BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002F02

Length=570
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP02281.1|  unnamed protein product                                150   1e-38   Coffea canephora [robusta coffee]
gb|AAU21294.1|  DND1-like protein                                       138   3e-37   Solanum tuberosum [potatoes]
ref|XP_009589735.1|  PREDICTED: cyclic nucleotide-gated ion chann...    145   9e-37   Nicotiana tomentosiformis
ref|XP_006373346.1|  hypothetical protein POPTR_0017s12550g             139   4e-35   
ref|XP_004232184.1|  PREDICTED: cyclic nucleotide-gated ion chann...    139   2e-34   Solanum lycopersicum
ref|XP_002532894.1|  Cyclic nucleotide-gated ion channel, putative      139   2e-34   Ricinus communis
ref|XP_006338398.1|  PREDICTED: cyclic nucleotide-gated ion chann...    139   2e-34   Solanum tuberosum [potatoes]
ref|XP_006373345.1|  hypothetical protein POPTR_0017s12550g             138   3e-34   Populus trichocarpa [western balsam poplar]
ref|XP_011035830.1|  PREDICTED: cyclic nucleotide-gated ion chann...    136   2e-33   Populus euphratica
gb|KDP27204.1|  hypothetical protein JCGZ_19903                         135   3e-33   Jatropha curcas
ref|XP_004232185.1|  PREDICTED: cyclic nucleotide-gated ion chann...    135   3e-33   Solanum lycopersicum
ref|XP_007032653.1|  Cyclic nucleotide-regulated ion channel fami...    135   5e-33   
ref|XP_009787011.1|  PREDICTED: cyclic nucleotide-gated ion chann...    134   8e-33   Nicotiana sylvestris
ref|XP_010258957.1|  PREDICTED: cyclic nucleotide-gated ion chann...    133   2e-32   Nelumbo nucifera [Indian lotus]
ref|XP_010661110.1|  PREDICTED: cyclic nucleotide-gated ion chann...    131   6e-32   Vitis vinifera
ref|XP_002284164.1|  PREDICTED: cyclic nucleotide-gated ion chann...    131   1e-31   Vitis vinifera
gb|KJB33475.1|  hypothetical protein B456_006G012600                    130   2e-31   Gossypium raimondii
gb|KJB33477.1|  hypothetical protein B456_006G012600                    128   3e-31   Gossypium raimondii
gb|EYU44163.1|  hypothetical protein MIMGU_mgv1a0024531mg               129   3e-31   Erythranthe guttata [common monkey flower]
ref|XP_007032654.1|  Cyclic nucleotide-regulated ion channel fami...    129   4e-31   
ref|XP_011085713.1|  PREDICTED: cyclic nucleotide-gated ion chann...    128   1e-30   Sesamum indicum [beniseed]
ref|XP_007139515.1|  hypothetical protein PHAVU_008G036200g             128   1e-30   Phaseolus vulgaris [French bean]
gb|AAX18166.2|  CNGC2                                                   128   2e-30   Gossypium hirsutum [American cotton]
ref|XP_008365415.1|  PREDICTED: cyclic nucleotide-gated ion chann...    125   1e-29   
ref|XP_003552549.1|  PREDICTED: cyclic nucleotide-gated ion chann...    124   5e-29   Glycine max [soybeans]
ref|XP_006585762.1|  PREDICTED: cyclic nucleotide-gated ion chann...    123   7e-29   Glycine max [soybeans]
ref|XP_010258180.1|  PREDICTED: cyclic nucleotide-gated ion chann...    123   8e-29   Nelumbo nucifera [Indian lotus]
ref|XP_007217012.1|  hypothetical protein PRUPE_ppa002126mg             122   1e-28   Prunus persica
ref|XP_004306106.1|  PREDICTED: cyclic nucleotide-gated ion chann...    122   2e-28   Fragaria vesca subsp. vesca
ref|XP_004491863.1|  PREDICTED: cyclic nucleotide-gated ion chann...    121   3e-28   Cicer arietinum [garbanzo]
ref|XP_006287115.1|  hypothetical protein CARUB_v10000276mg             121   3e-28   
gb|EYU34629.1|  hypothetical protein MIMGU_mgv1a002175mg                120   6e-28   Erythranthe guttata [common monkey flower]
ref|XP_010420197.1|  PREDICTED: cyclic nucleotide-gated ion chann...    120   6e-28   Camelina sativa [gold-of-pleasure]
ref|XP_010492375.1|  PREDICTED: cyclic nucleotide-gated ion chann...    120   1e-27   Camelina sativa [gold-of-pleasure]
ref|XP_008230836.1|  PREDICTED: LOW QUALITY PROTEIN: cyclic nucle...    119   2e-27   
ref|XP_006400062.1|  hypothetical protein EUTSA_v10012798mg             119   2e-27   Eutrema salsugineum [saltwater cress]
ref|XP_003531840.1|  PREDICTED: cyclic nucleotide-gated ion chann...    119   2e-27   Glycine max [soybeans]
ref|XP_009365837.1|  PREDICTED: cyclic nucleotide-gated ion chann...    118   3e-27   Pyrus x bretschneideri [bai li]
gb|AIT39758.1|  cyclic nucleotide gated ion channel 2 like              118   3e-27   Chrysanthemum boreale
ref|XP_009365836.1|  PREDICTED: cyclic nucleotide-gated ion chann...    118   3e-27   Pyrus x bretschneideri [bai li]
