++CKP A++VDICEKGD+FI+EQT
Sbjct  3    SDDERDEKELSLTSPEVVTKYKSAAEIVNKALQVVLAECKPKAKIVDICEKGDSFIKEQT  62

Query  426  GNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
             +MYKN KKKIERGVAFPTCISVNNTV HFSPL++DE+VLE
Sbjct  63   ASMYKNSKKKIERGVAFPTCISVNNTVGHFSPLASDESVLE  103



>ref|NP_001190060.1| putative nuclear DNA-binding protein G2p  [Arabidopsis thaliana]
 gb|AEE78846.1| putative nuclear DNA-binding protein G2p [Arabidopsis thaliana]
Length=385

 Score =   172 bits (437),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 79/101 (78%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +3

Query  246  SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQT  425
            SD+ER+EKEL L+SPEVVTKYKSAAEI+NKAL++V+++CKP A++VDICEKGD+FI+EQT
Sbjct  3    SDDERDEKELSLTSPEVVTKYKSAAEIVNKALQVVLAECKPKAKIVDICEKGDSFIKEQT  62

Query  426  GNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
             +MYKN KKKIERGVAFPTCISVNNTV HFSPL++DE+VLE
Sbjct  63   ASMYKNSKKKIERGVAFPTCISVNNTVGHFSPLASDESVLE  103



>ref|XP_006654286.1| PREDICTED: proliferation-associated protein 2G4-like [Oryza brachyantha]
Length=392

 Score =   172 bits (437),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  249  DEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTG  428
            DE REEKELDLSS +VVTKYK AA+I+N AL+LVVS CKP A++VDICE+GD++IREQTG
Sbjct  5    DEVREEKELDLSSSDVVTKYKDAADIINNALKLVVSLCKPKAKIVDICERGDSYIREQTG  64

Query  429  NMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            N+YKNVK+KIERG+AFPTC+SVNNTVCHFSPL+ DEAVLE
Sbjct  65   NIYKNVKRKIERGIAFPTCLSVNNTVCHFSPLATDEAVLE  104



>ref|XP_002877825.1| hypothetical protein ARALYDRAFT_906530 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54084.1| hypothetical protein ARALYDRAFT_906530 [Arabidopsis lyrata subsp. 
lyrata]
Length=393

 Score =   172 bits (437),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 78/101 (77%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +3

Query  246  SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQT  425
            SD+ER+E+EL L+SPEVVTKYK+AAEI+NKAL++V+++CKP A++VDICEKGDAFI+EQT
Sbjct  3    SDDERDEQELSLTSPEVVTKYKTAAEIVNKALQVVLAECKPKAKIVDICEKGDAFIKEQT  62

Query  426  GNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
             +MYKN KKKIERGVAFPTCISVNNTV HFSPL++DE+VLE
Sbjct  63   ASMYKNAKKKIERGVAFPTCISVNNTVGHFSPLASDESVLE  103



>ref|NP_190748.1| putative nuclear DNA-binding protein G2p  [Arabidopsis thaliana]
 gb|AAM46648.1|AF422841_1 cell cycle-related nuclear binding protein [Arabidopsis thaliana]
 gb|AAB18127.1| G2p [Arabidopsis thaliana]
 gb|AAC14407.1| putative nuclear DNA-binding protein G2p [Arabidopsis thaliana]
 gb|AAL25197.1| nuclear DNA-binding protein [Arabidopsis thaliana]
 gb|AAL25198.1| nuclear DNA-binding protein [Arabidopsis thaliana]
 gb|AAN13085.1| putative nuclear DNA-binding protein G2p [Arabidopsis thaliana]
 gb|AEE78844.1| putative nuclear DNA-binding protein G2p [Arabidopsis thaliana]
Length=392

 Score =   172 bits (436),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 79/101 (78%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +3

Query  246  SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQT  425
            SD+ER+EKEL L+SPEVVTKYKSAAEI+NKAL++V+++CKP A++VDICEKGD+FI+EQT
Sbjct  3    SDDERDEKELSLTSPEVVTKYKSAAEIVNKALQVVLAECKPKAKIVDICEKGDSFIKEQT  62

Query  426  GNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
             +MYKN KKKIERGVAFPTCISVNNTV HFSPL++DE+VLE
Sbjct  63   ASMYKNSKKKIERGVAFPTCISVNNTVGHFSPLASDESVLE  103



>ref|NP_001149216.1| proliferation-associated protein 2G4 [Zea mays]
 gb|ACG34597.1| proliferation-associated protein 2G4 [Zea mays]
 gb|ACR36319.1| unknown [Zea mays]
 gb|AFW77740.1| hypothetical protein ZEAMMB73_275925 [Zea mays]
Length=394

 Score =   172 bits (436),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  249  DEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTG  428
            DE REEKELDLSS +VVTKYK+AAEILN AL++VVSQCKP  ++VD+CEKGD+FIREQTG
Sbjct  5    DEVREEKELDLSSNDVVTKYKAAAEILNNALKIVVSQCKPKVKIVDLCEKGDSFIREQTG  64

Query  429  NMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            N+YKN K+KIERG+AFPTC+SVN+TVCHFSPL+ D+AVLE
Sbjct  65   NVYKNAKRKIERGIAFPTCVSVNDTVCHFSPLATDDAVLE  104



>ref|NP_850679.1| putative nuclear DNA-binding protein G2p  [Arabidopsis thaliana]
 gb|AEE78845.1| putative nuclear DNA-binding protein G2p [Arabidopsis thaliana]
Length=401

 Score =   172 bits (435),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 79/101 (78%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +3

Query  246  SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQT  425
            SD+ER+EKEL L+SPEVVTKYKSAAEI+NKAL++V+++CKP A++VDICEKGD+FI+EQT
Sbjct  3    SDDERDEKELSLTSPEVVTKYKSAAEIVNKALQVVLAECKPKAKIVDICEKGDSFIKEQT  62

Query  426  GNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
             +MYKN KKKIERGVAFPTCISVNNTV HFSPL++DE+VLE
Sbjct  63   ASMYKNSKKKIERGVAFPTCISVNNTVGHFSPLASDESVLE  103



>emb|CDY29047.1| BnaC07g32530D [Brassica napus]
Length=390

 Score =   171 bits (434),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 78/101 (77%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +3

Query  246  SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQT  425
            SD+ER++KELDL+SPEVVTKYKSAAEI+NKAL++V++ CKP A++VDICEKGDAFI +QT
Sbjct  3    SDDERDDKELDLTSPEVVTKYKSAAEIVNKALQVVLAICKPGAKIVDICEKGDAFIIKQT  62

Query  426  GNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            GNMYKN KKKI+RGVAFPTC+SVNN V HFSPL+ DE+VLE
Sbjct  63   GNMYKNAKKKIDRGVAFPTCVSVNNVVGHFSPLAGDESVLE  103



>gb|EMT31637.1| Proliferation-associated protein 2G4 [Aegilops tauschii]
Length=482

 Score =   173 bits (439),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 96/102 (94%), Gaps = 1/102 (1%)
 Frame = +3

Query  246  SDEE-REEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            SDEE REEKELDLSS EVVTKYK+AAEI+NKAL+LV+S+CKP A++VDICEKGD FI EQ
Sbjct  71   SDEEVREEKELDLSSNEVVTKYKTAAEIINKALKLVLSECKPKAKIVDICEKGDNFITEQ  130

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            TGN+YKNVK+KIERG+AFPTC+SVNNTVCHFSPL+ D++VLE
Sbjct  131  TGNVYKNVKRKIERGIAFPTCVSVNNTVCHFSPLATDDSVLE  172



>gb|AFG29445.1| Erb3 binding protein [Nervilia fordii]
Length=395

 Score =   171 bits (434),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 81/103 (79%), Positives = 96/103 (93%), Gaps = 1/103 (1%)
 Frame = +3

Query  243  MSDEE-REEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIRE  419
            MSD+E +EE ELDL+S +VVTKYK+A+EI+NKAL+LVVS CKP A++VDICEKGDAFIRE
Sbjct  1    MSDDEAKEEIELDLTSSDVVTKYKAASEIVNKALQLVVSGCKPKAKIVDICEKGDAFIRE  60

Query  420  QTGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            Q G+MYKNVKKKIERGVAFPTCISVNNTVCHFSP+++D+ VLE
Sbjct  61   QAGSMYKNVKKKIERGVAFPTCISVNNTVCHFSPMASDDTVLE  103



>gb|AAK25936.1|AF360226_1 putative nuclear DNA-binding protein G2p [Arabidopsis thaliana]
 gb|AAK64125.1| putative nuclear DNA-binding protein G2p [Arabidopsis thaliana]
Length=392

 Score =   171 bits (433),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/101 (77%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +3

Query  246  SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQT  425
            SD+ER+EKEL L+SPEVVTKYKSAAEI+NKAL++V+++CKP A++VDIC+KGD+FI+EQT
Sbjct  3    SDDERDEKELSLTSPEVVTKYKSAAEIVNKALQVVLAECKPKAKIVDICDKGDSFIKEQT  62

Query  426  GNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
             +MYKN KKKIERGVAFPTCISVNNTV HFSPL++DE+VLE
Sbjct  63   ASMYKNSKKKIERGVAFPTCISVNNTVGHFSPLASDESVLE  103



>gb|EMS60472.1| Proliferation-associated protein 2G4 [Triticum urartu]
Length=520

 Score =   173 bits (439),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 96/102 (94%), Gaps = 1/102 (1%)
 Frame = +3

Query  246  SDEE-REEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            SDEE REEKELDLSS EVVTKYK+AAEI+NKAL+LV+S+CKP A++VDICEKGD FI EQ
Sbjct  42   SDEEVREEKELDLSSNEVVTKYKTAAEIINKALKLVLSECKPKAKIVDICEKGDNFITEQ  101

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            TGN+YKNVK+KIERG+AFPTC+SVNNTVCHFSPL+ D++VLE
Sbjct  102  TGNVYKNVKRKIERGIAFPTCVSVNNTVCHFSPLATDDSVLE  143



>ref|XP_006291295.1| hypothetical protein CARUB_v10017431mg [Capsella rubella]
 gb|EOA24193.1| hypothetical protein CARUB_v10017431mg [Capsella rubella]
Length=381

 Score =   170 bits (431),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/101 (77%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +3

Query  246  SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQT  425
            SD+ER+EKEL L+SPEVVTKYK AAEI+NKAL++V+++CKP A++VDICEKGDAFI+EQT
Sbjct  3    SDDERDEKELSLTSPEVVTKYKGAAEIVNKALQVVLAECKPKAKIVDICEKGDAFIKEQT  62

Query  426  GNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
             +MYKN KKKIE+GVAFPTCISVNNTV HFSPL++DE VLE
Sbjct  63   ASMYKNSKKKIEKGVAFPTCISVNNTVGHFSPLASDETVLE  103



>ref|XP_011095038.1| PREDICTED: proliferation-associated protein 2G4-like [Sesamum 
indicum]
Length=394

 Score =   169 bits (429),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 76/89 (85%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +3

Query  282  SSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTGNMYKNVKKKIE  461
            +SPEVVTKYKSAAEI+NKAL+LV+S+CKP A++VD+CEKGDAFIREQTGNMYKNVKKKIE
Sbjct  14   TSPEVVTKYKSAAEIVNKALQLVISECKPKAKIVDVCEKGDAFIREQTGNMYKNVKKKIE  73

Query  462  RGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            RGVAFPTCISVNNTVCHFSPL++DE VL+
Sbjct  74   RGVAFPTCISVNNTVCHFSPLASDETVLQ  102



>ref|XP_011077533.1| PREDICTED: proliferation-associated protein 2G4-like [Sesamum 
indicum]
Length=394

 Score =   168 bits (425),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/89 (85%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +3

Query  282  SSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTGNMYKNVKKKIE  461
            +SPEVVTKYKSAA+I+NKAL+LVVS+CKP A++VD+CEKGDAFIREQTGNMYKNVKKKIE
Sbjct  14   TSPEVVTKYKSAADIVNKALQLVVSECKPKAKIVDLCEKGDAFIREQTGNMYKNVKKKIE  73

Query  462  RGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            +GVAFPTCISVNNTVCHFSPL++DE VLE
Sbjct  74   KGVAFPTCISVNNTVCHFSPLASDETVLE  102



>ref|XP_010253797.1| PREDICTED: proliferation-associated protein 2G4-like [Nelumbo 
nucifera]
Length=397

 Score =   167 bits (424),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/89 (85%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +3

Query  282  SSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTGNMYKNVKKKIE  461
            +SPEVVTKYK+AAEI+NKAL+LV+S+CKP A++VDICEKGDAFIREQTGNMYKNVK+KIE
Sbjct  15   TSPEVVTKYKNAAEIVNKALQLVLSECKPKAKIVDICEKGDAFIREQTGNMYKNVKRKIE  74

Query  462  RGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            RGVAFPTCISVNNTVCHFSPL++DE VLE
Sbjct  75   RGVAFPTCISVNNTVCHFSPLASDETVLE  103



>gb|ABK24337.1| unknown [Picea sitchensis]
Length=394

 Score =   166 bits (421),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 78/103 (76%), Positives = 95/103 (92%), Gaps = 1/103 (1%)
 Frame = +3

Query  243  MSDEE-REEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIRE  419
            MSD+E +EEKELDL+S +VVTKYK +AEI NKAL++V+S+CKP A+VVD+CEKGD++IRE
Sbjct  1    MSDDEAKEEKELDLTSHDVVTKYKLSAEIANKALQIVLSECKPKAKVVDLCEKGDSYIRE  60

