BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002F03

Length=391
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AHJ60265.1|  cinnamate 4-monooxygenase                               189   2e-54   Ipomoea purpurea
gb|AFR37652.1|  cinnamate 4-hydroxylase                                 177   3e-54   Populus trichocarpa [western balsam poplar]
gb|AFR37656.1|  cinnamate 4-hydroxylase                                 177   3e-54   Populus trichocarpa [western balsam poplar]
gb|AFR37649.1|  cinnamate 4-hydroxylase                                 177   6e-54   Populus trichocarpa [western balsam poplar]
emb|CAJ41419.1|  trans-cinnamate 4-monooxygenase                        180   1e-53   Coffea arabica [arabica coffee]
gb|AFP89891.1|  cinnamate 4-hydroxylase                                 177   9e-53   Neolamarckia cadamba
gb|AFP89895.1|  cinnamate 4-hydroxylase                                 177   9e-53   Neolamarckia cadamba
gb|AFK42083.1|  unknown                                                 174   2e-52   Medicago truncatula
gb|AFP89890.1|  cinnamate 4-hydroxylase                                 176   3e-52   Neolamarckia cadamba
ref|XP_008355112.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    176   1e-51   
ref|XP_004294725.1|  PREDICTED: trans-cinnamate 4-monooxygenase         181   2e-51   Fragaria vesca subsp. vesca
emb|CDP19477.1|  unnamed protein product                                181   2e-51   Coffea canephora [robusta coffee]
gb|AFP49808.1|  cinnamate 4-hydroxylase 4                               181   2e-51   Coffea arabica [arabica coffee]
gb|ADY38556.1|  cinnamate 4-hydroxylase                                 170   5e-51   Acacia mangium
gb|ADY38559.1|  cinnamate 4-hydroxylase                                 170   8e-51   Acacia mangium
ref|NP_001281035.1|  trans-cinnamate 4-monooxygenase                    179   1e-50   Malus domestica [apple tree]
ref|XP_010094425.1|  Trans-cinnamate 4-monooxygenase                    179   1e-50   Morus notabilis
gb|EYU36901.1|  hypothetical protein MIMGU_mgv1a004876mg                179   1e-50   Erythranthe guttata [common monkey flower]
dbj|BAJ17666.1|  cinnamate 4-hydroxylase                                179   1e-50   Gynura bicolor
ref|XP_009766429.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    178   2e-50   Nicotiana sylvestris
gb|ADX33332.1|  cinnamate-4-hydroxylase 1                               178   2e-50   Petunia x hybrida [garden petunia]
sp|P48522.1|TCMO_CATRO  RecName: Full=Trans-cinnamate 4-monooxyge...    178   2e-50   Catharanthus roseus [chatas]
gb|AHB52741.1|  cinnamate 4-hydroxylase                                 178   2e-50   Pyrus x bretschneideri [bai li]
gb|ABC75596.1|  cinnamate 4-hydroxylase                                 178   2e-50   Salvia miltiorrhiza [Chinese salvia]
gb|AJD25173.1|  cytochrome P450 CYP73A120                               178   2e-50   Salvia miltiorrhiza [Chinese salvia]
gb|ABN48717.1|  cinnamate 4-hydroxylase                                 178   3e-50   Salvia miltiorrhiza [Chinese salvia]
ref|XP_007205045.1|  hypothetical protein PRUPE_ppa004544mg             177   3e-50   Prunus persica
gb|ADY38558.1|  cinnamate 4-hydroxylase                                 168   3e-50   Acacia mangium
ref|XP_009374388.1|  PREDICTED: trans-cinnamate 4-monooxygenase         178   4e-50   Pyrus x bretschneideri [bai li]
ref|XP_008240713.1|  PREDICTED: trans-cinnamate 4-monooxygenase         177   4e-50   Prunus mume [ume]
gb|AEA02459.1|  cinnamate 4-hydroxylase                                 177   4e-50   Prunus cerasifera x Prunus munsoniana
gb|AEA02458.1|  cinnamate 4-hydroxylase                                 177   4e-50   Prunus armeniaca
emb|CAM84301.1|  putative cinnamate 4-hydroxylase                       170   5e-50   Cynara cardunculus var. scolymus [artichoke]
gb|AEN19718.1|  cinnamate 4-hydroxylase                                 177   5e-50   Acacia auriculiformis x Acacia mangium
ref|XP_009601847.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    177   5e-50   Nicotiana tomentosiformis
gb|ABY51678.1|  cinnamic acid 4-hydroxylase                             172   6e-50   Plagiochasma appendiculatum
gb|ABX75854.1|  cinnamate 4-hydroxylase                                 177   6e-50   Acacia auriculiformis x Acacia mangium
gb|AAG43824.1|AF212318_1  cinnamic acid 4-hydroxylase                   177   6e-50   Capsicum annuum
gb|KDP45711.1|  hypothetical protein JCGZ_17318                         177   6e-50   Jatropha curcas
gb|AFN44010.1|  cinnamate 4-hydroxylase                                 177   7e-50   Neolamarckia cadamba
gb|ABC69413.1|  CYP73A47v2                                              177   7e-50   Nicotiana tabacum [American tobacco]
gb|AAG50231.1|AF302495_1  cinnamate 4-hydroxylase                       177   7e-50   Populus trichocarpa x Populus deltoides
gb|ACF19421.1|  candidate cinnamic acid 4-hydroxylase                   177   7e-50   Capsicum annuum
ref|XP_009798122.1|  PREDICTED: trans-cinnamate 4-monooxygenase         177   7e-50   Nicotiana sylvestris
gb|AIY32618.1|  cinnamate-4-hydroxylase                                 177   7e-50   Perilla frutescens [beefsteak-mint]
ref|XP_011080651.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    177   7e-50   Sesamum indicum [beniseed]
gb|ADZ54778.1|  trans-cinnamate 4-monooxygenase                         177   7e-50   Prunus avium [gean]
gb|ACC63873.1|  trans-cinnamate 4-hydroxylase                           177   8e-50   Populus trichocarpa [western balsam poplar]
ref|XP_002319974.1|  hypothetical protein POPTR_0013s15380g             177   8e-50   Populus trichocarpa [western balsam poplar]
gb|ABX74779.1|  cinnamate-4-hydroxylase                                 176   8e-50   Rubus coreanus [cha tian pao]
gb|ABC69046.1|  cinnamic acid 4-hydroxylase                             176   8e-50   Solanum tuberosum [potatoes]
gb|ACM17896.1|  cinnamate-4-hydroxylase                                 176   9e-50   Rubus occidentalis [black raspberry]
gb|ACM69364.1|  cinnamic acid 4-hydroxylase                             176   9e-50   Humulus lupulus [common hop]
gb|AFG30055.1|  cinnamate-4-hydroxylase                                 176   9e-50   Malus hybrid cultivar
gb|ABX74781.1|  cinnamate-4-hydroxylase                                 176   9e-50   Rubus sp. SSL-2007
ref|XP_006350887.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    176   1e-49   Solanum tuberosum [potatoes]
gb|KGN46762.1|  hypothetical protein Csa_6G133710                       174   1e-49   Cucumis sativus [cucumbers]
gb|ADX33333.1|  cinnamate-4-hydroxylase 2                               176   2e-49   Petunia x hybrida [garden petunia]
dbj|BAE72875.1|  Cinnamic acid 4-hydroxylase                            175   3e-49   Glandularia x hybrida [garden verbena]
gb|AEK94316.1|  cinnamic acid 4-hydroxylase-like protein                175   3e-49   Pyrus x bretschneideri [bai li]
ref|XP_011089532.1|  PREDICTED: trans-cinnamate 4-monooxygenase         175   3e-49   Sesamum indicum [beniseed]
gb|AGH32777.1|  cinnamic acid 4-hydroxylase                             175   3e-49   Camellia chekiangoleosa
sp|Q43033.1|TCMO_PETCR  RecName: Full=Trans-cinnamate 4-monooxyge...    175   3e-49   Petroselinum crispum
dbj|BAB71716.1|  cinnamic acid 4-hydroxylase                            175   3e-49   Lithospermum erythrorhizon
ref|XP_009607087.1|  PREDICTED: trans-cinnamate 4-monooxygenase         175   3e-49   Nicotiana tomentosiformis
gb|AHY94893.1|  cinnamate-4-hydroxylase                                 175   4e-49   Prunella vulgaris
ref|XP_008456253.1|  PREDICTED: trans-cinnamate 4-monooxygenase         174   4e-49   Cucumis melo [Oriental melon]
ref|NP_001266151.1|  trans-cinnamate 4-monooxygenase                    174   4e-49   
gb|EYU46023.1|  hypothetical protein MIMGU_mgv1a004904mg                174   5e-49   Erythranthe guttata [common monkey flower]
gb|AID16078.1|  cinnamate 4-hydroxylase                                 174   5e-49   Morus alba
gb|ADO16244.1|  cinnamate 4-hydroxylase                                 174   6e-49   Ocimum basilicum [basil]
gb|AGM46644.1|  cinnamate 4-hydroxylase protein                         169   6e-49   Apium graveolens
gb|ACF74449.1|  trans-cinnamate 4-monooxygenase                         174   6e-49   Echinacea angustifolia [black sampson]
ref|XP_003616037.1|  Trans-cinnamate 4-monooxygenase                    174   6e-49   Medicago truncatula
ref|XP_009354901.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    174   7e-49   
gb|ADN32769.1|  cinnamate 4-hydroxylase                                 174   7e-49   Scutellaria baicalensis [Baikal skullcap]
ref|XP_004139932.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    174   8e-49   
ref|XP_004154553.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    174   8e-49   
gb|AFU54390.1|  cinnamate 4-hydroxylase                                 174   8e-49   Fagopyrum tataricum [Kangra buckwheat]
gb|KHG02507.1|  Cytochrome P450 protein                                 174   9e-49   Gossypium arboreum [tree cotton]
gb|ADO16243.1|  cinnamate 4-hydroxylase                                 174   9e-49   Ocimum tenuiflorum [holy basil]
gb|AAG10197.1|  cinnamate-4-hydroxylase                                 174   1e-48   Gossypium arboreum [tree cotton]
ref|XP_003544934.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    173   1e-48   Glycine max [soybeans]
gb|KJB72975.1|  hypothetical protein B456_011G207000                    173   1e-48   Gossypium raimondii
ref|XP_007011365.1|  Cinnamate-4-hydroxylase                            173   1e-48   
gb|ACR44227.1|  C4H                                                     173   1e-48   Glycine max [soybeans]
ref|NP_001237317.1|  trans-cinnamate 4-monooxygenase                    173   2e-48   Glycine max [soybeans]
gb|AEM63672.1|  cinnamate 4-hydroxylase                                 173   2e-48   Platycodon grandiflorus [balloon-flower]
gb|AGJ84133.1|  putative trans-cinnamate 4-hydroxylase                  173   2e-48   Hibiscus cannabinus [bimli-jute]
gb|AEM63594.1|  cinnamate 4-hydroxylase                                 173   2e-48   Leucaena leucocephala [cassie]
ref|XP_010253046.1|  PREDICTED: trans-cinnamate 4-monooxygenase         172   2e-48   Nelumbo nucifera [Indian lotus]
gb|ABD77493.2|  cinnamic acid 4-hydroxylase                             172   2e-48   Arnebia euchroma
ref|XP_002881114.1|  cinnamate-4-hydroxylase                            172   3e-48   
gb|AGX85600.1|  coumarate 4-hydroxylase                                 172   3e-48   Scoparia dulcis [escobilla]
gb|AIB06733.1|  cinnamate 4-mono-oxygenase                              172   4e-48   Mangifera indica
ref|XP_006410152.1|  hypothetical protein EUTSA_v10016545mg             172   4e-48   Eutrema salsugineum [saltwater cress]
sp|Q04468.1|TCMO_HELTU  RecName: Full=Trans-cinnamate 4-monooxyge...    172   4e-48   Helianthus tuberosus [Jerusalem artichoke]
ref|XP_009354868.1|  PREDICTED: trans-cinnamate 4-monooxygenase         172   5e-48   Pyrus x bretschneideri [bai li]
ref|XP_010685980.1|  PREDICTED: trans-cinnamate 4-monooxygenase         172   5e-48   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010510361.1|  PREDICTED: trans-cinnamate 4-monooxygenase         171   6e-48   Camelina sativa [gold-of-pleasure]
ref|XP_010414263.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    171   6e-48   Camelina sativa [gold-of-pleasure]
ref|XP_006294053.1|  hypothetical protein CARUB_v10023044mg             171   6e-48   Capsella rubella
gb|AGC29944.1|  CYP73A107                                               171   7e-48   Sinopodophyllum hexandrum [Himalayan mayapple]
sp|P37115.1|TCMO_VIGRR  RecName: Full=Trans-cinnamate 4-monooxyge...    171   7e-48   Vigna radiata var. radiata [golden gram]
gb|ACR10242.1|  cinnamate-4-hydroxylase                                 171   8e-48   Canarium album [Chinese white-olive]
gb|AHG97392.1|  C4H catalytic cinnamic acid-4-hydroxylase               171   9e-48   Ageratina adenophora
sp|Q43240.1|TCMO_ZINVI  RecName: Full=Trans-cinnamate 4-monooxyge...    171   2e-47   Zinnia elegans [garden zinnia]
gb|AAO62904.1|  cinnamate 4-hydroxylase                                 171   2e-47   Ammi majus [ameo mayor]
gb|AJD22263.1|  cinnamate 4-hydroxylase                                 170   2e-47   Angelica dahurica
gb|ADG43134.1|  cinnamate 4-hydroxylase                                 170   2e-47   Isatis tinctoria [woad]
gb|ABE68874.1|  cinnamate 4-hydroxylase                                 170   3e-47   Brassica rapa subsp. pekinensis [bai cai]
ref|XP_008810838.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    170   3e-47   Phoenix dactylifera
dbj|BAI77480.1|  cinnamate-4-hydroxylase                                170   3e-47   Brassica rapa
dbj|BAF81522.1|  cinnamate-4-hydroxylase                                169   3e-47   Brassica rapa
ref|NP_001288861.1|  trans-cinnamate 4-monooxygenase                    169   3e-47   Brassica rapa
gb|ABF17873.1|  cinnamate 4-hydroxylase isoform 1                       169   4e-47   Brassica napus [oilseed rape]
gb|ACY78690.1|  trans-cinnamate 4-monooxygenase                         169   4e-47   Cynara cardunculus var. scolymus [artichoke]
gb|AHL83550.1|  C4H                                                     169   4e-47   Morus alba var. multicaulis
gb|AFG26507.1|  putative cinnamate 4-hydroxylase                        159   4e-47   Leucaena leucocephala [cassie]
gb|AEV93475.1|  4-coumarate:CoA ligase                                  169   6e-47   Caragana korshinskii
gb|AAS48416.1|  cinammate 4-hydroxylase                                 169   6e-47   Allium cepa
gb|AHA84274.1|  trans-cinnamate 4-monooxygenase                         169   7e-47   Phaseolus vulgaris [French bean]
gb|AGU91429.1|  trans-cinnamate 4-monooxygenase                         168   8e-47   Chrysanthemum boreale
sp|P37114.1|TCMO_MEDSA  RecName: Full=Trans-cinnamate 4-monooxyge...    168   9e-47   Medicago sativa [alfalfa]
ref|XP_010921158.1|  PREDICTED: trans-cinnamate 4-monooxygenase         168   9e-47   Elaeis guineensis
gb|AGG55322.1|  cinnamate 4-hydroxylase                                 168   1e-46   Paeonia lactiflora [common garden peony]
gb|ADO24190.1|  cinnamate 4-hydroxylase                                 168   1e-46   Allium sativum
gb|ACB78015.1|  cinnamic acid 4-hydroxylase                             168   1e-46   Trifolium pratense [peavine clover]
gb|ADO16181.1|  cytochrome P450 mono-oxygenase                          168   1e-46   Artemisia annua [sweet Annie]
gb|ACJ37399.1|  trans-cinnamate 4-monooxygenase                         168   1e-46   Echinacea angustifolia [black sampson]
ref|XP_009354880.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    168   1e-46   Pyrus x bretschneideri [bai li]
gb|AFV47361.1|  C4H                                                     167   2e-46   Helichrysum aureonitens
ref|XP_004242478.1|  PREDICTED: trans-cinnamate 4-monooxygenase         163   3e-46   Solanum lycopersicum
ref|XP_004242477.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    163   3e-46   Solanum lycopersicum
gb|AAU09021.1|  Cinnamic acid 4-hydroxylase                             167   3e-46   Agastache rugosa
ref|XP_006842509.1|  hypothetical protein AMTR_s00077p00107120          166   5e-46   Amborella trichopoda
gb|AID69233.1|  cinnamate 4-hydroxylase                                 166   5e-46   Garcinia mangostana [mangosteen]
ref|XP_008782669.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    166   7e-46   Phoenix dactylifera
emb|CDY23996.1|  BnaC03g16950D                                          164   3e-45   Brassica napus [oilseed rape]
gb|ACY06865.2|  cinnamate 4-hydroxylase                                 164   4e-45   Astragalus chrysochlorus
gb|AFR37664.1|  cinnamate 4-hydroxylase                                 154   4e-45   Populus alba [abele]
gb|AFR37668.1|  cinnamate 4-hydroxylase                                 154   5e-45   Populus alba [abele]
ref|XP_010938024.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    163   1e-44   Elaeis guineensis
gb|AEH68208.1|  cinnamate 4-hydroxylase                                 163   1e-44   Astragalus mongholicus
ref|XP_002458683.1|  hypothetical protein SORBIDRAFT_03g038160          162   1e-44   Sorghum bicolor [broomcorn]
sp|Q96423.1|TCMO_GLYEC  RecName: Full=Trans-cinnamate 4-monooxyge...    162   1e-44   Glycyrrhiza echinata [hedgehog licorice]
gb|ACZ54906.1|  cinnamate 4-hydroxylase                                 162   1e-44   Leucaena leucocephala [cassie]
ref|XP_004970385.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    162   2e-44   
gb|AEM63593.1|  cinnamate 4-hydroxylase                                 162   2e-44   Leucaena leucocephala [cassie]
gb|AFR37527.1|  cinnamate 4-hydroxylase                                 152   3e-44   Populus nigra [black poplar]
gb|AID51447.1|  cinnamate 4-hydroxylase 2                               162   3e-44   Astragalus membranaceus
gb|AGO03798.1|  cytochrome P450-like protein                            161   4e-44   Tanacetum cinerariifolium [pyrethrum]
gb|AFR37513.1|  cinnamate 4-hydroxylase                                 152   8e-44   Populus alba [abele]
gb|AGN70893.1|  cinammate 4-hydroxylase                                 160   8e-44   Dendrobium officinale
gb|AFR37514.1|  cinnamate 4-hydroxylase                                 152   8e-44   Populus alba [abele]
gb|ACB78016.1|  cinnamic acid 4-hydroxylase                             160   9e-44   Trifolium pratense [peavine clover]
gb|ACB78014.1|  cinnamic acid 4-hydroxylase                             160   9e-44   Trifolium pratense [peavine clover]
ref|XP_010103664.1|  Trans-cinnamate 4-monooxygenase                    160   9e-44   Morus notabilis
gb|AFD36436.1|  cinnamate 4-hydroxylase 1                               160   1e-43   Astragalus membranaceus
gb|AFD29887.1|  cinnamate 4-hydroxylase                                 160   1e-43   Bambusa emeiensis
gb|ACZ73612.1|  cinnamate 4-hydroxylase                                 160   1e-43   Bambusa oldhamii
gb|AFR37522.1|  cinnamate 4-hydroxylase                                 150   1e-43   Populus fremontii
gb|AFR37528.1|  cinnamate 4-hydroxylase                                 150   2e-43   Populus nigra [black poplar]
gb|AFR37504.1|  cinnamate 4-hydroxylase                                 150   3e-43   Populus trichocarpa [western balsam poplar]
gb|AFR37525.1|  cinnamate 4-hydroxylase                                 150   3e-43   Populus fremontii
gb|AFR37498.1|  cinnamate 4-hydroxylase                                 150   3e-43   Populus trichocarpa [western balsam poplar]
gb|AFR37523.1|  cinnamate 4-hydroxylase                                 150   3e-43   Populus fremontii
dbj|BAB71717.1|  cinnamic acid 4-hydroxylase                            159   3e-43   Lithospermum erythrorhizon
gb|AAV36374.1|  cinnamate 4-hydroxylase                                 150   4e-43   Pinus taeda
gb|ADB65927.1|  cinnamate 4-hydroxylase                                 158   5e-43   Ipomoea batatas [batate]
gb|AFR37519.1|  cinnamate 4-hydroxylase                                 150   5e-43   Populus fremontii
gb|AHJ61295.1|  cinnamate-4-hydroxylase                                 158   5e-43   Hordeum vulgare [barley]
gb|AHY28685.1|  cinnamate 4-hydroxylase 1                               150   5e-43   Pinus echinata [shortleaf pine]
gb|AAV36368.1|  cinnamate 4-hydroxylase                                 149   5e-43   Pinus taeda
dbj|BAJ95120.1|  predicted protein                                      158   5e-43   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AHY28700.1|  cinnamate 4-hydroxylase 1                               149   6e-43   Pinus taeda
ref|XP_003564495.1|  PREDICTED: trans-cinnamate 4-monooxygenase         157   9e-43   Brachypodium distachyon [annual false brome]
dbj|BAJ22964.1|  cinnamate 4-hydroxylase                                150   1e-42   Agastache foeniculum [anise hyssop]
ref|XP_010032943.1|  PREDICTED: trans-cinnamate 4-monooxygenase         157   1e-42   Eucalyptus grandis [rose gum]
gb|AGJ71350.1|  cinnamate 4-hydroxylase 1                               157   1e-42   Eucalyptus urophylla
gb|AAV36401.1|  cinnamate 4-hydroxylase                                 149   1e-42   Pinus taeda
gb|AHY28687.1|  cinnamate 4-hydroxylase 1                               149   1e-42   Pinus echinata [shortleaf pine]
gb|AFR37521.1|  cinnamate 4-hydroxylase                                 149   2e-42   Populus fremontii
gb|AAV36377.1|  cinnamate 4-hydroxylase                                 148   2e-42   Pinus taeda
gb|ACE88962.1|  cinnamic acid 4-hydroxylase                             156   2e-42   Phyllostachys edulis [kikko-chiku]
ref|XP_007146898.1|  hypothetical protein PHAVU_006G079700g             156   2e-42   Phaseolus vulgaris [French bean]
pir||PC4236  trans-cinnamate 4-monooxygenase (EC 1.14.13.11) B - ...    153   1e-41
ref|XP_006410151.1|  hypothetical protein EUTSA_v10016544mg             154   2e-41   Eutrema salsugineum [saltwater cress]
ref|XP_009132738.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    153   3e-41   Brassica rapa
emb|CDX84830.1|  BnaA03g14000D                                          153   5e-41   
gb|ABF69101.1|  trans-cinnamate 4-hydroxylase                           152   5e-41   Populus tremuloides
gb|AAG10196.1|AF286647_1  cinnamate-4-hydroxylase                       152   1e-40   Gossypium arboreum [tree cotton]
gb|ACZ06240.1|  cinnamate 4-hydroxylase 2                               152   1e-40   Gossypium hirsutum [American cotton]
gb|ACE95171.1|  cinnamate-4-hydroxylase                                 151   2e-40   Populus tomentosa [Chinese white poplar]
ref|XP_011021057.1|  PREDICTED: trans-cinnamate 4-monooxygenase         151   2e-40   Populus euphratica
gb|ABF69102.1|  trans-cinnamate 4-hydroxylase                           151   2e-40   Populus tremuloides
ref|XP_004500376.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    151   2e-40   Cicer arietinum [garbanzo]
ref|XP_009416323.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    151   2e-40   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAC99993.1|  cinnamate 4-hydroxylase                                 151   3e-40   Arabidopsis thaliana [mouse-ear cress]
emb|CAK95273.1|  cinnamate-4-hydroxylase                                151   3e-40   Cucumis sativus [cucumbers]
gb|AAB58355.1|  cinnamate-4-hydroxylase                                 150   3e-40   Arabidopsis thaliana [mouse-ear cress]
emb|CAP08828.1|  cinnamate-4-hydroxylase                                150   3e-40   Arabidopsis thaliana [mouse-ear cress]
emb|CAP08827.1|  cinnamate-4-hydroxylase                                150   3e-40   Arabidopsis thaliana [mouse-ear cress]
sp|O24312.1|TCMO_POPTM  RecName: Full=Trans-cinnamate 4-monooxyge...    150   3e-40   Populus tremuloides
sp|Q43054.1|TCMO_POPKI  RecName: Full=Trans-cinnamate 4-monooxyge...    150   3e-40   Populus sieboldii x Populus grandidentata
gb|EAY76296.1|  hypothetical protein OsI_04230                          150   4e-40   Oryza sativa Indica Group [Indian rice]
gb|EAZ35606.1|  hypothetical protein OsJ_19896                          150   4e-40   Oryza sativa Japonica Group [Japonica rice]
gb|ABF69099.1|  trans-cinnamate 4-hydroxylase                           150   4e-40   Populus tremuloides
gb|AFZ78542.1|  cinnamate 4-hydroxylase                                 150   5e-40   Populus tomentosa [Chinese white poplar]
gb|ABA59555.1|  cinnamate-4-hydroxylase                                 150   6e-40   Parthenocissus henryana
gb|ABF69100.1|  trans-cinnamate 4-hydroxylase                           150   7e-40   Populus tremuloides
gb|KFK22945.1|  hypothetical protein AALP_AAs47561U000100               150   7e-40   Arabis alpina [alpine rockcress]
ref|XP_011041784.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    149   8e-40   Populus euphratica
ref|XP_011015228.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    149   8e-40   Populus euphratica
emb|CAE54486.1|  unnamed protein product                                142   1e-39   Pinus pinaster [cluster pine]
ref|XP_002325638.1|  trans-cinnamate 4-monooxygenase family protein     149   1e-39   Populus trichocarpa [western balsam poplar]
gb|AAT39513.1|  cinnamate-4-hydroxylase                                 149   1e-39   Camptotheca acuminata
gb|EMS49797.1|  Trans-cinnamate 4-monooxygenase                         149   1e-39   Triticum urartu
gb|KDO45077.1|  hypothetical protein CISIN_1g021610mg                   145   2e-39   Citrus sinensis [apfelsine]
emb|CAP08829.1|  cinnamate-4-hydroxylase                                149   2e-39   Arabidopsis thaliana [mouse-ear cress]
gb|KDO45078.1|  hypothetical protein CISIN_1g021610mg                   144   3e-39   Citrus sinensis [apfelsine]
emb|CDX84829.1|  BnaA03g14010D                                          148   3e-39   
gb|AIT52343.1|  cinammate 4-hydroxylase 2                               144   3e-39   Daucus carota [carrots]
emb|CDY23995.1|  BnaC03g16960D                                          148   3e-39   Brassica napus [oilseed rape]