ref|XP_010453677.1|  PREDICTED: cyclic nucleotide-gated ion chann...    118   4e-27   Camelina sativa [gold-of-pleasure]
ref|NP_197045.1|  cyclic nucleotide-gated ion channel 2                 118   4e-27   Arabidopsis thaliana [mouse-ear cress]
dbj|BAE99132.1|  cyclic nucleotide-gated cation channel                 118   5e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008341626.1|  PREDICTED: cyclic nucleotide-gated ion chann...    117   8e-27   
ref|XP_009360567.1|  PREDICTED: cyclic nucleotide-gated ion chann...    117   9e-27   Pyrus x bretschneideri [bai li]
gb|KJB33476.1|  hypothetical protein B456_006G012600                    117   1e-26   Gossypium raimondii
ref|XP_006482709.1|  PREDICTED: cyclic nucleotide-gated ion chann...    116   2e-26   Citrus sinensis [apfelsine]
ref|XP_002873723.1|  hypothetical protein ARALYDRAFT_488387             115   3e-26   
gb|EPS68594.1|  hypothetical protein M569_06173                         109   8e-26   Genlisea aurea
ref|XP_006431246.1|  hypothetical protein CICLE_v10011184mg             114   8e-26   Citrus clementina [clementine]
gb|ACA58352.1|  putative cyclic nucleotide-gated cation channel         113   2e-25   Sandersonia aurantiaca [Chinese-lantern lily]
ref|NP_974783.2|  cyclic nucleotide-gated ion channel 2                 114   2e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010029345.1|  PREDICTED: cyclic nucleotide-gated ion chann...    113   2e-25   Eucalyptus grandis [rose gum]
gb|KCW56239.1|  hypothetical protein EUGRSUZ_I01988                     113   2e-25   Eucalyptus grandis [rose gum]
ref|XP_011098700.1|  PREDICTED: cyclic nucleotide-gated ion chann...    110   2e-24   Sesamum indicum [beniseed]
ref|XP_010550023.1|  PREDICTED: cyclic nucleotide-gated ion chann...    110   3e-24   Tarenaya hassleriana [spider flower]
ref|XP_007032655.1|  Cyclic nucleotide-regulated ion channel fami...    108   1e-23   
emb|CDY26422.1|  BnaC09g42460D                                          107   3e-23   Brassica napus [oilseed rape]
ref|XP_003621352.1|  Cyclic nucleotide-gated ion channel                106   4e-23   Medicago truncatula
ref|XP_007032656.1|  Cyclic nucleotide-regulated ion channel fami...    106   5e-23   
gb|KHG15403.1|  Cyclic nucleotide-gated ion channel 2 -like protein     103   6e-23   Gossypium arboreum [tree cotton]
ref|XP_002323883.2|  hypothetical protein POPTR_0017s12570g             106   7e-23   Populus trichocarpa [western balsam poplar]
ref|XP_010936396.1|  PREDICTED: cyclic nucleotide-gated ion chann...    105   1e-22   
ref|XP_008780460.1|  PREDICTED: cyclic nucleotide-gated ion chann...    100   1e-22   Phoenix dactylifera
ref|XP_009416822.1|  PREDICTED: cyclic nucleotide-gated ion chann...    105   1e-22   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK25788.1|  hypothetical protein AALP_AA8G160300                    105   1e-22   Arabis alpina [alpine rockcress]
ref|XP_009121575.1|  PREDICTED: cyclic nucleotide-gated ion chann...    105   1e-22   Brassica rapa
gb|KJB75662.1|  hypothetical protein B456_012G050600                    103   2e-22   Gossypium raimondii
ref|XP_011035831.1|  PREDICTED: cyclic nucleotide-gated ion chann...    104   3e-22   Populus euphratica
emb|CDX69525.1|  BnaA10g18740D                                          104   3e-22   
gb|KJB75661.1|  hypothetical protein B456_012G050600                    103   7e-22   Gossypium raimondii
gb|KJB33474.1|  hypothetical protein B456_006G012500                    102   7e-22   Gossypium raimondii
gb|KJB33473.1|  hypothetical protein B456_006G012500                    102   1e-21   Gossypium raimondii
gb|KHG01341.1|  Cyclic nucleotide-gated ion channel 2 -like protein     100   5e-21   Gossypium arboreum [tree cotton]
emb|CDP02280.1|  unnamed protein product                              99.8    1e-20   Coffea canephora [robusta coffee]
ref|XP_008785948.1|  PREDICTED: cyclic nucleotide-gated ion chann...  99.0    2e-20   
ref|XP_008785947.1|  PREDICTED: cyclic nucleotide-gated ion chann...  99.4    2e-20   Phoenix dactylifera
ref|XP_010089586.1|  hypothetical protein L484_020976                 98.2    4e-20   
ref|XP_010551827.1|  PREDICTED: cyclic nucleotide-gated ion chann...  97.8    4e-20   Tarenaya hassleriana [spider flower]
ref|XP_010551825.1|  PREDICTED: cyclic nucleotide-gated ion chann...  97.8    5e-20   Tarenaya hassleriana [spider flower]