Query  420  QTGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            QTGN+YKN KKKIE+GVAFPTCISVN+TVCHFSPL+ DE VLE
Sbjct  61   QTGNVYKNAKKKIEKGVAFPTCISVNSTVCHFSPLAGDETVLE  103



>gb|EEE63363.1| hypothetical protein OsJ_18175 [Oryza sativa Japonica Group]
Length=368

 Score =   155 bits (392),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 86/100 (86%), Gaps = 7/100 (7%)
 Frame = +3

Query  249  DEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTG  428
            DE REEKELDLSS +VVTKYK AA+I+N AL+LVVS CKP A++VDICEK       QTG
Sbjct  5    DEVREEKELDLSSSDVVTKYKDAADIINNALKLVVSLCKPKAKIVDICEK-------QTG  57

Query  429  NMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            N+YKNVK+KIERGVAFPTC+SVNNTVCHFSPL+ DEAVLE
Sbjct  58   NIYKNVKRKIERGVAFPTCVSVNNTVCHFSPLATDEAVLE  97



>ref|XP_001779761.1| predicted protein [Physcomitrella patens]
 gb|EDQ55445.1| predicted protein [Physcomitrella patens]
Length=399

 Score =   155 bits (393),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 72/102 (71%), Positives = 91/102 (89%), Gaps = 1/102 (1%)
 Frame = +3

Query  243  MSDEE-REEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIRE  419
            MSD+E +EEKELDL+SP+VVTKYK AAE+ NKAL+ V++ CKP A++VD+CEKGD+ IR+
Sbjct  1    MSDDEVKEEKELDLTSPDVVTKYKCAAEVANKALQAVLADCKPGAKIVDLCEKGDSSIRD  60

Query  420  QTGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVL  545
             T  MYKN KKKI++GVAFPTC+SVNNTVCHFSPL++DE+VL
Sbjct  61   LTALMYKNSKKKIDKGVAFPTCVSVNNTVCHFSPLASDESVL  102



>ref|XP_001769950.1| predicted protein [Physcomitrella patens]
 gb|EDQ65310.1| predicted protein [Physcomitrella patens]
Length=394

 Score =   153 bits (387),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 70/102 (69%), Positives = 87/102 (85%), Gaps = 1/102 (1%)
 Frame = +3

Query  243  MSDEE-REEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIRE  419
            MSD+E +EEKELDL+SP+VVTKYK AAE+ NKAL+ V++ C P  ++VD+CEKGD+ IR+
Sbjct  1    MSDDEMKEEKELDLTSPDVVTKYKCAAEVANKALQAVLAACAPGFKIVDLCEKGDSVIRD  60

Query  420  QTGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVL  545
             T  MYKN KKKI+RGVAFPTC+SVNNTVCHFSPL+ DE+ L
Sbjct  61   LTAGMYKNFKKKIDRGVAFPTCVSVNNTVCHFSPLAGDESTL  102



>ref|XP_002963479.1| hypothetical protein SELMODRAFT_79780 [Selaginella moellendorffii]
 gb|EFJ35350.1| hypothetical protein SELMODRAFT_79780 [Selaginella moellendorffii]
Length=371

 Score =   147 bits (370),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 66/102 (65%), Positives = 89/102 (87%), Gaps = 1/102 (1%)
 Frame = +3

Query  243  MSDEE-REEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIRE  419
            MSD+E +EEKELDLSS +VVTKYK AAEI+NKAL+ V+++CK   +VV++C++GD++I+ 
Sbjct  1    MSDDESKEEKELDLSSADVVTKYKLAAEIVNKALQAVLAECKAGTKVVELCDRGDSYIKT  60

Query  420  QTGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVL  545
            QT ++YKN KKKI++GVAFPTC+S+NNTVCHFSPL+ DE  L
Sbjct  61   QTASVYKNAKKKIDKGVAFPTCVSLNNTVCHFSPLAGDETAL  102



>ref|XP_002988189.1| hypothetical protein SELMODRAFT_127648 [Selaginella moellendorffii]
 gb|EFJ10608.1| hypothetical protein SELMODRAFT_127648 [Selaginella moellendorffii]
Length=371

 Score =   146 bits (369),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 66/102 (65%), Positives = 89/102 (87%), Gaps = 1/102 (1%)
 Frame = +3

Query  243  MSDEE-REEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIRE  419
            MSD+E +EEKELDLSS +VVTKYK AAEI+NKAL+ V+++CK   +VV++C++GD++I+ 
Sbjct  1    MSDDESKEEKELDLSSADVVTKYKLAAEIVNKALQAVLAECKAGTKVVELCDRGDSYIKT  60

Query  420  QTGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVL  545
            QT ++YKN KKKI++GVAFPTC+S+NNTVCHFSPL+ DE  L
Sbjct  61   QTASVYKNAKKKIDKGVAFPTCVSLNNTVCHFSPLAGDETAL  102



>ref|XP_010920806.1| PREDICTED: proliferation-associated protein 2G4 isoform X2 [Elaeis 
guineensis]
 ref|XP_010920807.1| PREDICTED: proliferation-associated protein 2G4 isoform X2 [Elaeis 
guineensis]
Length=406

 Score =   137 bits (344),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = +3

Query  333  KALELVVSQCKPNARVVDICEKGDAFIREQTGNMYKNVKKKIERGVAFPTCISVNNTVCH  512
            KAL+LVVS+CKP A++VDICEKGD FI+EQ+GN+YKNVKKKIERGVAFPTCISVNNTVCH
Sbjct  7    KALQLVVSECKPKAKIVDICEKGDTFIKEQSGNVYKNVKKKIERGVAFPTCISVNNTVCH  66

Query  513  FSPLSNDEAVLE  548
            FSPLS DEAVLE
Sbjct  67   FSPLSGDEAVLE  78



>ref|XP_008792832.1| PREDICTED: proliferation-associated protein 2G4 isoform X2 [Phoenix 
dactylifera]
Length=376

 Score =   132 bits (332),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/78 (74%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +3

Query  315  AAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTGNMYKNVKKKIERGVAFPTCISV  494
            +  +  ++L LV+S+CKP A++ DICEKGDAFI+EQ+GN+YKNVKKKIERGVAFPTCISV
Sbjct  5    STSVTPRSLTLVISECKPKAKIADICEKGDAFIKEQSGNVYKNVKKKIERGVAFPTCISV  64

Query  495  NNTVCHFSPLSNDEAVLE  548
            NNTVCHFSPLS+DE VLE
Sbjct  65   NNTVCHFSPLSSDETVLE  82



>ref|XP_009799003.1| PREDICTED: LOW QUALITY PROTEIN: proliferation-associated protein 
2G4-like [Nicotiana sylvestris]
Length=361

 Score =   129 bits (323),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +3

Query  339  LELVVSQCKPNARVVDICEKGDAFIREQTGNMYKNVKKKIERGVAFPTCISVNNTVCHFS  518
            ++LVVS+CK  A++VD+CEKGDAFI+EQTGN+YKNVKKKIERGVAFPTCISVNNTVCHF 
Sbjct  1    MQLVVSECKTKAKIVDLCEKGDAFIKEQTGNIYKNVKKKIERGVAFPTCISVNNTVCHFX  60

Query  519  PLSNDEAVLE  548
            PLS+DE VLE
Sbjct  61   PLSSDETVLE  70



>gb|KJB36945.1| hypothetical protein B456_006G183700 [Gossypium raimondii]
Length=371

 Score =   127 bits (320),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +3

Query  333  KALELVVSQCKPNARVVDICEKGDAFIREQTGNMYKNVKKKIERGVAFPTCISVNNTVCH  512
            +AL+LVV +CKP  ++VDICEKGDAFIREQTGNMYKN K+KIERGVAFPTC+SVNNTVCH
Sbjct  10   EALQLVVKECKPKTKIVDICEKGDAFIREQTGNMYKNAKRKIERGVAFPTCLSVNNTVCH  69

Query  513  FSPLSNDEAVLE  548
            FSPL++D + L+
Sbjct  70   FSPLASDTSELQ  81



>ref|XP_001765994.1| predicted protein [Physcomitrella patens]
 gb|EDQ69315.1| predicted protein [Physcomitrella patens]
Length=378

 Score =   122 bits (305),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 65/109 (60%), Positives = 81/109 (74%), Gaps = 21/109 (19%)
 Frame = +3

Query  243  MSDEE-REEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIRE  419
            MSD+E +EEKE DL SP+VVTKYK AAE+              N ++VD+CEKGD+ IRE
Sbjct  1    MSDDEMKEEKEPDLRSPDVVTKYKCAAEV-------------ANTKIVDLCEKGDSLIRE  47

Query  420  Q---TGN----MYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVL  545
            Q   TG+    +YKN KKKI++GVAFPTC+SVNNTVCHFSPL++DE+VL
Sbjct  48   QKLFTGSQIALIYKNSKKKIDKGVAFPTCVSVNNTVCHFSPLASDESVL  96



>gb|KHN18040.1| Proliferation-associated protein 2G4, partial [Glycine soja]
Length=167

 Score =   110 bits (276),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 69/94 (73%), Gaps = 10/94 (11%)
 Frame = +3

Query  267  KELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTGNMYKNV  446
            KELDLSS EVVTKYK+AAEI+N    L ++   P    +        F   QTGN+YKNV
Sbjct  1    KELDLSSAEVVTKYKTAAEIVN---SLFLTLLMPLWSQI-------LFGFWQTGNVYKNV  50

Query  447  KKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            K+KIERGVAFPTC+SVNN VCHFSPL++DEAV+E
Sbjct  51   KRKIERGVAFPTCLSVNNVVCHFSPLASDEAVME  84



>ref|XP_002947167.1| hypothetical protein VOLCADRAFT_79596 [Volvox carteri f. nagariensis]
 gb|EFJ51757.1| hypothetical protein VOLCADRAFT_79596 [Volvox carteri f. nagariensis]
Length=382

 Score =   114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 79/104 (76%), Gaps = 4/104 (4%)
 Frame = +3

Query  243  MSDEE--REEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            MSD+   + E+E +LS PEVVTKYK+AA+I N+AL+ V+  CK  +++VD+C  GD FI 
Sbjct  1    MSDDGSIQGEQEPNLSVPEVVTKYKAAADICNRALQAVIDGCKDGSKIVDLCRTGDNFIT  60

Query  417  EQTGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            ++ GN+YK   K+IE+GVAFPTC+SVN+ V HFSP ++D + L+
Sbjct  61   KECGNIYKG--KQIEKGVAFPTCVSVNSVVGHFSPNADDTSALK  102



>ref|XP_002775231.1| proliferation-associated protein 2G4 metalloprotease, putative 
[Perkinsus marinus ATCC 50983]
 gb|EER07047.1| proliferation-associated protein 2G4 metalloprotease, putative 
[Perkinsus marinus ATCC 50983]
Length=379

 Score =   111 bits (278),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 55/99 (56%), Positives = 69/99 (70%), Gaps = 2/99 (2%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MSD E E++  DLS+P+V TKY +AA I NKALELV++  KP A V D+C  GD FI EQ
Sbjct  1    MSDSEYEDEVTDLSNPDVTTKYIAAAGITNKALELVLAAVKPGADVYDLCRLGDDFIEEQ  60

Query  423  TGNMY-KNVKKK-IERGVAFPTCISVNNTVCHFSPLSND  533
            TG +Y K VK   + +G+AFPTCIS+N    HFSPL  +
Sbjct  61   TGKLYNKKVKGAVVPKGIAFPTCISINEVAGHFSPLQGE  99



>gb|KHN20321.1| Proliferation-associated protein 2G4 [Glycine soja]
Length=165

 Score =   107 bits (268),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 72/94 (77%), Gaps = 10/94 (11%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MSD+EREEKELDLSS EVVTKYK+ AEI+NK+ +L++   +    V++I          Q
Sbjct  1    MSDDEREEKELDLSSAEVVTKYKTTAEIVNKS-KLIIFINEGALPVLNI---------YQ  50

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPL  524
            TGN+YKNVK+KIER VAFPTC+SVN+ VCHFSP+
Sbjct  51   TGNVYKNVKRKIERCVAFPTCLSVNSVVCHFSPM  84



>ref|XP_004148633.1| PREDICTED: LOW QUALITY PROTEIN: proliferation-associated protein 
2G4-like [Cucumis sativus]
Length=296

 Score =   108 bits (271),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 52/69 (75%), Positives = 61/69 (88%), Gaps = 0/69 (0%)
 Frame = +3

Query  246  SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQT  425
            SD+E EE ELDLSSP VVTKYK+AAEI+NKAL+LV+SQCKP A++VDICE GD+F  EQT
Sbjct  3    SDDESEEMELDLSSPGVVTKYKNAAEIINKALQLVISQCKPKAKIVDICEIGDSFTXEQT  62

Query  426  GNMYKNVKK  452
             N+YKNVKK
Sbjct  63   VNIYKNVKK  71



>ref|XP_002772853.1| Curved DNA-binding protein, putative [Perkinsus marinus ATCC 
50983]
 gb|EER04669.1| Curved DNA-binding protein, putative [Perkinsus marinus ATCC 
50983]
Length=221

 Score =   107 bits (266),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 53/104 (51%), Positives = 70/104 (67%), Gaps = 2/104 (2%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MSD E E++  DLS+P+V TKY +AA I NKALELV++  KP A V ++C  GD FI EQ
Sbjct  1    MSDSEYEDEVTDLSNPDVTTKYITAAGITNKALELVMNAVKPGADVYELCRLGDDFIEEQ  60

Query  423  TGNMY-KNVKKK-IERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            T  +Y K VK   + +G+AFPTCIS+N    HFSPL  +   ++
Sbjct  61   TAKLYNKKVKGSVVPKGIAFPTCISINEVAGHFSPLEGESVTIK  104