ref|XP_010252045.1|  PREDICTED: trans-cinnamate 4-monooxygenase         147   5e-39   Nelumbo nucifera [Indian lotus]
gb|KJB83924.1|  hypothetical protein B456_013G271700                    147   7e-39   Gossypium raimondii
ref|NP_180607.1|  trans-cinnamate 4-monooxygenase                       147   9e-39   Arabidopsis thaliana [mouse-ear cress]
sp|Q9AR74.1|TCMO_RUTGR  RecName: Full=Trans-cinnamate 4-monooxyge...    146   9e-39   Ruta graveolens
dbj|BAA24355.1|  trans-cinnamate 4-hydroxylase                          146   1e-38   Arabidopsis thaliana [mouse-ear cress]
emb|CDX97826.1|  BnaC04g41130D                                          146   1e-38   
gb|ABF17875.1|  cinnamate 4-hydroxylase isoform 2                       146   1e-38   Brassica napus [oilseed rape]
gb|AGP25594.1|  cinnamate 4-hydroxylase                                 146   1e-38   Aquilaria sinensis
dbj|BAA24356.1|  trans-ciinamate 4-hydroxylase                          137   1e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007017089.1|  Cinnamate-4-hydroxylase                            146   2e-38   Theobroma cacao [chocolate]
gb|AAN63028.1|  cinnamate 4-hydroxylase                                 145   2e-38   Ruta graveolens
ref|XP_002523952.1|  cinnamate 4-hydroxylase, putative                  145   3e-38   Ricinus communis
ref|XP_009132739.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    145   3e-38   Brassica rapa
ref|XP_009141068.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    144   5e-38   Brassica rapa
ref|XP_007142041.1|  hypothetical protein PHAVU_008G247400g             144   6e-38   Phaseolus vulgaris [French bean]
emb|CAP08846.1|  cinnamate-4-hydroxylase                                144   7e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006432069.1|  hypothetical protein CICLE_v10000921mg             143   2e-37   Citrus clementina [clementine]
ref|XP_001781223.1|  predicted protein                                  142   3e-37   
gb|ADF28535.1|  cinnamate 4-hydroxylase                                 142   3e-37   Physcomitrella patens
ref|XP_002461939.1|  hypothetical protein SORBIDRAFT_02g010910          142   3e-37   Sorghum bicolor [broomcorn]
gb|AHI17493.2|  cinnamate 4-hydroxylase                                 142   3e-37   Dryopteris fragrans
gb|AFY17064.1|  cinnamate 4-hydroxylase 1                               142   3e-37   Panicum virgatum
gb|AAC35857.1|  cinnamic acid 4-hydroxylase                             142   3e-37   Capsicum chinense [bonnet pepper]
gb|AAW70021.1|  cinnamic acid 4-hydroxylase                             142   4e-37   Ginkgo biloba [ginkgo]
ref|XP_004151467.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    142   4e-37   Cucumis sativus [cucumbers]
gb|AFX98061.1|  cinnamate 4-hydroxylase                                 142   4e-37   Cunninghamia lanceolata [China fir]
gb|AFL65041.1|  trans-cinnamate 4-hydroxylase                           142   4e-37   Pinus pinaster [cluster pine]
emb|CDX97827.1|  BnaC04g41120D                                          141   6e-37   
emb|CDY29671.1|  BnaA04g17560D                                          141   6e-37   Brassica napus [oilseed rape]
gb|ACN40359.1|  unknown                                                 141   9e-37   Picea sitchensis
gb|ACH56520.1|  cinnamate-4-hydroxylase                                 140   1e-36   Gossypium hirsutum [American cotton]
gb|AEA72281.1|  cinnamate 4-hydroxylase                                 140   2e-36   Angelica gigas
ref|XP_009141067.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    140   2e-36   Brassica rapa
ref|XP_008457287.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    140   2e-36   Cucumis melo [Oriental melon]
gb|AAD23378.1|AF096998_1  trans-cinnamate 4-hydroxylase                 140   2e-36   Pinus taeda
gb|AGE10592.1|  cinnamate 4-hydroxylase                                 140   2e-36   Lonicera japonica [Japanese honeysuckle]
gb|EMT12860.1|  Trans-cinnamate 4-monooxygenase                         139   3e-36   
ref|NP_001140681.1|  putative cytochrome P450 superfamily protein       139   4e-36   Zea mays [maize]
gb|AAG17469.1|AF123610_8  cytochrome P450                               139   6e-36   Triticum aestivum [Canadian hard winter wheat]
ref|XP_001773868.1|  predicted protein                                  139   6e-36   
emb|CDM82046.1|  unnamed protein product                                139   6e-36   Triticum aestivum [Canadian hard winter wheat]
gb|AER39775.1|  CYP73A91                                                139   6e-36   Festuca rubra subsp. commutata
gb|EPS58735.1|  cinnamate 4-hydroxylase                                 139   6e-36   Genlisea aurea
gb|AER39778.1|  CYP73A91-4                                              138   1e-35   Festuca rubra subsp. commutata
dbj|BAJ96982.1|  predicted protein                                      138   1e-35   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AIT52342.1|  cinammate 4-hydroxylase 1                               138   1e-35   Daucus carota [carrots]
gb|AFY17065.1|  cinnamate 4-hydroxylase 2                               138   1e-35   Panicum virgatum
gb|AER39776.1|  CYP73A91-2                                              137   2e-35   Festuca rubra subsp. commutata
gb|AER39777.1|  CYP73A91-3                                              137   2e-35   Festuca rubra subsp. commutata
ref|XP_010522015.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    137   2e-35   Tarenaya hassleriana [spider flower]
ref|XP_008792249.1|  PREDICTED: trans-cinnamate 4-monooxygenase         137   2e-35   Phoenix dactylifera
dbj|BAI40152.1|  cinnamate 4-hydroxylase                                128   2e-35   Diospyros kaki [Japanese persimmon]
ref|XP_003568699.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    137   3e-35   Brachypodium distachyon [annual false brome]
dbj|BAK03000.1|  predicted protein                                      136   6e-35   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AFV91402.1|  cinnamate 4-hydroxylase C4H2                            130   7e-35   Salix x smithiana
ref|XP_008657127.1|  PREDICTED: trans-cinnamate 4-monooxygenase         135   9e-35   
ref|XP_010922761.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    135   1e-34   
ref|XP_009410039.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    135   1e-34   
ref|XP_008788521.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    135   1e-34   
gb|AIS92509.1|  cinnamate 4-hydroxylase                                 135   2e-34   
gb|AAG09205.1|AF175275_1  trans-cinnamic acid hydroxylase               135   2e-34   
gb|AAC49187.2|  trans-cinnamic acid hydroxylase                         134   2e-34   
sp|Q43067.2|TCMO_PEA  RecName: Full=Trans-cinnamate 4-monooxygena...    134   2e-34   
prf||2209439A  cytochrome P450 monooxygenase                            134   2e-34
ref|XP_010542699.1|  PREDICTED: trans-cinnamate 4-monooxygenase         134   2e-34   
ref|XP_010931381.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    134   3e-34   
gb|EPS65721.1|  cinnamic acid 4-hydroxylase                             126   3e-34   
ref|NP_001275824.1|  cinnamate 4-hydroxylase CYP73                      134   3e-34   
gb|AFV91400.1|  cinnamate 4-hydroxylase C4H2                            128   5e-34   
gb|AFV91399.1|  cinnamate 4-hydroxylase C4H2                            128   5e-34   
gb|AFV91396.1|  cinnamate 4-hydroxylase C4H2                            128   5e-34   
gb|AHG06398.1|  cinnamic acid 4-hydroxylase                             133   6e-34   
ref|NP_001055190.1|  Os05g0320700                                       132   9e-34   
gb|EAY97535.1|  hypothetical protein OsI_19463                          132   9e-34   
ref|XP_009421412.1|  PREDICTED: trans-cinnamate 4-monooxygenase-l...    132   2e-33   
ref|XP_009421411.1|  PREDICTED: trans-cinnamate 4-monooxygenase-l...    132   2e-33   
gb|AFV91398.1|  cinnamate 4-hydroxylase C4H2                            126   2e-33   
gb|AFV91397.1|  cinnamate 4-hydroxylase C4H2                            126   3e-33   
gb|EMT32263.1|  Trans-cinnamate 4-monooxygenase                         131   3e-33   
gb|AFV91401.1|  cinnamate 4-hydroxylase C4H2                            126   3e-33   
ref|XP_006654260.1|  PREDICTED: trans-cinnamate 4-monooxygenase-l...    131   3e-33   
ref|XP_002266238.1|  PREDICTED: trans-cinnamate 4-monooxygenase         130   9e-33   
ref|XP_011089531.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    129   1e-32   
ref|XP_002980756.1|  trans-cinnamate 4-hydroxylase                      127   6e-32   
ref|XP_002977018.1|  trans-cinnamate 4-hydroxylase                      127   9e-32   
gb|ADF28536.1|  cinnamate 4-hydroxylase                                 127   1e-31   
gb|ABV80353.1|  cytochrome P450-dependent monooxygenase                 127   1e-31   
ref|XP_009387809.1|  PREDICTED: cytochrome P450 CYP73A100-like          121   2e-31   
ref|XP_011089530.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    125   2e-31   
ref|XP_011089529.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    125   4e-31   
gb|ABF58026.1|  cinnamate-4-hydroxylate-like                            123   2e-30   
gb|AHF20176.1|  cinnamate 4-hydroxylase                                 122   4e-30   
ref|XP_009391094.1|  PREDICTED: cytochrome P450 CYP73A100-like          121   5e-30   
ref|XP_004172870.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    116   5e-30   
ref|NP_001140726.1|  putative cytochrome P450 superfamily protein       122   6e-30   
ref|NP_001149158.1|  trans-cinnamate 4-monooxygenase                    122   6e-30   
ref|XP_001781937.1|  predicted protein                                  122   6e-30   
gb|KGN61202.1|  hypothetical protein Csa_2G070200                       116   1e-29   
gb|AHA92090.1|  cinnamate 4-hydroxylase                                 119   2e-29   
gb|EYU36905.1|  hypothetical protein MIMGU_mgv1a004883mg                120   2e-29   
ref|XP_009417516.1|  PREDICTED: cytochrome P450 CYP73A100-like          120   2e-29   
emb|CDP12494.1|  unnamed protein product                                120   3e-29   
ref|XP_008355951.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    114   3e-29   
ref|XP_010927178.1|  PREDICTED: cytochrome P450 CYP73A100-like          119   5e-29   
ref|XP_004151379.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    117   6e-29   
gb|EYU36902.1|  hypothetical protein MIMGU_mgv1a004808mg                119   7e-29   
gb|AFV91409.1|  cinnamate 4-hydroxylase C4H2                            114   8e-29   
ref|XP_010263371.1|  PREDICTED: cytochrome P450 CYP73A100-like          119   9e-29   
ref|XP_008798169.1|  PREDICTED: cytochrome P450 CYP73A100-like          117   4e-28   
ref|XP_004240122.1|  PREDICTED: cytochrome P450 CYP73A100-like          117   4e-28   
gb|KGN61203.1|  hypothetical protein Csa_2G070210                       114   6e-28   
ref|XP_008782811.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    116   1e-27   
ref|XP_004152891.1|  PREDICTED: LOW QUALITY PROTEIN: trans-cinnam...    116   1e-27   
gb|EEE56961.1|  hypothetical protein OsJ_06672                          112   1e-27   
ref|XP_008450720.1|  PREDICTED: cytochrome P450 CYP73A100-like          115   2e-27   
ref|XP_010928775.1|  PREDICTED: cytochrome P450 CYP73A100-like          115   2e-27   
ref|XP_008450733.1|  PREDICTED: cytochrome P450 CYP73A100-like          115   2e-27   
ref|XP_006360653.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    115   2e-27   
ref|XP_004172739.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    114   2e-27   
gb|KDP27749.1|  hypothetical protein JCGZ_19778                         115   3e-27   
ref|XP_008450772.1|  PREDICTED: cytochrome P450 CYP73A100-like          115   3e-27   
ref|XP_001773101.1|  predicted protein                                  113   5e-27   
ref|XP_002266142.1|  PREDICTED: cytochrome P450 CYP73A100               114   6e-27   
sp|H2DH22.1|C7A10_PANGI  RecName: Full=Cytochrome P450 CYP73A100        114   7e-27   
ref|XP_007014539.1|  Trans-cinnamate 4-monooxygenase                    114   7e-27   
gb|EYU36906.1|  hypothetical protein MIMGU_mgv1a025595mg                113   9e-27   
ref|XP_002266037.1|  PREDICTED: cytochrome P450 CYP73A100               113   9e-27   
emb|CAN70035.1|  hypothetical protein VITISV_027249                     113   9e-27   
ref|XP_010533060.1|  PREDICTED: cytochrome P450 CYP73A100-like          113   1e-26   
ref|XP_006665179.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    111   1e-26   
gb|EAY85792.1|  hypothetical protein OsI_07154                          111   1e-26   
gb|EAY85791.1|  hypothetical protein OsI_07153                          111   1e-26   
ref|XP_002534996.1|  cinnamate 4-hydroxylase, putative                  112   2e-26   
ref|XP_011017615.1|  PREDICTED: cytochrome P450 CYP73A100-like          112   2e-26   
gb|KHN11432.1|  Trans-cinnamate 4-monooxygenase                         112   3e-26   
ref|XP_003555891.1|  PREDICTED: trans-cinnamate 4-monooxygenase-l...    112   3e-26   
gb|KGN61199.1|  hypothetical protein Csa_2G068700                       112   3e-26   
ref|NP_001275769.1|  cinnamate 4-hydroxylase CYP73                      112   3e-26   
ref|XP_004152894.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    112   4e-26   
emb|CAA70595.1|  cinnamate 4-hydroxylase                                111   4e-26   
ref|XP_008450760.1|  PREDICTED: cytochrome P450 CYP73A100-like          111   5e-26   
ref|NP_001046819.1|  Os02g0467600                                       111   7e-26   
gb|AAD11427.1|  cinnamate 4-hydroxylase                                 110   1e-25   
ref|XP_009779123.1|  PREDICTED: cytochrome P450 CYP73A100-like          110   1e-25   
gb|AGE10593.1|  cinnamate 4-hydroxylase                                 110   1e-25   
ref|XP_009618442.1|  PREDICTED: cytochrome P450 CYP73A100-like          110   1e-25   
ref|XP_004299767.1|  PREDICTED: cytochrome P450 CYP73A100-like          110   1e-25   
gb|ACC63872.1|  trans-cinnamate 4-hydroxylase                           110   1e-25   
gb|AAK62344.1|  elicitor-inducible cytochrome P450                      110   1e-25   
ref|XP_010669584.1|  PREDICTED: cytochrome P450 CYP73A100-like          110   2e-25   
ref|XP_007142896.1|  hypothetical protein PHAVU_007G026000g             109   2e-25   
dbj|BAP11125.1|  putative trans-cinnamate 4-monooxygenase               105   3e-25   
ref|NP_001046814.1|  Os02g0467000                                       109   4e-25   
ref|XP_010046885.1|  PREDICTED: cytochrome P450 CYP73A100-like          108   5e-25   
gb|AGJ71351.1|  cinnamate 4-hydroxylase 2                               108   5e-25   
gb|ABO93195.1|  cinnamic acid 4-hydroxylase                             106   6e-25   
ref|XP_008223950.1|  PREDICTED: cytochrome P450 CYP73A100-like          108   8e-25   
gb|KGN44967.1|  hypothetical protein Csa_7G398770                       100   1e-24   
ref|XP_010106946.1|  Trans-cinnamate 4-monooxygenase                    108   1e-24   
ref|XP_006453189.1|  hypothetical protein CICLE_v10008125mg             107   2e-24   
ref|XP_003574953.1|  PREDICTED: cytochrome P450 CYP73A100-like          106   3e-24   
gb|KHN05578.1|  Trans-cinnamate 4-monooxygenase                         105   4e-24   
ref|XP_008780487.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    102   5e-24   
pir||PC4237  trans-cinnamate 4-monooxygenase (EC 1.14.13.11) C - ...    105   7e-24
gb|EMS54616.1|  Trans-cinnamate 4-monooxygenase                         102   5e-23   
ref|XP_006647306.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    101   2e-22   
ref|XP_008390630.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like  95.5    3e-22   
ref|XP_002452044.1|  hypothetical protein SORBIDRAFT_04g017460          100   5e-22   
dbj|BAJ98052.1|  predicted protein                                      100   5e-22   
ref|XP_007225069.1|  hypothetical protein PRUPE_ppa018282mg           99.4    9e-22   
ref|XP_006850963.1|  hypothetical protein AMTR_s00025p00202710        99.0    2e-21   
emb|CBI15809.3|  unnamed protein product                              98.2    3e-21   
gb|ACR36061.1|  unknown                                               96.3    2e-20   
gb|EMT22866.1|  Trans-cinnamate 4-monooxygenase                       95.9    2e-20   
ref|NP_001151365.1|  trans-cinnamate 4-monooxygenase                  95.9    3e-20   
ref|XP_003637406.1|  Trans-cinnamate 4-monooxygenase                  94.4    9e-20   
ref|XP_004497107.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like  94.0    2e-19   
gb|AFV91404.1|  cinnamate 4-hydroxylase C4H2                          87.0    1e-18   
gb|AFV91406.1|  cinnamate 4-hydroxylase C4H2                          87.0    2e-18   
ref|XP_004151378.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like  87.4    7e-18   
gb|AFV91407.1|  cinnamate 4-hydroxylase C4H2                          85.1    9e-18   
gb|AAL15268.1|  AT4g13770/F18A5_160                                   82.4    3e-16   
ref|NP_193113.1|  cytochrome P450 83A1                                82.4    2e-15   
ref|XP_002868339.1|  CYP83A1                                          82.4    2e-15   
gb|AAA79982.1|  cytochrome p450 dependent monooxygenase               82.4    2e-15   
gb|EMT08179.1|  Trans-cinnamate 4-monooxygenase                       82.0    2e-15   
ref|XP_004506715.1|  PREDICTED: cytochrome P450 71D9-like             79.7    1e-14   
ref|XP_006282589.1|  hypothetical protein CARUB_v10004635mg           79.3    2e-14   
ref|XP_006372202.1|  hypothetical protein POPTR_0018s14270g           75.9    2e-14   
emb|CDP11103.1|  unnamed protein product                              78.6    3e-14   
gb|KEH26493.1|  cytochrome P450 family 71 protein                     77.8    6e-14   
ref|XP_010450163.1|  PREDICTED: cytochrome P450 83A1                  77.4    7e-14   
gb|KEH34017.1|  cytochrome P450 family 71 protein                     76.6    2e-13   
ref|XP_010435226.1|  PREDICTED: cytochrome P450 83A1                  76.6    2e-13   
ref|XP_008227173.1|  PREDICTED: cytochrome P450 71D9-like             76.3    2e-13   
ref|XP_008227138.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...  76.3    2e-13   
ref|XP_008227171.1|  PREDICTED: cytochrome P450 71D9-like             75.5    3e-13   
gb|AGC13083.1|  cytochrome P450 83A1                                  73.2    3e-13   
ref|XP_007212458.1|  hypothetical protein PRUPE_ppa017406mg           74.3    3e-13   
ref|XP_010061478.1|  PREDICTED: cytochrome P450 71D9-like             75.5    4e-13   
ref|XP_004511453.1|  PREDICTED: geraniol 8-hydroxylase-like           75.1    4e-13   
ref|XP_004238498.1|  PREDICTED: cytochrome P450 71A2-like isoform X2  75.1    5e-13   
gb|AGO37755.1|  cytochrome P450 monooxygenase CYP83A1                 75.1    5e-13   
gb|ADK32329.1|  cytochrome P450 monooxygenase 83B1                    75.1    5e-13   
emb|CDY06899.1|  BnaA04g24160D                                        75.1    5e-13   
ref|XP_010320112.1|  PREDICTED: cytochrome P450 71A1-like isoform X1  75.1    5e-13   
gb|KJB61454.1|  hypothetical protein B456_009G3588002                 70.9    7e-13   
ref|XP_004237821.1|  PREDICTED: cytochrome P450 71A1-like             74.7    7e-13   
gb|EPS66524.1|  hypothetical protein M569_08252                       74.7    8e-13   
gb|KDP45509.1|  hypothetical protein JCGZ_17062                       74.3    9e-13   
ref|XP_006452555.1|  hypothetical protein CICLE_v10008411mg           73.9    1e-12   
gb|KDP43053.1|  hypothetical protein JCGZ_25239                       70.9    1e-12   
ref|XP_008246006.1|  PREDICTED: cytochrome P450 71D11-like            73.9    1e-12   
gb|AGS49167.1|  cytochrome P450 CYP83A1                               73.9    1e-12   
gb|AHB11194.1|  cytochrome P450 83A1                                  73.9    1e-12   
ref|XP_007213422.1|  hypothetical protein PRUPE_ppa025696mg           73.9    1e-12   
emb|CDY12709.1|  BnaC04g29320D                                        73.9    1e-12   
emb|CDY01156.1|  BnaA04g06630D                                        73.9    1e-12   
gb|AGD95055.1|  cytochrome P450 monooxygenase 83A1-5                  73.9    1e-12   
gb|AIK28472.1|  cytochrome P450 CYP83A1                               73.9    1e-12   
gb|KCW76838.1|  hypothetical protein EUGRSUZ_D01192                   73.9    1e-12   
ref|XP_010054541.1|  PREDICTED: premnaspirodiene oxygenase-like       73.9    1e-12   
ref|XP_006495418.1|  PREDICTED: cytochrome P450 71D10-like            71.2    1e-12   
ref|XP_009142022.1|  PREDICTED: cytochrome P450 83A1-like             73.9    1e-12   
gb|AHK60840.1|  CYP71BT1                                              73.6    2e-12   
ref|XP_006854595.1|  hypothetical protein AMTR_s00030p00127540        73.6    2e-12   
gb|KEH34024.1|  cytochrome P450 family 71 protein                     73.6    2e-12   
ref|XP_009780029.1|  PREDICTED: premnaspirodiene oxygenase-like       73.2    2e-12   
ref|XP_006452554.1|  hypothetical protein CICLE_v10008073mg           73.2    3e-12   
ref|XP_006469495.1|  PREDICTED: premnaspirodiene oxygenase-like       73.2    3e-12   
gb|KDO58402.1|  hypothetical protein CISIN_1g010334mg                 73.2    3e-12   
ref|XP_004237820.1|  PREDICTED: cytochrome P450 71A1-like             72.8    3e-12   
ref|XP_006447773.1|  hypothetical protein CICLE_v10014947mg           72.8    3e-12   
ref|XP_010094782.1|  Cytochrome P450 71A1                             72.8    4e-12   
gb|KHG19246.1|  Cytochrome P450                                       72.8    4e-12   
ref|XP_009776870.1|  PREDICTED: premnaspirodiene oxygenase-like       71.6    4e-12   
gb|EYU25443.1|  hypothetical protein MIMGU_mgv1a006310mg              72.4    4e-12   
ref|XP_009139598.1|  PREDICTED: cytochrome P450 83A1                  72.4    4e-12   
gb|KCW74943.1|  hypothetical protein EUGRSUZ_E03687                   72.0    4e-12   
gb|ACR10257.1|  cytochrome P450 83a1                                  72.4    4e-12   
gb|KFK37033.1|  hypothetical protein AALP_AA4G203400                  72.4    4e-12   
ref|XP_004295869.1|  PREDICTED: cytochrome P450 71D11-like            72.4    5e-12   
gb|KDP42351.1|  hypothetical protein JCGZ_02824                       72.4    5e-12   
emb|CCL99952.1|  predicted protein                                    72.4    5e-12   
gb|KCW66022.1|  hypothetical protein EUGRSUZ_G033142                  69.7    5e-12   
emb|CDY14794.1|  BnaC04g47910D                                        72.0    5e-12   
ref|XP_001779618.1|  predicted protein                                72.0    5e-12   
ref|XP_011465681.1|  PREDICTED: cytochrome P450 CYP736A12-like        72.0    5e-12   
ref|XP_006363816.1|  PREDICTED: premnaspirodiene oxygenase-like i...  72.0    6e-12   
ref|XP_009612418.1|  PREDICTED: premnaspirodiene oxygenase-like       72.0    6e-12   
ref|XP_003631427.1|  PREDICTED: geraniol 8-hydroxylase-like           72.0    7e-12   
gb|KDO62264.1|  hypothetical protein CISIN_1g0110961mg                69.3    7e-12   
ref|XP_007020549.1|  Cytochrome P450                                  72.0    7e-12   
ref|XP_010057720.1|  PREDICTED: geraniol 8-hydroxylase-like           71.6    7e-12   
gb|KHN20460.1|  Cytochrome P450 76C4                                  70.1    7e-12   
gb|ACU45738.1|  ferulate 5-hydroxylase                                72.0    7e-12   
dbj|BAI47545.1|  coniferaldehyde 5-hydroxylase                        72.0    7e-12   
dbj|BAI47544.1|  coniferaldehyde 5-hydroxylase                        72.0    7e-12   
ref|XP_007211074.1|  hypothetical protein PRUPE_ppa017688mg           71.6    7e-12   
gb|KCW74940.1|  hypothetical protein EUGRSUZ_E03685                   71.6    8e-12   
ref|XP_002523467.1|  cytochrome P450, putative                        71.6    8e-12   
ref|XP_009624010.1|  PREDICTED: premnaspirodiene oxygenase-like i...  71.6    8e-12   
ref|XP_010324705.1|  PREDICTED: geraniol 8-hydroxylase-like isofo...  71.6    8e-12   
ref|XP_006341719.1|  PREDICTED: premnaspirodiene oxygenase-like       71.6    9e-12   
gb|KJB25701.1|  hypothetical protein B456_004G205000                  71.2    1e-11   
ref|XP_006452559.1|  hypothetical protein CICLE_v10010637mg           71.6    1e-11   
ref|XP_006474923.1|  PREDICTED: cytochrome P450 71D11-like            71.2    1e-11   
ref|XP_010324706.1|  PREDICTED: geraniol 8-hydroxylase-like isofo...  70.9    1e-11   
ref|XP_007020551.1|  Cytochrome P450 71D10, putative                  71.2    1e-11   
ref|XP_004299223.2|  PREDICTED: cytochrome P450 CYP736A12-like        71.6    1e-11   
ref|XP_009796910.1|  PREDICTED: premnaspirodiene oxygenase-like       71.2    1e-11   
ref|XP_006435925.1|  hypothetical protein CICLE_v10031280mg           71.2    1e-11   
ref|XP_009776868.1|  PREDICTED: premnaspirodiene oxygenase-like       71.2    1e-11   
ref|XP_007214747.1|  hypothetical protein PRUPE_ppa025066mg           71.2    1e-11   
ref|XP_002276053.1|  PREDICTED: geraniol 8-hydroxylase-like           71.2    1e-11   
gb|AFR39832.1|  ferulate 5-hydroxylase                                67.8    1e-11   