ref|XP_008777824.1|  PREDICTED: cyclic nucleotide-gated ion chann...  96.7    1e-19   Phoenix dactylifera
gb|KGN52496.1|  hypothetical protein Csa_5G638350                     95.1    4e-19   Cucumis sativus [cucumbers]
ref|XP_004141458.1|  PREDICTED: cyclic nucleotide-gated ion chann...  95.1    4e-19   
ref|XP_010229614.1|  PREDICTED: cyclic nucleotide-gated ion chann...  95.1    4e-19   Brachypodium distachyon [annual false brome]
ref|XP_010229618.1|  PREDICTED: cyclic nucleotide-gated ion chann...  95.1    4e-19   Brachypodium distachyon [annual false brome]
ref|XP_008459361.1|  PREDICTED: cyclic nucleotide-gated ion chann...  94.4    8e-19   Cucumis melo [Oriental melon]
ref|XP_009419077.1|  PREDICTED: cyclic nucleotide-gated ion chann...  94.4    8e-19   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010904936.1|  PREDICTED: cyclic nucleotide-gated ion chann...  94.4    9e-19   Elaeis guineensis
gb|EEC76211.1|  hypothetical protein OsI_13606                        94.4    1e-18   Oryza sativa Indica Group [Indian rice]
ref|XP_010674211.1|  PREDICTED: cyclic nucleotide-gated ion chann...  93.6    1e-18   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008680983.1|  PREDICTED: uncharacterized protein LOC100191...  93.6    2e-18   
gb|AFW67569.1|  hypothetical protein ZEAMMB73_354655                  93.6    2e-18   
dbj|BAJ99130.1|  predicted protein                                    93.2    2e-18   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011085718.1|  PREDICTED: cyclic nucleotide-gated ion chann...  91.3    6e-18   Sesamum indicum [beniseed]
ref|XP_002466423.1|  hypothetical protein SORBIDRAFT_01g007550        91.3    1e-17   Sorghum bicolor [broomcorn]
ref|XP_011085714.1|  PREDICTED: cyclic nucleotide-gated ion chann...  90.9    1e-17   Sesamum indicum [beniseed]
ref|XP_008792776.1|  PREDICTED: cyclic nucleotide-gated ion chann...  90.1    3e-17   Phoenix dactylifera
ref|XP_011085717.1|  PREDICTED: cyclic nucleotide-gated ion chann...  89.4    4e-17   Sesamum indicum [beniseed]
dbj|BAM44882.1|  cyclic nucleotide gated channel 2                    89.0    7e-17   Phragmites australis
dbj|BAM44883.1|  cyclic nucleotide gated channel 2                    89.0    7e-17   Phragmites australis
dbj|BAM44881.1|  cyclic nucleotide gated channel 2                    89.0    7e-17   Phragmites australis
gb|AAK16188.1|AC079887_20  putative cyclic nucleotide and calmodu...  88.6    8e-17   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004981703.1|  PREDICTED: cyclic nucleotide-gated ion chann...  88.6    9e-17   Setaria italica
ref|XP_010109131.1|  hypothetical protein L484_017070                 84.3    1e-16   
ref|XP_008666400.1|  PREDICTED: uncharacterized protein LOC100272...  87.0    2e-16   
ref|XP_008666390.1|  PREDICTED: uncharacterized protein LOC100272...  87.0    3e-16   
dbj|BAM44884.1|  cyclic nucleotide gated channel 2                    87.0    3e-16   Phragmites australis
dbj|BAM44886.1|  cyclic nucleotide gated channel 2                    87.0    3e-16   Phragmites australis
dbj|BAM44885.1|  cyclic nucleotide gated channel 2                    87.0    3e-16   Phragmites australis
ref|XP_010034400.1|  PREDICTED: cyclic nucleotide-gated ion chann...  86.7    4e-16   Eucalyptus grandis [rose gum]
gb|KCW51913.1|  hypothetical protein EUGRSUZ_J01368                   86.7    4e-16   Eucalyptus grandis [rose gum]
ref|XP_010939040.1|  PREDICTED: LOW QUALITY PROTEIN: cyclic nucle...  83.6    4e-15   Elaeis guineensis
ref|XP_009405110.1|  PREDICTED: cyclic nucleotide-gated ion chann...  82.8    8e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008234503.1|  PREDICTED: cyclic nucleotide-gated ion chann...  79.7    8e-14   Prunus mume [ume]
ref|XP_008357023.1|  PREDICTED: cyclic nucleotide-gated ion chann...  76.6    9e-14   
ref|XP_007220842.1|  hypothetical protein PRUPE_ppa024719mg           78.6    2e-13   
ref|XP_009370501.1|  PREDICTED: cyclic nucleotide-gated ion chann...  72.4    2e-11   
ref|XP_009372825.1|  PREDICTED: cyclic nucleotide-gated ion chann...  71.6    4e-11   Pyrus x bretschneideri [bai li]
ref|XP_010923647.1|  PREDICTED: cyclic nucleotide-gated ion chann...  70.5    8e-11   
ref|XP_006651833.1|  PREDICTED: cyclic nucleotide-gated ion chann...  69.7    2e-10   
ref|XP_006848733.1|  hypothetical protein AMTR_s00177p00064020        65.5    5e-10   
ref|XP_004309022.1|  PREDICTED: cyclic nucleotide-gated ion chann...  54.7    1e-05   Fragaria vesca subsp. vesca