>ref|XP_001699126.1| hypothetical protein CHLREDRAFT_139416 [Chlamydomonas reinhardtii]
 gb|EDO98981.1| predicted protein [Chlamydomonas reinhardtii]
Length=387

 Score =   106 bits (265),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 72/103 (70%), Gaps = 3/103 (3%)
 Frame = +3

Query  243  MSDEER-EEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIRE  419
            MSD+   E +E +LS PEVVTKYK+AA+I N+AL  VV   K  A+VVD+C  GD FI +
Sbjct  1    MSDDGSIEHQEPNLSVPEVVTKYKAAADICNRALLAVVEAAKDGAKVVDLCRMGDQFINK  60

Query  420  QTGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            +  N+YK   K+IE+GVAFPTC+S N+ V HFSP S D   L+
Sbjct  61   ECANIYKG--KEIEKGVAFPTCVSANSIVGHFSPNSEDATALK  101



>ref|XP_002772849.1| proliferation-associated protein 2G4 metalloprotease, putative 
[Perkinsus marinus ATCC 50983]
 gb|EER04665.1| proliferation-associated protein 2G4 metalloprotease, putative 
[Perkinsus marinus ATCC 50983]
Length=382

 Score =   106 bits (265),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 53/104 (51%), Positives = 70/104 (67%), Gaps = 2/104 (2%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MSD E E++  DLS+P+V TKY +AA I NKALELV++  KP A V ++C  GD FI EQ
Sbjct  1    MSDSEYEDEVTDLSNPDVTTKYITAAGITNKALELVMNAVKPGADVYELCRLGDDFIEEQ  60

Query  423  TGNMY-KNVKKK-IERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            T  +Y K VK   + +G+AFPTCIS+N    HFSPL  +   ++
Sbjct  61   TAKLYNKKVKGSVVPKGIAFPTCISINEVAGHFSPLEGESVTIK  104



>ref|XP_007253393.1| PREDICTED: proliferation-associated protein 2G4-like [Astyanax 
mexicanus]
Length=392

 Score =   106 bits (264),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 74/99 (75%), Gaps = 7/99 (7%)
 Frame = +3

Query  243  MSDEEREEKEL--DLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            MSD+E++E+ +  DL    VVTKYK + +I N+AL+LV+   KP   V+ +CEKGDA+I 
Sbjct  1    MSDDEQQEQTIAEDL----VVTKYKMSGDIANQALKLVIEAAKPGVSVLSLCEKGDAYIM  56

Query  417  EQTGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND  533
             +TG ++K  +K +++G+AFPTC+SVNN VCHFSPL +D
Sbjct  57   AETGKVFKR-EKDMKKGIAFPTCVSVNNCVCHFSPLKSD  94



>ref|XP_002423336.1| Proliferation-associated protein 2G4, putative [Pediculus humanus 
corporis]
 gb|EEB10598.1| Proliferation-associated protein 2G4, putative [Pediculus humanus 
corporis]
Length=389

 Score =   106 bits (264),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 76/103 (74%), Gaps = 7/103 (7%)
 Frame = +3

Query  243  MSDEEREEKEL--DLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            M+D++ EEK +  DL    VVTKYK A EI+N+ L+ V+ +C+PNA V  ICE GD+ I 
Sbjct  1    MADKDVEEKTIAEDL----VVTKYKLAGEIVNRVLKQVIDKCQPNASVRQICESGDSLIL  56

Query  417  EQTGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVL  545
            E+T  ++K  +K++++G+AFPTCISVNN +CHFSP+ ND  V+
Sbjct  57   EETNKVFKK-EKELKKGIAFPTCISVNNCICHFSPIPNDPDVI  98



>ref|XP_003062941.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH52880.1| predicted protein [Micromonas pusilla CCMP1545]
Length=374

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 71/105 (68%), Gaps = 4/105 (4%)
 Frame = +3

Query  246  SDEEREEKELD-LSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            SD +REE+E + L +P VV KYK AAEI NK+L  V++ C P A+VVD C  GD  I ++
Sbjct  4    SDSDREEREDETLGNPAVVDKYKVAAEIANKSLAAVIAACVPGAKVVDACALGDKSIEDE  63

Query  423  TGNMYKNV---KKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
                Y       +KI++G+AFPTC+SVNN VCH SP  +D+AV+E
Sbjct  64   AAKFYNKKGADGQKIDKGIAFPTCVSVNNQVCHNSPAPDDDAVIE  108



>ref|NP_001002070.1| proliferation-associated 2G4, a [Danio rerio]
 emb|CAD58759.1| novel protein similar to human proliferation-associated 2G4 protein 
(PA2G4) [Danio rerio]
 gb|AAH71407.1| Proliferation-associated 2G4, a [Danio rerio]
Length=392

 Score =   104 bits (260),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 71/99 (72%), Gaps = 7/99 (7%)
 Frame = +3

Query  243  MSDEEREEKEL--DLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            MSD+E++E+ +  DL    VVTKYK   +I N+AL  V+   KP   V+ +C+KGDAFI 
Sbjct  1    MSDDEQQEQTIAEDL----VVTKYKMGGDIANQALRAVIEAAKPGVSVLSLCQKGDAFIM  56

Query  417  EQTGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND  533
             +TG ++K  +K +++G+AFPTC+SVNN VCHFSPL +D
Sbjct  57   AETGKIFKR-EKDMKKGIAFPTCVSVNNCVCHFSPLKSD  94



>gb|KIZ00762.1| hypothetical protein MNEG_7198 [Monoraphidium neglectum]
Length=383

 Score =   103 bits (257),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 69/96 (72%), Gaps = 2/96 (2%)
 Frame = +3

Query  261  EEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTGNMYK  440
            EE+ELDLS+ +VVTKYK+AAEI NKA+   V   K  A+VVD+C  GD  I ++  N++K
Sbjct  3    EEQELDLSNSDVVTKYKAAAEICNKAISAAVEASKDGAKVVDVCRIGDDVITKEVQNIFK  62

Query  441  NVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
               KK E+G+AFPTC+SVN+ V HFSP ++D   ++
Sbjct  63   G--KKFEKGIAFPTCVSVNSVVGHFSPATDDTTTIK  96



>gb|ADX97052.1| proliferation-associated protein 2g4, partial [Perca flavescens]
Length=391

 Score =   103 bits (257),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 50/97 (52%), Positives = 70/97 (72%), Gaps = 4/97 (4%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MSDEE+E+    ++   VVTKYK   +I N+AL LVV   KP   V+ +CEKGDA+I  +
Sbjct  1    MSDEEQEQT---IAEDLVVTKYKMGGDIANQALRLVVETAKPGVSVLSLCEKGDAYIMAE  57

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND  533
            TG ++K  +K++++G+AFPT +SVNN VCHFSPL +D
Sbjct  58   TGKVFKK-EKEMKKGIAFPTSVSVNNCVCHFSPLKSD  93



>ref|XP_002508417.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO69675.1| predicted protein [Micromonas sp. RCC299]
Length=376

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 69/108 (64%), Gaps = 6/108 (6%)
 Frame = +3

Query  243  MSD---EEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            MSD   +  +E E   ++P VV KYK AAEI NKAL + ++ CKP A++VDIC  GD  +
Sbjct  1    MSDYGSDAEDETETTCANPAVVDKYKVAAEIANKALAVALAACKPGAKIVDICNLGDKTV  60

Query  414  REQTGNMYKNVKK---KIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
             E+    Y    K   KIE+G+AFPTCISVN+ VCH SP S+D   LE
Sbjct  61   EEEAAKFYNKKDKDGNKIEKGIAFPTCISVNHQVCHNSPPSDDATSLE  108



>ref|XP_002047403.1| GJ11948 [Drosophila virilis]
 gb|EDW69745.1| GJ11948 [Drosophila virilis]
Length=394

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 69/97 (71%), Gaps = 2/97 (2%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            M+D E+E  E  ++   VVTKYK A EI NK L+ V+  C P+A V +IC KGD  + E+
Sbjct  1    MADVEKE-PEKTIAEDLVVTKYKLAGEIANKTLKTVIGLCVPDASVREICTKGDNLLTEE  59

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND  533
            TG +YK  +K++++G+AFPTC+SVNN VCHFSP  ND
Sbjct  60   TGKVYKK-EKELKKGIAFPTCLSVNNCVCHFSPAKND  95



>ref|XP_008294311.1| PREDICTED: proliferation-associated protein 2G4 [Stegastes partitus]
Length=391

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 70/97 (72%), Gaps = 4/97 (4%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MSD+E+E+    ++   VVTKYK   +I N+AL LVV   KP   V+ +CEKGDA+I  +
Sbjct  1    MSDDEQEQT---IAEDLVVTKYKMGGDIANQALRLVVETAKPGVSVLSLCEKGDAYIMAE  57

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND  533
            TG ++K  +K++++G+AFPT +SVNN VCHFSPL +D
Sbjct  58   TGKVFKK-EKEMKKGIAFPTSVSVNNCVCHFSPLKSD  93



>ref|XP_004544946.1| PREDICTED: proliferation-associated protein 2G4-like [Maylandia 
zebra]
Length=424

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 71/98 (72%), Gaps = 4/98 (4%)
 Frame = +3

Query  240  KMSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIRE  419
            KMSD+E+E+    ++   VVTKYK   +I N+AL LV+   KP   V+ +CEKGDA+I  
Sbjct  33   KMSDDEQEQT---IAEDLVVTKYKMGGDIANQALRLVMEAAKPGVSVLSLCEKGDAYIMV  89

Query  420  QTGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND  533
            +TG ++K  +K++++G+AFPT +SVNN VCHFSPL +D
Sbjct  90   ETGKVFKK-EKEMKKGIAFPTSVSVNNCVCHFSPLKSD  126



>ref|XP_010747198.1| PREDICTED: proliferation-associated protein 2G4 [Larimichthys 
crocea]
Length=391

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 70/97 (72%), Gaps = 4/97 (4%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MSD+E+E+    ++   VVTKYK   +I N+AL LVV   KP   V+ +CEKGDA+I  +
Sbjct  1    MSDDEQEQT---IAEDLVVTKYKMGGDIANQALRLVVETAKPGVSVLSLCEKGDAYIMAE  57

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND  533
            TG ++K  +K++++G+AFPT +SVNN VCHFSPL +D
Sbjct  58   TGKVFKK-EKEMKKGIAFPTSVSVNNCVCHFSPLKSD  93



>ref|XP_003448224.1| PREDICTED: proliferation-associated protein 2G4-like [Oreochromis 
niloticus]
Length=392

 Score =   101 bits (252),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 48/95 (51%), Positives = 68/95 (72%), Gaps = 1/95 (1%)
 Frame = +3

Query  261  EEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTGNMYK  440
            E +E  ++   VVTKYK  AEI N+AL+ VV   K    V+ +CEKGDAFI  +TG ++K
Sbjct  6    ETQEQTIADDLVVTKYKMGAEIANQALKAVVEAAKAGVSVLSLCEKGDAFIAAETGKIFK  65

Query  441  NVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVL  545
              +K++++G+AFPTC+SVNN VCHFSPL +D  ++
Sbjct  66   R-EKEMKKGIAFPTCVSVNNCVCHFSPLKSDPEII  99



>ref|XP_003441515.1| PREDICTED: proliferation-associated protein 2G4-like [Oreochromis 
niloticus]
Length=391

 Score =   101 bits (251),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 70/97 (72%), Gaps = 4/97 (4%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MSD+E+E+    ++   VVTKYK   +I N+AL LV+   KP   V+ +CEKGDA+I  +
Sbjct  1    MSDDEQEQT---IAEDLVVTKYKMGGDIANQALRLVMEAAKPGVSVLSLCEKGDAYIMAE  57

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND  533
            TG ++K  +K++++G+AFPT +SVNN VCHFSPL +D
Sbjct  58   TGKVFKK-EKEMKKGIAFPTSVSVNNCVCHFSPLKSD  93



>ref|XP_004558839.1| PREDICTED: proliferation-associated protein 2G4-like [Maylandia 
zebra]
 ref|XP_005732632.1| PREDICTED: proliferation-associated protein 2G4-like [Pundamilia 
nyererei]
 ref|XP_005914803.1| PREDICTED: proliferation-associated protein 2G4-like [Haplochromis 
burtoni]
 ref|XP_006785707.1| PREDICTED: proliferation-associated protein 2G4-like [Neolamprologus 
brichardi]
Length=392

 Score =   101 bits (251),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 49/95 (52%), Positives = 68/95 (72%), Gaps = 1/95 (1%)
 Frame = +3

Query  261  EEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTGNMYK  440
            E +E  ++   VVTKYK  AEI N+AL+ VV   K    V+ +CEKGDAFI  +TG ++K
Sbjct  6    ETQEQTIADDLVVTKYKMGAEIANQALKAVVEAAKTGVSVLSLCEKGDAFIVAETGKIFK  65

Query  441  NVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVL  545
              +K++++G+AFPTC+SVNN VCHFSPL +D  V+
Sbjct  66   R-EKEMKKGIAFPTCVSVNNCVCHFSPLKSDPEVI  99



>ref|XP_001984453.1| GH15010 [Drosophila grimshawi]
 gb|EDV96801.1| GH15010 [Drosophila grimshawi]
Length=394

 Score =   101 bits (251),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 69/97 (71%), Gaps = 2/97 (2%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            M+D E+E  E  ++   VVTKYK A EI+NK L+ V+  C  +A V DIC KGD  + E+
Sbjct  1    MADVEKE-PEKTIAEDLVVTKYKLAGEIVNKTLKTVIGLCVNDASVRDICTKGDNLLTEE  59