>gb|AHJ60265.1| cinnamate 4-monooxygenase [Ipomoea purpurea]
Length=505

 Score =   189 bits (479),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 92/93 (99%), Positives = 92/93 (99%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM
Sbjct  14   FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSPELAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVV  106



>gb|AFR37652.1| cinnamate 4-hydroxylase, partial [Populus trichocarpa]
 gb|AFR37653.1| cinnamate 4-hydroxylase, partial [Populus trichocarpa]
 gb|AFR37660.1| cinnamate 4-hydroxylase, partial [Populus trichocarpa]
 gb|AFR37662.1| cinnamate 4-hydroxylase, partial [Populus trichocarpa]
Length=118

 Score =   177 bits (450),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 91/93 (98%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            FVAI+VAI+VSKLRGK++KLPPGPIPVPVFGNWLQVGDDLNHRNLTD AKKFGDIF+LRM
Sbjct  14   FVAILVAILVSKLRGKRFKLPPGPIPVPVFGNWLQVGDDLNHRNLTDLAKKFGDIFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP+L+KEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPDLSKEVLHTQGVEFGSRTRNVV  106



>gb|AFR37656.1| cinnamate 4-hydroxylase, partial [Populus trichocarpa]
 gb|AFR37657.1| cinnamate 4-hydroxylase, partial [Populus trichocarpa]
 gb|AFR37661.1| cinnamate 4-hydroxylase, partial [Populus trichocarpa]
Length=118

 Score =   177 bits (449),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 91/93 (98%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            FVAI+VAI+VSKLRGK++KLPPGPIPVPVFGNWLQVGDDLNHRNLTD AKKFGDIF+LRM
Sbjct  14   FVAILVAILVSKLRGKRFKLPPGPIPVPVFGNWLQVGDDLNHRNLTDLAKKFGDIFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP+L+KEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPDLSKEVLHTQGVEFGSRTRNVV  106



>gb|AFR37649.1| cinnamate 4-hydroxylase, partial [Populus trichocarpa]
 gb|AFR37650.1| cinnamate 4-hydroxylase, partial [Populus trichocarpa]
 gb|AFR37651.1| cinnamate 4-hydroxylase, partial [Populus trichocarpa]
 gb|AFR37654.1| cinnamate 4-hydroxylase, partial [Populus trichocarpa]
 gb|AFR37655.1| cinnamate 4-hydroxylase, partial [Populus trichocarpa]
 gb|AFR37658.1| cinnamate 4-hydroxylase, partial [Populus trichocarpa]
 gb|AFR37659.1| cinnamate 4-hydroxylase, partial [Populus trichocarpa]
 gb|AFR37663.1| cinnamate 4-hydroxylase, partial [Populus trichocarpa]
 gb|AFR37671.1| cinnamate 4-hydroxylase, partial [Populus fremontii]
 gb|AFR37672.1| cinnamate 4-hydroxylase, partial [Populus fremontii]
 gb|AFR37673.1| cinnamate 4-hydroxylase, partial [Populus fremontii]
 gb|AFR37674.1| cinnamate 4-hydroxylase, partial [Populus fremontii]
 gb|AFR37675.1| cinnamate 4-hydroxylase, partial [Populus fremontii]
 gb|AFR37676.1| cinnamate 4-hydroxylase, partial [Populus fremontii]
 gb|AFR37677.1| cinnamate 4-hydroxylase, partial [Populus fremontii]
 gb|AFR37678.1| cinnamate 4-hydroxylase, partial [Populus fremontii]
 gb|AFR37679.1| cinnamate 4-hydroxylase, partial [Populus fremontii]
Length=118

 Score =   177 bits (448),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 91/93 (98%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            FVAI+VAI+VSKLRGK++KLPPGPIPVPVFGNWLQVGDDLNHRNLTD AKKFGDIF+LRM
Sbjct  14   FVAILVAILVSKLRGKRFKLPPGPIPVPVFGNWLQVGDDLNHRNLTDLAKKFGDIFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP+L+KEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPDLSKEVLHTQGVEFGSRTRNVV  106



>emb|CAJ41419.1| trans-cinnamate 4-monooxygenase [Coffea arabica]
Length=230

 Score =   180 bits (456),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 91/93 (98%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F AIIVAIVVSKLRGKK+KLPPGPIPVP+FGNWLQ+GDDLNHRNLTDYAKKFG+IF+LRM
Sbjct  12   FAAIIVAIVVSKLRGKKFKLPPGPIPVPIFGNWLQIGDDLNHRNLTDYAKKFGEIFLLRM  71

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSPELAK+VLHTQGVEFGSRTRN V
Sbjct  72   GQRNLVVVSSPELAKDVLHTQGVEFGSRTRNVV  104



>gb|AFP89891.1| cinnamate 4-hydroxylase, partial [Neolamarckia cadamba]
 gb|AFP89892.1| cinnamate 4-hydroxylase, partial [Neolamarckia cadamba]
 gb|AFP89893.1| cinnamate 4-hydroxylase, partial [Neolamarckia cadamba]
 gb|AFP89894.1| cinnamate 4-hydroxylase, partial [Neolamarckia cadamba]
 gb|AFP89896.1| cinnamate 4-hydroxylase, partial [Neolamarckia cadamba]
 gb|AFP89897.1| cinnamate 4-hydroxylase, partial [Neolamarckia cadamba]
 gb|AFP89898.1| cinnamate 4-hydroxylase, partial [Neolamarckia cadamba]
 gb|AFP89899.1| cinnamate 4-hydroxylase, partial [Neolamarckia cadamba]
 gb|AFP89900.1| cinnamate 4-hydroxylase, partial [Neolamarckia cadamba]
 gb|AFP89901.1| cinnamate 4-hydroxylase, partial [Neolamarckia cadamba]
Length=219

 Score =   177 bits (449),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 82/93 (88%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F AI+VA V+SKLRG+K+KLPPGPIPVP+FGNWLQVGDDLNHRNLTDYAKKFG+IF+LRM
Sbjct  14   FAAIVVATVISKLRGRKFKLPPGPIPVPIFGNWLQVGDDLNHRNLTDYAKKFGEIFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP+LAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVV  106



>gb|AFP89895.1| cinnamate 4-hydroxylase, partial [Neolamarckia cadamba]
Length=219

 Score =   177 bits (449),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 82/93 (88%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F AI+VA V+SKLRG+K+KLPPGPIPVP+FGNWLQVGDDLNHRNLTDYAKKFG+IF+LRM
Sbjct  14   FAAIVVATVISKLRGRKFKLPPGPIPVPIFGNWLQVGDDLNHRNLTDYAKKFGEIFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP+LAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVV  106



>gb|AFK42083.1| unknown [Medicago truncatula]
Length=152

 Score =   174 bits (441),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F+A  +AI +SKLRGK++KLPPGPIPVP+FGNWLQVGDDLNHRNLTDYAK+FG++F+LRM
Sbjct  14   FIAATIAITISKLRGKRFKLPPGPIPVPIFGNWLQVGDDLNHRNLTDYAKRFGEMFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSPELAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVV  106



>gb|AFP89890.1| cinnamate 4-hydroxylase, partial [Neolamarckia cadamba]
Length=219

 Score =   176 bits (445),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F AI+VA V+SKLRG+K+KLPPGPIPVP+FGNWLQVGDDLNHRNLTDYAKKFG+IF+LRM
Sbjct  14   FAAIVVATVISKLRGRKFKLPPGPIPVPIFGNWLQVGDDLNHRNLTDYAKKFGEIFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP+LAKEVLHTQG EFGSRTRN V
Sbjct  74   GQRNLVVVSSPDLAKEVLHTQGAEFGSRTRNVV  106



>ref|XP_008355112.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Malus domestica]
Length=308

 Score =   176 bits (447),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 83/93 (89%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            FVA+IVAI +SKLRGKK+KLPPGP+PVPVFGNWLQVGDDLNHR LTD AKKFGD F+LRM
Sbjct  14   FVAVIVAITISKLRGKKFKLPPGPMPVPVFGNWLQVGDDLNHRKLTDLAKKFGDCFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSPELAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVV  106



>ref|XP_004294725.1| PREDICTED: trans-cinnamate 4-monooxygenase [Fragaria vesca subsp. 
vesca]
Length=504

 Score =   181 bits (458),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 91/93 (98%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F+AI+VAI+VSKLRGKK+KLPPGPIPVPVFGNWLQVGDDLNHRNLTD AKKFGD+FMLRM
Sbjct  14   FIAIVVAIIVSKLRGKKFKLPPGPIPVPVFGNWLQVGDDLNHRNLTDMAKKFGDVFMLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP+LAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVV  106



>emb|CDP19477.1| unnamed protein product [Coffea canephora]
Length=505

 Score =   181 bits (458),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/93 (92%), Positives = 91/93 (98%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F AIIVAIVVSKLRGKK+KLPPGPIPVP+FGNWLQVGDDLNHRNLTDYAKKFG+IF+LRM
Sbjct  14   FAAIIVAIVVSKLRGKKFKLPPGPIPVPIFGNWLQVGDDLNHRNLTDYAKKFGEIFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSPELAK+VLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPELAKDVLHTQGVEFGSRTRNVV  106



>gb|AFP49808.1| cinnamate 4-hydroxylase 4 [Coffea arabica]
Length=505

 Score =   181 bits (458),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/93 (92%), Positives = 91/93 (98%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F AIIVAIVVSKLRGKK+KLPPGPIPVP+FGNWLQVGDDLNHRNLTDYAKKFG+IF+LRM
Sbjct  14   FAAIIVAIVVSKLRGKKFKLPPGPIPVPIFGNWLQVGDDLNHRNLTDYAKKFGEIFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSPELAK+VLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPELAKDVLHTQGVEFGSRTRNVV  106



>gb|ADY38556.1| cinnamate 4-hydroxylase, partial [Acacia mangium]
 gb|ADY38557.1| cinnamate 4-hydroxylase, partial [Acacia mangium]
 gb|ADY38560.1| cinnamate 4-hydroxylase, partial [Acacia mangium]
Length=152

 Score =   170 bits (431),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 79/89 (89%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +2

Query  125  IVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRMGQRN  304
            ++AIV+SKLRGK++KLPPGP+PVP+FGNWLQVGDDLNHRNLTD AKKFGDIF+LRMGQRN
Sbjct  1    VLAIVISKLRGKRFKLPPGPLPVPIFGNWLQVGDDLNHRNLTDLAKKFGDIFLLRMGQRN  60

Query  305  LVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            LVVVSSPELAKEVLHTQGVEFGSRTRN V
Sbjct  61   LVVVSSPELAKEVLHTQGVEFGSRTRNVV  89



>gb|ADY38559.1| cinnamate 4-hydroxylase, partial [Acacia mangium]
 gb|ADY38561.1| cinnamate 4-hydroxylase, partial [Acacia mangium]
Length=152

 Score =   170 bits (430),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 79/89 (89%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +2

Query  125  IVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRMGQRN  304
            ++AIV+SKLRGK++KLPPGP+PVP+FGNWLQVGDDLNHRNLTD AKKFGDIF+LRMGQRN
Sbjct  1    VLAIVISKLRGKRFKLPPGPLPVPIFGNWLQVGDDLNHRNLTDLAKKFGDIFLLRMGQRN  60

Query  305  LVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            LVVVSSPELAKEVLHTQGVEFGSRTRN V
Sbjct  61   LVVVSSPELAKEVLHTQGVEFGSRTRNVV  89



>ref|NP_001281035.1| trans-cinnamate 4-monooxygenase [Malus domestica]
 gb|AAY87450.1| cinnamic acid hydroxylase [Malus domestica]
Length=504

 Score =   179 bits (454),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            FVA+IVAI +SKLRGKK+KLPPGPIPVPVFGNWLQVGDDLNHRNLTD AKKFGD F+LRM
Sbjct  14   FVAVIVAIAISKLRGKKFKLPPGPIPVPVFGNWLQVGDDLNHRNLTDMAKKFGDCFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSPELAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVV  106



>ref|XP_010094425.1| Trans-cinnamate 4-monooxygenase [Morus notabilis]
 gb|EXB56006.1| Trans-cinnamate 4-monooxygenase [Morus notabilis]
Length=505

 Score =   179 bits (453),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F A+IVAIV+SKLRGK++KLPPGPIPVPVFGNWLQVGDDLNHRNLTD AKKFGDIF+LRM
Sbjct  14   FAAVIVAIVISKLRGKRFKLPPGPIPVPVFGNWLQVGDDLNHRNLTDLAKKFGDIFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLV+VSSPELAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVIVSSPELAKEVLHTQGVEFGSRTRNVV  106



>gb|EYU36901.1| hypothetical protein MIMGU_mgv1a004876mg [Erythranthe guttata]
Length=506

 Score =   179 bits (453),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F AI++A VVSKLRGKK+KLPPGPIPVP+FGNWLQVGDDLNHRNLT+YAKKFGDI MLRM
Sbjct  15   FAAIVIAAVVSKLRGKKFKLPPGPIPVPIFGNWLQVGDDLNHRNLTEYAKKFGDILMLRM  74

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSPELAKEVLHTQGVEFGSRTRN V
Sbjct  75   GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVV  107



>dbj|BAJ17666.1| cinnamate 4-hydroxylase [Gynura bicolor]
Length=505

 Score =   179 bits (453),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F AII+AIV+SKLRGKK+KLPPGPIPVP+FGNWLQVGDDLNHRNLTD AKKFGDIF LRM
Sbjct  14   FTAIIIAIVISKLRGKKFKLPPGPIPVPIFGNWLQVGDDLNHRNLTDMAKKFGDIFHLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNL+VVSSPELAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLIVVSSPELAKEVLHTQGVEFGSRTRNVV  106



>ref|XP_009766429.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Nicotiana sylvestris]
Length=506

 Score =   178 bits (452),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F AIIVAIVVSKLR KK+KLPPGPIPVP+FGNWLQVGDDLNHRNLT+YAKKFGD+F+LRM
Sbjct  14   FFAIIVAIVVSKLRSKKFKLPPGPIPVPIFGNWLQVGDDLNHRNLTEYAKKFGDMFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSPELAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVV  106



>gb|ADX33332.1| cinnamate-4-hydroxylase 1 [Petunia x hybrida]
Length=506

 Score =   178 bits (452),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F AII+AIVVSKLR KK+KLPPGPIPVPVFGNWLQVGDDLNHRNLT+YAKKFGD+F+LRM
Sbjct  14   FFAIIIAIVVSKLRSKKFKLPPGPIPVPVFGNWLQVGDDLNHRNLTEYAKKFGDLFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSPELAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVV  106



>sp|P48522.1|TCMO_CATRO RecName: Full=Trans-cinnamate 4-monooxygenase; AltName: Full=Cinnamic 
acid 4-hydroxylase; Short=C4H; Short=CA4H; AltName: 
Full=Cytochrome P450 73; AltName: Full=Cytochrome P450C4H [Catharanthus 
roseus]
 emb|CAA83552.1| cinnamate 4-hydroxylase (CYP73) [Catharanthus roseus]
Length=505

 Score =   178 bits (452),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F AIIVA +VSKLRGKK+KLPPGPIPVPVFGNWLQVGDDLNHRNL+DYAKKFG+IF+LRM
Sbjct  14   FAAIIVASIVSKLRGKKFKLPPGPIPVPVFGNWLQVGDDLNHRNLSDYAKKFGEIFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSPELAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVV  106



>gb|AHB52741.1| cinnamate 4-hydroxylase [Pyrus x bretschneideri]
Length=504

 Score =   178 bits (452),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            FVA+IVAI +SKLRGKK++LPPGPIPVPVFGNWLQVGDDLNHRNLTD AKKFGD F+LRM
Sbjct  14   FVAVIVAITISKLRGKKFRLPPGPIPVPVFGNWLQVGDDLNHRNLTDMAKKFGDCFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSPELAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVV  106



>gb|ABC75596.1| cinnamate 4-hydroxylase [Salvia miltiorrhiza]
Length=504

 Score =   178 bits (451),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F AI+VA VVSKLRGKK+KLPPGPIPVP+FGNWLQVGDDLNHRNLTDYAK+FGDIF+LRM
Sbjct  14   FSAIVVAAVVSKLRGKKFKLPPGPIPVPIFGNWLQVGDDLNHRNLTDYAKRFGDIFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNL VVSSPELAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLAVVSSPELAKEVLHTQGVEFGSRTRNVV  106



>gb|AJD25173.1| cytochrome P450 CYP73A120 [Salvia miltiorrhiza]
Length=504

 Score =   178 bits (451),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F AI+VA VVSKLRGKK+KLPPGPIPVP+FGNWLQVGDDLNHRNLTDYAK+FGDIF+LRM
Sbjct  14   FSAIVVAAVVSKLRGKKFKLPPGPIPVPIFGNWLQVGDDLNHRNLTDYAKRFGDIFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNL VVSSPELAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLAVVSSPELAKEVLHTQGVEFGSRTRNVV  106



>gb|ABN48717.1| cinnamate 4-hydroxylase [Salvia miltiorrhiza]
Length=504

 Score =   178 bits (451),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F AI+VA VVSKLRGKK+KLPPGPIPVP+FGNWLQVGDDLNHRNLTDYAK+FGDIF+LRM
Sbjct  14   FSAIVVAAVVSKLRGKKFKLPPGPIPVPIFGNWLQVGDDLNHRNLTDYAKRFGDIFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNL VVSSPELAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLAVVSSPELAKEVLHTQGVEFGSRTRNVV  106



>ref|XP_007205045.1| hypothetical protein PRUPE_ppa004544mg [Prunus persica]
 gb|EMJ06244.1| hypothetical protein PRUPE_ppa004544mg [Prunus persica]
Length=504

 Score =   177 bits (450),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 83/93 (89%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F+A+IVAI +SKLRGK++KLPPGPIPVPVFGNWLQVGDDLNHRNLTD AKKFGDIF+LRM
Sbjct  14   FIAVIVAITISKLRGKRFKLPPGPIPVPVFGNWLQVGDDLNHRNLTDLAKKFGDIFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP+LAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVV  106



>gb|ADY38558.1| cinnamate 4-hydroxylase, partial [Acacia mangium]
 gb|ADY38562.1| cinnamate 4-hydroxylase, partial [Acacia mangium]
 gb|ADY38563.1| cinnamate 4-hydroxylase, partial [Acacia mangium]
 gb|ADY38564.1| cinnamate 4-hydroxylase, partial [Acacia mangium]
 gb|ADY38565.1| cinnamate 4-hydroxylase, partial [Acacia mangium]
 gb|ADY38566.1| cinnamate 4-hydroxylase, partial [Acacia mangium]
 gb|ADY38567.1| cinnamate 4-hydroxylase, partial [Acacia mangium]
Length=152

 Score =   168 bits (426),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 78/89 (88%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +2

Query  125  IVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRMGQRN  304
            ++AIV+SKLRGK++ LPPGP+PVP+FGNWLQVGDDLNHRNLTD AKKFGDIF+LRMGQRN
Sbjct  1    VLAIVISKLRGKRFNLPPGPLPVPIFGNWLQVGDDLNHRNLTDLAKKFGDIFLLRMGQRN  60

Query  305  LVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            LVVVSSPELAKEVLHTQGVEFGSRTRN V
Sbjct  61   LVVVSSPELAKEVLHTQGVEFGSRTRNVV  89



>ref|XP_009374388.1| PREDICTED: trans-cinnamate 4-monooxygenase [Pyrus x bretschneideri]
Length=557

 Score =   178 bits (452),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            FVA+IVAI +SKLRGKK++LPPGPIPVPVFGNWLQVGDDLNHRNLTD AKKFGD F+LRM
Sbjct  67   FVAVIVAITISKLRGKKFRLPPGPIPVPVFGNWLQVGDDLNHRNLTDMAKKFGDCFLLRM  126

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSPELAKEVLHTQGVEFGSRTRN V
Sbjct  127  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVV  159



>ref|XP_008240713.1| PREDICTED: trans-cinnamate 4-monooxygenase [Prunus mume]
Length=504

 Score =   177 bits (450),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 83/93 (89%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F+A+IVAI +SKLRGK++KLPPGPIPVPVFGNWLQVGDDLNHRNLTD AKKFGDIF+LRM
Sbjct  14   FIAVIVAITISKLRGKRFKLPPGPIPVPVFGNWLQVGDDLNHRNLTDLAKKFGDIFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP+LAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVV  106



>gb|AEA02459.1| cinnamate 4-hydroxylase [Prunus cerasifera x Prunus munsoniana]
Length=504

 Score =   177 bits (450),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 83/93 (89%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F+A+IVAI +SKLRGK++KLPPGPIPVPVFGNWLQVGDDLNHRNLTD AKKFGDIF+LRM
Sbjct  14   FIAVIVAITISKLRGKRFKLPPGPIPVPVFGNWLQVGDDLNHRNLTDLAKKFGDIFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP+LAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVV  106



>gb|AEA02458.1| cinnamate 4-hydroxylase [Prunus armeniaca]
Length=504

 Score =   177 bits (449),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 83/93 (89%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F+A+IVAI +SKLRGK++KLPPGPIPVPVFGNWLQVGDDLNHRNLTD AKKFGDIF+LRM
Sbjct  14   FIAVIVAITISKLRGKRFKLPPGPIPVPVFGNWLQVGDDLNHRNLTDLAKKFGDIFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP+LAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVV  106



>emb|CAM84301.1| putative cinnamate 4-hydroxylase [Cynara cardunculus var. scolymus]
Length=211

 Score =   170 bits (430),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            FVAI+ AI +SKLRGK++KLPPGP PVP+FGNWLQVGDDLNHRNLTD AKKFG IF+LRM
Sbjct  14   FVAILGAIFISKLRGKRFKLPPGPFPVPIFGNWLQVGDDLNHRNLTDLAKKFGQIFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP+LAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVV  106



>gb|AEN19718.1| cinnamate 4-hydroxylase [Acacia auriculiformis x Acacia mangium]
Length=505

 Score =   177 bits (449),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 82/93 (88%), Positives = 91/93 (98%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            FVA+++AIV+SKLRGK++KLPPGP+PVP+FGNWLQVGDDLNHRNLTD AKKFGDIF+LRM
Sbjct  14   FVAVVLAIVISKLRGKRFKLPPGPLPVPIFGNWLQVGDDLNHRNLTDLAKKFGDIFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSPELAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVV  106



>ref|XP_009601847.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Nicotiana tomentosiformis]
Length=506

 Score =   177 bits (449),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F AIIVAIVVSKLR K +KLPPGPIPVPVFGNWLQVGDDLNHRNLT+YAKKFGD+F+LRM
Sbjct  14   FFAIIVAIVVSKLRSKNFKLPPGPIPVPVFGNWLQVGDDLNHRNLTEYAKKFGDMFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSPELAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVV  106



>gb|ABY51678.1| cinnamic acid 4-hydroxylase [Plagiochasma appendiculatum]
Length=277

 Score =   172 bits (435),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F AII +I +SKLRGK++KLPPGP+PVP+FGNWLQVGDDLNHRNLTD AKKFG+IF+LRM
Sbjct  14   FAAIIASIFISKLRGKRFKLPPGPVPVPIFGNWLQVGDDLNHRNLTDLAKKFGEIFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP LAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPNLAKEVLHTQGVEFGSRTRNVV  106



>gb|ABX75854.1| cinnamate 4-hydroxylase [Acacia auriculiformis x Acacia mangium]
Length=505

 Score =   177 bits (448),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 82/93 (88%), Positives = 91/93 (98%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            FVA+++AIV+SKLRGK++KLPPGP+PVP+FGNWLQVGDDLNHRNLTD AKKFGDIF+LRM
Sbjct  14   FVAVVLAIVISKLRGKRFKLPPGPLPVPIFGNWLQVGDDLNHRNLTDLAKKFGDIFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSPELAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVV  106



>gb|AAG43824.1|AF212318_1 cinnamic acid 4-hydroxylase [Capsicum annuum]
Length=505

 Score =   177 bits (448),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F AI+VAI+VSKLR K++KLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIF+LRM
Sbjct  14   FFAIVVAIIVSKLRSKRFKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSPE AKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPESAKEVLHTQGVEFGSRTRNVV  106



>gb|KDP45711.1| hypothetical protein JCGZ_17318 [Jatropha curcas]
Length=505

 Score =   177 bits (448),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 83/93 (89%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F A+IVAIVVSKLRGK++KLPPGP+P+PVFGNWLQVGDDLNHRNLTD AKKFGDIF+LRM
Sbjct  14   FAAVIVAIVVSKLRGKRFKLPPGPLPIPVFGNWLQVGDDLNHRNLTDLAKKFGDIFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP+LAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVV  106



>gb|AFN44010.1| cinnamate 4-hydroxylase [Neolamarckia cadamba]
Length=505

 Score =   177 bits (448),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 82/93 (88%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F AI+VA V+SKLRG+K+KLPPGPIPVP+FGNWLQVGDDLNHRNLTDYAKKFG+IF+LRM
Sbjct  14   FAAIVVATVISKLRGRKFKLPPGPIPVPIFGNWLQVGDDLNHRNLTDYAKKFGEIFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP+LAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVV  106



>gb|ABC69413.1| CYP73A47v2 [Nicotiana tabacum]
Length=505

 Score =   177 bits (448),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 82/93 (88%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F AI++A++VSKLR K++KLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGD+F+LRM
Sbjct  14   FFAILIALIVSKLRSKRFKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDLFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSPELAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVV  106



>gb|AAG50231.1|AF302495_1 cinnamate 4-hydroxylase [Populus trichocarpa x Populus deltoides]
Length=505

 Score =   177 bits (448),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 91/93 (98%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            FVAI+VAI+VSKLRGK++KLPPGPIPVPVFGNWLQVGDDLNHRNLTD AKKFGDIF+LRM
Sbjct  14   FVAILVAILVSKLRGKRFKLPPGPIPVPVFGNWLQVGDDLNHRNLTDLAKKFGDIFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP+L+KEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPDLSKEVLHTQGVEFGSRTRNVV  106



>gb|ACF19421.1| candidate cinnamic acid 4-hydroxylase [Capsicum annuum]
Length=505

 Score =   177 bits (448),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F AI+VAI+VSKLR K++KLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIF+LRM
Sbjct  14   FFAILVAIIVSKLRSKRFKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSPE AKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPESAKEVLHTQGVEFGSRTRNVV  106