>emb|CDP02281.1| unnamed protein product [Coffea canephora]
Length=703

 Score =   150 bits (379),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 83/118 (70%), Positives = 90/118 (76%), Gaps = 9/118 (8%)
 Frame = +1

Query  226  MPSYPGLHFSLSRWFGTILRRKSVQPDNSDDTYD-ENPNFISTECYACTQVGVPVFHSTS  402
            MPS P LH+S+ RWFG I RR+SVQPDN +D  D  NP   S ECYACTQVGVPVFHSTS
Sbjct  1    MPSSPDLHYSIPRWFG-IFRRRSVQPDNGEDADDYNNPFSNSGECYACTQVGVPVFHSTS  59

Query  403  CDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPF--GRVLDPRSKRVQRWN  570
            CD AHQP+WEASAGSSLIPI+NRPG +   STQ   RS P   GRVLDPRSK VQ WN
Sbjct  60   CDKAHQPQWEASAGSSLIPIRNRPGQL---STQK--RSIPISRGRVLDPRSKTVQSWN  112



>gb|AAU21294.1| DND1-like protein [Solanum tuberosum]
Length=186

 Score =   138 bits (348),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 93/118 (79%), Gaps = 4/118 (3%)
 Frame = +1

Query  226  MPSYPGLHFSLSRWFGTILRRKSVQPDNSDDTYDEN-PNFISTECYACTQVGVPVFHSTS  402
            M S+  + F LSRWFG I RR+SVQPDNSDD  D+N P   S ECYACTQVGVPVFHSTS
Sbjct  1    MSSHQDVRFFLSRWFG-IFRRRSVQPDNSDDNDDDNNPISNSIECYACTQVGVPVFHSTS  59

Query  403  CDNAHQPEWEASAGSSLIPIKNRPGSVTHR--STQDFHRSGPFGRVLDPRSKRVQRWN  570
            CD A+QPEWEASAGSSLIPI+NR    T +  S++  H SGPFGRVLDPRSKRVQRWN
Sbjct  60   CDGANQPEWEASAGSSLIPIQNRTDLKTGKSRSSRSRHTSGPFGRVLDPRSKRVQRWN  117



>ref|XP_009589735.1| PREDICTED: cyclic nucleotide-gated ion channel 2 [Nicotiana tomentosiformis]
Length=709

 Score =   145 bits (365),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 84/119 (71%), Positives = 94/119 (79%), Gaps = 5/119 (4%)
 Frame = +1

Query  226  MPSYPGLHFSLSRWFGTILRRKSVQPDNSDDTYDEN-PNFISTECYACTQVGVPVFHSTS  402
            M S   L F LSRWFG I RR+SVQPDNSDD  D++ P   S ECYACTQVGVPVFHSTS
Sbjct  1    MSSRQDLRFFLSRWFG-IFRRRSVQPDNSDDNDDDSNPISNSIECYACTQVGVPVFHSTS  59

Query  403  CDNAHQPEWEASAGSSLIPIKNRPG---SVTHRSTQDFHRSGPFGRVLDPRSKRVQRWN  570
            CD AHQPEWEASAGSSL+PI+NR     +   RS+++ H+SGPFGRVLDPRSKRVQRWN
Sbjct  60   CDGAHQPEWEASAGSSLVPIQNRTNNSRTGKSRSSRNRHQSGPFGRVLDPRSKRVQRWN  118



>ref|XP_006373346.1| hypothetical protein POPTR_0017s12550g [Populus trichocarpa]
 gb|ERP51143.1| hypothetical protein POPTR_0017s12550g [Populus trichocarpa]
Length=534

 Score =   139 bits (350),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 86/127 (68%), Gaps = 12/127 (9%)
 Frame = +1

Query  226  MPSYPGLHFSLSRWFGTILRR--KSVQPDNSDDTY--------DENPNFISTECYACTQV  375
            MPS P  HFSL RW G +  +  +S   DNSD++         D NP   S ECYACTQV
Sbjct  1    MPSQPNSHFSLPRWIGLLCHKNSQSETGDNSDNSNLNSTNNIDDSNPISNSIECYACTQV  60

Query  376  GVPVFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHR--SGPFGRVLDPRS  549
            GVPVFHSTSCD AHQPEWEASAGSSL+PIKNR GS    + +   R  +GP G VLDPRS
Sbjct  61   GVPVFHSTSCDQAHQPEWEASAGSSLVPIKNRLGSRKSPANRAQSRRPAGPLGTVLDPRS  120

Query  550  KRVQRWN  570
            KRVQ+WN
Sbjct  121  KRVQKWN  127



>ref|XP_004232184.1| PREDICTED: cyclic nucleotide-gated ion channel 2 isoform X1 [Solanum 
lycopersicum]
Length=708

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 82/118 (69%), Positives = 93/118 (79%), Gaps = 4/118 (3%)
 Frame = +1

Query  226  MPSYPGLHFSLSRWFGTILRRKSVQPDNSDDTYDEN-PNFISTECYACTQVGVPVFHSTS  402
            M S+  + F LS+WFG I RR+SVQPDNSDD  D+  P   S ECYACTQVGVPVFHSTS
Sbjct  1    MSSHQDVRFFLSKWFG-IFRRRSVQPDNSDDNDDDINPISNSIECYACTQVGVPVFHSTS  59

Query  403  CDNAHQPEWEASAGSSLIPIKNRPGSVTHR--STQDFHRSGPFGRVLDPRSKRVQRWN  570
            CD A+QPEWEASAGSSL+PI+NR  S T +  S++  H SGPFGRVLDPRSKRVQRWN
Sbjct  60   CDGANQPEWEASAGSSLVPIQNRTDSKTGKSRSSRSRHTSGPFGRVLDPRSKRVQRWN  117



>ref|XP_002532894.1| Cyclic nucleotide-gated ion channel, putative [Ricinus communis]
 gb|EEF29474.1| Cyclic nucleotide-gated ion channel, putative [Ricinus communis]
Length=715

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 75/124 (60%), Positives = 88/124 (71%), Gaps = 10/124 (8%)
 Frame = +1