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND  533
            TG +YK  +K++++G+AFPTC+SVNN VCHFSP  ND
Sbjct  60   TGKVYKK-EKELKKGIAFPTCLSVNNCVCHFSPAKND  95



>ref|XP_006807648.1| PREDICTED: proliferation-associated protein 2G4-like [Neolamprologus 
brichardi]
Length=391

 Score =   101 bits (251),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 70/97 (72%), Gaps = 4/97 (4%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MSD+E+E+    ++   VVTKYK   +I N+AL LV+   KP   V+ +CEKGDA+I  +
Sbjct  1    MSDDEQEQT---IAEDLVVTKYKMGGDIANQALRLVMEAAKPGVSVLSLCEKGDAYIMAE  57

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND  533
            TG ++K  +K++++G+AFPT +SVNN VCHFSPL +D
Sbjct  58   TGKVFKK-EKEMKKGIAFPTSVSVNNCVCHFSPLKSD  93



>ref|XP_004085494.1| PREDICTED: proliferation-associated protein 2G4-like [Oryzias 
latipes]
Length=391

 Score =   101 bits (251),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 69/97 (71%), Gaps = 4/97 (4%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MSD+E+E+    ++   VVTKYK   +I N+ L LV+   KP   V+ +CEKGDA+I  +
Sbjct  1    MSDDEQEQT---IAEDLVVTKYKMGGDIANQTLRLVMEAAKPGVSVISLCEKGDAYIMAE  57

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND  533
            TG ++K  +K++++G+AFPT ISVNN VCHFSPL +D
Sbjct  58   TGKVFKK-EKEMKKGIAFPTSISVNNCVCHFSPLKSD  93



>emb|CAG06775.1| unnamed protein product [Tetraodon nigroviridis]
Length=391

 Score =   100 bits (250),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 50/97 (52%), Positives = 69/97 (71%), Gaps = 4/97 (4%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MSD+E E+    ++   VVTKYK   +I N+AL LVV    P A V+ +CEKGDA+I  +
Sbjct  1    MSDDEHEQT---IAEDIVVTKYKMGGDIANQALRLVVESACPGASVLSLCEKGDAYIMAE  57

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND  533
            TG ++K  +K++++G+AFPT ISVNN VCHFSPL +D
Sbjct  58   TGKVFKK-EKEMKKGIAFPTSISVNNCVCHFSPLKSD  93



>ref|XP_008318205.1| PREDICTED: proliferation-associated protein 2G4-like [Cynoglossus 
semilaevis]
Length=391

 Score =   100 bits (250),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 69/97 (71%), Gaps = 4/97 (4%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MSD+E+E+    ++   VVTKYK   +I N+AL LVV   KP   V+ +CE GDA+I  +
Sbjct  1    MSDDEQEQT---VAEDLVVTKYKMGGDIANQALRLVVGAAKPGLSVLSLCEMGDAYIMTE  57

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND  533
            TG ++K  +K++++G+AFPT ISVNN VCHFSPL +D
Sbjct  58   TGKVFKK-EKEMKKGIAFPTSISVNNCVCHFSPLKSD  93



>ref|XP_010764812.1| PREDICTED: proliferation-associated protein 2G4 [Notothenia coriiceps]
Length=391

 Score =   100 bits (250),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 69/97 (71%), Gaps = 4/97 (4%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MSD+E+E+    ++   VVTKYK   +I N+AL LVV    P   V+ +CEKGDA+I  +
Sbjct  1    MSDDEKEQT---IAEDLVVTKYKMGGDIANQALRLVVETAMPGVSVLSLCEKGDAYIMAE  57

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND  533
            TG ++K  +K++++G+AFPT +SVNN VCHFSPL +D
Sbjct  58   TGKVFKK-EKEMKKGIAFPTSVSVNNCVCHFSPLKSD  93



>ref|XP_001957516.1| GF10449 [Drosophila ananassae]
 gb|EDV40322.1| GF10449 [Drosophila ananassae]
Length=394

 Score =   100 bits (250),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 50/97 (52%), Positives = 68/97 (70%), Gaps = 2/97 (2%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            M+D E+E  E  ++   VVTKYK A EI+NK L+ V+  C  +A V DIC +GD  + E+
Sbjct  1    MTDVEKEP-EKTIAEDLVVTKYKLAGEIVNKTLKTVIGLCVADASVRDICTQGDNLLTEE  59

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND  533
            TG +YK  +K +++G+AFPTC+SVNN VCHFSP  ND
Sbjct  60   TGKVYKK-EKDLKKGIAFPTCLSVNNCVCHFSPAKND  95



>ref|XP_005741395.1| PREDICTED: proliferation-associated protein 2G4-like [Pundamilia 
nyererei]
 ref|XP_005944019.1| PREDICTED: proliferation-associated protein 2G4-like [Haplochromis 
burtoni]
Length=391

 Score =   100 bits (249),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 70/97 (72%), Gaps = 4/97 (4%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MSD+E+E+    ++   VVTKYK   +I N+AL LV+   KP   V+ +CEKGDA+I  +
Sbjct  1    MSDDEQEQT---IAEDLVVTKYKMGGDIANQALRLVMEAAKPGVSVLSLCEKGDAYIMVE  57

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND  533
            TG ++K  +K++++G+AFPT +SVNN VCHFSPL +D
Sbjct  58   TGKVFKK-EKEMKKGIAFPTSVSVNNCVCHFSPLKSD  93



>ref|XP_008317097.1| PREDICTED: proliferation-associated protein 2G4-like [Cynoglossus 
semilaevis]
Length=392

 Score =   100 bits (249),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 69/95 (73%), Gaps = 1/95 (1%)
 Frame = +3

Query  261  EEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTGNMYK  440
            + +E  ++   VVTKYK  AEI N+AL++VV   K    V+ +CEKGD+FI  +TG ++K
Sbjct  6    DSQEQTIADDLVVTKYKMGAEIANQALKVVVEAAKSGVSVLSLCEKGDSFIMTETGKIFK  65

Query  441  NVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVL  545
              +K++++G+AFPTC+SVNN VCHFSPL +D  ++
Sbjct  66   K-EKEMKKGIAFPTCVSVNNCVCHFSPLKSDADII  99



>ref|XP_002007862.1| GI13173 [Drosophila mojavensis]
 gb|EDW18338.1| GI13173 [Drosophila mojavensis]
Length=390

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/97 (52%), Positives = 69/97 (71%), Gaps = 2/97 (2%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            M+D E+E  E  ++   VVTKYK A EI+NK L+ V+  C  +A V +IC KGD  + E+
Sbjct  1    MADVEKE-PEKTIAEDLVVTKYKLAGEIVNKTLKTVIELCVADASVREICTKGDNLLTEE  59

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND  533
            TG +YK  +K++++G+AFPTC+SVNN VCHFSP  ND
Sbjct  60   TGKVYKK-EKELKKGIAFPTCLSVNNCVCHFSPAKND  95



>ref|XP_008877833.1| DNA-binding protein, 42 kDa [Aphanomyces invadans]
 gb|ETV93491.1| DNA-binding protein, 42 kDa [Aphanomyces invadans]
Length=407

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 72/109 (66%), Gaps = 8/109 (7%)
 Frame = +3

Query  240  KMSDEEREEKELDL------SSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKG  401
            +MSD + +E + D+      S+ +VVTKY+ AAEI   ALE V++Q  P   VV++   G
Sbjct  19   RMSDVDPQETKADVPVVEDCSNTDVVTKYRLAAEIAQSALEGVIAQLLPGKSVVEVATFG  78

Query  402  DAFIREQTGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            DA I  + G +YK+  KK+E+G+AFPTC+SVN  VCHFSPL ++   L+
Sbjct  79   DALITARAGTVYKS--KKVEKGIAFPTCLSVNEVVCHFSPLPSESVTLK  125



>ref|XP_002062021.1| GK16873 [Drosophila willistoni]
 gb|EDW73007.1| GK16873 [Drosophila willistoni]
Length=399

 Score = 99.4 bits (246),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 51/101 (50%), Positives = 69/101 (68%), Gaps = 2/101 (2%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            M+D E+E  E  ++   VVTKYK A EI+NK L+ ++  C  +A V DIC KGD  + E+
Sbjct  1    MADVEKE-PEKTIAEDLVVTKYKLAGEIVNKILKSLIDLCVVDASVRDICSKGDQLLTEE  59

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVL  545
            TG +YK  +K +++G+AFPTC+SVNN VCHFSP  ND   L
Sbjct  60   TGKVYKK-EKDLKKGIAFPTCLSVNNCVCHFSPAKNDTDYL  99



>ref|XP_003741970.1| PREDICTED: proliferation-associated protein 2G4-like [Metaseiulus 
occidentalis]
Length=381

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 68/101 (67%), Gaps = 3/101 (3%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MS+   EE+   + +  VVTKYK+A EI+N+ L  VV  CK  A V+DICE GD  + E+
Sbjct  1    MSEMHEEEQTCRIDA--VVTKYKTAGEIVNRTLAKVVEMCKAGAVVLDICEAGDKMLLEE  58

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVL  545
            T  +YK   K++ +G+AFPTCI VNN +CHFSPL ++  V+
Sbjct  59   TAGIYKK-DKELRKGIAFPTCICVNNCICHFSPLKSESPVV  98



>ref|XP_003973252.1| PREDICTED: proliferation-associated protein 2G4-like [Takifugu 
rubripes]
Length=391

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 68/97 (70%), Gaps = 4/97 (4%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MSD+E E+    ++   VVTKYK   +I N+AL LVV      A V+ +CEKGDA+I  +
Sbjct  1    MSDDEHEQT---IAEDIVVTKYKMGGDIANQALRLVVESASSGASVLGLCEKGDAYIMAE  57

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND  533
            TG ++K  +K++++G+AFPT +SVNN VCHFSPL +D
Sbjct  58   TGKVFKK-EKEMKKGIAFPTSVSVNNCVCHFSPLKSD  93



>gb|AAH44287.1| Pa2g4 protein, partial [Xenopus laevis]
Length=395

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 72/103 (70%), Gaps = 2/103 (2%)
 Frame = +3

Query  237  TKMSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            TKMS +E E++E  ++   VVTKYK   +I N+ L  +V      A ++++CEKGDA I 
Sbjct  4    TKMSGDE-EQQEQTIAEDLVVTKYKMGGDIANRVLRALVDTATAGASLLNLCEKGDAMIM  62

Query  417  EQTGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVL  545
            E+TG ++K  +K++++G+AFPT ISVNN VCHFSPL +D+  L
Sbjct  63   EETGKIFKK-EKEMKKGIAFPTSISVNNCVCHFSPLKSDQDYL  104



>ref|XP_001353865.1| GA10407 [Drosophila pseudoobscura pseudoobscura]
 ref|XP_002027807.1| GL16317 [Drosophila persimilis]
 gb|EAL29600.1| GA10407 [Drosophila pseudoobscura pseudoobscura]
 gb|EDW37526.1| GL16317 [Drosophila persimilis]
Length=391

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 68/97 (70%), Gaps = 2/97 (2%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            M+D E+E  E  ++   VVTKYK A EI+NK L+ V+  C  +A V +IC +GD  + E+
Sbjct  1    MADAEKE-PEKTIAEDLVVTKYKLAGEIVNKTLKAVIGLCVADASVREICTQGDNLLTEE  59

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND  533
            TG +YK  +K +++G+AFPTC+SVNN VCHFSP  ND
Sbjct  60   TGKVYKK-EKDLKKGIAFPTCLSVNNCVCHFSPAKND  95



>emb|CBK24689.2| unnamed protein product [Blastocystis hominis]
Length=399

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/89 (55%), Positives = 65/89 (73%), Gaps = 3/89 (3%)
 Frame = +3

Query  276  DLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTGNMYKNVKKK  455
            DLS+P VV KYK AA+I+NKAL+ V+SQC     V DIC  GD  I +Q   +YKN  K+
Sbjct  17   DLSNPNVVEKYKVAADIVNKALKGVLSQCVAGKLVSDICSFGDLLIEKQCEQIYKN--KQ  74

Query  456  IERGVAFPTCISVNNTVCHFSPLSNDEAV  542
            +E+G+AFPTC+SVN+ VCH+SP   DE++
Sbjct  75   LEKGIAFPTCVSVNDMVCHYSPYP-DESI  102



>ref|XP_005311138.1| PREDICTED: LOW QUALITY PROTEIN: proliferation-associated protein 
2G4 [Chrysemys picta bellii]
Length=394

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 67/98 (68%), Gaps = 2/98 (2%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MS EE E  EL ++   VVTKYK   +I N+ L  VV   K    V+ +CEKGDA I E+
Sbjct  1    MSGEE-EAAELTIAEDLVVTKYKMGGDIANRVLRAVVEAAKSGGSVLSLCEKGDAMIMEE  59

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDE  536
            TG ++K  +K++++G+AFPT ISVNN VCHFSPL +D+
Sbjct  60   TGKIFKK-EKEMKKGIAFPTSISVNNCVCHFSPLKSDQ  96



>ref|XP_005533908.1| PREDICTED: proliferation-associated protein 2G4 [Pseudopodoces 
humilis]
Length=401

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 68/98 (69%), Gaps = 2/98 (2%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MS EE E  EL ++   VVTKYK   +I N+ L  VV    P A V+ +CEKGDA I E+
Sbjct  1    MSGEE-EATELTIAEDLVVTKYKMGGDIANRVLRSVVEAANPGASVLCLCEKGDAMIMEE  59

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDE  536
            TG ++K  +K++++G+AFPT ISVNN VCHFSPL +D+
Sbjct  60   TGKIFKK-EKEMKKGIAFPTSISVNNCVCHFSPLKSDQ  96