>ref|XP_009798122.1| PREDICTED: trans-cinnamate 4-monooxygenase [Nicotiana sylvestris]
 gb|ABC69411.1| CYP73A47v1 [Nicotiana tabacum]
Length=505

 Score =   177 bits (448),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 82/93 (88%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F AI++A++VSKLR K++KLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGD+F+LRM
Sbjct  14   FFAILIALIVSKLRSKRFKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDLFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSPELAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVV  106



>gb|AIY32618.1| cinnamate-4-hydroxylase [Perilla frutescens]
Length=505

 Score =   177 bits (448),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 83/93 (89%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F AI+VA +VSKLRGKK+KLPPGPIPVPVFGNWLQVGDDLNHRNL+DYAKKFG+IF+LRM
Sbjct  14   FAAIVVATIVSKLRGKKFKLPPGPIPVPVFGNWLQVGDDLNHRNLSDYAKKFGNIFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSPELAK+VLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPELAKDVLHTQGVEFGSRTRNVV  106



>ref|XP_011080651.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Sesamum indicum]
Length=505

 Score =   177 bits (448),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 83/93 (89%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F+AI+VA VVSKLRGKK+KLPPGPIPVP+FGNWLQVGDDLNHRNL+DYAKKFGDI +LRM
Sbjct  14   FLAIVVATVVSKLRGKKFKLPPGPIPVPIFGNWLQVGDDLNHRNLSDYAKKFGDILLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP+LAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVV  106



>gb|ADZ54778.1| trans-cinnamate 4-monooxygenase [Prunus avium]
Length=505

 Score =   177 bits (448),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 82/93 (88%), Positives = 91/93 (98%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F+AIIVAI++SKLRGK++KLPPGPIPVP+FGNW+QVGDDLNHRNLTD AKKFGDIF+LRM
Sbjct  14   FIAIIVAIMISKLRGKRFKLPPGPIPVPIFGNWIQVGDDLNHRNLTDLAKKFGDIFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP+LAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVV  106



>gb|ACC63873.1| trans-cinnamate 4-hydroxylase [Populus trichocarpa]
Length=505

 Score =   177 bits (448),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 91/93 (98%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            FVAI+VAI+VSKLRGK++KLPPGPIPVPVFGNWLQVGDDLNHRNLTD AKKFGDIF+LRM
Sbjct  14   FVAILVAILVSKLRGKRFKLPPGPIPVPVFGNWLQVGDDLNHRNLTDLAKKFGDIFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP+L+KEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPDLSKEVLHTQGVEFGSRTRNVV  106



>ref|XP_002319974.1| hypothetical protein POPTR_0013s15380g [Populus trichocarpa]
 ref|XP_002319975.1| trans-cinnamate 4-monooxygenase family protein [Populus trichocarpa]
 gb|ABK93900.1| unknown [Populus trichocarpa]
 gb|EEE95897.1| hypothetical protein POPTR_0013s15380g [Populus trichocarpa]
 gb|EEE95898.1| trans-cinnamate 4-monooxygenase family protein [Populus trichocarpa]
Length=505

 Score =   177 bits (448),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 91/93 (98%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            FVAI+VAI+VSKLRGK++KLPPGPIPVPVFGNWLQVGDDLNHRNLTD AKKFGDIF+LRM
Sbjct  14   FVAILVAILVSKLRGKRFKLPPGPIPVPVFGNWLQVGDDLNHRNLTDLAKKFGDIFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP+L+KEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPDLSKEVLHTQGVEFGSRTRNVV  106



>gb|ABX74779.1| cinnamate-4-hydroxylase [Rubus coreanus]
Length=504

 Score =   176 bits (447),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 83/93 (89%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F A++VAI VSKLRGKK+KLPPGPIPVPVFGNWLQVGDDLNHRNLTD AKKFG++FMLRM
Sbjct  14   FAAVVVAITVSKLRGKKFKLPPGPIPVPVFGNWLQVGDDLNHRNLTDMAKKFGEVFMLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP+LAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVV  106



>gb|ABC69046.1| cinnamic acid 4-hydroxylase [Solanum tuberosum]
Length=505

 Score =   176 bits (447),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 82/93 (88%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F AI++AI+VSKLR K++KLPPGPIPVPVFGNWLQVGDDLNHRNLT+YAKKFGD+F+LRM
Sbjct  14   FFAILIAIIVSKLRSKRFKLPPGPIPVPVFGNWLQVGDDLNHRNLTEYAKKFGDVFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSPELAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVV  106



>gb|ACM17896.1| cinnamate-4-hydroxylase [Rubus occidentalis]
Length=504

 Score =   176 bits (447),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 83/93 (89%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            FVA++VAI VSKLRGKK+KLPPGPIPVPVFGNWLQVGDDLNHRNLT+ AKKFG++FMLRM
Sbjct  14   FVAVVVAITVSKLRGKKFKLPPGPIPVPVFGNWLQVGDDLNHRNLTEMAKKFGEVFMLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP+LAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVV  106



>gb|ACM69364.1| cinnamic acid 4-hydroxylase [Humulus lupulus]
Length=505

 Score =   176 bits (447),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 82/93 (88%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            FVA+++AI ++K+RGKK+KLPPGPIPVPVFGNWLQVGDDLNHRNLTD AKKFGDIF+LRM
Sbjct  14   FVAVVLAIAIAKIRGKKFKLPPGPIPVPVFGNWLQVGDDLNHRNLTDMAKKFGDIFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSPELAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVV  106



>gb|AFG30055.1| cinnamate-4-hydroxylase [Malus hybrid cultivar]
Length=504

 Score =   176 bits (447),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            FVA+IVAI +SKLRGKK+KLPPGPIPVPVFGNWLQ GDDLNHRNLTD AKKFGD F+LRM
Sbjct  14   FVAVIVAIAISKLRGKKFKLPPGPIPVPVFGNWLQDGDDLNHRNLTDMAKKFGDCFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSPELAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVV  106



>gb|ABX74781.1| cinnamate-4-hydroxylase [Rubus sp. SSL-2007]
Length=504

 Score =   176 bits (447),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 83/93 (89%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            FVA++VAI VSKLRGKK+KLPPGPIPVPVFGNWLQVGDDLNHRNLT+ AKKFG++FMLRM
Sbjct  14   FVAVVVAITVSKLRGKKFKLPPGPIPVPVFGNWLQVGDDLNHRNLTEMAKKFGEVFMLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP+LAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVV  106



>ref|XP_006350887.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Solanum tuberosum]
Length=526

 Score =   176 bits (447),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/93 (88%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F AI++AI+VSKLR K++KLPPGPIPVPVFGNWLQVGDDLNHRNLT+YAKKFGD+F+LRM
Sbjct  35   FFAILIAIIVSKLRSKRFKLPPGPIPVPVFGNWLQVGDDLNHRNLTEYAKKFGDVFLLRM  94

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSPELAKEVLHTQGVEFGSRTRN V
Sbjct  95   GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVV  127



>gb|KGN46762.1| hypothetical protein Csa_6G133710 [Cucumis sativus]
Length=391

 Score =   174 bits (440),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F+++++AI +SKLRGK++KLPPGP+PVP+FGNWLQVGDDLNHRNLTD AKKFGDIF+LRM
Sbjct  14   FLSVVLAIAISKLRGKRFKLPPGPLPVPIFGNWLQVGDDLNHRNLTDLAKKFGDIFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSPELAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVV  106



>gb|ADX33333.1| cinnamate-4-hydroxylase 2 [Petunia x hybrida]
Length=505

 Score =   176 bits (445),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F+AII+A +VSKLR K++KLPPGPIPVPVFGNWLQVGDDLNHRNLT+YAKKFGD+F+LRM
Sbjct  14   FIAIIIATIVSKLRSKRFKLPPGPIPVPVFGNWLQVGDDLNHRNLTEYAKKFGDLFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP+LAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVV  106



>dbj|BAE72875.1| Cinnamic acid 4-hydroxylase [Verbena x hybrida]
Length=505

 Score =   175 bits (444),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F AI++A VVSKLRGKK+KLPPGPIPVP+FGNWLQVGDDLNHRNLTDYAKKFGD+F+LRM
Sbjct  14   FSAIVIAAVVSKLRGKKFKLPPGPIPVPIFGNWLQVGDDLNHRNLTDYAKKFGDLFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP+LA++VLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPDLARDVLHTQGVEFGSRTRNVV  106



>gb|AEK94316.1| cinnamic acid 4-hydroxylase-like protein [Pyrus x bretschneideri]
Length=504

 Score =   175 bits (444),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 83/93 (89%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            FVA+IVAI +SKLRGKK++LPPGPIPVPVFGNWLQVGD LNHRNLTD AKKFGD F+LRM
Sbjct  14   FVAVIVAITISKLRGKKFRLPPGPIPVPVFGNWLQVGDGLNHRNLTDMAKKFGDCFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSPELAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVV  106



>ref|XP_011089532.1| PREDICTED: trans-cinnamate 4-monooxygenase [Sesamum indicum]
Length=505

 Score =   175 bits (443),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 83/93 (89%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F AI+VA VVSKLRGKK KLPPGPIPVP+FGNWLQVGDDLNHRNL+DYAKKFG+IF+LRM
Sbjct  14   FFAIVVATVVSKLRGKKLKLPPGPIPVPIFGNWLQVGDDLNHRNLSDYAKKFGNIFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP+LAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVV  106



>gb|AGH32777.1| cinnamic acid 4-hydroxylase [Camellia chekiangoleosa]
Length=505

 Score =   175 bits (443),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F+A+++AI +SKLRGK++KLPPGPIPVPVFGNWLQVGDDLNHRNLTD AKKFG IFMLRM
Sbjct  14   FIAVVLAITISKLRGKRFKLPPGPIPVPVFGNWLQVGDDLNHRNLTDLAKKFGQIFMLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP+LAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVV  106



>sp|Q43033.1|TCMO_PETCR RecName: Full=Trans-cinnamate 4-monooxygenase; AltName: Full=Cinnamic 
acid 4-hydroxylase; Short=C4H; Short=CA4H; AltName: 
Full=Cytochrome P450 73; AltName: Full=Cytochrome P450C4H [Petroselinum 
crispum]
 gb|AAC41660.1| trans-cinnamate 4-monooxygenase [Petroselinum crispum]
Length=506

 Score =   175 bits (443),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 83/93 (89%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F+A IVAI +SKLRGKK KLPPGPIPVPVFGNWLQVGDDLN RNL DYAKKFGD+FMLRM
Sbjct  15   FIATIVAITISKLRGKKLKLPPGPIPVPVFGNWLQVGDDLNQRNLVDYAKKFGDLFMLRM  74

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSPELAK+VLHTQGVEFGSRTRN V
Sbjct  75   GQRNLVVVSSPELAKDVLHTQGVEFGSRTRNVV  107



>dbj|BAB71716.1| cinnamic acid 4-hydroxylase [Lithospermum erythrorhizon]
Length=505

 Score =   175 bits (443),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F + I+AIV+SKLRGKK+KLPPGPIPVP+FGNWLQVGDDLNHRNLT+YAKKFG+IF+LRM
Sbjct  14   FFSFIIAIVISKLRGKKFKLPPGPIPVPIFGNWLQVGDDLNHRNLTEYAKKFGEIFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP+LAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVV  106



>ref|XP_009607087.1| PREDICTED: trans-cinnamate 4-monooxygenase [Nicotiana tomentosiformis]
 gb|ABC69412.1| CYP73A47v3 [Nicotiana tabacum]
Length=505

 Score =   175 bits (443),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F AI++AI+VS+LR K++KLPPGPIPVPVFGNWLQVGDDLNHRNLTD+AKKFGD+F+LRM
Sbjct  14   FFAILIAIIVSRLRSKRFKLPPGPIPVPVFGNWLQVGDDLNHRNLTDFAKKFGDLFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSPELAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVV  106



>gb|AHY94893.1| cinnamate-4-hydroxylase [Prunella vulgaris]
Length=505

 Score =   175 bits (443),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 82/93 (88%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F AI+VA VVS+LRGKK+KLPPGPIPVP+FGNWLQVGDDLNHRNLTDYAK+FGDI +LRM
Sbjct  14   FFAIVVAAVVSELRGKKFKLPPGPIPVPIFGNWLQVGDDLNHRNLTDYAKRFGDILLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP+LAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVV  106



>ref|XP_008456253.1| PREDICTED: trans-cinnamate 4-monooxygenase [Cucumis melo]
Length=505

 Score =   174 bits (442),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F+A+++AI +SKLRGK++KLPPGP+PVP+FGNWLQVGDDLNHRNLTD AKKFGDIF+LRM
Sbjct  14   FLAVVLAIAISKLRGKRFKLPPGPLPVPIFGNWLQVGDDLNHRNLTDLAKKFGDIFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSPELAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVV  106



>ref|NP_001266151.1| trans-cinnamate 4-monooxygenase [Cicer arietinum]
 sp|O81928.2|TCMO_CICAR RecName: Full=Trans-cinnamate 4-monooxygenase; AltName: Full=Cinnamic 
acid 4-hydroxylase; Short=C4H; Short=CA4H; AltName: 
Full=Cytochrome P450 73; AltName: Full=Cytochrome P450C4H [Cicer 
arietinum]
 emb|CAA07519.2| trans-cinnamic 4-monooxygenase [Cicer arietinum]
Length=505

 Score =   174 bits (442),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F+A  +AI +SKLRGK++KLPPGPIPVPVFGNWLQVGDDLNHRNLTD AK+FGDIF+LRM
Sbjct  14   FIAATIAITISKLRGKRFKLPPGPIPVPVFGNWLQVGDDLNHRNLTDLAKRFGDIFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSPELAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVV  106



>gb|EYU46023.1| hypothetical protein MIMGU_mgv1a004904mg [Erythranthe guttata]
Length=505

 Score =   174 bits (442),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F A+ VA +VSKLRG+K+KLPPGPIPVP+FGNWLQVGDDLNHRNLTDYAK+ GDIF+LRM
Sbjct  14   FFAVTVATIVSKLRGRKFKLPPGPIPVPIFGNWLQVGDDLNHRNLTDYAKRLGDIFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSPELAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVV  106



>gb|AID16078.1| cinnamate 4-hydroxylase [Morus alba]
Length=505

 Score =   174 bits (442),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 83/93 (89%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F A+IVA V+SKLRGK++KLPPGPIPVPVFGNWLQVGDDLNHRNLTD AKKFG IF+LRM
Sbjct  14   FAAVIVATVISKLRGKRFKLPPGPIPVPVFGNWLQVGDDLNHRNLTDLAKKFGGIFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSPELAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVV  106



>gb|ADO16244.1| cinnamate 4-hydroxylase [Ocimum basilicum]
Length=505

 Score =   174 bits (442),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 82/93 (88%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F AI+VA VVSKLRG+K+KLPPGPIPVP+FGNWLQVGDDLNHRNLTDYAK+FG+IF+LRM
Sbjct  14   FSAIVVAAVVSKLRGRKFKLPPGPIPVPIFGNWLQVGDDLNHRNLTDYAKRFGEIFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSPE AKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPEHAKEVLHTQGVEFGSRTRNVV  106



>gb|AGM46644.1| cinnamate 4-hydroxylase protein, partial [Apium graveolens]
Length=266

 Score =   169 bits (427),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F+A IVAI +SKLRGKK  LPPGPIPVPVFGNWLQVGDDLN RNL + AKKFGD+FMLRM
Sbjct  13   FIATIVAITISKLRGKKLNLPPGPIPVPVFGNWLQVGDDLNQRNLVELAKKFGDLFMLRM  72

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSPELAK+VLHTQGVEFGSRTRN V
Sbjct  73   GQRNLVVVSSPELAKDVLHTQGVEFGSRTRNVV  105



>gb|ACF74449.1| trans-cinnamate 4-monooxygenase [Echinacea angustifolia]
Length=505

 Score =   174 bits (441),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F AII AIVVSKLRGKK+KLPPGPIPVP+FGNWLQVGDDLNHRNLTD AKKFG IF+LRM
Sbjct  14   FAAIIGAIVVSKLRGKKFKLPPGPIPVPIFGNWLQVGDDLNHRNLTDLAKKFGQIFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSPELAK+VLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPELAKDVLHTQGVEFGSRTRNVV  106



>ref|XP_003616037.1| Trans-cinnamate 4-monooxygenase [Medicago truncatula]
 gb|ABC59087.1| cytochrome P450 monooxygenase CYP73A3 [Medicago truncatula]
 gb|ADK91846.1| coumarate 4-hydroxylase [Medicago truncatula]
 gb|AES98995.1| cytochrome P450 family cinnamate 4-hydroxylase [Medicago truncatula]
Length=506

 Score =   174 bits (441),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F+A  +AI +SKLRGK++KLPPGPIPVP+FGNWLQVGDDLNHRNLTDYAK+FG++F+LRM
Sbjct  14   FIAATIAITISKLRGKRFKLPPGPIPVPIFGNWLQVGDDLNHRNLTDYAKRFGEMFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSPELAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVV  106



>ref|XP_009354901.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Pyrus x bretschneideri]
Length=504

 Score =   174 bits (441),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 82/93 (88%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F+A+IVAI +SKLR KK+KLPPGPIPVPVFGNWLQVGDDLNHRNLTD AKKFGD F+LRM
Sbjct  14   FLAVIVAIAISKLRSKKFKLPPGPIPVPVFGNWLQVGDDLNHRNLTDLAKKFGDCFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSPELAKEVLHTQ VEFGSRTRN V
Sbjct  74   GQRNLVVVSSPELAKEVLHTQAVEFGSRTRNVV  106



>gb|ADN32769.1| cinnamate 4-hydroxylase [Scutellaria baicalensis]
Length=507

 Score =   174 bits (441),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 83/93 (89%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F+AIIVA +VSKLRGKK+KLPPGPIPVP+FGNWLQVGDDLNHRNLT YAKKFG+IF+ RM
Sbjct  14   FLAIIVATMVSKLRGKKFKLPPGPIPVPIFGNWLQVGDDLNHRNLTAYAKKFGEIFLHRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSPELAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVV  106



>ref|XP_004139932.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Cucumis sativus]
Length=505

 Score =   174 bits (441),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F+++++AI +SKLRGK++KLPPGP+PVP+FGNWLQVGDDLNHRNLTD AKKFGDIF+LRM
Sbjct  14   FLSVVLAIAISKLRGKRFKLPPGPLPVPIFGNWLQVGDDLNHRNLTDLAKKFGDIFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSPELAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVV  106



>ref|XP_004154553.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Cucumis sativus]
Length=505

 Score =   174 bits (440),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F+++++AI +SKLRGK++KLPPGP+PVP+FGNWLQVGDDLNHRNLTD AKKFGDIF+LRM
Sbjct  14   FLSVVLAIAISKLRGKRFKLPPGPLPVPIFGNWLQVGDDLNHRNLTDLAKKFGDIFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSPELAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVV  106



>gb|AFU54390.1| cinnamate 4-hydroxylase [Fagopyrum tataricum]
Length=504

 Score =   174 bits (440),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 83/93 (89%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F AI VAIV+SKLRGKKYKLPPGPIPVP+FGNWLQVGDDLNHRNLT+ AKK+G+IF+LRM
Sbjct  14   FFAISVAIVISKLRGKKYKLPPGPIPVPIFGNWLQVGDDLNHRNLTELAKKYGEIFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSPELAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVV  106



>gb|KHG02507.1| Cytochrome P450 protein [Gossypium arboreum]
Length=532

 Score =   174 bits (441),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 82/93 (88%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F  II AI+VSKLRGK++KLPPGP+P+PVFGNWLQVGDDLNHRNLTD AKKFGDIF+LRM
Sbjct  14   FFTIIFAILVSKLRGKRFKLPPGPLPIPVFGNWLQVGDDLNHRNLTDLAKKFGDIFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSPELAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVV  106



>gb|ADO16243.1| cinnamate 4-hydroxylase [Ocimum tenuiflorum]
Length=505

 Score =   174 bits (440),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F AI+VA VVSK RG+K+KLPPGPIPVP+FGNWLQVGDDLNHRNLTDYAK+FG+IF+LRM
Sbjct  14   FFAIVVAAVVSKFRGRKFKLPPGPIPVPIFGNWLQVGDDLNHRNLTDYAKRFGEIFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSPE AKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPEFAKEVLHTQGVEFGSRTRNVV  106



>gb|AAG10197.1| cinnamate-4-hydroxylase [Gossypium arboreum]
 gb|ACZ06239.1| cinnamate 4-hydroxylase [Gossypium hirsutum]
Length=505

 Score =   174 bits (440),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F  II AI+VSKLRGK++KLPPGP+P+PVFGNWLQVGDDLNHRNLTD AKKFGDIF+LRM
Sbjct  14   FFTIIFAILVSKLRGKRFKLPPGPLPIPVFGNWLQVGDDLNHRNLTDLAKKFGDIFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVV+SSPELAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVISSPELAKEVLHTQGVEFGSRTRNVV  106



>ref|XP_003544934.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Glycine max]
Length=505

 Score =   173 bits (439),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F+A +VAI VS LRG+K+KLPPGP+PVP+FGNWLQVGDDLNHRNLTD AKKFGDIF+LRM
Sbjct  14   FLAAVVAIAVSTLRGRKFKLPPGPLPVPIFGNWLQVGDDLNHRNLTDLAKKFGDIFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSPELAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVV  106



>gb|KJB72975.1| hypothetical protein B456_011G207000 [Gossypium raimondii]
Length=505

 Score =   173 bits (439),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F  II AI+VSKLRGK++KLPPGP+P+PVFGNWLQVGDDLNHRNLTD AKKFGDIF+LRM
Sbjct  14   FFTIIFAILVSKLRGKRFKLPPGPLPIPVFGNWLQVGDDLNHRNLTDLAKKFGDIFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVV+SSPELAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVISSPELAKEVLHTQGVEFGSRTRNVV  106



>ref|XP_007011365.1| Cinnamate-4-hydroxylase [Theobroma cacao]
 gb|EOY20175.1| Cinnamate-4-hydroxylase [Theobroma cacao]
Length=505

 Score =   173 bits (439),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F+ +I+AI++SKLR K+++LPPGPIPVPVFGNWLQVGDDLNHRNLTD AKKFGDIF+LRM
Sbjct  14   FITVILAILISKLRSKRFRLPPGPIPVPVFGNWLQVGDDLNHRNLTDLAKKFGDIFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSPELAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVV  106



>gb|ACR44227.1| C4H [Glycine max]
 gb|ADG63467.1| C4H [Glycine max]
Length=506

 Score =   173 bits (439),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F+A +VAI VS LRG+K+KLPPGP+PVP+FGNWLQVGDDLNHRNLTD AKKFGDIF+LRM
Sbjct  14   FLAAVVAIAVSTLRGRKFKLPPGPLPVPIFGNWLQVGDDLNHRNLTDLAKKFGDIFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSPELAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVV  106



>ref|NP_001237317.1| trans-cinnamate 4-monooxygenase [Glycine max]
 sp|Q42797.1|TCMO_SOYBN RecName: Full=Trans-cinnamate 4-monooxygenase; AltName: Full=Cinnamic 
acid 4-hydroxylase; Short=C4H; Short=CA4H; AltName: 
Full=Cytochrome P450 73; AltName: Full=Cytochrome P450C4H [Glycine 
max]
 emb|CAA63172.1| cinnamic acid 4-hydroxylase [Glycine max]
 gb|ACN81819.1| coumarate 4-hydroxylase [Glycine max]
 gb|AEX32785.1| cinnamate-4-hydroxylase [Glycine max]
Length=506

 Score =   173 bits (439),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F+A +VAI VS LRG+K+KLPPGP+PVP+FGNWLQVGDDLNHRNLTD AKKFGDIF+LRM
Sbjct  14   FLAAVVAIAVSTLRGRKFKLPPGPLPVPIFGNWLQVGDDLNHRNLTDLAKKFGDIFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSPELAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVV  106



>gb|AEM63672.1| cinnamate 4-hydroxylase [Platycodon grandiflorus]
Length=505

 Score =   173 bits (438),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            FVAI+VAI +SKLRGK++KLPPGPIPVP+FGNWLQVGDDLNHRNLT YAKKFGD+F+LRM
Sbjct  14   FVAIVVAITISKLRGKRFKLPPGPIPVPIFGNWLQVGDDLNHRNLTVYAKKFGDVFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP+ AKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPDHAKEVLHTQGVEFGSRTRNVV  106



>gb|AGJ84133.1| putative trans-cinnamate 4-hydroxylase [Hibiscus cannabinus]
Length=505

 Score =   173 bits (438),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F  II AI+V+KLRGK+YKLPPGP+PVP+FGNWLQVGDDLNHRNLTD  KKFGDIF+LRM
Sbjct  14   FFTIIFAILVAKLRGKRYKLPPGPLPVPIFGNWLQVGDDLNHRNLTDLTKKFGDIFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSPELAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVV  106



>gb|AEM63594.1| cinnamate 4-hydroxylase [Leucaena leucocephala]
 gb|AEX08610.1| cinnamate 4-hydroxylase [Leucaena leucocephala]
Length=505

 Score =   173 bits (438),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F A +VAI VSKLRGK++KLPPGP+PVP+FGNWLQVGDDLNHRNLTD AKKFGDIF+LRM
Sbjct  14   FFAAVVAIAVSKLRGKRFKLPPGPLPVPIFGNWLQVGDDLNHRNLTDLAKKFGDIFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNL+VVSSPELAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLLVVSSPELAKEVLHTQGVEFGSRTRNVV  106



>ref|XP_010253046.1| PREDICTED: trans-cinnamate 4-monooxygenase [Nelumbo nucifera]
Length=505

 Score =   172 bits (437),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F AI++AI +SKLRGK++KLPPGPIPVPVFGNWLQVGDDLNHRNLTD AKKFG+IF+LRM
Sbjct  14   FFAIVLAITISKLRGKRFKLPPGPIPVPVFGNWLQVGDDLNHRNLTDLAKKFGNIFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP+LAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVV  106



>gb|ABD77493.2| cinnamic acid 4-hydroxylase [Arnebia euchroma]
Length=504

 Score =   172 bits (437),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F ++I+AIV+SKL GKK+KLPPGPIPVP+FGNWLQVGDDLNHRNLT+YAKKFG+IF+LRM
Sbjct  14   FFSVIIAIVISKLGGKKFKLPPGPIPVPIFGNWLQVGDDLNHRNLTEYAKKFGEIFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP+LAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVV  106



>ref|XP_002881114.1| cinnamate-4-hydroxylase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57373.1| cinnamate-4-hydroxylase [Arabidopsis lyrata subsp. lyrata]
Length=505