Query  226  MPSYPGLHFSLSRWFGTILRRKSVQPDNSDDT--------YDENPNFIST-ECYACTQVG  378
            MPS P  HFSL RW G +L  K+ Q DNSD +         D+N N  S+ ECYACTQVG
Sbjct  1    MPSQPDFHFSLQRWIG-LLCGKNGQNDNSDSSGGDSTVRNIDDNNNISSSVECYACTQVG  59

Query  379  VPVFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPFGRVLDPRSKRV  558
            VPVFHSTSCD+AHQP+W ASAGSSLIPI+N+PG+    +      +GPFG VLDPRSKRV
Sbjct  60   VPVFHSTSCDHAHQPQWVASAGSSLIPIQNQPGAKKPPTIISRFPAGPFGAVLDPRSKRV  119

Query  559  QRWN  570
            Q+WN
Sbjct  120  QKWN  123



>ref|XP_006338398.1| PREDICTED: cyclic nucleotide-gated ion channel 2-like [Solanum 
tuberosum]
Length=708

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 93/118 (79%), Gaps = 4/118 (3%)
 Frame = +1

Query  226  MPSYPGLHFSLSRWFGTILRRKSVQPDNSDDTYDEN-PNFISTECYACTQVGVPVFHSTS  402
            M S+  + F LSRWFG I RR+SVQPDNSDD  D+N P   S ECYACTQVGVPVFHSTS
Sbjct  1    MSSHQDVRFFLSRWFG-IFRRRSVQPDNSDDNDDDNNPISNSIECYACTQVGVPVFHSTS  59

Query  403  CDNAHQPEWEASAGSSLIPIKNRPGSVTHR--STQDFHRSGPFGRVLDPRSKRVQRWN  570
            CD A+QPEWEASAGSSLIPI+NR    T +  S++  H SGPFGRVLDPRSKRVQRWN
Sbjct  60   CDGANQPEWEASAGSSLIPIQNRTDLKTGKSRSSRSRHTSGPFGRVLDPRSKRVQRWN  117



>ref|XP_006373345.1| hypothetical protein POPTR_0017s12550g [Populus trichocarpa]
 gb|ERP51142.1| hypothetical protein POPTR_0017s12550g [Populus trichocarpa]
Length=718

 Score =   138 bits (348),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 86/127 (68%), Gaps = 12/127 (9%)
 Frame = +1

Query  226  MPSYPGLHFSLSRWFGTILRR--KSVQPDNSDDTY--------DENPNFISTECYACTQV  375
            MPS P  HFSL RW G +  +  +S   DNSD++         D NP   S ECYACTQV
Sbjct  1    MPSQPNSHFSLPRWIGLLCHKNSQSETGDNSDNSNLNSTNNIDDSNPISNSIECYACTQV  60

Query  376  GVPVFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHR--SGPFGRVLDPRS  549
            GVPVFHSTSCD AHQPEWEASAGSSL+PIKNR GS    + +   R  +GP G VLDPRS
Sbjct  61   GVPVFHSTSCDQAHQPEWEASAGSSLVPIKNRLGSRKSPANRAQSRRPAGPLGTVLDPRS  120

Query  550  KRVQRWN  570
            KRVQ+WN
Sbjct  121  KRVQKWN  127



>ref|XP_011035830.1| PREDICTED: cyclic nucleotide-gated ion channel 2 [Populus euphratica]
Length=718

 Score =   136 bits (343),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 85/127 (67%), Gaps = 12/127 (9%)
 Frame = +1

Query  226  MPSYPGLHFSLSRWFGTILRRKSV-----QPDNSD-----DTYDENPNFISTECYACTQV  375
            MPS P  HFSL RW G +  + S      + DNS+     +  D NP   S ECYACTQV
Sbjct  1    MPSQPNSHFSLPRWIGLLCHKNSQSETGDKSDNSNLNSTNNIDDSNPISNSIECYACTQV  60

Query  376  GVPVFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHR--SGPFGRVLDPRS  549
            GVPVFHSTSCD AHQPEWEASAGSSL+PIKNR GS    + +   R  +GP G VLDPRS
Sbjct  61   GVPVFHSTSCDQAHQPEWEASAGSSLVPIKNRLGSRKSPANRAQSRWPAGPLGTVLDPRS  120

Query  550  KRVQRWN  570
            KRVQ+WN
Sbjct  121  KRVQKWN  127



>gb|KDP27204.1| hypothetical protein JCGZ_19903 [Jatropha curcas]
Length=770

 Score =   135 bits (341),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 73/141 (52%), Positives = 87/141 (62%), Gaps = 11/141 (8%)
 Frame = +1

Query  181  LNSLISHPYGFPPPKMPSYPGLHFSLSRWFGTILRRKSVQPDNSDDTYDENPNFI-----  345
            L + +   +GF    MPS P   FSL RW G + ++K       +    EN N I     
Sbjct  39   LTTFLLSSHGFALSIMPSPPNFSFSLLRWIGLLCQKKGESESGDNSGRGENNNSIVDDNS  98

Query  346  ----STECYACTQVGVPVFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHR  513
                + ECYACTQVGVPVFHSTSCD+AHQPEW ASAGS L+PI++R G     STQ   R
Sbjct  99   VPNNTVECYACTQVGVPVFHSTSCDHAHQPEWVASAGSYLVPIQSRTGPKKCPSTQTHSR  158

Query  514  --SGPFGRVLDPRSKRVQRWN  570
              +GPFG VLDPRSKRVQ+WN
Sbjct  159  LPTGPFGTVLDPRSKRVQKWN  179



>ref|XP_004232185.1| PREDICTED: cyclic nucleotide-gated ion channel 2 isoform X2 [Solanum 
lycopersicum]
Length=704