>gb|AFM85909.1| proliferation-associated 2G4, partial [Callorhinchus milii]
Length=365

 Score = 98.6 bits (244),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 68/99 (69%), Gaps = 7/99 (7%)
 Frame = +3

Query  243  MSDEEREEKEL--DLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            MSDEE +E+ +  DL    VVTKYK   +I N+ L  VV   K    V  +CEKGDA I 
Sbjct  1    MSDEESQEQTIAEDL----VVTKYKMGGDIANRVLRTVVEAAKEGESVFSLCEKGDAMIM  56

Query  417  EQTGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND  533
            E+TG ++K  +K++++G+AFPTC+SVNN VCH+SPL +D
Sbjct  57   EETGKIFKK-EKEMKKGIAFPTCVSVNNCVCHYSPLKSD  94



>ref|XP_008279469.1| PREDICTED: proliferation-associated protein 2G4-like [Stegastes 
partitus]
Length=392

 Score = 98.6 bits (244),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 70/101 (69%), Gaps = 2/101 (2%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MS ++ E +E  ++   VVTKYK  AEI N+AL+ VV        V+ +CEKGDAFI  +
Sbjct  1    MSGDD-ETQEQTIADDLVVTKYKMGAEIANQALKTVVGAATAGVSVLSLCEKGDAFIAAE  59

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVL  545
            TG ++K  +K +++G+AFPTC+SVNN VCH+SPL +D  V+
Sbjct  60   TGKIFKK-EKDMKKGIAFPTCVSVNNCVCHYSPLKSDPDVI  99



>gb|AFM86347.1| proliferation-associated 2G4, partial [Callorhinchus milii]
Length=365

 Score = 98.2 bits (243),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 68/99 (69%), Gaps = 7/99 (7%)
 Frame = +3

Query  243  MSDEEREEKEL--DLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            MSDEE +E+ +  DL    VVTKYK   +I N+ L  VV   K    V  +CEKGDA I 
Sbjct  1    MSDEESQEQTIAEDL----VVTKYKMGGDIANRVLRTVVEAAKEGESVFSLCEKGDAMIM  56

Query  417  EQTGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND  533
            E+TG ++K  +K++++G+AFPTC+SVNN VCH+SPL +D
Sbjct  57   EETGKIFKK-EKEMKKGIAFPTCVSVNNCVCHYSPLKSD  94



>ref|XP_969584.1| PREDICTED: proliferation-associated protein 2G4 [Tribolium castaneum]
 gb|EFA11745.1| hypothetical protein TcasGA2_TC004235 [Tribolium castaneum]
Length=386

 Score = 98.2 bits (243),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 72/97 (74%), Gaps = 3/97 (3%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            M+DE+  EK   +S   VVTKYK A EI+N+ L+ V+ +CKP + V +ICE GD  I E+
Sbjct  1    MADEKNVEK--TISEDLVVTKYKMAGEIVNRILKQVLEKCKPGSSVREICEFGDQLITEE  58

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND  533
            T  ++K  +K++++G+AFPTC+SVNN +CHFSP++++
Sbjct  59   TSKVFKK-EKELKKGIAFPTCVSVNNCICHFSPIASE  94



>ref|XP_010907413.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X2 [Elaeis guineensis]
Length=344

 Score = 97.8 bits (242),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MSD+E +E+ELDL+SP+VVTKYKSAA+I++KAL+L VS+CKP A++VDICEKGDAFIR+ 
Sbjct  1    MSDDEAKEEELDLTSPDVVTKYKSAADIVSKALQLAVSECKPKAKIVDICEKGDAFIRDD  60

Query  423  TG  428
             G
Sbjct  61   MG  62



>ref|NP_001279838.1| proliferation-associated 2G4, 38kDa [Callorhinchus milii]
 gb|AFK10918.1| proliferation-associated protein 2G4 [Callorhinchus milii]
Length=393

 Score = 98.2 bits (243),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 68/99 (69%), Gaps = 7/99 (7%)
 Frame = +3

Query  243  MSDEEREEKEL--DLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            MSDEE +E+ +  DL    VVTKYK   +I N+ L  VV   K    V  +CEKGDA I 
Sbjct  1    MSDEESQEQTIAEDL----VVTKYKMGGDIANRVLRTVVEAAKEGESVFSLCEKGDAMIM  56

Query  417  EQTGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND  533
            E+TG ++K  +K++++G+AFPTC+SVNN VCH+SPL +D
Sbjct  57   EETGKIFKK-EKEMKKGIAFPTCVSVNNCVCHYSPLKSD  94



>ref|XP_006629280.1| PREDICTED: proliferation-associated protein 2G4-like [Lepisosteus 
oculatus]
Length=394

 Score = 98.2 bits (243),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 46/91 (51%), Positives = 65/91 (71%), Gaps = 1/91 (1%)
 Frame = +3

Query  261  EEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTGNMYK  440
            E++E  ++   VVTKYK   +I N+AL  VV   KP   V+ +CEKGDA I E+TG ++K
Sbjct  6    EQQEQTIAEDLVVTKYKMGGDIANQALRKVVEAAKPGVSVLALCEKGDALIMEETGKIFK  65

Query  441  NVKKKIERGVAFPTCISVNNTVCHFSPLSND  533
              +K++++G+AFPT +SVNN VCHFSPL +D
Sbjct  66   K-EKEMKKGIAFPTSVSVNNCVCHFSPLKSD  95



>ref|XP_005650680.1| proliferation-associated protein 1 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE26136.1| proliferation-associated protein 1 [Coccomyxa subellipsoidea 
C-169]
Length=402

 Score = 97.8 bits (242),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 67/100 (67%), Gaps = 5/100 (5%)
 Frame = +3

Query  243  MSDEE---REEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            MSD +    E +ELDLS+ +VVTKYK+AA+I N AL  V+   K  A++VD+C  GD  I
Sbjct  1    MSDYDSDVEEGQELDLSNSDVVTKYKAAADITNNALAAVIKAAKAGAKLVDLCSLGDKSI  60

Query  414  REQTGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND  533
             + +  ++K   K IE+G+AFPTC SVNN + H SPL+ D
Sbjct  61   EDASAKVFKG--KTIEKGIAFPTCTSVNNVIGHVSPLAED  98



>ref|XP_007556640.1| PREDICTED: proliferation-associated protein 2G4-like [Poecilia 
formosa]
Length=392

 Score = 97.8 bits (242),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 66/97 (68%), Gaps = 2/97 (2%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MS +E E  E  ++   VVTKYK  AEI N+AL+ V     P   V+ +C+KGD FI  +
Sbjct  1    MSGDE-ETPEQTIAEDLVVTKYKMGAEIANQALKTVAEAAAPGVSVLSLCQKGDEFIAAE  59

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND  533
            TG ++K  +K +++G+AFPTC+SVNN VCHFSPL +D
Sbjct  60   TGKIFKR-EKDMKKGIAFPTCVSVNNCVCHFSPLKSD  95



>gb|EFX72560.1| hypothetical protein DAPPUDRAFT_308181 [Daphnia pulex]
Length=387

 Score = 97.8 bits (242),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 73/100 (73%), Gaps = 1/100 (1%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            M+D++++E+E  ++   VVTKYK A EI N+ ++ V++QC   A V ++C  GD  + E+
Sbjct  1    MADKDKDEQEKTIAEDFVVTKYKMAGEISNRVIQGVIAQCVAGASVRELCTLGDKLLLEE  60

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAV  542
            T  ++K  +K++++G+AFPTC+SVNN VCHFSPL++D  V
Sbjct  61   TVKVFKK-EKELKKGIAFPTCLSVNNCVCHFSPLASDADV  99



>ref|XP_004348044.1| proliferation-associated 2G4,b [Capsaspora owczarzaki ATCC 30864]
 gb|KJE93426.1| proliferation-associated 2G4,b [Capsaspora owczarzaki ATCC 30864]
Length=395

 Score = 97.8 bits (242),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 68/96 (71%), Gaps = 1/96 (1%)
 Frame = +3

Query  255  EREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTGNM  434
            E EE +  L +P+ VTKY++A +I N+ ++ V++   P A V+ +C+ GD  I E+   +
Sbjct  8    EEEEGDFTLDNPDTVTKYRTAGDIANRVIKKVLAAAVPGATVLALCKLGDGEINEEVAKI  67

Query  435  YKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAV  542
            YK   KK+++G+AFPTC+S+N+TVCH SPLS+D A+
Sbjct  68   YK-ANKKVKKGIAFPTCVSLNSTVCHQSPLSSDAAI  102



>ref|XP_010782747.1| PREDICTED: proliferation-associated protein 2G4-like [Notothenia 
coriiceps]
Length=392

 Score = 97.4 bits (241),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 70/101 (69%), Gaps = 2/101 (2%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MS ++ + +E  ++   VVTKYK  AEI N+AL+ VV    P   V+ +C+KGDAF+  +
Sbjct  1    MSGDD-DSQEQTIADDLVVTKYKMGAEIANQALKTVVEAALPGVSVLSLCQKGDAFVMAE  59

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVL  545
            TG ++K  +K +++G AFPTC+SVNNTVCH SPL +D  V+
Sbjct  60   TGKIFKK-EKDMKKGSAFPTCVSVNNTVCHHSPLKSDPDVI  99



>ref|XP_005801435.1| PREDICTED: proliferation-associated protein 2G4-like [Xiphophorus 
maculatus]
Length=392

 Score = 97.4 bits (241),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 68/101 (67%), Gaps = 2/101 (2%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MS +E E  E  ++   VVTKYK  AEI N+AL+ V     P   V+ +C+KGD FI  +
Sbjct  1    MSGDE-ETPEQTIAEDLVVTKYKMGAEIANQALKKVAEAAAPGVSVLSLCQKGDEFIAAE  59

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVL  545
            TG ++K  +K +++G+AFPTC+SVNN VCHFSPL +D  V+
Sbjct  60   TGKIFKR-EKDMKKGIAFPTCVSVNNCVCHFSPLKSDPDVI  99



>ref|XP_011400941.1| Proliferation-associated protein A [Auxenochlorella protothecoides]
 gb|KFM27934.1| Proliferation-associated protein A [Auxenochlorella protothecoides]
Length=353

 Score = 97.4 bits (241),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 67/101 (66%), Gaps = 3/101 (3%)
 Frame = +3

Query  246  SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQT  425
            SD E  E E  +S+P+VVTKYK+AA+I+N  L  V+   KP A++VD+C  GD  I E  
Sbjct  6    SDSESRENE-SISNPDVVTKYKAAAKIVNDTLAAVIDAAKPGAKIVDLCTLGDKLITEAA  64

Query  426  GNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
               +K   K IE+G+A PTC+SVNN + HFSP +++ A L+
Sbjct  65   AKEFKG--KDIEKGIAVPTCVSVNNCIGHFSPPADNTATLK  103



>gb|ELT89178.1| hypothetical protein CAPTEDRAFT_136142, partial [Capitella teleta]
Length=142

 Score = 94.0 bits (232),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/94 (46%), Positives = 66/94 (70%), Gaps = 1/94 (1%)
 Frame = +3

Query  252  EEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTGN  431
            +  E +EL +S   VVTKY +AA+I N A+ ++       ++V+D+CEKGD FI E+T  
Sbjct  3    DAGETEELTISDDSVVTKYNTAAKIANDAVAMLQKLTVAGSKVIDLCEKGDNFIIEETDK  62

Query  432  MYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND  533
            ++++ KK +++GVAFPTC+S N  +CHFSPL +D
Sbjct  63   VFRS-KKSMKKGVAFPTCVSTNACICHFSPLKSD  95



>gb|KDO24965.1| hypothetical protein SPRG_20806 [Saprolegnia parasitica CBS 223.65]
Length=277

 Score = 96.7 bits (239),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/91 (51%), Positives = 62/91 (68%), Gaps = 2/91 (2%)
 Frame = +3

Query  276  DLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTGNMYKNVKKK  455
            D S+ +VVTKY+ AAEI   ALE V+ Q  P   VV++C  GDA I  +   +YK+  KK
Sbjct  21   DCSNTDVVTKYRLAAEIAQSALEGVIGQLAPGKSVVELCAFGDAIITARAATVYKS--KK  78

Query  456  IERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            +E+G+AFPTC+SVN  VCHFSPL N+   ++
Sbjct  79   VEKGIAFPTCVSVNEVVCHFSPLPNETTTIK  109



>ref|XP_011180648.1| PREDICTED: proliferation-associated protein 2G4 [Bactrocera cucurbitae]
Length=402

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 66/97 (68%), Gaps = 1/97 (1%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            M++ E+E  E  ++   VVTKYK A EI+NK L+ V+  C   A V DIC KGD  I ++
Sbjct  1    MAEVEKEVPEKTIAEDLVVTKYKLAGEIVNKTLKAVIDVCVAEASVRDICTKGDNLIIDE  60

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND  533
            T  +YK  +K +++G+AFPTC+SVNN VCHFSP  ND
Sbjct  61   TSKVYKK-EKDLKKGIAFPTCLSVNNCVCHFSPSKND  96



>ref|XP_001363571.1| PREDICTED: proliferation-associated protein 2G4 [Monodelphis 
domestica]
Length=394

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 48/98 (49%), Positives = 69/98 (70%), Gaps = 2/98 (2%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MS E+ E++E  ++   VVTKYK   +I N+ L +VV      A V+ +CEKGDA I E+
Sbjct  1    MSGED-EQQEQTIAEDLVVTKYKMGGDIANRVLRVVVEASTSGASVLGLCEKGDAMIMEE  59