 Score =   172 bits (437),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            FVA+++A V+SKLRGKK KLPPGP+PVP+FGNWLQVGDDLNHRNL DYAKKFGD+F+LRM
Sbjct  14   FVAVVLATVISKLRGKKLKLPPGPMPVPIFGNWLQVGDDLNHRNLVDYAKKFGDLFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP+L KEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPDLTKEVLHTQGVEFGSRTRNVV  106



>gb|AGX85600.1| coumarate 4-hydroxylase [Scoparia dulcis]
Length=505

 Score =   172 bits (436),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F AI++A VVSKLRGKK++LPPGPIPVP+FGNWLQ+GDDLNHRNL+DYAKKFGD+F+LRM
Sbjct  14   FFAIVLASVVSKLRGKKFRLPPGPIPVPIFGNWLQIGDDLNHRNLSDYAKKFGDMFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP+LAK+VLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPDLAKDVLHTQGVEFGSRTRNVV  106



>gb|AIB06733.1| cinnamate 4-mono-oxygenase [Mangifera indica]
Length=505

 Score =   172 bits (436),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            FVAI++AI +SKLRGK++KLPPGPIPVP+FGNWLQVGDDLNHRNLTD AKKFG+I +LRM
Sbjct  14   FVAIVLAITISKLRGKRFKLPPGPIPVPLFGNWLQVGDDLNHRNLTDLAKKFGEILLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP+LAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVV  106



>ref|XP_006410152.1| hypothetical protein EUTSA_v10016545mg [Eutrema salsugineum]
 dbj|BAJ33716.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ51605.1| hypothetical protein EUTSA_v10016545mg [Eutrema salsugineum]
Length=505

 Score =   172 bits (436),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            FVA+I+A V+SKLRGKK KLPPGP+P+PVFGNWLQVGDDLNHRNL DYAKKFGD+F+LRM
Sbjct  14   FVAVILATVISKLRGKKLKLPPGPMPIPVFGNWLQVGDDLNHRNLVDYAKKFGDLFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP L KEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPNLTKEVLHTQGVEFGSRTRNVV  106



>sp|Q04468.1|TCMO_HELTU RecName: Full=Trans-cinnamate 4-monooxygenase; AltName: Full=Cinnamic 
acid 4-hydroxylase; Short=C4H; Short=CA4H; AltName: 
Full=Cytochrome P450 73; AltName: Full=Cytochrome P450C4H [Helianthus 
tuberosus]
 emb|CAA78982.1| trans-cinnamate 4-monooxygenase [Helianthus tuberosus]
Length=505

 Score =   172 bits (436),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F AII AI++SKLRGKK+KLPPGPIPVP+FGNWLQVGDDLNHRNLTD AK+FG+I +LRM
Sbjct  14   FAAIIGAILISKLRGKKFKLPPGPIPVPIFGNWLQVGDDLNHRNLTDLAKRFGEILLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSPELAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVV  106



>ref|XP_009354868.1| PREDICTED: trans-cinnamate 4-monooxygenase [Pyrus x bretschneideri]
Length=504

 Score =   172 bits (435),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 83/93 (89%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            FVA+IVAI +SKLRGKK+KLPPGPIPVPVFG  LQVGDDLNHRNLTD AKKFGD F+LRM
Sbjct  14   FVAVIVAITISKLRGKKFKLPPGPIPVPVFGTGLQVGDDLNHRNLTDLAKKFGDCFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSPELAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVV  106



>ref|XP_010685980.1| PREDICTED: trans-cinnamate 4-monooxygenase [Beta vulgaris subsp. 
vulgaris]
Length=504

 Score =   172 bits (435),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F AI +AIV+SKL+GKK+KLPPGPIPVP+FGNWLQVGDDLNHRNLTD AKKFG++F+LRM
Sbjct  14   FFAITLAIVISKLKGKKFKLPPGPIPVPIFGNWLQVGDDLNHRNLTDLAKKFGEMFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSPELAK+VLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPELAKDVLHTQGVEFGSRTRNVV  106



>ref|XP_010510361.1| PREDICTED: trans-cinnamate 4-monooxygenase [Camelina sativa]
Length=505

 Score =   171 bits (434),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            FVA+++A VVSKLRGKK KLPPGP+P+P+FGNWLQVGDDLNHRNL DYAKKFGD+F+LRM
Sbjct  14   FVAVVLATVVSKLRGKKLKLPPGPMPIPIFGNWLQVGDDLNHRNLVDYAKKFGDLFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP L KEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPNLTKEVLHTQGVEFGSRTRNVV  106



>ref|XP_010414263.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Camelina sativa]
 ref|XP_010469851.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Camelina sativa]
Length=505

 Score =   171 bits (434),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            FVA+++A VVSKLRGKK KLPPGP+P+P+FGNWLQVGDDLNHRNL DYAKKFGD+F+LRM
Sbjct  14   FVAVVLATVVSKLRGKKLKLPPGPMPIPIFGNWLQVGDDLNHRNLVDYAKKFGDLFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP L KEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPNLTKEVLHTQGVEFGSRTRNVV  106



>ref|XP_006294053.1| hypothetical protein CARUB_v10023044mg [Capsella rubella]
 gb|EOA26951.1| hypothetical protein CARUB_v10023044mg [Capsella rubella]
Length=506

 Score =   171 bits (434),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            FVA+++A VVSKLRGKK KLPPGP+P+P+FGNWLQVGDDLNHRNL DYAKKFGD+F+LRM
Sbjct  15   FVAVVLATVVSKLRGKKLKLPPGPMPIPIFGNWLQVGDDLNHRNLVDYAKKFGDLFLLRM  74

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP L KEVLHTQGVEFGSRTRN V
Sbjct  75   GQRNLVVVSSPNLTKEVLHTQGVEFGSRTRNVV  107



>gb|AGC29944.1| CYP73A107 [Sinopodophyllum hexandrum]
 gb|AGV76060.1| cinnamate-4-hydroxylase [Sinopodophyllum hexandrum]
Length=504

 Score =   171 bits (434),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            FVAII AIV+SKLRGK++KLPPGPIPVP+FGNWLQVGDDLNHRNLTD A+KFG+I +LRM
Sbjct  14   FVAIIGAIVISKLRGKRFKLPPGPIPVPIFGNWLQVGDDLNHRNLTDLARKFGEILLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNL+VVSSP+LAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLIVVSSPDLAKEVLHTQGVEFGSRTRNVV  106



>sp|P37115.1|TCMO_VIGRR RecName: Full=Trans-cinnamate 4-monooxygenase; AltName: Full=Cinnamic 
acid 4-hydroxylase; Short=C4H; Short=CA4H; AltName: 
Full=Cytochrome P450 73; AltName: Full=Cytochrome P450C4H [Vigna 
radiata var. radiata]
 gb|AAA33755.1| cinnamate 4-hydroxylase [Vigna radiata var. radiata]
Length=505

 Score =   171 bits (434),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F+A +VAIVVSKLRGK++KLPPGP+PVP+FGNWLQVGDDLNHRNLT  AK+FGDIF+LRM
Sbjct  14   FLAAVVAIVVSKLRGKRFKLPPGPLPVPIFGNWLQVGDDLNHRNLTQLAKRFGDIFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP+LAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVV  106



>gb|ACR10242.1| cinnamate-4-hydroxylase [Canarium album]
Length=505

 Score =   171 bits (433),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 82/93 (88%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            FVAI++AI VSKLRGK++KLPPGPIPVPVFGNWLQVGDDLNHRNLT  AKKFGDI +LRM
Sbjct  14   FVAIVLAIAVSKLRGKRFKLPPGPIPVPVFGNWLQVGDDLNHRNLTYLAKKFGDILLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP+LAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVV  106



>gb|AHG97392.1| C4H catalytic cinnamic acid-4-hydroxylase [Ageratina adenophora]
Length=505

 Score =   171 bits (433),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 82/93 (88%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F AIIVAIV+SKLRGKK+ LPPGPIPVP+FGNWLQVGDDLNHRNLT  AKKFG IF+LRM
Sbjct  14   FSAIIVAIVISKLRGKKFNLPPGPIPVPIFGNWLQVGDDLNHRNLTGLAKKFGQIFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSPELAK+VLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPELAKDVLHTQGVEFGSRTRNVV  106



>sp|Q43240.1|TCMO_ZINVI RecName: Full=Trans-cinnamate 4-monooxygenase; AltName: Full=Cinnamic 
acid 4-hydroxylase; Short=C4H; Short=CA4H; AltName: 
Full=Cytochrome P450 73; AltName: Full=Cytochrome P450C4H [Zinnia 
violacea]
 gb|AAB42024.1| cinnamic acid 4-hydroxylase [Zinnia violacea]
Length=505

 Score =   171 bits (432),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F AII +I +SKLRGK++KLPPGP+PVP+FGNWLQVGDDLNHRNLTD AKKFG+IF+LRM
Sbjct  14   FAAIIASIFISKLRGKRFKLPPGPVPVPIFGNWLQVGDDLNHRNLTDLAKKFGEIFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP LAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPNLAKEVLHTQGVEFGSRTRNVV  106



>gb|AAO62904.1| cinnamate 4-hydroxylase [Ammi majus]
Length=506

 Score =   171 bits (432),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F+A IVAI +SKLRGKK KLPPGPIPVPVFGNWLQVGDDLN RNL +YAKKFGD+F+LRM
Sbjct  15   FIATIVAITISKLRGKKLKLPPGPIPVPVFGNWLQVGDDLNQRNLVEYAKKFGDLFLLRM  74

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP+LAK+VLHTQGVEFGSRTRN V
Sbjct  75   GQRNLVVVSSPDLAKDVLHTQGVEFGSRTRNVV  107



>gb|AJD22263.1| cinnamate 4-hydroxylase [Angelica dahurica]
Length=505

 Score =   170 bits (431),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 86/93 (92%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F+A IVAI +SKLRGKK KLPPGPIPVPVFGNWLQVGDDLN RNL  YAKKFGD+FMLRM
Sbjct  14   FIATIVAITISKLRGKKLKLPPGPIPVPVFGNWLQVGDDLNQRNLVGYAKKFGDLFMLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP+LAK+VLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPDLAKDVLHTQGVEFGSRTRNVV  106



>gb|ADG43134.1| cinnamate 4-hydroxylase [Isatis tinctoria]
Length=509

 Score =   170 bits (431),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 77/93 (83%), Positives = 86/93 (92%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F A+++A V+SKLRGKK KLPPGP+P+P+FGNWLQVGDDLNHRNL DYAKKFGD+F+LRM
Sbjct  14   FAAVVLATVISKLRGKKLKLPPGPMPIPIFGNWLQVGDDLNHRNLVDYAKKFGDLFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP L KEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPNLTKEVLHTQGVEFGSRTRNVV  106



>gb|ABE68874.1| cinnamate 4-hydroxylase [Brassica rapa subsp. pekinensis]
Length=505

 Score =   170 bits (430),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 77/93 (83%), Positives = 86/93 (92%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F A+++A V+SKLRGKK KLPPGP+P+P+FGNWLQVGDDLNHRNL DYAKKFGD+F+LRM
Sbjct  14   FAAVVLATVISKLRGKKLKLPPGPMPIPIFGNWLQVGDDLNHRNLVDYAKKFGDLFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP L KEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPNLTKEVLHTQGVEFGSRTRNVV  106



>ref|XP_008810838.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Phoenix dactylifera]
Length=505

 Score =   170 bits (430),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 78/93 (84%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F A+ +AI VSKLRGK++KLPPGP+PVP+FGNWLQVGDDLNHRNLT  AK+FGDIF+LRM
Sbjct  14   FAAVTIAIAVSKLRGKRFKLPPGPLPVPIFGNWLQVGDDLNHRNLTALAKRFGDIFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSPELA+EVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPELAREVLHTQGVEFGSRTRNVV  106



>dbj|BAI77480.1| cinnamate-4-hydroxylase [Brassica rapa]
 emb|CDY10741.1| BnaA05g11950D [Brassica napus]
Length=505

 Score =   170 bits (430),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 77/93 (83%), Positives = 86/93 (92%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F A+++A V+SKLRGKK KLPPGP+P+P+FGNWLQVGDDLNHRNL DYAKKFGD+F+LRM
Sbjct  14   FAAVVLATVISKLRGKKLKLPPGPMPIPIFGNWLQVGDDLNHRNLVDYAKKFGDLFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP L KEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPNLTKEVLHTQGVEFGSRTRNVV  106



>dbj|BAF81522.1| cinnamate-4-hydroxylase [Brassica rapa]
 dbj|BAI77479.1| cinnamate-4-hydroxylase [Brassica rapa subsp. pekinensis]
Length=505

 Score =   169 bits (429),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 77/93 (83%), Positives = 86/93 (92%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F A+++A V+SKLRGKK KLPPGP+P+P+FGNWLQVGDDLNHRNL DYAKKFGD+F+LRM
Sbjct  14   FAAVVLATVISKLRGKKLKLPPGPMPIPIFGNWLQVGDDLNHRNLVDYAKKFGDLFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP L KEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPNLTKEVLHTQGVEFGSRTRNVV  106



>ref|NP_001288861.1| trans-cinnamate 4-monooxygenase [Brassica rapa]
 dbj|BAI77481.1| cinnamate-4-hydroxylase [Brassica rapa]
Length=505

 Score =   169 bits (429),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 77/93 (83%), Positives = 86/93 (92%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F A+++A V+SKLRGKK KLPPGP+P+P+FGNWLQVGDDLNHRNL DYAKKFGD+F+LRM
Sbjct  14   FAAVVLATVISKLRGKKLKLPPGPMPIPIFGNWLQVGDDLNHRNLVDYAKKFGDLFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP L KEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPNLTKEVLHTQGVEFGSRTRNVV  106



>gb|ABF17873.1| cinnamate 4-hydroxylase isoform 1 [Brassica napus]
 gb|ABF17874.1| cinnamate 4-hydroxylase isoform 1 [Brassica napus]
 emb|CDY02068.1| BnaC04g14330D [Brassica napus]
Length=505

 Score =   169 bits (429),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 77/93 (83%), Positives = 86/93 (92%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F A+++A V+SKLRGKK KLPPGP+P+P+FGNWLQVGDDLNHRNL DYAKKFGD+F+LRM
Sbjct  14   FAAVVLATVISKLRGKKLKLPPGPMPIPIFGNWLQVGDDLNHRNLVDYAKKFGDLFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP L KEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPNLTKEVLHTQGVEFGSRTRNVV  106



>gb|ACY78690.1| trans-cinnamate 4-monooxygenase [Cynara cardunculus var. scolymus]
Length=505

 Score =   169 bits (429),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            FVAI+ AI +SKLRGK++KLPPGP PVP+FGNWLQVGDDLNHRNLTD AKKFG IF+LRM
Sbjct  14   FVAILGAIFISKLRGKRFKLPPGPFPVPIFGNWLQVGDDLNHRNLTDLAKKFGQIFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP+LAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVV  106



>gb|AHL83550.1| C4H [Morus alba var. multicaulis]
Length=505

 Score =   169 bits (429),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 86/93 (92%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F A+IVA V+SKLRGK++KLPPGPIPVPVFGNWLQVGD LNHRNLTD AKKFG I +LRM
Sbjct  14   FAAVIVATVISKLRGKRFKLPPGPIPVPVFGNWLQVGDALNHRNLTDLAKKFGGILLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSPELAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVV  106



>gb|AFG26507.1| putative cinnamate 4-hydroxylase, partial [Leucaena leucocephala]
Length=110

 Score =   159 bits (401),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 74/83 (89%), Positives = 79/83 (95%), Gaps = 0/83 (0%)
 Frame = +2

Query  143  SKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRMGQRNLVVVSS  322
            SK RG ++KLPPGP+PVP+FGNWLQVGDDLNHRNLTD AKKFGDIF+LRMGQRNLVVVSS
Sbjct  24   SKFRGNRFKLPPGPLPVPIFGNWLQVGDDLNHRNLTDLAKKFGDIFLLRMGQRNLVVVSS  83

Query  323  PELAKEVLHTQGVEFGSRTRNXV  391
            PELAKEVLHTQGVEFGSRTRN V
Sbjct  84   PELAKEVLHTQGVEFGSRTRNVV  106



>gb|AEV93475.1| 4-coumarate:CoA ligase [Caragana korshinskii]
Length=505

 Score =   169 bits (428),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 77/93 (83%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F+A  +AI +SKLRGK++KLPPGPIPVP+FGNWLQVGDDLNHRNLTD AK+FG+I +LRM
Sbjct  14   FIAATIAITISKLRGKRFKLPPGPIPVPIFGNWLQVGDDLNHRNLTDLAKRFGEILLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP+LAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVV  106



>gb|AAS48416.1| cinammate 4-hydroxylase [Allium cepa]
Length=505

 Score =   169 bits (428),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 77/93 (83%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F AI +AIV+SKLRGKK+KLPPGP+PVP+FGNWLQVGDDLNHRNL ++AKKFGD+F+LRM
Sbjct  14   FFAITLAIVISKLRGKKFKLPPGPLPVPIFGNWLQVGDDLNHRNLANFAKKFGDVFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP+LA++VLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPDLARDVLHTQGVEFGSRTRNVV  106



>gb|AHA84274.1| trans-cinnamate 4-monooxygenase [Phaseolus vulgaris]
Length=506

 Score =   169 bits (427),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 78/93 (84%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F++ +VAI VSKLRGK++KLPPGP+PVP+FGNWLQVGDDLNHRNLT  AK+FGDIF+LRM
Sbjct  14   FLSAVVAIAVSKLRGKRFKLPPGPLPVPIFGNWLQVGDDLNHRNLTGLAKRFGDIFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP+LAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVV  106



>gb|AGU91429.1| trans-cinnamate 4-monooxygenase [Chrysanthemum boreale]
Length=505

 Score =   168 bits (426),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
              AI+ AI +SKLRGK++KLPPGPIPVP+FGNWLQVGDDLNHRNLTD AKKFG+IF+LRM
Sbjct  14   LAAILGAIFISKLRGKRFKLPPGPIPVPIFGNWLQVGDDLNHRNLTDLAKKFGEIFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP+LAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVV  106



>sp|P37114.1|TCMO_MEDSA RecName: Full=Trans-cinnamate 4-monooxygenase; AltName: Full=Cinnamic 
acid 4-hydroxylase; Short=C4H; Short=CA4H; AltName: 
Full=Cytochrome P450 73; AltName: Full=Cytochrome P450C4H [Medicago 
sativa]
Length=506

 Score =   168 bits (426),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 77/93 (83%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F+A  +A+ +SKLRGK++KLPPGPIPVP+FG WLQVGDDLNHRNLTDYAK+FG+IF+LRM
Sbjct  14   FIAATIAVTISKLRGKRFKLPPGPIPVPIFGYWLQVGDDLNHRNLTDYAKRFGEIFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSPELAKEVLHTQ VEFGSRTRN V
Sbjct  74   GQRNLVVVSSPELAKEVLHTQCVEFGSRTRNVV  106



>ref|XP_010921158.1| PREDICTED: trans-cinnamate 4-monooxygenase [Elaeis guineensis]
Length=505

 Score =   168 bits (426),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 77/93 (83%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F A+ +AI VSK+RGK++KLPPGP+PVP+FGNWLQVGDDLNHRNLT  AK+FGDIF+LRM
Sbjct  14   FAAVTLAIAVSKIRGKRFKLPPGPLPVPIFGNWLQVGDDLNHRNLTALAKRFGDIFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSPELA+EVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPELAREVLHTQGVEFGSRTRNVV  106



>gb|AGG55322.1| cinnamate 4-hydroxylase [Paeonia lactiflora]
Length=505

 Score =   168 bits (426),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F+A+I AI VSKLRGK++KLPPGP+PVP+FGNWLQVGDDLNHRNL D+AKKFG++ +LRM
Sbjct  14   FIAMITAITVSKLRGKRFKLPPGPLPVPIFGNWLQVGDDLNHRNLADFAKKFGEVLLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP+LAK+VLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPDLAKDVLHTQGVEFGSRTRNVV  106



>gb|ADO24190.1| cinnamate 4-hydroxylase [Allium sativum]
Length=507

 Score =   168 bits (426),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 77/93 (83%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F AI +AIV+SKLRG+K+KLPPGP+PVP+FGNWLQVGDDLNHRNLT+ AKKFGD+F+LRM
Sbjct  14   FFAITLAIVISKLRGRKFKLPPGPLPVPIFGNWLQVGDDLNHRNLTNLAKKFGDVFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP+LA++VLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPDLARDVLHTQGVEFGSRTRNVV  106



>gb|ACB78015.1| cinnamic acid 4-hydroxylase, partial [Trifolium pratense]
Length=498

 Score =   168 bits (425),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 88/93 (95%), Gaps = 1/93 (1%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F+A+I AI +SKLRGK++KLPPGPIPVP+FGNWLQVGDDLNHRNLTD AK+FG+I +LRM
Sbjct  7    FIAVI-AITISKLRGKRFKLPPGPIPVPIFGNWLQVGDDLNHRNLTDLAKRFGEILLLRM  65

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSPELAKEVLHTQGVEFGSRTRN V
Sbjct  66   GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVV  98



>gb|ADO16181.1| cytochrome P450 mono-oxygenase [Artemisia annua]
Length=505

 Score =   168 bits (425),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/92 (86%), Positives = 88/92 (96%), Gaps = 0/92 (0%)
 Frame = +2

Query  116  VAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRMG  295
            VAI+ AI +SKLRGK++KLPPGPIPVP+FGNWLQVGDDLNHRNLTD AKKFG+IF+LRMG
Sbjct  15   VAILGAIFISKLRGKRFKLPPGPIPVPIFGNWLQVGDDLNHRNLTDLAKKFGEIFLLRMG  74

Query  296  QRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            QRNLVVVSSP+LAK+VLHTQGVEFGSRTRN V
Sbjct  75   QRNLVVVSSPDLAKDVLHTQGVEFGSRTRNVV  106



>gb|ACJ37399.1| trans-cinnamate 4-monooxygenase [Echinacea angustifolia]
Length=505

 Score =   168 bits (425),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 78/93 (84%), Positives = 86/93 (92%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F AII +I +SKLRGK++KLPPGP+PVP+FGNWLQVGDDLNHRNLTD AKKFG+I +LRM
Sbjct  14   FAAIIASIFISKLRGKRFKLPPGPLPVPIFGNWLQVGDDLNHRNLTDLAKKFGEILLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP LAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPNLAKEVLHTQGVEFGSRTRNVV  106



>ref|XP_009354880.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Pyrus x bretschneideri]
Length=504

 Score =   168 bits (425),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 78/93 (84%), Positives = 86/93 (92%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            FVA+ +AI +SKLR KK+KLPPGPIPVPVFGNWLQVGDDLNHR+L+D A+KFGD F+LRM
Sbjct  14   FVAVTIAIAISKLRSKKFKLPPGPIPVPVFGNWLQVGDDLNHRSLSDLARKFGDCFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSS ELAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSTELAKEVLHTQGVEFGSRTRNVV  106



>gb|AFV47361.1| C4H [Helichrysum aureonitens]
Length=504

 Score =   167 bits (424),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/93 (84%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F  I+ AI +SKLRGK++KLPPGPIPVP+FGNWLQVGDDLNHRNLTD AKKFG+IF+LRM
Sbjct  14   FATILGAIFISKLRGKRFKLPPGPIPVPIFGNWLQVGDDLNHRNLTDLAKKFGEIFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP+LAK+VLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPDLAKDVLHTQGVEFGSRTRNVV  106



>ref|XP_004242478.1| PREDICTED: trans-cinnamate 4-monooxygenase [Solanum lycopersicum]
Length=317

 Score =   163 bits (413),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 74/83 (89%), Positives = 80/83 (96%), Gaps = 0/83 (0%)
 Frame = +2

Query  143  SKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRMGQRNLVVVSS  322
            SKLR K++KLPPGPIPVP+FGNWLQVGDDLNHRNLT+YAKKFGD+F+LRMGQRNL VVSS
Sbjct  24   SKLRSKRFKLPPGPIPVPIFGNWLQVGDDLNHRNLTEYAKKFGDVFLLRMGQRNLAVVSS  83

Query  323  PELAKEVLHTQGVEFGSRTRNXV  391
            PELAKEVLHTQGVEFGSRTRN V
Sbjct  84   PELAKEVLHTQGVEFGSRTRNVV  106



>ref|XP_004242477.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Solanum lycopersicum]
Length=318

 Score =   163 bits (413),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 74/83 (89%), Positives = 80/83 (96%), Gaps = 0/83 (0%)
 Frame = +2

Query  143  SKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRMGQRNLVVVSS  322
            SKLR K++KLPPGPIPVP+FGNWLQVGDDLNHRNLT+YAKKFGD+F+LRMGQRNL VVSS
Sbjct  24   SKLRSKRFKLPPGPIPVPIFGNWLQVGDDLNHRNLTEYAKKFGDVFLLRMGQRNLAVVSS  83

Query  323  PELAKEVLHTQGVEFGSRTRNXV  391
            PELAKEVLHTQGVEFGSRTRN V
Sbjct  84   PELAKEVLHTQGVEFGSRTRNVV  106



>gb|AAU09021.1| Cinnamic acid 4-hydroxylase [Agastache rugosa]
Length=502

 Score =   167 bits (423),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 78/83 (94%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +2

Query  143  SKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRMGQRNLVVVSS  322
            SKLRGKK+KLPPGPIPVP+FGNWLQVGDDLNHRNLTDYAKKFGDIF+LRMGQRNLVVVSS
Sbjct  24   SKLRGKKFKLPPGPIPVPIFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRMGQRNLVVVSS  83

Query  323  PELAKEVLHTQGVEFGSRTRNXV  391
            PELAK+VLHTQGVEFGSRTRN V
Sbjct  84   PELAKDVLHTQGVEFGSRTRNVV  106



>ref|XP_006842509.1| hypothetical protein AMTR_s00077p00107120 [Amborella trichopoda]
 gb|ERN04184.1| hypothetical protein AMTR_s00077p00107120 [Amborella trichopoda]
Length=504

 Score =   166 bits (421),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            FVAI+ AI VSKLRGK+ +LPPGP+ +P+FGNWLQVGDDLNHRNL+D AKKFGD+F+LRM
Sbjct  14   FVAIVTAITVSKLRGKRLRLPPGPLTIPIFGNWLQVGDDLNHRNLSDLAKKFGDVFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP+LAK+VLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPDLAKDVLHTQGVEFGSRTRNVV  106