 Score =   135 bits (340),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 82/112 (73%), Positives = 90/112 (80%), Gaps = 5/112 (4%)
 Frame = +1

Query  247  HFSL-SRWFGTILRRKSVQPDNSDDTYDEN-PNFISTECYACTQVGVPVFHSTSCDNAHQ  420
            HF L SRWFG I RR+SVQPDNSDD  D+  P   S ECYACTQVGVPVFHSTSCD A+Q
Sbjct  3    HFLLNSRWFG-IFRRRSVQPDNSDDNDDDINPISNSIECYACTQVGVPVFHSTSCDGANQ  61

Query  421  PEWEASAGSSLIPIKNRPGSVTHR--STQDFHRSGPFGRVLDPRSKRVQRWN  570
            PEWEASAGSSL+PI+NR  S T +  S++  H SGPFGRVLDPRSKRVQRWN
Sbjct  62   PEWEASAGSSLVPIQNRTDSKTGKSRSSRSRHTSGPFGRVLDPRSKRVQRWN  113



>ref|XP_007032653.1| Cyclic nucleotide-regulated ion channel family protein isoform 
1 [Theobroma cacao]
 gb|EOY03579.1| Cyclic nucleotide-regulated ion channel family protein isoform 
1 [Theobroma cacao]
Length=707

 Score =   135 bits (339),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 79/110 (72%), Gaps = 2/110 (2%)
 Frame = +1

Query  247  HFSLSRWFGTILRRKS--VQPDNSDDTYDENPNFISTECYACTQVGVPVFHSTSCDNAHQ  420
            + SLSRW G    + S     D+S D  ++NP   + ECYACTQVGVPVFHSTSCD+AHQ
Sbjct  6    NLSLSRWIGLCQLQNSPGENSDHSGDISEDNPISNTVECYACTQVGVPVFHSTSCDHAHQ  65

Query  421  PEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPFGRVLDPRSKRVQRWN  570
            PEWEASAGSSL+PI+ R G    ++    H SGP GRVLDPRSKRVQ+WN
Sbjct  66   PEWEASAGSSLVPIQARAGQKKTQAAASRHPSGPLGRVLDPRSKRVQKWN  115



>ref|XP_009787011.1| PREDICTED: cyclic nucleotide-gated ion channel 2 [Nicotiana sylvestris]
Length=709

 Score =   134 bits (337),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 81/119 (68%), Positives = 90/119 (76%), Gaps = 5/119 (4%)
 Frame = +1

Query  226  MPSYPGLHFSLSRWFGTILRRKSVQPDNSDDTYDEN-PNFISTECYACTQVGVPVFHSTS  402
            M S   L F LSRWFG I RR+SVQPDNSDD  D++ P   S ECYACTQVGVPVFHSTS
Sbjct  1    MSSRQDLRFFLSRWFG-IFRRRSVQPDNSDDNEDDSNPISNSIECYACTQVGVPVFHSTS  59

Query  403  CDNAHQPEWEASAGSSLIPIKNRPG---SVTHRSTQDFHRSGPFGRVLDPRSKRVQRWN  570
            CD A+ PEWEASAGSSL+PI+NR     +   RS+ + H SGPFG VLDPRSKRVQRWN
Sbjct  60   CDQANPPEWEASAGSSLVPIQNRTNNSRTGKSRSSHNRHPSGPFGSVLDPRSKRVQRWN  118



>ref|XP_010258957.1| PREDICTED: cyclic nucleotide-gated ion channel 2-like [Nelumbo 
nucifera]
Length=713

 Score =   133 bits (335),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 69/124 (56%), Positives = 78/124 (63%), Gaps = 9/124 (7%)
 Frame = +1

Query  226  MPSYPGLHFSLSRWFGTILRRKSVQPDNSDDTYDENPNFISTECYACTQVGVPVFHSTSC  405
            MP+ P    SL RW G +L+ +  Q    DD  +ENP+  S ECYACTQVG P FHSTSC
Sbjct  1    MPALPESLISLRRWPGVLLQFRKNQLGAGDDEEEENPSSHSVECYACTQVGAPAFHSTSC  60

Query  406  DNAHQPEWEASAGSSLIPIKNR------PGSVTHRSTQDFHRSGP---FGRVLDPRSKRV  558
            D AH PEWEASAGSSLIPI++       P   + R T    R      FGRVLDPRSKRV
Sbjct  61   DRAHTPEWEASAGSSLIPIQSHSDDGASPDRKSLRKTVSNKRRTSRWVFGRVLDPRSKRV  120

Query  559  QRWN  570
            QRWN
Sbjct  121  QRWN  124



>ref|XP_010661110.1| PREDICTED: cyclic nucleotide-gated ion channel 2 isoform X2 [Vitis 
vinifera]
Length=622

 Score =   131 bits (329),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 71/117 (61%), Positives = 82/117 (70%), Gaps = 9/117 (8%)
 Frame = +1

Query  226  MPSYPGLHFSLSRWFGTILRRKSVQPDNSDDTYDENPNFIS--TECYACTQVGVPVFHST  399
            M + P    SL RW G   RRK+    NSD+ Y+E+   IS   ECYACTQVGVPVFHST
Sbjct  1    MDAPPNFQISLPRWIGIFRRRKA----NSDENYEEDDGPISNSIECYACTQVGVPVFHST  56