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDE  536
            TG ++K  +K++++G+AFPT ISVNN VCHFSPL +D+
Sbjct  60   TGKIFKK-EKEMKKGIAFPTSISVNNCVCHFSPLKSDQ  96



>gb|KDO19442.1| DNA-binding protein [Saprolegnia parasitica CBS 223.65]
Length=393

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/91 (51%), Positives = 62/91 (68%), Gaps = 2/91 (2%)
 Frame = +3

Query  276  DLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTGNMYKNVKKK  455
            D S+ +VVTKY+ AAEI   ALE V+ Q  P   VV++C  GDA I  +   +YK+  KK
Sbjct  21   DCSNTDVVTKYRLAAEIAQSALEGVIGQLAPGKSVVELCAFGDAIITARAATVYKS--KK  78

Query  456  IERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            +E+G+AFPTC+SVN  VCHFSPL N+   ++
Sbjct  79   VEKGIAFPTCVSVNEVVCHFSPLPNETTTIK  109



>ref|XP_008619458.1| hypothetical protein SDRG_15074 [Saprolegnia diclina VS20]
 gb|EQC27064.1| hypothetical protein SDRG_15074 [Saprolegnia diclina VS20]
Length=393

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/91 (51%), Positives = 62/91 (68%), Gaps = 2/91 (2%)
 Frame = +3

Query  276  DLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTGNMYKNVKKK  455
            D S+ +VVTKY+ AAEI   ALE V+ Q  P   VV++C  GDA I  +   +YK+  KK
Sbjct  21   DCSNTDVVTKYRLAAEIAQSALEGVIGQLAPGKSVVELCAFGDAIITARAATVYKS--KK  78

Query  456  IERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            +E+G+AFPTC+SVN  VCHFSPL N+   ++
Sbjct  79   VEKGIAFPTCVSVNEVVCHFSPLPNETTTIK  109



>gb|ETE68956.1| Proliferation-associated protein 2G4 [Ophiophagus hannah]
Length=367

 Score = 96.7 bits (239),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 64/98 (65%), Gaps = 2/98 (2%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MS EE E  EL ++   VV KYK   EI N+ L  VV   K    V+ +CEKGD  I E+
Sbjct  1    MSGEE-EAAELTIAEDVVVNKYKMGGEIANRVLRTVVEAAKSGVSVLSLCEKGDVMIMEE  59

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDE  536
            TG ++K  +K I++G+AFPT ISVNN VCHFSPL +D+
Sbjct  60   TGKIFKK-EKDIKKGIAFPTSISVNNCVCHFSPLKSDQ  96



>ref|XP_009041985.1| hypothetical protein AURANDRAFT_55591 [Aureococcus anophagefferens]
 gb|EGB03305.1| hypothetical protein AURANDRAFT_55591 [Aureococcus anophagefferens]
Length=393

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 53/102 (52%), Positives = 72/102 (71%), Gaps = 6/102 (6%)
 Frame = +3

Query  246  SDEE----REEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            +DEE     EE ELD+S+ +V TKY+ A +I N AL+ +V Q KP A+V+D+C+ GD  I
Sbjct  9    TDEEVERSDEEVELDISNSDVCTKYREAGKIANLALQGLVLQVKPGAKVLDLCKFGDMVI  68

Query  414  REQTGNMY-KNVK-KKIERGVAFPTCISVNNTVCHFSPLSND  533
             ++ G +Y K VK K I++GVAFPTC+SVN  VCH SPL +D
Sbjct  69   TKKCGTIYQKKVKGKAIDKGVAFPTCVSVNECVCHNSPLESD  110



>ref|XP_011209005.1| PREDICTED: proliferation-associated protein 2G4 [Bactrocera dorsalis]
 ref|XP_011209006.1| PREDICTED: proliferation-associated protein 2G4 [Bactrocera dorsalis]
Length=403

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 66/97 (68%), Gaps = 1/97 (1%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            M++ E+E  E  ++   VVTKYK A EI+NK L+ V+  C   A V DIC KGD  I ++
Sbjct  1    MAEVEKEVPEKTIAEDLVVTKYKLAGEIVNKTLKAVIDLCVVEASVRDICTKGDNLIVDE  60

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND  533
            T  +YK  +K +++G+AFPTC+SVNN VCHFSP  ND
Sbjct  61   TSKVYKK-EKDLKKGIAFPTCLSVNNCVCHFSPSKND  96



>gb|ACI67880.1| Proliferation-associated protein 2G4 [Salmo salar]
 gb|ADM16001.1| Proliferation-associated protein 2G4 [Salmo salar]
Length=119

 Score = 92.8 bits (229),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 66/97 (68%), Gaps = 3/97 (3%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MSD   EE+E  ++   VVTKYK   +I N+AL +V+   K    V+ +CEKGDA I  +
Sbjct  1    MSD--NEEQEQTIAEDLVVTKYKMGGDIANQALRVVIEASKSGVSVLSLCEKGDAHIMAE  58

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND  533
            TG +++  +K +++G+AFPT +SVNN VCHFSPL +D
Sbjct  59   TGKVFRK-EKDLKKGIAFPTSVSVNNCVCHFSPLKSD  94



>ref|XP_009011773.1| hypothetical protein HELRODRAFT_156370 [Helobdella robusta]
 gb|ESO09959.1| hypothetical protein HELRODRAFT_156370 [Helobdella robusta]
Length=401

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 62/80 (78%), Gaps = 1/80 (1%)
 Frame = +3

Query  294  VVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTGNMYKNVKKKIERGVA  473
            VVTKYK AAEI+N  L+ ++ +C+ NA++ D+C+ GD  + EQT  ++K  KK +++G+A
Sbjct  22   VVTKYKMAAEIVNDVLKKLIEKCETNAKIQDLCDLGDQLLTEQTNKVFKT-KKDMKKGIA  80

Query  474  FPTCISVNNTVCHFSPLSND  533
            FPTCISVNN +CHFSPL ++
Sbjct  81   FPTCISVNNCICHFSPLKSE  100



>ref|XP_008411912.1| PREDICTED: proliferation-associated protein 2G4-like [Poecilia 
reticulata]
Length=392

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 66/97 (68%), Gaps = 2/97 (2%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MS +E E  E  ++   VVTKYK  AEI N+AL+ +     P   V+ +C+KGD FI  +
Sbjct  1    MSGDE-ETPEQTIAEDLVVTKYKMGAEIANQALKTLAEAAAPGVSVLSLCQKGDEFIAAE  59

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND  533
            TG ++K  +K +++G+AFPTC+SVNN VCHFSPL +D
Sbjct  60   TGKIFKR-EKDMKKGIAFPTCVSVNNCVCHFSPLKSD  95



>ref|XP_009839077.1| DNA-binding protein, 42 kDa [Aphanomyces astaci]
 gb|ETV71412.1| DNA-binding protein, 42 kDa [Aphanomyces astaci]
Length=391

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/109 (48%), Positives = 70/109 (64%), Gaps = 9/109 (8%)
 Frame = +3

Query  243  MSD-EEREEKEL------DLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKG  401
            MSD +E E K        D S+ +VVTKY+ AAEI   ALE V++Q  P   VV++   G
Sbjct  1    MSDVDEHETKAAEAPVVEDCSNTDVVTKYRLAAEIAQSALEGVIAQLLPGKTVVEVATFG  60

Query  402  DAFIREQTGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
            DA I  + G +YK+  KK+E+G+AFPTC+SVN  VCHFSPL ++   L+
Sbjct  61   DALIAARAGTVYKS--KKVEKGIAFPTCLSVNEVVCHFSPLPSESVTLK  107



>gb|AAV36985.2| LD30448p [Drosophila melanogaster]
Length=391

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 68/97 (70%), Gaps = 2/97 (2%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            M+D E+E  E  ++   VVTKYK A EI+NK L+ V+  C  +A V +IC +GD  + E+
Sbjct  1    MADVEKE-PEKTIAEDLVVTKYKLAGEIVNKTLKAVIGLCVVDASVREICTQGDNQLTEE  59

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND  533
            TG +YK  +K +++G+AFPTC+SVNN VCHFSP  ND
Sbjct  60   TGKVYKK-EKDLKKGIAFPTCLSVNNCVCHFSPAKND  95



>ref|XP_003880798.1| methionine aminopeptidase,related [Neospora caninum Liverpool]
 emb|CBZ50765.1| methionine aminopeptidase,related [Neospora caninum Liverpool]
Length=404

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 67/100 (67%), Gaps = 6/100 (6%)
 Frame = +3

Query  243  MSDEEREEKEL----DLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAF  410
            M+D    E E     DLS+P+VVTKY++AA+I+N AL+ V+S C P A V  +C+ GDA+
Sbjct  1    MADATGSEVEAEVVQDLSNPDVVTKYRTAADIVNGALKKVISGCIPGADVYALCKTGDAY  60

Query  411  IREQTGNMY--KNVKKKIERGVAFPTCISVNNTVCHFSPL  524
            I E    +Y  K   KK+E+G+AFPTCIS+N    HFSP+
Sbjct  61   ISEACAKVYNKKENGKKMEKGIAFPTCISINEICGHFSPV  100



>ref|XP_002083760.1| GD13178 [Drosophila simulans]
 gb|EDX09345.1| GD13178 [Drosophila simulans]
Length=391

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 68/97 (70%), Gaps = 2/97 (2%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            M+D E+E  E  ++   VVTKYK A EI+NK L+ V+  C  +A V +IC +GD  + E+
Sbjct  1    MADVEKE-PEKTIAEDLVVTKYKLAGEIVNKTLKAVIGLCVVDASVREICTQGDNQLTEE  59

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND  533
            TG +YK  +K +++G+AFPTC+SVNN VCHFSP  ND
Sbjct  60   TGKVYKK-EKDLKKGIAFPTCLSVNNCVCHFSPAKND  95



>ref|XP_002035467.1| GM13901 [Drosophila sechellia]
 gb|EDW50603.1| GM13901 [Drosophila sechellia]
Length=391

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 68/97 (70%), Gaps = 2/97 (2%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            M+D E+E  E  ++   VVTKYK A EI+NK L+ V+  C  +A V +IC +GD  + E+
Sbjct  1    MADVEKE-PEKTIAEDLVVTKYKLAGEIVNKTLKAVIGLCVVDASVREICTQGDNQLTEE  59

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND  533
            TG +YK  +K +++G+AFPTC+SVNN VCHFSP  ND
Sbjct  60   TGKVYKK-EKDLKKGIAFPTCLSVNNCVCHFSPAKND  95



>ref|XP_002093823.1| GE20541 [Drosophila yakuba]
 gb|EDW93535.1| GE20541 [Drosophila yakuba]
Length=391

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 68/97 (70%), Gaps = 2/97 (2%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            M+D E+E  E  ++   VVTKYK A EI+NK L+ V+  C  +A V +IC +GD  + E+
Sbjct  1    MADVEKE-PEKTIAEDLVVTKYKLAGEIVNKTLKAVIGLCVVDASVREICTQGDNQLTEE  59

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND  533
            TG +YK  +K +++G+AFPTC+SVNN VCHFSP  ND
Sbjct  60   TGKVYKK-EKDLKKGIAFPTCLSVNNCVCHFSPAKND  95



>ref|XP_001972015.1| GG14116 [Drosophila erecta]
 gb|EDV51041.1| GG14116 [Drosophila erecta]
Length=391

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 68/97 (70%), Gaps = 2/97 (2%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            M+D E+E  E  ++   VVTKYK A EI+NK L+ V+  C  +A V +IC +GD  + E+
Sbjct  1    MADVEKE-PEKTIAEDLVVTKYKLAGEIVNKTLKAVIGLCVVDASVREICTQGDNQLTEE  59

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND  533
            TG +YK  +K +++G+AFPTC+SVNN VCHFSP  ND
Sbjct  60   TGKVYKK-EKDLKKGIAFPTCLSVNNCVCHFSPAKND  95



>ref|NP_647984.1| CG10576, isoform A [Drosophila melanogaster]
 ref|NP_729089.2| CG10576, isoform C [Drosophila melanogaster]
 ref|NP_001286949.1| CG10576, isoform D [Drosophila melanogaster]
 gb|AAF50751.1| CG10576, isoform A [Drosophila melanogaster]
 gb|AAN12106.2| CG10576, isoform C [Drosophila melanogaster]
 gb|AHN57974.1| CG10576, isoform D [Drosophila melanogaster]
Length=391

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 68/97 (70%), Gaps = 2/97 (2%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            M+D E+E  E  ++   VVTKYK A EI+NK L+ V+  C  +A V +IC +GD  + E+
Sbjct  1    MADVEKE-PEKTIAEDLVVTKYKLAGEIVNKTLKAVIGLCVVDASVREICTQGDNQLTEE  59

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND  533
            TG +YK  +K +++G+AFPTC+SVNN VCHFSP  ND
Sbjct  60   TGKVYKK-EKDLKKGIAFPTCLSVNNCVCHFSPAKND  95



>ref|XP_003223249.1| PREDICTED: proliferation-associated protein 2G4 [Anolis carolinensis]
Length=394

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/98 (49%), Positives = 64/98 (65%), Gaps = 2/98 (2%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MS EE E  EL ++   VV KYK   EI N+ L  V    KP   V+ +CE+GD  I E+
Sbjct  1    MSGEE-ETSELTIAEDVVVNKYKMGGEIANRTLRTVTETAKPGVSVLSLCERGDEMIMEE  59

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDE  536
            TG ++K  +K +++G+AFPT ISVNN VCHFSPL +D+
Sbjct  60   TGKIFKK-EKDMKKGIAFPTSISVNNCVCHFSPLKSDQ  96



>ref|XP_004525166.1| PREDICTED: proliferation-associated protein 2G4-like [Ceratitis 
capitata]
Length=405