>gb|AID69233.1| cinnamate 4-hydroxylase [Garcinia mangostana]
Length=505

 Score =   166 bits (421),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 77/93 (83%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F A +VAIV+S LRGK++KLPPGP+P+PVFGNWL+VGDDLNHRNLT+ AKKFG IF+LRM
Sbjct  14   FFAAVVAIVISTLRGKRFKLPPGPLPIPVFGNWLEVGDDLNHRNLTELAKKFGQIFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSPELAK+VLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPELAKDVLHTQGVEFGSRTRNVV  106



>ref|XP_008782669.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Phoenix dactylifera]
Length=505

 Score =   166 bits (420),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F A+ +AI VSKLRGK+++LPPGP+PVP+FGNWLQVGDDLNHRNLT  AK+FGDIF+LRM
Sbjct  14   FAAVTLAIAVSKLRGKRFRLPPGPLPVPIFGNWLQVGDDLNHRNLTALAKRFGDIFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSPE+A++VLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPEMARDVLHTQGVEFGSRTRNVV  106



>emb|CDY23996.1| BnaC03g16950D [Brassica napus]
Length=481

 Score =   164 bits (415),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 86/93 (92%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F+A+++A ++SKLRGKK KLPPGPIPVPVFGNWLQVGDDLNHRNL DYAKKFGD+F LRM
Sbjct  14   FLAVVLATMISKLRGKKLKLPPGPIPVPVFGNWLQVGDDLNHRNLVDYAKKFGDLFHLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQR+LVV+SSP+LAKEVL TQGVEFGSR RN V
Sbjct  74   GQRDLVVISSPDLAKEVLQTQGVEFGSRYRNIV  106



>gb|ACY06865.2| cinnamate 4-hydroxylase [Astragalus chrysochlorus]
Length=506

 Score =   164 bits (415),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 76/83 (92%), Positives = 81/83 (98%), Gaps = 0/83 (0%)
 Frame = +2

Query  143  SKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRMGQRNLVVVSS  322
            SKLRGK++KLPPGPIPVP+FGNWLQVGDDLNHRNLTD AK+FGDIF+LRMGQRNLVVVSS
Sbjct  24   SKLRGKRFKLPPGPIPVPIFGNWLQVGDDLNHRNLTDLAKRFGDIFLLRMGQRNLVVVSS  83

Query  323  PELAKEVLHTQGVEFGSRTRNXV  391
            PELAKEVLHTQGVEFGSRTRN V
Sbjct  84   PELAKEVLHTQGVEFGSRTRNVV  106



>gb|AFR37664.1| cinnamate 4-hydroxylase, partial [Populus alba]
 gb|AFR37665.1| cinnamate 4-hydroxylase, partial [Populus alba]
 gb|AFR37666.1| cinnamate 4-hydroxylase, partial [Populus alba]
 gb|AFR37667.1| cinnamate 4-hydroxylase, partial [Populus alba]
 gb|AFR37669.1| cinnamate 4-hydroxylase, partial [Populus alba]
 gb|AFR37670.1| cinnamate 4-hydroxylase, partial [Populus alba]
 gb|AFR37680.1| cinnamate 4-hydroxylase, partial [Populus nigra]
 gb|AFR37681.1| cinnamate 4-hydroxylase, partial [Populus nigra]
Length=118

 Score =   154 bits (389),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 83/93 (89%), Positives = 91/93 (98%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            FVAI+VAI+VSKLRGK++KLPPGP+PVPVFGNWLQVGDDLNHRNLTD AKKFGDIF+LRM
Sbjct  14   FVAILVAILVSKLRGKRFKLPPGPLPVPVFGNWLQVGDDLNHRNLTDLAKKFGDIFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP+L+KEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPDLSKEVLHTQGVEFGSRTRNVV  106



>gb|AFR37668.1| cinnamate 4-hydroxylase, partial [Populus alba]
Length=116

 Score =   154 bits (389),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 83/93 (89%), Positives = 91/93 (98%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            FVAI+VAI+VSKLRGK++KLPPGP+PVPVFGNWLQVGDDLNHRNLTD AKKFGDIF+LRM
Sbjct  14   FVAILVAILVSKLRGKRFKLPPGPLPVPVFGNWLQVGDDLNHRNLTDLAKKFGDIFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP+L+KEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPDLSKEVLHTQGVEFGSRTRNVV  106



>ref|XP_010938024.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Elaeis guineensis]
Length=505

 Score =   163 bits (412),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 86/93 (92%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F A+ +AI VSKLRGK++KLPPGP+PVP+FGNWLQVGDDLNHRNLT  AK+FG+I +LRM
Sbjct  14   FAAVSLAIAVSKLRGKRFKLPPGPLPVPIFGNWLQVGDDLNHRNLTALAKRFGNILLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSPELA++VLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPELARDVLHTQGVEFGSRTRNVV  106



>gb|AEH68208.1| cinnamate 4-hydroxylase [Astragalus mongholicus]
Length=505

 Score =   163 bits (412),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 74/85 (87%), Positives = 82/85 (96%), Gaps = 0/85 (0%)
 Frame = +2

Query  137  VVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRMGQRNLVVV  316
             +SKLRGK++KLPPGPIPVP+FGNWLQVGDDLNHRNLTD AK+FGDIF+LRMGQRNLVV+
Sbjct  22   TISKLRGKRFKLPPGPIPVPIFGNWLQVGDDLNHRNLTDLAKRFGDIFLLRMGQRNLVVI  81

Query  317  SSPELAKEVLHTQGVEFGSRTRNXV  391
            SSP+LAKEVLHTQGVEFGSRTRN V
Sbjct  82   SSPDLAKEVLHTQGVEFGSRTRNVV  106



>ref|XP_002458683.1| hypothetical protein SORBIDRAFT_03g038160 [Sorghum bicolor]
 gb|EES03803.1| hypothetical protein SORBIDRAFT_03g038160 [Sorghum bicolor]
Length=505

 Score =   162 bits (411),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 74/93 (80%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F +++VAI VSK+RG+K +LPPGP+PVP+FGNWLQVGDDLNHRNL   A+KFGDIF+LRM
Sbjct  14   FASVVVAIAVSKMRGRKLRLPPGPVPVPIFGNWLQVGDDLNHRNLAALARKFGDIFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP LA+EVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPPLAREVLHTQGVEFGSRTRNVV  106



>sp|Q96423.1|TCMO_GLYEC RecName: Full=Trans-cinnamate 4-monooxygenase; AltName: Full=Cinnamic 
acid 4-hydroxylase; Short=C4H; Short=CA4H; AltName: 
Full=Cytochrome P450 73; AltName: Full=Cytochrome P450C4H [Glycyrrhiza 
echinata]
 dbj|BAA13414.1| cytochrome P450 (CYP73A14) [Glycyrrhiza echinata]
Length=505

 Score =   162 bits (411),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/83 (90%), Positives = 81/83 (98%), Gaps = 0/83 (0%)
 Frame = +2

Query  143  SKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRMGQRNLVVVSS  322
            SKLRG+++KLPPGPIPVP+FGNWLQVGDDLNHRNLTD AK+FGDIF+LRMGQRNLVVVSS
Sbjct  24   SKLRGRRFKLPPGPIPVPIFGNWLQVGDDLNHRNLTDLAKRFGDIFLLRMGQRNLVVVSS  83

Query  323  PELAKEVLHTQGVEFGSRTRNXV  391
            PELAKEVLHTQGVEFGSRTRN V
Sbjct  84   PELAKEVLHTQGVEFGSRTRNVV  106



>gb|ACZ54906.1| cinnamate 4-hydroxylase [Leucaena leucocephala]
Length=505

 Score =   162 bits (411),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/83 (90%), Positives = 81/83 (98%), Gaps = 0/83 (0%)
 Frame = +2

Query  143  SKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRMGQRNLVVVSS  322
            SKLRGK++KLPPGP+PVP+FGNWLQVGDDLNHRNLTD AKKFGDIF+LRMGQRNL+VVSS
Sbjct  24   SKLRGKRFKLPPGPLPVPIFGNWLQVGDDLNHRNLTDLAKKFGDIFLLRMGQRNLLVVSS  83

Query  323  PELAKEVLHTQGVEFGSRTRNXV  391
            PELAKEVLHTQGVEFGSRTRN V
Sbjct  84   PELAKEVLHTQGVEFGSRTRNVV  106



>ref|XP_004970385.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Setaria italica]
Length=505

 Score =   162 bits (411),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/93 (80%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F +++VAI VSKLRG+K +LPPGP+PVP+FGNWLQVGDDLNHRNL   A++FGDIF+LRM
Sbjct  14   FASVVVAIAVSKLRGRKLRLPPGPVPVPIFGNWLQVGDDLNHRNLAALARRFGDIFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP LA+EVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPPLAREVLHTQGVEFGSRTRNVV  106



>gb|AEM63593.1| cinnamate 4-hydroxylase [Leucaena leucocephala]
Length=505

 Score =   162 bits (410),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/83 (90%), Positives = 81/83 (98%), Gaps = 0/83 (0%)
 Frame = +2

Query  143  SKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRMGQRNLVVVSS  322
            SKLRGK++KLPPGP+PVP+FGNWLQVGDDLNHRNLTD AKKFGDIF+LRMGQRNL+VVSS
Sbjct  24   SKLRGKRFKLPPGPLPVPIFGNWLQVGDDLNHRNLTDLAKKFGDIFLLRMGQRNLLVVSS  83

Query  323  PELAKEVLHTQGVEFGSRTRNXV  391
            PELAKEVLHTQGVEFGSRTRN V
Sbjct  84   PELAKEVLHTQGVEFGSRTRNVV  106



>gb|AFR37527.1| cinnamate 4-hydroxylase, partial [Populus nigra]
 gb|AFR37538.1| cinnamate 4-hydroxylase, partial [Populus nigra]
Length=112

 Score =   152 bits (383),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 82/93 (88%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            FVAI+VAI+VS+LRGK++KLPPGP+PVPVFGNWLQVGDDLNHRNLTD AKKFGDI +LRM
Sbjct  14   FVAILVAILVSQLRGKRFKLPPGPLPVPVFGNWLQVGDDLNHRNLTDLAKKFGDILLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP+LAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVV  106



>gb|AID51447.1| cinnamate 4-hydroxylase 2 [Astragalus membranaceus]
Length=505

 Score =   162 bits (409),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 75/82 (91%), Positives = 80/82 (98%), Gaps = 0/82 (0%)
 Frame = +2

Query  146  KLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRMGQRNLVVVSSP  325
            KLRGK++KLPPGP+PVP+FGNWLQVGDDLNHRNLTD AKKFGDIF+LRMGQRNLVVVSSP
Sbjct  25   KLRGKRFKLPPGPLPVPIFGNWLQVGDDLNHRNLTDLAKKFGDIFLLRMGQRNLVVVSSP  84

Query  326  ELAKEVLHTQGVEFGSRTRNXV  391
            ELAKEVLHTQGVEFGSRTRN V
Sbjct  85   ELAKEVLHTQGVEFGSRTRNVV  106



>gb|AGO03798.1| cytochrome P450-like protein [Tanacetum cinerariifolium]
Length=505

 Score =   161 bits (407),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 74/84 (88%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = +2

Query  140  VSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRMGQRNLVVVS  319
            +SKLRGK++KLPPGPIPVP+FGNWLQVGDDLNHRNLTD AKKFG+IF+LRMGQRNLVVVS
Sbjct  23   ISKLRGKRFKLPPGPIPVPIFGNWLQVGDDLNHRNLTDLAKKFGEIFLLRMGQRNLVVVS  82

Query  320  SPELAKEVLHTQGVEFGSRTRNXV  391
            SP+LAK+VLHTQGVEFGSRTRN V
Sbjct  83   SPDLAKDVLHTQGVEFGSRTRNVV  106



>gb|AFR37513.1| cinnamate 4-hydroxylase, partial [Populus alba]
 gb|AFR37515.1| cinnamate 4-hydroxylase, partial [Populus alba]
 gb|AFR37517.1| cinnamate 4-hydroxylase, partial [Populus alba]
 gb|AFR37518.1| cinnamate 4-hydroxylase, partial [Populus alba]
Length=152

 Score =   152 bits (383),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 83/93 (89%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            FVAI+VAI+VSKLRGK++KLPPGP+PVPVFGNWLQVGDDLNHRNLTD AKKFGDI +LRM
Sbjct  14   FVAILVAILVSKLRGKRFKLPPGPLPVPVFGNWLQVGDDLNHRNLTDLAKKFGDILLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP+LAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVV  106



>gb|AGN70893.1| cinammate 4-hydroxylase [Dendrobium catenatum]
Length=505

 Score =   160 bits (405),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F A+ +A+VVSKL GKK KLPPGP+PVP+FGNWLQVGDDLNHRNL   AKKFGDI +LRM
Sbjct  14   FAAVTLAVVVSKLSGKKLKLPPGPLPVPIFGNWLQVGDDLNHRNLASLAKKFGDILLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP+ A+EVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPDHAREVLHTQGVEFGSRTRNVV  106



>gb|AFR37514.1| cinnamate 4-hydroxylase, partial [Populus alba]
 gb|AFR37516.1| cinnamate 4-hydroxylase, partial [Populus alba]
Length=153

 Score =   152 bits (383),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 83/93 (89%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            FVAI+VAI+VSKLRGK++KLPPGP+PVPVFGNWLQVGDDLNHRNLTD AKKFGDI +LRM
Sbjct  14   FVAILVAILVSKLRGKRFKLPPGPLPVPVFGNWLQVGDDLNHRNLTDLAKKFGDILLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP+LAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVV  106



>gb|ACB78016.1| cinnamic acid 4-hydroxylase [Trifolium pratense]
Length=506

 Score =   160 bits (405),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 74/83 (89%), Positives = 80/83 (96%), Gaps = 0/83 (0%)
 Frame = +2

Query  143  SKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRMGQRNLVVVSS  322
            SKLRGK++KLPPGPIPVP+FGNWLQVGDDLNHRNLTD AK+FG+I +LRMGQRNLVVVSS
Sbjct  24   SKLRGKRFKLPPGPIPVPIFGNWLQVGDDLNHRNLTDLAKRFGEILLLRMGQRNLVVVSS  83

Query  323  PELAKEVLHTQGVEFGSRTRNXV  391
            PELAKEVLHTQGVEFGSRTRN V
Sbjct  84   PELAKEVLHTQGVEFGSRTRNVV  106



>gb|ACB78014.1| cinnamic acid 4-hydroxylase [Trifolium pratense]
Length=506

 Score =   160 bits (405),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 74/83 (89%), Positives = 80/83 (96%), Gaps = 0/83 (0%)
 Frame = +2

Query  143  SKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRMGQRNLVVVSS  322
            SKLRGK++KLPPGPIPVP+FGNWLQVGDDLNHRNLTD AK+FG+I +LRMGQRNLVVVSS
Sbjct  24   SKLRGKRFKLPPGPIPVPIFGNWLQVGDDLNHRNLTDLAKRFGEILLLRMGQRNLVVVSS  83

Query  323  PELAKEVLHTQGVEFGSRTRNXV  391
            PELAKEVLHTQGVEFGSRTRN V
Sbjct  84   PELAKEVLHTQGVEFGSRTRNVV  106



>ref|XP_010103664.1| Trans-cinnamate 4-monooxygenase [Morus notabilis]
 gb|EXB96547.1| Trans-cinnamate 4-monooxygenase [Morus notabilis]
Length=505

 Score =   160 bits (405),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 73/87 (84%), Positives = 84/87 (97%), Gaps = 0/87 (0%)
 Frame = +2

Query  131  AIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRMGQRNLV  310
            AI+VS+LRGK++KLPPGP+ VP+FGNWLQVGDDLNHRNL+D A+KFGDIF+LRMGQRNLV
Sbjct  20   AILVSRLRGKRFKLPPGPLTVPIFGNWLQVGDDLNHRNLSDLARKFGDIFLLRMGQRNLV  79

Query  311  VVSSPELAKEVLHTQGVEFGSRTRNXV  391
            VVSSP+LAK+VLHTQGVEFGSRTRN V
Sbjct  80   VVSSPDLAKQVLHTQGVEFGSRTRNVV  106



>gb|AFD36436.1| cinnamate 4-hydroxylase 1 [Astragalus membranaceus]
Length=505

 Score =   160 bits (405),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 74/85 (87%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = +2

Query  137  VVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRMGQRNLVVV  316
             +SKLRGK++KLPPG IPVP+FGNWLQVGDDLNHRNLTD AK+FGDIF+LRMGQRNLVVV
Sbjct  22   TISKLRGKRFKLPPGQIPVPIFGNWLQVGDDLNHRNLTDLAKRFGDIFLLRMGQRNLVVV  81

Query  317  SSPELAKEVLHTQGVEFGSRTRNXV  391
            SSP+LAKEVLHTQGVEFGSRTRN V
Sbjct  82   SSPDLAKEVLHTQGVEFGSRTRNVV  106



>gb|AFD29887.1| cinnamate 4-hydroxylase [Bambusa emeiensis]
Length=507

 Score =   160 bits (405),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F +++VAI VSK+RG+K +LPPGP+PVP+FGNWLQVGDDLNHRNL   A+KFG+IF+LRM
Sbjct  14   FASVVVAIAVSKIRGRKLRLPPGPLPVPIFGNWLQVGDDLNHRNLAALARKFGEIFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP LA+EVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPPLAREVLHTQGVEFGSRTRNVV  106



>gb|ACZ73612.1| cinnamate 4-hydroxylase [Bambusa oldhamii]
Length=507

 Score =   160 bits (404),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F +++VAI VSK+RG+K +LPPGP+PVP+FGNWLQVGDDLNHRNL   A+KFG+IF+LRM
Sbjct  14   FASVVVAIAVSKIRGRKLRLPPGPLPVPIFGNWLQVGDDLNHRNLAALARKFGEIFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP LA+EVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPPLAREVLHTQGVEFGSRTRNVV  106



>gb|AFR37522.1| cinnamate 4-hydroxylase, partial [Populus fremontii]
Length=109

 Score =   150 bits (379),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            FVA++VAI+VS+LRGK++KLPPGP+PVPVFGNWLQVGDDLNHRNLTD AKKFGDI +LRM
Sbjct  14   FVAVLVAILVSQLRGKRFKLPPGPLPVPVFGNWLQVGDDLNHRNLTDLAKKFGDILLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP+LAKEVLHTQGVEFGSRT+N V
Sbjct  74   GQRNLVVVSSPDLAKEVLHTQGVEFGSRTKNVV  106



>gb|AFR37528.1| cinnamate 4-hydroxylase, partial [Populus nigra]
Length=153

 Score =   150 bits (380),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 82/93 (88%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            FVAI+VAI+VS+LRGK++KLPPGP+PVPVFGNWLQVGDDLNHRNLTD AKKFGDI +LRM
Sbjct  14   FVAILVAILVSQLRGKRFKLPPGPLPVPVFGNWLQVGDDLNHRNLTDLAKKFGDILLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP+LAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVV  106



>gb|AFR37504.1| cinnamate 4-hydroxylase, partial [Populus trichocarpa]
 gb|AFR37506.1| cinnamate 4-hydroxylase, partial [Populus trichocarpa]
 gb|AFR37508.1| cinnamate 4-hydroxylase, partial [Populus trichocarpa]
 gb|AFR37509.1| cinnamate 4-hydroxylase, partial [Populus trichocarpa]
 gb|AFR37529.1| cinnamate 4-hydroxylase, partial [Populus nigra]
 gb|AFR37530.1| cinnamate 4-hydroxylase, partial [Populus nigra]
 gb|AFR37532.1| cinnamate 4-hydroxylase, partial [Populus nigra]
 gb|AFR37535.1| cinnamate 4-hydroxylase, partial [Populus nigra]
 gb|AFR37536.1| cinnamate 4-hydroxylase, partial [Populus nigra]
 gb|AFR37537.1| cinnamate 4-hydroxylase, partial [Populus nigra]
 gb|AFR37539.1| cinnamate 4-hydroxylase, partial [Populus nigra]
 gb|AFR37540.1| cinnamate 4-hydroxylase, partial [Populus nigra]
Length=152

 Score =   150 bits (380),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 82/93 (88%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            FVAI+VAI+VS+LRGK++KLPPGP+PVPVFGNWLQVGDDLNHRNLTD AKKFGDI +LRM
Sbjct  14   FVAILVAILVSQLRGKRFKLPPGPLPVPVFGNWLQVGDDLNHRNLTDLAKKFGDILLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP+LAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVV  106



>gb|AFR37525.1| cinnamate 4-hydroxylase, partial [Populus fremontii]
 gb|AFR37526.1| cinnamate 4-hydroxylase, partial [Populus fremontii]
 gb|AFR37531.1| cinnamate 4-hydroxylase, partial [Populus nigra]
Length=151

 Score =   150 bits (380),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 82/93 (88%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            FVAI+VAI+VS+LRGK++KLPPGP+PVPVFGNWLQVGDDLNHRNLTD AKKFGDI +LRM
Sbjct  14   FVAILVAILVSQLRGKRFKLPPGPLPVPVFGNWLQVGDDLNHRNLTDLAKKFGDILLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP+LAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVV  106



>gb|AFR37498.1| cinnamate 4-hydroxylase, partial [Populus trichocarpa]
 gb|AFR37499.1| cinnamate 4-hydroxylase, partial [Populus trichocarpa]
 gb|AFR37500.1| cinnamate 4-hydroxylase, partial [Populus trichocarpa]
 gb|AFR37501.1| cinnamate 4-hydroxylase, partial [Populus trichocarpa]
 gb|AFR37502.1| cinnamate 4-hydroxylase, partial [Populus trichocarpa]
 gb|AFR37503.1| cinnamate 4-hydroxylase, partial [Populus trichocarpa]
 gb|AFR37505.1| cinnamate 4-hydroxylase, partial [Populus trichocarpa]
 gb|AFR37507.1| cinnamate 4-hydroxylase, partial [Populus trichocarpa]
 gb|AFR37510.1| cinnamate 4-hydroxylase, partial [Populus trichocarpa]
 gb|AFR37511.1| cinnamate 4-hydroxylase, partial [Populus trichocarpa]
 gb|AFR37512.1| cinnamate 4-hydroxylase, partial [Populus trichocarpa]
 gb|AFR37533.1| cinnamate 4-hydroxylase, partial [Populus nigra]
 gb|AFR37534.1| cinnamate 4-hydroxylase, partial [Populus nigra]
 gb|AFR37541.1| cinnamate 4-hydroxylase, partial [Populus nigra]
Length=153

 Score =   150 bits (380),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 82/93 (88%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            FVAI+VAI+VS+LRGK++KLPPGP+PVPVFGNWLQVGDDLNHRNLTD AKKFGDI +LRM
Sbjct  14   FVAILVAILVSQLRGKRFKLPPGPLPVPVFGNWLQVGDDLNHRNLTDLAKKFGDILLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP+LAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVV  106



>gb|AFR37523.1| cinnamate 4-hydroxylase, partial [Populus fremontii]
Length=141

 Score =   150 bits (379),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            FVA++VAI+VS+LRGK++KLPPGP+PVPVFGNWLQVGDDLNHRNLTD AKKFGDI +LRM
Sbjct  6    FVAVLVAILVSQLRGKRFKLPPGPLPVPVFGNWLQVGDDLNHRNLTDLAKKFGDILLLRM  65

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP+LAKEVLHTQGVEFGSRTRN V
Sbjct  66   GQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVV  98



>dbj|BAB71717.1| cinnamic acid 4-hydroxylase [Lithospermum erythrorhizon]
Length=505

 Score =   159 bits (401),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 74/82 (90%), Positives = 79/82 (96%), Gaps = 0/82 (0%)
 Frame = +2

Query  146  KLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRMGQRNLVVVSSP  325
            KL GKK+KLPPGP PVP+FGNWLQVGDDLNHRNLTDYAKKFG+IF+LRMGQRNLVVVSSP
Sbjct  25   KLGGKKFKLPPGPFPVPIFGNWLQVGDDLNHRNLTDYAKKFGEIFLLRMGQRNLVVVSSP  84

Query  326  ELAKEVLHTQGVEFGSRTRNXV  391
            +LAKEVLHTQGVEFGSRTRN V
Sbjct  85   DLAKEVLHTQGVEFGSRTRNVV  106



>gb|AAV36374.1| cinnamate 4-hydroxylase, partial [Pinus taeda]
 gb|AAV36380.1| cinnamate 4-hydroxylase, partial [Pinus taeda]
 gb|AAV36386.1| cinnamate 4-hydroxylase, partial [Pinus taeda]
 gb|AAV36392.1| cinnamate 4-hydroxylase, partial [Pinus taeda]
 gb|AAV36398.1| cinnamate 4-hydroxylase, partial [Pinus taeda]
 gb|AAV36413.1| cinnamate 4-hydroxylase, partial [Pinus taeda]
 gb|AAV36425.1| cinnamate 4-hydroxylase, partial [Pinus taeda]
 gb|AAV36431.1| cinnamate 4-hydroxylase, partial [Pinus taeda]
 gb|AAV36452.1| cinnamate 4-hydroxylase, partial [Pinus taeda]
 gb|AAV36461.1| cinnamate 4-hydroxylase, partial [Pinus taeda]
Length=144

 Score =   150 bits (378),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 69/83 (83%), Positives = 77/83 (93%), Gaps = 0/83 (0%)
 Frame = +2

Query  143  SKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRMGQRNLVVVSS  322
            +KLRG+K KLPPGP  +P+FGNWLQVGDDLNHRNLTD AKK+G IF+L+MGQRNLVVVSS
Sbjct  31   NKLRGRKLKLPPGPFALPIFGNWLQVGDDLNHRNLTDLAKKYGKIFLLKMGQRNLVVVSS  90

Query  323  PELAKEVLHTQGVEFGSRTRNXV  391
            P+LAKEVLHTQGVEFGSRTRN V
Sbjct  91   PDLAKEVLHTQGVEFGSRTRNVV  113



>gb|ADB65927.1| cinnamate 4-hydroxylase [Ipomoea batatas]
Length=505

 Score =   158 bits (400),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 88/93 (95%), Positives = 91/93 (98%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F AI+VAIVVSKLRGKKYKLPPGP+PVPVFGNWLQVGDDLNHRNLTDYAKKFGDIF+LRM
Sbjct  14   FFAILVAIVVSKLRGKKYKLPPGPLPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSPELAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVV  106



>gb|AFR37519.1| cinnamate 4-hydroxylase, partial [Populus fremontii]
 gb|AFR37520.1| cinnamate 4-hydroxylase, partial [Populus fremontii]
 gb|AFR37524.1| cinnamate 4-hydroxylase, partial [Populus fremontii]
Length=153

 Score =   150 bits (378),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            FVA++VAI+VS+LRGK++KLPPGP+PVPVFGNWLQVGDDLNHRNLTD AKKFGDI +LRM
Sbjct  14   FVAVLVAILVSQLRGKRFKLPPGPLPVPVFGNWLQVGDDLNHRNLTDLAKKFGDILLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP+LAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVV  106