Query  400  SCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPFGRVLDPRSKRVQRWN  570
            SCD AHQPEWEASAGSSLIPI++R    T ++  +   SGPFG VLDPR+K VQRWN
Sbjct  57   SCDQAHQPEWEASAGSSLIPIQDRR---TGKARSNGRPSGPFGPVLDPRTKPVQRWN  110



>ref|XP_002284164.1| PREDICTED: cyclic nucleotide-gated ion channel 2 isoform X1 [Vitis 
vinifera]
 emb|CBI22277.3| unnamed protein product [Vitis vinifera]
Length=701

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 71/117 (61%), Positives = 82/117 (70%), Gaps = 9/117 (8%)
 Frame = +1

Query  226  MPSYPGLHFSLSRWFGTILRRKSVQPDNSDDTYDENPNFIS--TECYACTQVGVPVFHST  399
            M + P    SL RW G   RRK+    NSD+ Y+E+   IS   ECYACTQVGVPVFHST
Sbjct  1    MDAPPNFQISLPRWIGIFRRRKA----NSDENYEEDDGPISNSIECYACTQVGVPVFHST  56

Query  400  SCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPFGRVLDPRSKRVQRWN  570
            SCD AHQPEWEASAGSSLIPI++R    T ++  +   SGPFG VLDPR+K VQRWN
Sbjct  57   SCDQAHQPEWEASAGSSLIPIQDRR---TGKARSNGRPSGPFGPVLDPRTKPVQRWN  110



>gb|KJB33475.1| hypothetical protein B456_006G012600 [Gossypium raimondii]
Length=766

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 77/140 (55%), Positives = 92/140 (66%), Gaps = 16/140 (11%)
 Frame = +1

Query  184  NSLISHPYGFPPPKMPSYPGLHFSLSRWFGTILRRKSVQPDNSD------DTYDENPNFI  345
            NS +SH   F    MP  P  +FSLSRWFG + +  +  P+ SD      +  +ENP   
Sbjct  40   NSFLSHGSTFL--TMP--PQSNFSLSRWFG-LFQLPNSMPERSDNGSVSGEGNEENPISY  94

Query  346  STECYACTQVGVPVFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQ----DFHR  513
            + ECYACTQVGVPVFHSTSCD AH PEWEASAGSSL+PI+ R  S   ++ Q    +  R
Sbjct  95   TVECYACTQVGVPVFHSTSCDQAHPPEWEASAGSSLVPIQARTASKQKKTQQPAAPNTRR  154

Query  514  -SGPFGRVLDPRSKRVQRWN  570
             SGPFGRVLDPR+KRVQ WN
Sbjct  155  PSGPFGRVLDPRTKRVQNWN  174



>gb|KJB33477.1| hypothetical protein B456_006G012600 [Gossypium raimondii]
Length=554

 Score =   128 bits (322),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 70/122 (57%), Positives = 84/122 (69%), Gaps = 12/122 (10%)
 Frame = +1

Query  238  PGLHFSLSRWFGTILRRKSVQPDNSD------DTYDENPNFISTECYACTQVGVPVFHST  399
            P  +FSLSRWFG + +  +  P+ SD      +  +ENP   + ECYACTQVGVPVFHST
Sbjct  3    PQSNFSLSRWFG-LFQLPNSMPERSDNGSVSGEGNEENPISYTVECYACTQVGVPVFHST  61

Query  400  SCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQ----DFHR-SGPFGRVLDPRSKRVQR  564
            SCD AH PEWEASAGSSL+PI+ R  S   ++ Q    +  R SGPFGRVLDPR+KRVQ 
Sbjct  62   SCDQAHPPEWEASAGSSLVPIQARTASKQKKTQQPAAPNTRRPSGPFGRVLDPRTKRVQN  121

Query  565  WN  570
            WN
Sbjct  122  WN  123



>gb|EYU44163.1| hypothetical protein MIMGU_mgv1a0024531mg, partial [Erythranthe 
guttata]
Length=669

 Score =   129 bits (325),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 69/115 (60%), Positives = 76/115 (66%), Gaps = 8/115 (7%)
 Frame = +1

Query  247  HFSLSRWFGTILRRKSVQPDNSDDTYDENPNFIST----ECYACTQVGVPVFHSTSCDNA  414
            +FSLS  FG   R   + PDN  D  +EN   IST    ECYACTQVG PVFHSTSCD A
Sbjct  3    NFSLSSCFGIFRRESVLTPDNGGDESEENQT-ISTGGGGECYACTQVGAPVFHSTSCDKA  61

Query  415  HQPEWEASAGSSLIPIKNRPGS--VTHRSTQDFHRSGPF-GRVLDPRSKRVQRWN  570
            H+PEWEASAGSSL+PI+NR G      RS+       PF G VLDPR KRVQRWN
Sbjct  62   HRPEWEASAGSSLLPIRNRAGQNPAGTRSSSARGAGQPFGGGVLDPRRKRVQRWN  116



>ref|XP_007032654.1| Cyclic nucleotide-regulated ion channel family protein isoform 
2, partial [Theobroma cacao]
 gb|EOY03580.1| Cyclic nucleotide-regulated ion channel family protein isoform 
2, partial [Theobroma cacao]
Length=660

 Score =   129 bits (324),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 60/89 (67%), Positives = 70/89 (79%), Gaps = 0/89 (0%)
 Frame = +1