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 66/97 (68%), Gaps = 1/97 (1%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            M++ E+E  E  ++   VVTKYK A EI+NK L+ V+  C   A V DIC KGD  I ++
Sbjct  1    MAEVEKEVPEKTIAEDLVVTKYKLAGEIVNKTLKAVIDLCVAEASVRDICTKGDNLITDE  60

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND  533
            T  ++K  +K +++G+AFPTC+SVNN VCHFSP  ND
Sbjct  61   TSKVHKK-EKDLKKGIAFPTCLSVNNCVCHFSPSKND  96



>emb|CDQ89185.1| unnamed protein product [Oncorhynchus mykiss]
Length=393

 Score = 95.9 bits (237),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 67/97 (69%), Gaps = 3/97 (3%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MSD   EE+E  ++   VVTKYK   +I N+AL +V+ + K    V+ +CEKGDA I  +
Sbjct  1    MSD--NEEQEQTIAEDLVVTKYKMGGDIANQALRMVIEEAKSGVSVLSLCEKGDAHIMAE  58

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND  533
            TG +++  +K +++G+AFPT +SVNN VCHFSPL +D
Sbjct  59   TGKVFRK-EKDLKKGIAFPTSVSVNNCVCHFSPLKSD  94



>emb|CAJ82581.1| proliferation-associated 2G4 [Xenopus (Silurana) tropicalis]
Length=367

 Score = 95.5 bits (236),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 70/101 (69%), Gaps = 2/101 (2%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MS +E E++E  ++   VVTKYK   +I N+ L  +V      A ++++CEKGDA I E+
Sbjct  1    MSGDE-EQQEQTIAEDLVVTKYKMGGDIANRVLRTLVDAATAGASLLNLCEKGDAMIMEE  59

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVL  545
            TG ++K  +K++++G+AFPT ISVNN VCHFSPL +D+  L
Sbjct  60   TGKIFKK-EKEMKKGIAFPTSISVNNCVCHFSPLKSDQDYL  99



>gb|KFB44440.1| AGAP005108-PA-like protein [Anopheles sinensis]
Length=425

 Score = 96.3 bits (238),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 65/98 (66%), Gaps = 1/98 (1%)
 Frame = +3

Query  252  EEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTGN  431
            E++EEKEL + +P VV KYK A +I+N+ L+  +  C   A    IC KGDA + ++   
Sbjct  5    EKQEEKELTIDTPAVVEKYKVAGDIVNRVLQTTIKACVVGASAKAICLKGDAMLMQEADK  64

Query  432  MYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVL  545
             YKN ++ +++GVAFPTC+SVNN +CHFSP  ND   L
Sbjct  65   KYKN-EEDMKKGVAFPTCLSVNNCICHFSPSRNDPDYL  101



>ref|NP_001008439.1| ErbB3-binding protein 1 [Xenopus (Silurana) tropicalis]
 gb|AAH80337.1| MGC79578 protein [Xenopus (Silurana) tropicalis]
Length=390

 Score = 95.5 bits (236),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 70/101 (69%), Gaps = 2/101 (2%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MS +E E++E  ++   VVTKYK   +I N+ L  +V      A ++++CEKGDA I E+
Sbjct  1    MSGDE-EQQEQTIAEDLVVTKYKMGGDIANRVLRTLVDAATAGASLLNLCEKGDAMIMEE  59

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVL  545
            TG ++K  +K++++G+AFPT ISVNN VCHFSPL +D+  L
Sbjct  60   TGKIFKK-EKEMKKGIAFPTSISVNNCVCHFSPLKSDQDYL  99



>gb|ACI33074.1| Proliferation-associated protein 2G4 [Salmo salar]
Length=398

 Score = 95.5 bits (236),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 67/97 (69%), Gaps = 2/97 (2%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MS ++ E +E  ++   VVTKYK  AEI N+AL+ VV   K    VV +CE GDAFI  +
Sbjct  1    MSGDD-EPQEQTIADDLVVTKYKMGAEIANQALKAVVESAKAGVTVVSLCETGDAFIMAE  59

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND  533
            TG +++  +K +++G+AFPT +SVNN VCHFSPL +D
Sbjct  60   TGKVFRK-EKDLKKGIAFPTSVSVNNCVCHFSPLKSD  95



>ref|NP_001083993.1| proliferation-associated 2G4, 38kD [Xenopus laevis]
 gb|AAH84760.1| Pa2g4 protein [Xenopus laevis]
Length=390

 Score = 95.5 bits (236),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 70/101 (69%), Gaps = 2/101 (2%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MS +E E++E  ++   VVTKYK   +I N+ L  +V      A ++++CEKGDA I E+
Sbjct  1    MSGDE-EQQEQTIAEDLVVTKYKMGGDIANRVLRALVDTATAGASLLNLCEKGDAMIMEE  59

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVL  545
            TG ++K  +K++++G+AFPT ISVNN VCHFSPL +D+  L
Sbjct  60   TGKIFKK-EKEMKKGIAFPTSISVNNCVCHFSPLKSDQDYL  99



>gb|EFA84439.1| proliferation associated protein [Polysphondylium pallidum PN500]
Length=384

 Score = 95.5 bits (236),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 68/101 (67%), Gaps = 1/101 (1%)
 Frame = +3

Query  246  SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQT  425
            S++E E    DL+SP VVT Y+SAA I NKAL+ V+++C   A +VD+C  GD FI ++ 
Sbjct  10   SEDEDENIVEDLTSPWVVTCYQSAALIANKALKEVIAKCVEGAVIVDVCAAGDDFIEKEV  69

Query  426  GNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVLE  548
               + N +K +E+G+AFPT +SVNN V HFSPL  D   L+
Sbjct  70   AKTF-NKRKGLEKGIAFPTSVSVNNCVGHFSPLKGDTRTLK  109



>ref|XP_313985.4| AGAP005108-PA [Anopheles gambiae str. PEST]
 gb|EAA09411.4| AGAP005108-PA [Anopheles gambiae str. PEST]
Length=413

 Score = 95.5 bits (236),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 65/94 (69%), Gaps = 1/94 (1%)
 Frame = +3

Query  252  EEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTGN  431
            E++ ++EL +  P V+ KY+ A +++N+ L+ +V +C   A V +IC+KGD  +   TG 
Sbjct  5    EKQTDQELTIEDPTVIEKYRIAGDVVNRTLQAIVKECVAGASVKEICQKGDNMLMHDTGK  64

Query  432  MYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND  533
             YK+  + +++G+AFPTC+SVNN +CHFSP  ND
Sbjct  65   KYKH-DEDMKKGIAFPTCLSVNNCICHFSPARND  97



>ref|XP_007238523.1| PREDICTED: proliferation-associated protein 2G4-like [Astyanax 
mexicanus]
Length=248

 Score = 94.4 bits (233),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 71/99 (72%), Gaps = 7/99 (7%)
 Frame = +3

Query  243  MSDEEREEKEL--DLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            MS++E++E+ +  DL    VVTKYK  A+I N+AL+ V    KP   V+ +CEKGDAFI 
Sbjct  1    MSEDEQQEQTIAEDL----VVTKYKMGADIANRALKAVTEAAKPGVSVLSLCEKGDAFIA  56

Query  417  EQTGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND  533
             +TG +    +K+I++G+AFPTC+SVNN VCHFSPL +D
Sbjct  57   AETGKV-FKKEKEIKKGIAFPTCVSVNNFVCHFSPLKSD  94



>emb|CDQ74715.1| unnamed protein product [Oncorhynchus mykiss]
Length=393

 Score = 95.1 bits (235),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 67/97 (69%), Gaps = 3/97 (3%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MSD   EE+E  ++   VVTKYK   +I N+AL +V+   K    VV++CEKGDA I  +
Sbjct  1    MSD--NEEQEQTIAEDLVVTKYKMGGDIANQALRVVIEAAKSGVSVVNLCEKGDAHIMVE  58

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND  533
            TG +++  +K +++G+AFPT +SVNN VCHFSPL +D
Sbjct  59   TGKVFRK-EKDLKKGIAFPTSVSVNNCVCHFSPLKSD  94



>ref|XP_005184671.1| PREDICTED: proliferation-associated protein 2G4 [Musca domestica]
Length=393

 Score = 95.1 bits (235),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 68/99 (69%), Gaps = 7/99 (7%)
 Frame = +3

Query  243  MSDEEREEKEL--DLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            M++ E+EEK +  DL    VVTKYK A EI+N+ L+ V+  C  +A V DIC K D  + 
Sbjct  1    MAEIEKEEKTIAEDL----VVTKYKLAGEIVNRTLKTVIDLCVADASVRDICTKSDNLLT  56

Query  417  EQTGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND  533
            E+T  +YK  +K +++G+AFPTC+SVNN VCHFSP  ND
Sbjct  57   EETNKVYKK-EKDLKKGIAFPTCLSVNNCVCHFSPSKND  94



>ref|XP_780193.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
1 [Strongylocentrotus purpuratus]
Length=402

 Score = 95.1 bits (235),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 68/100 (68%), Gaps = 2/100 (2%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            M D + EE E  ++S  VVTKYK   +++N  L+ V+ +C   A VV IC+ GD  + E 
Sbjct  1    MPDSDSEE-EPTIASDVVVTKYKMVGDMVNDVLKQVMVKCVTGAEVVSICDFGDKTLEEM  59

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAV  542
            TG +YK   K++++G+AFPTCISVNN VCHFSPL +D+ V
Sbjct  60   TGGVYKK-DKEMKKGIAFPTCISVNNCVCHFSPLRSDKKV  98



>ref|XP_006011099.1| PREDICTED: proliferation-associated protein 2G4-like [Latimeria 
chalumnae]
Length=411

 Score = 95.1 bits (235),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 65/95 (68%), Gaps = 1/95 (1%)
 Frame = +3

Query  261  EEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTGNMYK  440
            E++E  ++   VVTKYK   +I N+ L +VV   +    VV +CEKGDA I E+TG ++K
Sbjct  6    EQQEQTVADDLVVTKYKMGGDIANRVLRMVVEAARVGESVVGLCEKGDAMIMEETGKIFK  65

Query  441  NVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVL  545
               K++++G+AFPT ISVNN VCHFSPL++D   L
Sbjct  66   K-DKEMKKGIAFPTSISVNNCVCHFSPLNSDPDYL  99



>ref|XP_002182273.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC46174.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=406

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 63/89 (71%), Gaps = 2/89 (2%)
 Frame = +3

Query  276  DLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTGNMY-KNVKK  452
            DLSS +V TKY+ AA+I+N AL+ +VSQC P   ++DICE G   I  Q+  +Y K V  
Sbjct  26   DLSSSDVCTKYQEAAKIVNLALQGLVSQCVPGGTILDICEFGQTIITTQSAKLYTKKVNG  85

Query  453  K-IERGVAFPTCISVNNTVCHFSPLSNDE  536
            + ++RGVAFP CISVN+ VC+ SPL N+E
Sbjct  86   QVVDRGVAFPVCISVNDIVCNHSPLPNEE  114



>ref|XP_010745944.1| PREDICTED: proliferation-associated protein 2G4-like [Larimichthys 
crocea]
Length=392

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 64/95 (67%), Gaps = 1/95 (1%)
 Frame = +3

Query  261  EEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTGNMYK  440
            E +E  ++   VVTKYK  AEI N+A++  V        V+ +CEKGDAFI  +TG ++K
Sbjct  6    ETQEQTIADDLVVTKYKMGAEIANQAMKTTVGAAMAGVSVLSLCEKGDAFIMAETGKIFK  65

Query  441  NVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVL  545
              +K +++G+AFPTC+SVNN VCH SPL +D  V+
Sbjct  66   K-EKDMKKGIAFPTCVSVNNCVCHHSPLKSDPDVI  99



>ref|NP_001085830.1| ErbB3-binding protein 1 [Xenopus laevis]
 gb|AAH73401.1| MGC80858 protein [Xenopus laevis]
Length=390

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/101 (46%), Positives = 70/101 (69%), Gaps = 2/101 (2%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MS +E E++E  ++   VVTKYK   +I N+ L  ++      A ++++CEKGDA I E+
Sbjct  1    MSGDE-EQQEQTIAEDLVVTKYKMGGDIANRVLRTLLDTATAGASLLNLCEKGDAMIMEE  59

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVL  545
            TG ++K  +K++++G+AFPT ISVNN VCHFSPL +D+  L
Sbjct  60   TGKIFKK-EKEMKKGIAFPTSISVNNCVCHFSPLKSDQDYL  99



>gb|ACI68772.1| Proliferation-associated protein 2G4 [Salmo salar]
Length=256

 Score = 93.6 bits (231),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 69/101 (68%), Gaps = 2/101 (2%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MS ++ + +E  ++   VVTKYK  AEI N+AL+ VV   K    VV +C KGDAFI  +
Sbjct  1    MSGDD-DPQEQTIADDLVVTKYKMGAEIANQALKAVVGAAKAGETVVSLCAKGDAFIMAE  59

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVL  545
            TG +++  +K +++G+AFPT +SVNN VCHFSPL +D  ++
Sbjct  60   TGKVFRK-EKDLKKGIAFPTSVSVNNCVCHFSPLKSDPEIV  99



>ref|XP_004070502.1| PREDICTED: proliferation-associated protein 2G4-like [Oryzias 
latipes]
Length=392

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 69/101 (68%), Gaps = 2/101 (2%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MS ++ E +E  ++   VVTKYK  AEI N+AL+ VV+       V+ +CEKGDA I  +
Sbjct  1    MSGDD-ETQEQTIADDLVVTKYKMGAEIANQALKAVVTAATAGVSVLSLCEKGDALIVAE  59