>gb|AHJ61295.1| cinnamate-4-hydroxylase [Hordeum vulgare]
Length=505

 Score =   158 bits (400),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
              A++ AIVVSK+RG+K +LPPGPIPVP+FGNWLQVGDDLNHRNL   A+KFG++F+LRM
Sbjct  14   LAAVVGAIVVSKIRGRKLRLPPGPIPVPIFGNWLQVGDDLNHRNLAAMARKFGEVFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP LA+EVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPPLAREVLHTQGVEFGSRTRNVV  106



>gb|AHY28685.1| cinnamate 4-hydroxylase 1, partial [Pinus echinata]
 gb|AHY28703.1| cinnamate 4-hydroxylase 1, partial [Pinus taeda]
Length=148

 Score =   150 bits (378),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 69/83 (83%), Positives = 77/83 (93%), Gaps = 0/83 (0%)
 Frame = +2

Query  143  SKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRMGQRNLVVVSS  322
            +KLRG+K KLPPGP  +P+FGNWLQVGDDLNHRNLTD AKK+G IF+L+MGQRNLVVVSS
Sbjct  31   NKLRGRKLKLPPGPFALPIFGNWLQVGDDLNHRNLTDLAKKYGKIFLLKMGQRNLVVVSS  90

Query  323  PELAKEVLHTQGVEFGSRTRNXV  391
            P+LAKEVLHTQGVEFGSRTRN V
Sbjct  91   PDLAKEVLHTQGVEFGSRTRNVV  113



>gb|AAV36368.1| cinnamate 4-hydroxylase, partial [Pinus taeda]
 gb|AAV36371.1| cinnamate 4-hydroxylase, partial [Pinus taeda]
 gb|AAV36383.1| cinnamate 4-hydroxylase, partial [Pinus taeda]
 gb|AAV36389.1| cinnamate 4-hydroxylase, partial [Pinus taeda]
 gb|AAV36395.1| cinnamate 4-hydroxylase, partial [Pinus taeda]
 gb|AAV36404.1| cinnamate 4-hydroxylase, partial [Pinus taeda]
 gb|AAV36407.1| cinnamate 4-hydroxylase, partial [Pinus taeda]
 gb|AAV36410.1| cinnamate 4-hydroxylase, partial [Pinus taeda]
 gb|AAV36440.1| cinnamate 4-hydroxylase, partial [Pinus taeda]
 gb|AAV36443.1| cinnamate 4-hydroxylase, partial [Pinus taeda]
 gb|AAV36446.1| cinnamate 4-hydroxylase, partial [Pinus taeda]
 gb|AAV36449.1| cinnamate 4-hydroxylase, partial [Pinus taeda]
 gb|AAV36455.1| cinnamate 4-hydroxylase, partial [Pinus taeda]
 gb|AAV36458.1| cinnamate 4-hydroxylase, partial [Pinus taeda]
Length=144

 Score =   149 bits (377),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 69/83 (83%), Positives = 77/83 (93%), Gaps = 0/83 (0%)
 Frame = +2

Query  143  SKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRMGQRNLVVVSS  322
            +KLRG+K KLPPGP  +P+FGNWLQVGDDLNHRNLTD AKK+G IF+L+MGQRNLVVVSS
Sbjct  31   NKLRGRKLKLPPGPFALPIFGNWLQVGDDLNHRNLTDLAKKYGKIFLLKMGQRNLVVVSS  90

Query  323  PELAKEVLHTQGVEFGSRTRNXV  391
            P+LAKEVLHTQGVEFGSRTRN V
Sbjct  91   PDLAKEVLHTQGVEFGSRTRNVV  113



>dbj|BAJ95120.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=505

 Score =   158 bits (400),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
              A++ AIVVSK+RG+K +LPPGPIPVP+FGNWLQVGDDLNHRNL   A+KFG++F+LRM
Sbjct  14   LAAVVGAIVVSKIRGRKLRLPPGPIPVPIFGNWLQVGDDLNHRNLAAMARKFGEVFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP LA+EVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPPLAREVLHTQGVEFGSRTRNVV  106



>gb|AHY28700.1| cinnamate 4-hydroxylase 1, partial [Pinus taeda]
Length=148

 Score =   149 bits (377),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 69/83 (83%), Positives = 77/83 (93%), Gaps = 0/83 (0%)
 Frame = +2

Query  143  SKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRMGQRNLVVVSS  322
            +KLRG+K KLPPGP  +P+FGNWLQVGDDLNHRNLTD AKK+G IF+L+MGQRNLVVVSS
Sbjct  31   NKLRGRKLKLPPGPFALPIFGNWLQVGDDLNHRNLTDLAKKYGKIFLLKMGQRNLVVVSS  90

Query  323  PELAKEVLHTQGVEFGSRTRNXV  391
            P+LAKEVLHTQGVEFGSRTRN V
Sbjct  91   PDLAKEVLHTQGVEFGSRTRNVV  113



>ref|XP_003564495.1| PREDICTED: trans-cinnamate 4-monooxygenase [Brachypodium distachyon]
Length=505

 Score =   157 bits (398),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
              + +VAI VSK+RG+K KLPPGP+PVP+FGNWLQVGDDLNHRNL   A+KFG+IF+LRM
Sbjct  14   LASALVAIAVSKIRGRKLKLPPGPLPVPIFGNWLQVGDDLNHRNLAAMARKFGEIFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP LA+EVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPPLAREVLHTQGVEFGSRTRNVV  106



>dbj|BAJ22964.1| cinnamate 4-hydroxylase [Agastache foeniculum]
Length=194

 Score =   150 bits (379),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 69/75 (92%), Positives = 73/75 (97%), Gaps = 0/75 (0%)
 Frame = +2

Query  167  KLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRMGQRNLVVVSSPELAKEVL  346
            KLPPGPIPVP+FGNWLQVGDDLNHRNLTDYAK+FGDIF+LRMGQRNLVVVSSP+ AKEVL
Sbjct  2    KLPPGPIPVPIFGNWLQVGDDLNHRNLTDYAKRFGDIFLLRMGQRNLVVVSSPDSAKEVL  61

Query  347  HTQGVEFGSRTRNXV  391
            HTQGVEFGSRTRN V
Sbjct  62   HTQGVEFGSRTRNVV  76



>ref|XP_010032943.1| PREDICTED: trans-cinnamate 4-monooxygenase [Eucalyptus grandis]
 gb|KCW52446.1| hypothetical protein EUGRSUZ_J01844 [Eucalyptus grandis]
Length=505

 Score =   157 bits (397),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 71/83 (86%), Positives = 80/83 (96%), Gaps = 0/83 (0%)
 Frame = +2

Query  143  SKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRMGQRNLVVVSS  322
            SKLRGK+++LPPGP+PVP+FGNWLQVGDDLNHRNLTD AK+FGDI +LRMGQRNLVVVSS
Sbjct  24   SKLRGKRFRLPPGPLPVPIFGNWLQVGDDLNHRNLTDLAKRFGDILLLRMGQRNLVVVSS  83

Query  323  PELAKEVLHTQGVEFGSRTRNXV  391
            P+L+KEVLHTQGVEFGSRTRN V
Sbjct  84   PDLSKEVLHTQGVEFGSRTRNVV  106



>gb|AGJ71350.1| cinnamate 4-hydroxylase 1 [Eucalyptus urophylla]
Length=505

 Score =   157 bits (397),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 71/83 (86%), Positives = 80/83 (96%), Gaps = 0/83 (0%)
 Frame = +2

Query  143  SKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRMGQRNLVVVSS  322
            SKLRGK+++LPPGP+PVP+FGNWLQVGDDLNHRNLTD AK+FGDI +LRMGQRNLVVVSS
Sbjct  24   SKLRGKRFRLPPGPLPVPIFGNWLQVGDDLNHRNLTDLAKRFGDILLLRMGQRNLVVVSS  83

Query  323  PELAKEVLHTQGVEFGSRTRNXV  391
            P+L+KEVLHTQGVEFGSRTRN V
Sbjct  84   PDLSKEVLHTQGVEFGSRTRNVV  106



>gb|AAV36401.1| cinnamate 4-hydroxylase, partial [Pinus taeda]
 gb|AAV36416.1| cinnamate 4-hydroxylase, partial [Pinus taeda]
 gb|AAV36419.1| cinnamate 4-hydroxylase, partial [Pinus taeda]
 gb|AAV36422.1| cinnamate 4-hydroxylase, partial [Pinus taeda]
 gb|AAV36428.1| cinnamate 4-hydroxylase, partial [Pinus taeda]
 gb|AAV36434.1| cinnamate 4-hydroxylase, partial [Pinus taeda]
 gb|AAV36437.1| cinnamate 4-hydroxylase, partial [Pinus taeda]
Length=144

 Score =   149 bits (375),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 68/83 (82%), Positives = 77/83 (93%), Gaps = 0/83 (0%)
 Frame = +2

Query  143  SKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRMGQRNLVVVSS  322
            +KLRG+K KLPPGP  +P+FGNWLQVGDDLNHRNL+D AKK+G IF+L+MGQRNLVVVSS
Sbjct  31   NKLRGRKLKLPPGPFALPIFGNWLQVGDDLNHRNLSDLAKKYGKIFLLKMGQRNLVVVSS  90

Query  323  PELAKEVLHTQGVEFGSRTRNXV  391
            P+LAKEVLHTQGVEFGSRTRN V
Sbjct  91   PDLAKEVLHTQGVEFGSRTRNVV  113



>gb|AHY28687.1| cinnamate 4-hydroxylase 1, partial [Pinus echinata]
 gb|AHY28690.1| cinnamate 4-hydroxylase 1, partial [Pinus elliottii]
 gb|AHY28692.1| cinnamate 4-hydroxylase 1, partial [Pinus elliottii]
 gb|AHY28695.1| cinnamate 4-hydroxylase 1, partial [Pinus palustris]
 gb|AHY28698.1| cinnamate 4-hydroxylase 1, partial [Pinus palustris]
Length=148

 Score =   149 bits (375),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 68/83 (82%), Positives = 77/83 (93%), Gaps = 0/83 (0%)
 Frame = +2

Query  143  SKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRMGQRNLVVVSS  322
            +KLRG+K KLPPGP  +P+FGNWLQVGDDLNHRNL+D AKK+G IF+L+MGQRNLVVVSS
Sbjct  31   NKLRGRKLKLPPGPFALPIFGNWLQVGDDLNHRNLSDLAKKYGKIFLLKMGQRNLVVVSS  90

Query  323  PELAKEVLHTQGVEFGSRTRNXV  391
            P+LAKEVLHTQGVEFGSRTRN V
Sbjct  91   PDLAKEVLHTQGVEFGSRTRNVV  113



>gb|AFR37521.1| cinnamate 4-hydroxylase, partial [Populus fremontii]
Length=153

 Score =   149 bits (375),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            FVA +VAI+VS+LRGK++KLPPGP+PVPVFGNWLQVGDDLNHRNLTD AKKFGDI +LRM
Sbjct  14   FVAXLVAILVSQLRGKRFKLPPGPLPVPVFGNWLQVGDDLNHRNLTDLAKKFGDILLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP+LAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVV  106



>gb|AAV36377.1| cinnamate 4-hydroxylase, partial [Pinus taeda]
Length=144

 Score =   148 bits (374),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 68/83 (82%), Positives = 77/83 (93%), Gaps = 0/83 (0%)
 Frame = +2

Query  143  SKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRMGQRNLVVVSS  322
            +KLRG+K KLPPGP  +P+FGNWLQVGDDLNHRNL+D AKK+G IF+L+MGQRNLVVVSS
Sbjct  31   NKLRGRKLKLPPGPFALPIFGNWLQVGDDLNHRNLSDLAKKYGKIFLLKMGQRNLVVVSS  90

Query  323  PELAKEVLHTQGVEFGSRTRNXV  391
            P+LAKEVLHTQGVEFGSRTRN V
Sbjct  91   PDLAKEVLHTQGVEFGSRTRNVV  113



>gb|ACE88962.1| cinnamic acid 4-hydroxylase [Phyllostachys edulis]
Length=472

 Score =   156 bits (395),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F + +VAI VSK+RG+K +LPPGP+ VP+FGNWLQVGDDLNHR+LT  A+KFG+IF+LRM
Sbjct  14   FASAVVAIAVSKIRGRKLRLPPGPLAVPIFGNWLQVGDDLNHRSLTALARKFGEIFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP LA+EVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPPLAREVLHTQGVEFGSRTRNVV  106



>ref|XP_007146898.1| hypothetical protein PHAVU_006G079700g [Phaseolus vulgaris]
 gb|ESW18892.1| hypothetical protein PHAVU_006G079700g [Phaseolus vulgaris]
Length=505

 Score =   156 bits (395),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F A ++A+  +KLRGK+++LPPGP+ VP+FGNWLQVGDDLNH NL   A++FGDIF+LRM
Sbjct  14   FFAAVIAVTAAKLRGKRFRLPPGPLSVPIFGNWLQVGDDLNHLNLAGIARRFGDIFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSPELAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVV  106



>pir||PC4236 trans-cinnamate 4-monooxygenase (EC 1.14.13.11) B - Japanese 
aspen x large-toothed aspen (fragment)
 dbj|BAA11577.1| cinnamic acid 4-hydroxylase [Populus kitakamiensis]
Length=396

 Score =   153 bits (386),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 83/93 (89%), Positives = 91/93 (98%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            FVAI+VAI+VSKLRGK++KLPPGP+PVPVFGNWLQVGDDLNHRNLTD AKKFGDIF+LRM
Sbjct  14   FVAILVAILVSKLRGKRFKLPPGPLPVPVFGNWLQVGDDLNHRNLTDLAKKFGDIFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP+L+KEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPDLSKEVLHTQGVEFGSRTRNVV  106



>ref|XP_006410151.1| hypothetical protein EUTSA_v10016544mg [Eutrema salsugineum]
 gb|ESQ51604.1| hypothetical protein EUTSA_v10016544mg [Eutrema salsugineum]
Length=505

 Score =   154 bits (389),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 71/84 (85%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = +2

Query  140  VSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRMGQRNLVVVS  319
            +SKLRGKK KLPPGPIP+PVFGNWLQVGDDLNHRNL DYAK+FGD+F LRMGQRNLVVVS
Sbjct  23   ISKLRGKKLKLPPGPIPIPVFGNWLQVGDDLNHRNLVDYAKRFGDLFHLRMGQRNLVVVS  82

Query  320  SPELAKEVLHTQGVEFGSRTRNXV  391
            SP+L KEVL TQG+EFGSR RN V
Sbjct  83   SPDLTKEVLQTQGIEFGSRYRNIV  106



>ref|XP_009132738.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Brassica rapa]
Length=503

 Score =   153 bits (387),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 70/93 (75%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F+A+++A ++SKL  KK KLPPGPIP+PVFGNWL+VG+DLNHRNL DYAKKFGD+F LRM
Sbjct  14   FLAVVLAKMISKLCSKKLKLPPGPIPIPVFGNWLEVGNDLNHRNLVDYAKKFGDLFHLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQR++VV+SSP+LAKEVL TQGVEFGSR RN V
Sbjct  74   GQRDIVVISSPDLAKEVLQTQGVEFGSRYRNIV  106



>emb|CDX84830.1| BnaA03g14000D [Brassica napus]
Length=503

 Score =   153 bits (386),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F+A+++A ++SKL  KK KLPPGPIP+PVFGNWL+VG+DLNHRNL DYAKKFGD+F LRM
Sbjct  14   FLAVVLAKMISKLCSKKLKLPPGPIPIPVFGNWLEVGNDLNHRNLVDYAKKFGDLFHLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQR++V++SSP+LAKEVL TQGVEFGSR RN V
Sbjct  74   GQRDIVIISSPDLAKEVLQTQGVEFGSRYRNIV  106



>gb|ABF69101.1| trans-cinnamate 4-hydroxylase [Populus tremuloides]
Length=505

 Score =   152 bits (385),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 91/93 (98%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            FVAI+VAI+VSKLRGK++KLPPGP+PVPVFGNWLQVGDDLNHRNLTD AKKFGDIF+LRM
Sbjct  14   FVAILVAILVSKLRGKRFKLPPGPLPVPVFGNWLQVGDDLNHRNLTDLAKKFGDIFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSPEL+KEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPELSKEVLHTQGVEFGSRTRNVV  106



>gb|AAG10196.1|AF286647_1 cinnamate-4-hydroxylase [Gossypium arboreum]
 gb|KHG13044.1| Cytochrome P450 protein [Gossypium arboreum]
Length=505

 Score =   152 bits (383),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 82/93 (88%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            FVA+++AI +SKLRGK++KLPPGP+PVPVFGNWLQVGDDLNHRNLTD AKKFGDIF+LRM
Sbjct  14   FVAVVLAITISKLRGKRFKLPPGPLPVPVFGNWLQVGDDLNHRNLTDLAKKFGDIFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSPELAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVV  106



>gb|ACZ06240.1| cinnamate 4-hydroxylase 2 [Gossypium hirsutum]
Length=505

 Score =   152 bits (383),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 82/93 (88%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            FVA+++AI +SKLRGK++KLPPGP+PVPVFGNWLQVGDDLNHRNLTD AKKFGDIF+LRM
Sbjct  14   FVAVVLAITISKLRGKRFKLPPGPLPVPVFGNWLQVGDDLNHRNLTDLAKKFGDIFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSPELAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVV  106



>gb|ACE95171.1| cinnamate-4-hydroxylase [Populus tomentosa]
 gb|AFZ78541.1| cinnamate 4-hydroxylase [Populus tomentosa]
Length=505

 Score =   151 bits (382),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 83/93 (89%), Positives = 91/93 (98%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            FVAI+VAI+VSKLRGK++KLPPGP+PVPVFGNWLQVGDDLNHRNLTD AKKFGDIF+LRM
Sbjct  14   FVAILVAILVSKLRGKRFKLPPGPLPVPVFGNWLQVGDDLNHRNLTDLAKKFGDIFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP+L+KEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPDLSKEVLHTQGVEFGSRTRNVV  106



>ref|XP_011021057.1| PREDICTED: trans-cinnamate 4-monooxygenase [Populus euphratica]
Length=505

 Score =   151 bits (382),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 83/93 (89%), Positives = 91/93 (98%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            FVAI+VAI+VSKLRGK++KLPPGP+PVPVFGNWLQVGDDLNHRNLTD AKKFGDIF+LRM
Sbjct  14   FVAILVAILVSKLRGKRFKLPPGPLPVPVFGNWLQVGDDLNHRNLTDLAKKFGDIFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP+L+KEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPDLSKEVLHTQGVEFGSRTRNVV  106



>gb|ABF69102.1| trans-cinnamate 4-hydroxylase [Populus tremuloides]
Length=505

 Score =   151 bits (382),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 83/93 (89%), Positives = 91/93 (98%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            FVAI+VAI+VSKLRGK++KLPPGP+PVPVFGNWLQVGDDLNHRNLTD AKKFGDIF+LRM
Sbjct  14   FVAILVAILVSKLRGKRFKLPPGPLPVPVFGNWLQVGDDLNHRNLTDLAKKFGDIFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP+L+KEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPDLSKEVLHTQGVEFGSRTRNVV  106



>ref|XP_004500376.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Cicer arietinum]
Length=505

 Score =   151 bits (382),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            FVA ++AI+ +KLRGK++KLPPGP PVP+FGNWLQVGDDLNHRNLT+ +KK+G+IF+LRM
Sbjct  14   FVAALLAILAAKLRGKRFKLPPGPFPVPIFGNWLQVGDDLNHRNLTELSKKYGEIFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP+LAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPKLAKEVLHTQGVEFGSRTRNAV  106



>ref|XP_009416323.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Musa acuminata 
subsp. malaccensis]
Length=503

 Score =   151 bits (381),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F A+ +AIVVSKL GK++KLPPGP PVP+FGNWLQVGDDLNHR LTD A++FG+IF L M
Sbjct  14   FAAVTLAIVVSKLCGKRFKLPPGPTPVPIFGNWLQVGDDLNHRLLTDMARRFGEIFHLLM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            G R+LVVVSSP+LA+EVLH QGVEFGSRTRN V
Sbjct  74   GVRDLVVVSSPDLAREVLHAQGVEFGSRTRNVV  106



>gb|AAC99993.1| cinnamate 4-hydroxylase [Arabidopsis thaliana]
Length=505

 Score =   151 bits (381),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            FVA+I+A V+SKLRGKK KLPPGPIP+P+FGNWLQVGDDLNHRNL DYAKKFGD+F+LRM
Sbjct  14   FVAVILATVISKLRGKKLKLPPGPIPIPIFGNWLQVGDDLNHRNLVDYAKKFGDLFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP+L KEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPDLTKEVLHTQGVEFGSRTRNVV  106



>emb|CAK95273.1| cinnamate-4-hydroxylase [Cucumis sativus]
Length=505

 Score =   151 bits (381),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 78/93 (84%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F+++++AI +SKLRGK++K PPGP+PVP+FGNWLQVGDDLNHRNLTD AKKFGDIF+LRM
Sbjct  14   FLSVVLAIAISKLRGKRFKPPPGPLPVPIFGNWLQVGDDLNHRNLTDLAKKFGDIFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSPELAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVV  106



>gb|AAB58355.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
 emb|CAP08830.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
 emb|CAP08831.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
 emb|CAP08832.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
 emb|CAP08833.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
 emb|CAP08838.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
 emb|CAP08839.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
 emb|CAP08842.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
 emb|CAP08843.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
 emb|CAP08844.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
 emb|CAP08845.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
Length=505

 Score =   150 bits (380),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            FVA+I+A V+SKLRGKK KLPPGPIP+P+FGNWLQVGDDLNHRNL DYAKKFGD+F+LRM
Sbjct  14   FVAVILATVISKLRGKKLKLPPGPIPIPIFGNWLQVGDDLNHRNLVDYAKKFGDLFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP+L KEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPDLTKEVLHTQGVEFGSRTRNVV  106



>emb|CAP08828.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
Length=505

 Score =   150 bits (380),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            FVA+I+A V+SKLRGKK KLPPGPIP+P+FGNWLQVGDDLNHRNL DYAKKFGD+F+LRM
Sbjct  14   FVAVILATVISKLRGKKLKLPPGPIPIPIFGNWLQVGDDLNHRNLVDYAKKFGDLFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP+L KEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPDLTKEVLHTQGVEFGSRTRNVV  106



>emb|CAP08827.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
 emb|CAP08834.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
 emb|CAP08835.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
 emb|CAP08836.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
 emb|CAP08837.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
Length=505

 Score =   150 bits (380),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            FVA+I+A V+SKLRGKK KLPPGPIP+P+FGNWLQVGDDLNHRNL DYAKKFGD+F+LRM
Sbjct  14   FVAVILATVISKLRGKKLKLPPGPIPIPIFGNWLQVGDDLNHRNLVDYAKKFGDLFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP+L KEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPDLTKEVLHTQGVEFGSRTRNVV  106



>sp|O24312.1|TCMO_POPTM RecName: Full=Trans-cinnamate 4-monooxygenase; AltName: Full=Cinnamic 
acid 4-hydroxylase; Short=C4H; Short=CA4H; AltName: 
Full=Cytochrome P450 73; AltName: Full=Cytochrome P450C4H [Populus 
tremuloides]
 gb|AAB67874.1| trans-cinnamate 4-hydroxylase [Populus tremuloides]
Length=505

 Score =   150 bits (380),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 83/93 (89%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            FVAI+VAI+VSKLRGK++KLPPGP+PVPVFGNWLQVGDDLNHRNLTD AKKFGDI +LRM
Sbjct  14   FVAILVAILVSKLRGKRFKLPPGPLPVPVFGNWLQVGDDLNHRNLTDLAKKFGDILLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSPEL+KEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPELSKEVLHTQGVEFGSRTRNVV  106



>sp|Q43054.1|TCMO_POPKI RecName: Full=Trans-cinnamate 4-monooxygenase; AltName: Full=Cinnamic 
acid 4-hydroxylase; Short=C4H; Short=CA4H; AltName: 
Full=Cytochrome P450 73; AltName: Full=Cytochrome P450C4H [Populus 
sieboldii x Populus grandidentata]
 pir||JC5129 trans-cinnamate 4-monooxygenase (EC 1.14.13.11) A - Japanese 
aspen x large-toothed aspen
 dbj|BAA11579.1| cinnamic acid 4-hydroxylase [Populus kitakamiensis]
 dbj|BAA11576.1| cinnamic acid 4-hydroxylase [Populus kitakamiensis]
Length=505

 Score =   150 bits (380),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 82/93 (88%), Positives = 91/93 (98%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            FVA++VAI+VSKLRGK++KLPPGP+PVPVFGNWLQVGDDLNHRNLTD AKKFGDIF+LRM
Sbjct  14   FVAVLVAILVSKLRGKRFKLPPGPLPVPVFGNWLQVGDDLNHRNLTDLAKKFGDIFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP+L+KEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPDLSKEVLHTQGVEFGSRTRNVV  106



>gb|EAY76296.1| hypothetical protein OsI_04230 [Oryza sativa Indica Group]
Length=481

 Score =   150 bits (379),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 70/83 (84%), Positives = 76/83 (92%), Gaps = 0/83 (0%)
 Frame = +2

Query  143  SKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRMGQRNLVVVSS  322
            SKLRG+K +LPPGP PVPVFGNWLQVGDDLNHRNL   A++FGDIF+LRMGQRNLVVVSS
Sbjct  24   SKLRGRKLRLPPGPTPVPVFGNWLQVGDDLNHRNLAALARRFGDIFLLRMGQRNLVVVSS  83

Query  323  PELAKEVLHTQGVEFGSRTRNXV  391
            P LA+EVLHTQGVEFGSRTRN V
Sbjct  84   PPLAREVLHTQGVEFGSRTRNVV  106



>gb|EAZ35606.1| hypothetical protein OsJ_19896 [Oryza sativa Japonica Group]
Length=481

 Score =   150 bits (379),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 70/83 (84%), Positives = 76/83 (92%), Gaps = 0/83 (0%)
 Frame = +2

Query  143  SKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRMGQRNLVVVSS  322
            SKLRG+K +LPPGP PVPVFGNWLQVGDDLNHRNL   A++FGDIF+LRMGQRNLVVVSS
Sbjct  24   SKLRGRKLRLPPGPTPVPVFGNWLQVGDDLNHRNLAALARRFGDIFLLRMGQRNLVVVSS  83