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVL  545
            TG ++K  +K +++G+AFPTC+SVNN VCH SPL +D  V+
Sbjct  60   TGKIFKR-EKDMKKGIAFPTCVSVNNCVCHHSPLKSDPDVI  99



>emb|CDQ85755.1| unnamed protein product [Oncorhynchus mykiss]
Length=398

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 63/91 (69%), Gaps = 1/91 (1%)
 Frame = +3

Query  261  EEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTGNMYK  440
            E +E  ++   VVTKYK  AEI N+AL+ VV   +    VV +CE GDAFI  +TG +++
Sbjct  6    EPQEQTIADDLVVTKYKMGAEIANQALKAVVEAARAGVTVVSLCETGDAFIMAETGKVFR  65

Query  441  NVKKKIERGVAFPTCISVNNTVCHFSPLSND  533
              +K +++G+AFPT +SVNN VCHFSPL +D
Sbjct  66   K-EKDLKKGIAFPTSVSVNNCVCHFSPLKSD  95



>ref|XP_005655650.1| PREDICTED: proliferation-associated protein 2G4 [Sus scrofa]
Length=178

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 67/98 (68%), Gaps = 2/98 (2%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MS E+ E++E  ++   VVTKYK   +I N+ L  +V        V+ +CEKGDA I E+
Sbjct  1    MSGED-EQQEQTIAEDLVVTKYKMGGDIANRVLRSLVEASCSGVSVLSLCEKGDAMIMEE  59

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDE  536
            TG ++K  +K++++G+AFPT ISVNN VCHFSPL +D+
Sbjct  60   TGKIFKK-EKEMKKGIAFPTSISVNNCVCHFSPLKSDQ  96



>ref|XP_002605416.1| hypothetical protein BRAFLDRAFT_278505 [Branchiostoma floridae]
 gb|EEN61426.1| hypothetical protein BRAFLDRAFT_278505 [Branchiostoma floridae]
Length=378

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 65/97 (67%), Gaps = 2/97 (2%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            M+D+  +E E  ++   VVTKYK A ++ N  L  +V+QC   A V D+CE GD  I E+
Sbjct  1    MADDSSDE-EQTVAKDIVVTKYKMAGDMANGILRKLVAQCVTGASVRDLCEAGDTLILEE  59

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND  533
            TG ++K   K +++G+AFPTCIS NN +CHFSPL +D
Sbjct  60   TGKVFKK-DKDMKKGIAFPTCISTNNCICHFSPLRSD  95



>ref|XP_010879916.1| PREDICTED: proliferation-associated protein 2G4-like [Esox lucius]
Length=393

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 68/97 (70%), Gaps = 3/97 (3%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MSD   EE+E  ++   VVTKYK   +I N+AL +V+   K    V+ +CEKGDA+I  +
Sbjct  1    MSD--NEEQEQTIAEDLVVTKYKMGGDIANQALCVVIEAAKSGMSVLSLCEKGDAYIMAE  58

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND  533
            TG +++  +K++++G+AFPT +SVNN VCHFSPL +D
Sbjct  59   TGKVFRK-EKELKKGIAFPTSVSVNNCVCHFSPLKSD  94



>gb|ACI33868.1| Proliferation-associated protein 2G4 [Salmo salar]
Length=393

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 66/97 (68%), Gaps = 3/97 (3%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MSD   EE+E  ++   VVTKYK   +I N+AL +V+   K    V+ +CEKGDA I  +
Sbjct  1    MSD--NEEQEQTIAEDLVVTKYKMGGDIANQALRVVIEASKSGVSVLSLCEKGDAHIMAE  58

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND  533
            TG +++  +K +++G+AFPT +SVNN VCHFSPL +D
Sbjct  59   TGKVFRK-EKDLKKGIAFPTSVSVNNCVCHFSPLKSD  94



>emb|CAG07405.1| unnamed protein product [Tetraodon nigroviridis]
Length=406

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 71/100 (71%), Gaps = 2/100 (2%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MS ++ E +E  ++   VVTK+K  A+I N+AL+++V        V+ +C KGDAFI E+
Sbjct  1    MSGDD-ETQEQTIADDLVVTKFKMGADIANRALKMLVEAAVAGTSVLSLCVKGDAFILEE  59

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAV  542
            TG ++K  +K++++G+AFPTC+SVNN VCHFSP+ +D  V
Sbjct  60   TGKIFKK-EKEMKKGIAFPTCVSVNNCVCHFSPVKSDPDV  98



>ref|XP_005335677.1| PREDICTED: proliferation-associated protein 2G4 [Ictidomys tridecemlineatus]
Length=394

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 67/98 (68%), Gaps = 2/98 (2%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MS E+ E++E  ++   VVTKYK   +I N+ L  +V    P   V+ +CEKGD  I E+
Sbjct  1    MSGED-EQQEQTIAEDLVVTKYKMGGDIANRVLRSLVEASSPGVSVLSLCEKGDNMIMEE  59

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDE  536
            TG ++K  +K++++G+AFPT ISVNN VCHFSPL +D+
Sbjct  60   TGKIFKK-EKEMKKGIAFPTSISVNNCVCHFSPLKSDQ  96



>gb|AEE62360.1| unknown [Dendroctonus ponderosae]
Length=389

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 70/99 (71%), Gaps = 7/99 (7%)
 Frame = +3

Query  243  MSDEEREEKEL--DLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            M+D++  EK +  DL    VVTKYK A EI+N+ L+LV+++C P A V  +C  GD  + 
Sbjct  1    MADDKDVEKTIAEDL----VVTKYKMAGEIVNRILKLVIAKCVPGASVKAVCLYGDELLT  56

Query  417  EQTGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND  533
            E+TG ++K   K +++G+AFPTC+SVNN +CHFSP+ ++
Sbjct  57   EETGKVFKK-DKDLKKGIAFPTCVSVNNCICHFSPVPSE  94



>ref|XP_003963121.1| PREDICTED: proliferation-associated protein 2G4-like [Takifugu 
rubripes]
Length=392

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 67/95 (71%), Gaps = 1/95 (1%)
 Frame = +3

Query  261  EEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTGNMYK  440
            E +E  ++   VVTK+K  A+I N+AL++VV        V+ +CEKGD +I E+ G ++K
Sbjct  6    ETQEQTIADDLVVTKFKMGADIANRALKMVVEAAVAGTSVLSLCEKGDTYIMEEIGKIFK  65

Query  441  NVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVL  545
              +K++++G+AFPTC+SVNN VCHFSP+ +D  V+
Sbjct  66   K-EKEMKKGIAFPTCVSVNNCVCHFSPVKSDPNVI  99



>gb|EGT51094.1| hypothetical protein CAEBREN_32580 [Caenorhabditis brenneri]
Length=192

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 64/96 (67%), Gaps = 1/96 (1%)
 Frame = +3

Query  258  REEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTGNMY  437
            ++ +E  LS   VVTKY+ AAEI N  L+ V++  K  A V D+C+ GD  I E+TG +Y
Sbjct  16   QDHEEYTLSDDAVVTKYQVAAEITNVVLKEVIANVKDGAAVGDLCDLGDKLILEKTGKLY  75

Query  438  KNVKKKIERGVAFPTCISVNNTVCHFSPLSNDEAVL  545
            K   K + +G+A PTCISV+N +CHF+PL ++  V+
Sbjct  76   KK-DKNMTKGIAMPTCISVDNCICHFTPLRSEAPVI  110



>gb|ENN76413.1| hypothetical protein YQE_07074, partial [Dendroctonus ponderosae]
Length=389

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 70/99 (71%), Gaps = 7/99 (7%)
 Frame = +3

Query  243  MSDEEREEKEL--DLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            M+D++  EK +  DL    VVTKYK A EI+N+ L+LV+++C P A V  +C  GD  + 
Sbjct  1    MADDKDVEKTIAEDL----VVTKYKMAGEIVNRILKLVIAKCVPGASVKAVCLYGDELLT  56

Query  417  EQTGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND  533
            E+TG ++K   K +++G+AFPTC+SVNN +CHFSP+ ++
Sbjct  57   EETGKVFKK-DKDLKKGIAFPTCVSVNNCICHFSPVPSE  94



>ref|XP_009039553.1| hypothetical protein AURANDRAFT_54512 [Aureococcus anophagefferens]
 gb|EGB05714.1| hypothetical protein AURANDRAFT_54512 [Aureococcus anophagefferens]
Length=395

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 69/93 (74%), Gaps = 2/93 (2%)
 Frame = +3

Query  261  EEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTGNMY-  437
            E+ ELD+S+ +V TKY+ A +I N AL+ +V Q KP A+V+++C+ GD  I ++ G++Y 
Sbjct  18   EDVELDISNSDVCTKYREAGKIANLALQGLVLQVKPGAKVLELCKFGDMVIIQKCGSIYQ  77

Query  438  KNVKKK-IERGVAFPTCISVNNTVCHFSPLSND  533
            K +K K I++GVAFPTC+SVN  VCH SPL +D
Sbjct  78   KKIKGKLIDKGVAFPTCVSVNECVCHNSPLESD  110



>emb|CDQ78322.1| unnamed protein product [Oncorhynchus mykiss]
Length=412

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 58/80 (73%), Gaps = 1/80 (1%)
 Frame = +3

Query  294  VVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTGNMYKNVKKKIERGVA  473
            VVTKYK  AEI N+AL+ VV   K    VV +C KGDAFI  +TG +++  +K +++G+A
Sbjct  17   VVTKYKMGAEIANQALKAVVEAAKAGETVVSLCAKGDAFIMAETGKVFRK-EKDLKKGIA  75

Query  474  FPTCISVNNTVCHFSPLSND  533
            FPT +SVNN VCHFSPL +D
Sbjct  76   FPTSVSVNNCVCHFSPLKSD  95



>ref|XP_005371237.1| PREDICTED: proliferation-associated protein 2G4 [Microtus ochrogaster]
Length=394

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 67/98 (68%), Gaps = 2/98 (2%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MS E+ E++E  ++   VVTKYK   +I N+ L  +V        V+ +CEKGDA I E+
Sbjct  1    MSGED-EQQEQTIAEDLVVTKYKMGGDIANRVLRSLVDAASSGVSVLSLCEKGDAMIMEE  59

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDE  536
            TG ++K  +K++++G+AFPT ISVNN VCHFSPL +D+
Sbjct  60   TGKIFKK-EKEMKKGIAFPTSISVNNCVCHFSPLKSDQ  96



>gb|ELT99251.1| hypothetical protein CAPTEDRAFT_152656 [Capitella teleta]
Length=387

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 65/91 (71%), Gaps = 1/91 (1%)
 Frame = +3

Query  261  EEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTGNMYK  440
            E +EL +S   VVTKY +AA+I N A+ ++       ++V+D+CEKGD FI E+T  +++
Sbjct  6    ETEELTISDDSVVTKYNTAAKIANDAVAMLQKLTVAGSKVIDLCEKGDNFIIEETDKVFR  65

Query  441  NVKKKIERGVAFPTCISVNNTVCHFSPLSND  533
            + KK +++GVAFPTC+S N  +CHFSPL +D
Sbjct  66   S-KKSMKKGVAFPTCVSTNACICHFSPLKSD  95



>ref|XP_008472310.1| PREDICTED: proliferation-associated protein 2G4 [Diaphorina citri]
Length=402

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/98 (49%), Positives = 69/98 (70%), Gaps = 7/98 (7%)
 Frame = +3

Query  246  SDEEREEKEL--DLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIRE  419
            +D++ EEK +  DL    VVTKYK A+EI+N+ L+LV+ +C  NA   DICE  D  + +
Sbjct  5    NDDKNEEKTIAEDL----VVTKYKMASEIVNRVLKLVIEKCVENASAKDICEFSDQLLFD  60

Query  420  QTGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND  533
            +T   +K + K +++G+AFPTCISVNN +CHFSPL +D
Sbjct  61   ETSKCFKKI-KDMKKGIAFPTCISVNNCICHFSPLRSD  97



>ref|XP_011059200.1| PREDICTED: proliferation-associated protein 2G4 [Acromyrmex echinatior]
 gb|EGI62683.1| Proliferation-associated protein 2G4 [Acromyrmex echinatior]
Length=386

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 69/93 (74%), Gaps = 1/93 (1%)
 Frame = +3

Query  255  EREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTGNM  434
            ++EE E  ++   VVTKYK A EI+N+ L+ V+++C   A V +ICE GD  + E+T  +
Sbjct  3    DKEETEKTIAEDLVVTKYKMAGEIVNRVLKQVLNKCIAGASVREICEFGDKILTEETSKV  62

Query  435  YKNVKKKIERGVAFPTCISVNNTVCHFSPLSND  533
            +K  +K++++G+AFPTCISVNN +CHFSP++++
Sbjct  63   FKK-EKELKKGIAFPTCISVNNCICHFSPIASE  94



>ref|XP_003383390.1| PREDICTED: proliferation-associated protein 2G4-like [Amphimedon 
queenslandica]
Length=391

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 61/83 (73%), Gaps = 1/83 (1%)
 Frame = +3

Query  294  VVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTGNMYKNVKKKIERGVA  473
            VVTKYK A ++ N+ L+ V+  C   A+V+D+C+ GD  I E+ G ++K  +K++++G+A
Sbjct  19   VVTKYKMAGDMANRILKTVIDGCIEGAKVLDLCQLGDQMILEEAGKVFKK-EKEMKKGIA  77

Query  474  FPTCISVNNTVCHFSPLSNDEAV  542
            FPTCISVNN VCHFSPL +D  V
Sbjct  78   FPTCISVNNCVCHFSPLKSDPLV  100



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 592801777335