Query  323  PELAKEVLHTQGVEFGSRTRNXV  391
            P LA+EVLHTQGVEFGSRTRN V
Sbjct  84   PPLAREVLHTQGVEFGSRTRNVV  106



>gb|ABF69099.1| trans-cinnamate 4-hydroxylase [Populus tremuloides]
Length=505

 Score =   150 bits (379),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 83/93 (89%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            FVAI+VAI+VSKLRGK++KLPPGP+PVPVFGNWLQVGDDLNHRNLTD AKKFGDI +LRM
Sbjct  14   FVAILVAILVSKLRGKRFKLPPGPLPVPVFGNWLQVGDDLNHRNLTDLAKKFGDILLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP+LAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVV  106



>gb|AFZ78542.1| cinnamate 4-hydroxylase [Populus tomentosa]
Length=505

 Score =   150 bits (378),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 82/93 (88%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            FVA++VAI+VSKLRGK++KLPPGP+PVPVFGNWLQVGDDLNHRNLTD AKKFGDI +LRM
Sbjct  14   FVAVLVAILVSKLRGKRFKLPPGPLPVPVFGNWLQVGDDLNHRNLTDLAKKFGDILLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP+LAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVV  106



>gb|ABA59555.1| cinnamate-4-hydroxylase [Parthenocissus henryana]
 gb|ACA25599.1| cinnamate-4-hydroxylase [Parthenocissus henryana]
Length=505

 Score =   150 bits (378),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 83/93 (89%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F AII+AI +SKL GKK+KLPPGP+PVPVFGNWLQVGDDLNHRNLTD AKKFGDIFMLRM
Sbjct  14   FCAIILAITISKLLGKKFKLPPGPLPVPVFGNWLQVGDDLNHRNLTDLAKKFGDIFMLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP+LAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVV  106



>gb|ABF69100.1| trans-cinnamate 4-hydroxylase [Populus tremuloides]
Length=505

 Score =   150 bits (378),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 82/93 (88%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            FVA++VAI+VSKLRGK++KLPPGP+PVPVFGNWLQVGDDLNHRNLTD AKKFGDI +LRM
Sbjct  14   FVAVLVAILVSKLRGKRFKLPPGPLPVPVFGNWLQVGDDLNHRNLTDLAKKFGDILLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP+LAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVV  106



>gb|KFK22945.1| hypothetical protein AALP_AAs47561U000100 [Arabis alpina]
Length=505

 Score =   150 bits (378),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F A+I+A VVSKLRGKK KLPPGPIP+P+FGNWLQVGDDLNHRNL DYAKKFGD+F+LRM
Sbjct  14   FAAVILATVVSKLRGKKLKLPPGPIPIPIFGNWLQVGDDLNHRNLVDYAKKFGDLFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP+L KEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPDLTKEVLHTQGVEFGSRTRNVV  106



>ref|XP_011041784.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Populus euphratica]
Length=505

 Score =   149 bits (377),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 83/93 (89%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            FVAI+VAIVVSKLRGK++KLPPGP+PVPVFGNWLQVGDDLNHRNL D AKKFGDI +LRM
Sbjct  14   FVAILVAIVVSKLRGKRFKLPPGPLPVPVFGNWLQVGDDLNHRNLADLAKKFGDILLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP+LAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVV  106



>ref|XP_011015228.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Populus euphratica]
Length=505

 Score =   149 bits (377),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 83/93 (89%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            FVAI+VAIVVSKLRGK++KLPPGP+PVPVFGNWLQVGDDLNHRNL D AKKFGDI +LRM
Sbjct  14   FVAILVAIVVSKLRGKRFKLPPGPLPVPVFGNWLQVGDDLNHRNLADLAKKFGDILLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP+LAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVV  106



>emb|CAE54486.1| unnamed protein product [Pinus pinaster]
Length=174

 Score =   142 bits (358),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F  I+ AI +SKL+ KK KLPPGP+ VPVFGNWLQVGDDLNHRNL D AKK+G+IF+L+M
Sbjct  17   FAVIVGAIFISKLKSKKLKLPPGPLAVPVFGNWLQVGDDLNHRNLGDLAKKYGEIFLLKM  76

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSPELAKEVLHTQGVEFGSRTRN V
Sbjct  77   GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVV  109



>ref|XP_002325638.1| trans-cinnamate 4-monooxygenase family protein [Populus trichocarpa]
 gb|ACC63871.1| trans-cinnamate 4-hydroxylase [Populus trichocarpa]
 gb|EEF00020.1| trans-cinnamate 4-monooxygenase family protein [Populus trichocarpa]
Length=505

 Score =   149 bits (376),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 82/93 (88%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            FVAI+VAI+VS+LRGK++KLPPGP+PVPVFGNWLQVGDDLNHRNLTD AKKFGDI +LRM
Sbjct  14   FVAILVAILVSQLRGKRFKLPPGPLPVPVFGNWLQVGDDLNHRNLTDLAKKFGDILLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP+LAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVV  106



>gb|AAT39513.1| cinnamate-4-hydroxylase [Camptotheca acuminata]
Length=505

 Score =   149 bits (375),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F AI++AI +SKLRGK++KLPPGP+PVPVFGNWLQVGDDLNHRNLTD AKKFGD+F+LRM
Sbjct  14   FAAIVLAITISKLRGKRFKLPPGPLPVPVFGNWLQVGDDLNHRNLTDLAKKFGDMFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP+LAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVV  106



>gb|EMS49797.1| Trans-cinnamate 4-monooxygenase [Triticum urartu]
Length=536

 Score =   149 bits (376),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 70/93 (75%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            FVA ++AI V+KL GK+++LPPGP   P+ GNWLQVGDDLNHRNL   AK+FG++F+LRM
Sbjct  15   FVAAMLAIAVAKLPGKRFRLPPGPSGAPIVGNWLQVGDDLNHRNLMGMAKRFGEVFLLRM  74

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            G RNLVVVSSPELAKEVLHTQGVEFGSRTRN V
Sbjct  75   GVRNLVVVSSPELAKEVLHTQGVEFGSRTRNVV  107



>gb|KDO45077.1| hypothetical protein CISIN_1g021610mg [Citrus sinensis]
Length=310

 Score =   145 bits (366),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 77/93 (83%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F A++VAI VSKLRGK++KLPPGP+PVPVFGNWLQVGDDLNHRNL+D AKK+GD+ +LRM
Sbjct  14   FAAVVVAITVSKLRGKRFKLPPGPLPVPVFGNWLQVGDDLNHRNLSDLAKKYGDVLLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP+ AKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPDHAKEVLHTQGVEFGSRTRNVV  106



>emb|CAP08829.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
Length=505

 Score =   149 bits (375),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 79/92 (86%), Positives = 87/92 (95%), Gaps = 0/92 (0%)
 Frame = +2

Query  116  VAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRMG  295
            VA+I+A V+SKLRGKK KLPPGPIP+P+FGNWLQVGDDLNHRNL DYAKKFGD+F+LRMG
Sbjct  15   VAVILATVISKLRGKKLKLPPGPIPIPIFGNWLQVGDDLNHRNLVDYAKKFGDLFLLRMG  74

Query  296  QRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            QRNLVVVSSP+L KEVLHTQGVEFGSRTRN V
Sbjct  75   QRNLVVVSSPDLTKEVLHTQGVEFGSRTRNVV  106



>gb|KDO45078.1| hypothetical protein CISIN_1g021610mg [Citrus sinensis]
Length=298

 Score =   144 bits (364),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 77/93 (83%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F A++VAI VSKLRGK++KLPPGP+PVPVFGNWLQVGDDLNHRNL+D AKK+GD+ +LRM
Sbjct  14   FAAVVVAITVSKLRGKRFKLPPGPLPVPVFGNWLQVGDDLNHRNLSDLAKKYGDVLLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP+ AKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPDHAKEVLHTQGVEFGSRTRNVV  106



>emb|CDX84829.1| BnaA03g14010D [Brassica napus]
Length=505

 Score =   148 bits (373),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 78/93 (84%), Positives = 86/93 (92%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F A+++A V+SKLRGKK KLPPGPIP+P+FGNWLQVGDDLNHRNL DYAKKFGD+F+LRM
Sbjct  14   FAAVVLATVISKLRGKKLKLPPGPIPIPIFGNWLQVGDDLNHRNLVDYAKKFGDLFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP L KEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPNLTKEVLHTQGVEFGSRTRNVV  106



>gb|AIT52343.1| cinammate 4-hydroxylase 2 [Daucus carota]
Length=312

 Score =   144 bits (364),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F+ I++AI +SKLR K++KLPPGP PVP+FGNWLQVG+DLNH NL D AK+FG +F+LRM
Sbjct  16   FLGIMIAIFISKLRHKQFKLPPGPTPVPIFGNWLQVGNDLNHGNLVDLAKRFGHLFLLRM  75

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            G RNLVVVSSP+LAK+VLHTQGV FGSR  N V
Sbjct  76   GVRNLVVVSSPQLAKQVLHTQGVVFGSRCSNMV  108



>emb|CDY23995.1| BnaC03g16960D [Brassica napus]
Length=505

 Score =   148 bits (373),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 78/93 (84%), Positives = 86/93 (92%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F A+++A V+SKLRGKK KLPPGPIP+P+FGNWLQVGDDLNHRNL DYAKKFGD+F+LRM
Sbjct  14   FAAVVLATVISKLRGKKLKLPPGPIPIPIFGNWLQVGDDLNHRNLVDYAKKFGDLFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP L KEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPNLTKEVLHTQGVEFGSRTRNVV  106



>ref|XP_010252045.1| PREDICTED: trans-cinnamate 4-monooxygenase [Nelumbo nucifera]
Length=505

 Score =   147 bits (371),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F AI++AI +SKLRGK++KLPPGP+PVPVFGNWLQVGDDLNHRNLTD AKKFGDI +LRM
Sbjct  14   FFAIVLAITISKLRGKRFKLPPGPLPVPVFGNWLQVGDDLNHRNLTDLAKKFGDILLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP+LAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVV  106



>gb|KJB83924.1| hypothetical protein B456_013G271700 [Gossypium raimondii]
Length=505

 Score =   147 bits (370),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 78/93 (84%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F A+++AI +SKLRGK++KLPPGP+PVPVFGNWLQVGDDLNHRNLTD AKK+GDIF+LRM
Sbjct  14   FAAVVLAITISKLRGKRFKLPPGPLPVPVFGNWLQVGDDLNHRNLTDLAKKYGDIFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSPE+AKEVLH+QGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPEIAKEVLHSQGVEFGSRTRNVV  106



>ref|NP_180607.1| trans-cinnamate 4-monooxygenase [Arabidopsis thaliana]
 sp|P92994.1|TCMO_ARATH RecName: Full=Trans-cinnamate 4-monooxygenase; AltName: Full=Cinnamic 
acid 4-hydroxylase; Short=C4H; Short=CA4H; AltName: 
Full=Cytochrome P450 73; AltName: Full=Cytochrome P450C4H [Arabidopsis 
thaliana]
 gb|AAB58356.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
 gb|AAB63088.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
 gb|AAL38321.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
 gb|AAP68314.1| At2g30490 [Arabidopsis thaliana]
 emb|CAP08840.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
 emb|CAP08841.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
 gb|AEC08397.1| trans-cinnamate 4-monooxygenase [Arabidopsis thaliana]
 gb|AGA15806.1| C4H [Expression vector pUDE172]
Length=505

 Score =   147 bits (370),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            FVA+I+A V+SKLRGKK KLPPGPIP+P+FGNWLQVGDDLNHRNL DYAKKFGD+F+LRM
Sbjct  14   FVAVILATVISKLRGKKLKLPPGPIPIPIFGNWLQVGDDLNHRNLVDYAKKFGDLFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP+L KEVL TQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPDLTKEVLLTQGVEFGSRTRNVV  106



>sp|Q9AR74.1|TCMO_RUTGR RecName: Full=Trans-cinnamate 4-monooxygenase; AltName: Full=Cinnamic 
acid 4-hydroxylase; Short=C4H; Short=CA4H; AltName: 
Full=Cytochrome P450 73; AltName: Full=Cytochrome P450C4H [Ruta 
graveolens]
 emb|CAC35977.1| putative cinnamate 4-hydroxylase [Ruta graveolens]
Length=506

 Score =   146 bits (369),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 67/83 (81%), Positives = 76/83 (92%), Gaps = 0/83 (0%)
 Frame = +2

Query  143  SKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRMGQRNLVVVSS  322
            SKLRGK++KLPPGP+  PVFGNWLQVGDDLN R L + +KKFGD+++LRMGQRNLVVVSS
Sbjct  24   SKLRGKRFKLPPGPLGFPVFGNWLQVGDDLNQRKLANLSKKFGDVYLLRMGQRNLVVVSS  83

Query  323  PELAKEVLHTQGVEFGSRTRNXV  391
            PE+AKEVLHTQGVEFGSRTRN V
Sbjct  84   PEMAKEVLHTQGVEFGSRTRNVV  106



>dbj|BAA24355.1| trans-cinnamate 4-hydroxylase [Arabidopsis thaliana]
Length=505

 Score =   146 bits (369),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            FVA+I+A V+SKLRGKK KLPPGPIP+P+FGNWLQVGDDLNHRNL DYAKKFGD+F+LRM
Sbjct  14   FVAVILATVISKLRGKKLKLPPGPIPIPIFGNWLQVGDDLNHRNLVDYAKKFGDLFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP+L KEVL TQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPDLTKEVLLTQGVEFGSRTRNVV  106



>emb|CDX97826.1| BnaC04g41130D [Brassica napus]
Length=505

 Score =   146 bits (369),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 77/93 (83%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F A+++A V+SKLRGKK  LPPGPIP+P+FGNWLQVGDDLNHRNL DYAKKFGD+F+LRM
Sbjct  14   FAAVVLATVISKLRGKKLNLPPGPIPIPIFGNWLQVGDDLNHRNLVDYAKKFGDLFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP L KEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPNLTKEVLHTQGVEFGSRTRNVV  106



>gb|ABF17875.1| cinnamate 4-hydroxylase isoform 2 [Brassica napus]
 gb|ABF17876.1| cinnamate 4-hydroxylase isoform 2 [Brassica napus]
 emb|CDY29670.1| BnaA04g17570D [Brassica napus]
Length=505

 Score =   146 bits (369),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 77/93 (83%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F A+++A V+SKLRGKK  LPPGPIP+P+FGNWLQVGDDLNHRNL DYAKKFGD+F+LRM
Sbjct  14   FAAVVLATVISKLRGKKLNLPPGPIPIPIFGNWLQVGDDLNHRNLVDYAKKFGDLFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP L KEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPNLTKEVLHTQGVEFGSRTRNVV  106



>gb|AGP25594.1| cinnamate 4-hydroxylase [Aquilaria sinensis]
Length=504

 Score =   146 bits (369),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F  +I+AI +SKL GKKY+LPPGP+PVPVFGNWLQVGDDLNHRNL+D A+KFGDIF+LRM
Sbjct  14   FATVILAIAISKLCGKKYRLPPGPLPVPVFGNWLQVGDDLNHRNLSDLARKFGDIFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSPELAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVV  106



>dbj|BAA24356.1| trans-ciinamate 4-hydroxylase [Arabidopsis thaliana]
Length=98

 Score =   137 bits (344),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 72/85 (85%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            FVA+I+A V+SKLRGKK KLPPGPIP+P+FGNWLQVGDDLNHRNL DYAKKFGD+F+LRM
Sbjct  14   FVAVILATVISKLRGKKLKLPPGPIPIPIFGNWLQVGDDLNHRNLVDYAKKFGDLFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEF  367
            GQRNLVVVSSP+L KEVL TQGVEF
Sbjct  74   GQRNLVVVSSPDLTKEVLLTQGVEF  98



>ref|XP_007017089.1| Cinnamate-4-hydroxylase [Theobroma cacao]
 gb|EOY34708.1| Cinnamate-4-hydroxylase [Theobroma cacao]
Length=505

 Score =   146 bits (368),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 82/93 (88%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            FVA++VAI +SKLRGK++KLPPGP PVPVFGNWLQVGDDLNHRNLT  AKKFGDIF+LRM
Sbjct  14   FVAVVVAITISKLRGKRFKLPPGPFPVPVFGNWLQVGDDLNHRNLTGLAKKFGDIFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSPELAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVV  106



>gb|AAN63028.1| cinnamate 4-hydroxylase [Ruta graveolens]
Length=506

 Score =   145 bits (367),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/83 (81%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = +2

Query  143  SKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRMGQRNLVVVSS  322
            SKLRGK++KLPPGP   PVFGNWLQVGDDLN R L + +KKFGD+++LRMGQRNLVVVSS
Sbjct  24   SKLRGKRFKLPPGPFGFPVFGNWLQVGDDLNQRKLANLSKKFGDVYLLRMGQRNLVVVSS  83

Query  323  PELAKEVLHTQGVEFGSRTRNXV  391
            PE+AKEVLHTQGVEFGSRTRN V
Sbjct  84   PEMAKEVLHTQGVEFGSRTRNVV  106



>ref|XP_002523952.1| cinnamate 4-hydroxylase, putative [Ricinus communis]
 gb|EEF38439.1| cinnamate 4-hydroxylase, putative [Ricinus communis]
Length=505

 Score =   145 bits (365),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F A+IVAIV+SKLRGK++KLPPGP+PVPVFGNWLQVGDDLN RNL D AKKFGDI +LRM
Sbjct  14   FAAVIVAIVISKLRGKRFKLPPGPLPVPVFGNWLQVGDDLNQRNLADLAKKFGDILLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP+LAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVV  106



>ref|XP_009132739.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Brassica rapa]
Length=505

 Score =   145 bits (365),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 77/93 (83%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F A+++A V+SKLRGK  KLPPGPIP+P+FGNWLQVGDDLNHRNL DYAKKFGD+F+LRM
Sbjct  14   FAAVVLATVISKLRGKILKLPPGPIPIPIFGNWLQVGDDLNHRNLVDYAKKFGDLFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP L KEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPNLTKEVLHTQGVEFGSRTRNVV  106



>ref|XP_009141068.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Brassica rapa]
Length=505

 Score =   144 bits (364),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 77/93 (83%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F A+++A V+SKLRGKK  LPPGPIP+P+FGNWLQVGDDLNHRNL DYAKKFGD+F+LRM
Sbjct  14   FPAVVLATVISKLRGKKLNLPPGPIPIPIFGNWLQVGDDLNHRNLVDYAKKFGDLFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP L KEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPNLTKEVLHTQGVEFGSRTRNVV  106



>ref|XP_007142041.1| hypothetical protein PHAVU_008G247400g [Phaseolus vulgaris]
 gb|ESW14035.1| hypothetical protein PHAVU_008G247400g [Phaseolus vulgaris]
Length=505

 Score =   144 bits (364),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F++ +VAI VSKLRGK++KLPPGP+PVPVFGNWLQVGDDLNHRNLT  AK+FGDIF+LRM
Sbjct  14   FLSAVVAIAVSKLRGKRFKLPPGPLPVPVFGNWLQVGDDLNHRNLTGLAKRFGDIFLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP+LAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVV  106



>emb|CAP08846.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
Length=488

 Score =   144 bits (363),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 77/89 (87%), Positives = 84/89 (94%), Gaps = 0/89 (0%)
 Frame = +2

Query  125  IVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRMGQRN  304
            I+A V+SKLRGKK KLPPGPIP+P+FGNWLQVGDDLNHRNL DYAKKFGD+F+LRMGQRN
Sbjct  1    ILATVISKLRGKKLKLPPGPIPIPIFGNWLQVGDDLNHRNLVDYAKKFGDLFLLRMGQRN  60

Query  305  LVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            LVVVSSP+L KEVLHTQGVEFGSRTRN V
Sbjct  61   LVVVSSPDLTKEVLHTQGVEFGSRTRNVV  89



>ref|XP_006432069.1| hypothetical protein CICLE_v10000921mg [Citrus clementina]
 gb|AAK57011.1|AF378333_1 cinnamate 4-hydroxylase [Citrus x paradisi]
 gb|ESR45309.1| hypothetical protein CICLE_v10000921mg [Citrus clementina]
Length=505

 Score =   143 bits (360),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 77/93 (83%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F A++VAI VSKLRGK++KLPPGP+PVPVFGNWLQVGDDLNHRNL+D AKK+GD+ +LRM
Sbjct  14   FAAVVVAITVSKLRGKRFKLPPGPLPVPVFGNWLQVGDDLNHRNLSDLAKKYGDVLLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSP+ AKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPDHAKEVLHTQGVEFGSRTRNVV  106



>ref|XP_001781223.1| predicted protein [Physcomitrella patens]
 gb|EDQ53921.1| predicted protein [Physcomitrella patens]
Length=503

 Score =   142 bits (359),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = +2

Query  116  VAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRMG  295
            VA+ + IV+ KLR  K KLPPGP  +P+ GNWLQVGDDLN RNL + ++K+GD+F+L+MG
Sbjct  13   VAVFLGIVIMKLRAPKLKLPPGPFALPIVGNWLQVGDDLNQRNLAEMSQKYGDVFLLKMG  72

Query  296  QRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            QRNLVVVSSP++AK+VLHTQGVEFGSRTRN V
Sbjct  73   QRNLVVVSSPDIAKDVLHTQGVEFGSRTRNVV  104



>gb|ADF28535.1| cinnamate 4-hydroxylase [Physcomitrella patens]
Length=517

 Score =   142 bits (359),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = +2

Query  116  VAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRMG  295
            VA+ + IV+ KLR  K KLPPGP  +P+ GNWLQVGDDLN RNL + ++K+GD+F+L+MG
Sbjct  27   VAVFLGIVIMKLRAPKLKLPPGPFALPIVGNWLQVGDDLNQRNLAEISQKYGDVFLLKMG  86

Query  296  QRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            QRNLVVVSSP++AK+VLHTQGVEFGSRTRN V
Sbjct  87   QRNLVVVSSPDIAKDVLHTQGVEFGSRTRNVV  118



>ref|XP_002461939.1| hypothetical protein SORBIDRAFT_02g010910 [Sorghum bicolor]
 gb|AAK54447.1| cinnamic acid 4-hydroxylase [Sorghum bicolor]
 gb|EER98460.1| hypothetical protein SORBIDRAFT_02g010910 [Sorghum bicolor]
Length=501

 Score =   142 bits (359),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 67/82 (82%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +2

Query  146  KLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRMGQRNLVVVSSP  325
            KL GK+Y+LPPGP   PV GNWLQVGDDLNHRNL   AK+FGDIF+LRMG RNLVVVS+P
Sbjct  25   KLTGKRYRLPPGPAGAPVVGNWLQVGDDLNHRNLMSLAKRFGDIFLLRMGVRNLVVVSTP  84

Query  326  ELAKEVLHTQGVEFGSRTRNXV  391
            ELAKEVLHTQGVEFGSRTRN V
Sbjct  85   ELAKEVLHTQGVEFGSRTRNVV  106



>gb|AHI17493.2| cinnamate 4-hydroxylase [Dryopteris fragrans]
Length=508

 Score =   142 bits (359),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/93 (71%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
             V I+ ++ V  L   K +LPPGP+ VP+FGNWLQVGDDLNH NL++ A+K+G+I +LRM
Sbjct  22   LVVILASLAVVHLLRPKLRLPPGPLAVPIFGNWLQVGDDLNHENLSELARKYGEILLLRM  81

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSPELAKEVLHTQGVEFGSRTRN V
Sbjct  82   GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVV  114



>gb|AFY17064.1| cinnamate 4-hydroxylase 1 [Panicum virgatum]
Length=501

 Score =   142 bits (358),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 67/82 (82%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +2

Query  146  KLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRMGQRNLVVVSSP  325
            KL GK+ +LPPGP   PV GNWLQVGDDLNHRNL D AK+FGDIF+LRMG RNLVVVS+P
Sbjct  25   KLTGKRLRLPPGPAGAPVVGNWLQVGDDLNHRNLMDLAKRFGDIFLLRMGVRNLVVVSTP  84

Query  326  ELAKEVLHTQGVEFGSRTRNXV  391
            ELAKEVLHTQGVEFGSRTRN V
Sbjct  85   ELAKEVLHTQGVEFGSRTRNVV  106



>gb|AAC35857.1| cinnamic acid 4-hydroxylase [Capsicum chinense]
Length=469

 Score =   142 bits (357),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 67/70 (96%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +2

Query  182  PIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRMGQRNLVVVSSPELAKEVLHTQGV  361
            PIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIF+LRMGQRNLVVVSSPE AKEVLHTQGV
Sbjct  1    PIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRMGQRNLVVVSSPESAKEVLHTQGV  60

Query  362  EFGSRTRNXV  391
            EFGSRTRN V
Sbjct  61   EFGSRTRNVV  70



>gb|AAW70021.1| cinnamic acid 4-hydroxylase [Ginkgo biloba]
Length=505

 Score =   142 bits (358),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 74/93 (80%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            FV ++ AI VSKL+ KK KLPPGP  +P+FGNWLQVGDDLNHRNLTD AKK+G+IF+L+M
Sbjct  15   FVVVVSAIFVSKLKSKKLKLPPGPFALPIFGNWLQVGDDLNHRNLTDLAKKYGEIFLLKM  74

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSPE AKEVLHTQGVEFGSRTRN V
Sbjct  75   GQRNLVVVSSPEYAKEVLHTQGVEFGSRTRNVV  107



>ref|XP_004151467.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Cucumis sativus]
 ref|XP_004173174.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Cucumis sativus]
Length=507

 Score =   142 bits (358),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = +2

Query  113  FVAIIVAIVVSKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRM  292
            F  ++VAI +SK RGK++KLPPGPIP+P+FGNWLQVGDDLNHRNL + AK+FGDI +LRM
Sbjct  14   FFTMVVAISISKFRGKRFKLPPGPIPIPIFGNWLQVGDDLNHRNLRELAKRFGDILLLRM  73

Query  293  GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNXV  391
            GQRNLVVVSSPELAKEVLHTQGVEFGSRTRN V
Sbjct  74   GQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVV  106



>gb|AFX98061.1| cinnamate 4-hydroxylase [Cunninghamia lanceolata]
Length=508

 Score =   142 bits (358),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 66/83 (80%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = +2

Query  143  SKLRGKKYKLPPGPIPVPVFGNWLQVGDDLNHRNLTDYAKKFGDIFMLRMGQRNLVVVSS  322
            +K RGKK KLPPGP+ VP+FGNWLQVGDDLNHRNL D AKKFG IF+L+MG+RNLVVVSS
Sbjct  30   NKFRGKKLKLPPGPLAVPIFGNWLQVGDDLNHRNLGDLAKKFGKIFLLKMGRRNLVVVSS  89

Query  323  PELAKEVLHTQGVEFGSRTRNXV  391
            P+LAKE+L T+GVEFGSRTRN V
Sbjct  90   PDLAKEMLTTKGVEFGSRTRNVV  112



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 561277149640