Query  304  DNSDDTYDENPNFISTECYACTQVGVPVFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSV  483
            D+S D  ++NP   + ECYACTQVGVPVFHSTSCD+AHQPEWEASAGSSL+PI+ R G  
Sbjct  7    DHSGDISEDNPISNTVECYACTQVGVPVFHSTSCDHAHQPEWEASAGSSLVPIQARAGQK  66

Query  484  THRSTQDFHRSGPFGRVLDPRSKRVQRWN  570
              ++    H SGP GRVLDPRSKRVQ+WN
Sbjct  67   KTQAAASRHPSGPLGRVLDPRSKRVQKWN  95



>ref|XP_011085713.1| PREDICTED: cyclic nucleotide-gated ion channel 2-like [Sesamum 
indicum]
Length=692

 Score =   128 bits (322),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 76/111 (68%), Gaps = 16/111 (14%)
 Frame = +1

Query  238  PGLHFSLSRWFGTILRRKSVQPDNSDDTYDENPNFISTECYACTQVGVPVFHSTSCDNAH  417
            P LHFSL RWFG + RR S   D++DDT          ECYACTQVGVP FHSTSCD AH
Sbjct  7    PDLHFSLPRWFG-LFRRDS---DDADDTRFSTFG----ECYACTQVGVPAFHSTSCDKAH  58

Query  418  QPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPFGRVLDPRSKRVQRWN  570
            QPEWEASAGSSL+PIKNRPG     S +         RVLDPRSKRVQRWN
Sbjct  59   QPEWEASAGSSLLPIKNRPGPKNRTSFRS--------RVLDPRSKRVQRWN  101



>ref|XP_007139515.1| hypothetical protein PHAVU_008G036200g [Phaseolus vulgaris]
 gb|ESW11509.1| hypothetical protein PHAVU_008G036200g [Phaseolus vulgaris]
Length=709

 Score =   128 bits (322),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 65/116 (56%), Positives = 77/116 (66%), Gaps = 9/116 (8%)
 Frame = +1

Query  250  FSLSRWFGTILRRKSVQPDNSDDT---------YDENPNFISTECYACTQVGVPVFHSTS  402
            FSL  W G  LRR++   +    +          D+NP   + ECYACTQVGVPVFHSTS
Sbjct  5    FSLLWWIGKKLRRRNTVSNGESGSNENVVGAVVVDDNPFGSTVECYACTQVGVPVFHSTS  64

Query  403  CDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPFGRVLDPRSKRVQRWN  570
            CD+ +QP+WEASAGSSL+PI+NRP  V    T      GPFGRVLDPRSKRVQ+WN
Sbjct  65   CDSFNQPQWEASAGSSLVPIQNRPNKVLGFRTVSGSNIGPFGRVLDPRSKRVQKWN  120



>gb|AAX18166.2| CNGC2 [Gossypium hirsutum]
Length=715

 Score =   128 bits (321),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 86/126 (68%), Gaps = 14/126 (11%)
 Frame = +1

Query  226  MPSYPGLHFSLSRWFGTILRRKSVQPDNSD------DTYDENPNFISTECYACTQVGVPV  387
            MPS    +FSLSRWFG + +  +  P+ SD      +  +ENP   + ECYACTQVGVPV
Sbjct  1    MPSQS--NFSLSRWFG-LFQLPNSMPERSDNGSVSGEGNEENPISYTVECYACTQVGVPV  57

Query  388  FHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQ----DFHR-SGPFGRVLDPRSK  552
            FHSTSCD AH PEWEASAGSSL+PI+ R  S   ++ Q    +  R SGPFGRVLDPR+K
Sbjct  58   FHSTSCDQAHPPEWEASAGSSLVPIQARTASKQKKTQQPAAPNTRRPSGPFGRVLDPRTK  117

Query  553  RVQRWN  570
            RVQ WN
Sbjct  118  RVQNWN  123



>ref|XP_008365415.1| PREDICTED: cyclic nucleotide-gated ion channel 2-like [Malus 
domestica]
Length=712

 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 82/117 (70%), Gaps = 12/117 (10%)
 Frame = +1

Query  247  HFSLSRWFGTILRRKSVQPDNSDDTYDEN--PNFI-------STECYACTQVGVPVFHST  399
            HFSL RW   +LRR++ Q D++D+ ++ N   + I       S ECYACTQVGVP FHST
Sbjct  5    HFSLPRW-TRVLRRQNSQIDDADNNHNSNNIEDIINAPIISNSVECYACTQVGVPAFHST  63

Query  400  SCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPFGRVLDPRSKRVQRWN  570
            SCD AHQP+WEASAGSSLIPI++R  S   +       +GPFG VLDPRSKRVQRWN
Sbjct  64   SCDGAHQPQWEASAGSSLIPIQSR--SDLKKGISRHRPAGPFGPVLDPRSKRVQRWN  118



>ref|XP_003552549.1| PREDICTED: cyclic nucleotide-gated ion channel 2-like [Glycine 
max]
Length=714

 Score =   124 bits (310),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 78/117 (67%), Gaps = 11/117 (9%)
 Frame = +1

Query  253  SLSRWFGTILRRKSV--QPDNSDDTY--------DENPNFISTECYACTQVGVPVFHSTS  402
            SL RW    LRR++     D+  D++        D+NP     ECYACTQVGVPVFHSTS
Sbjct  7    SLLRWISKKLRRRNSISNGDSGSDSFQNGAATVVDDNPFSSGVECYACTQVGVPVFHSTS  66

Query  403  CDNA-HQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPFGRVLDPRSKRVQRWN  570
            CD+A HQ +WEASAGSSL+PI++RP  V    T      GPFGRVLDPRSKRVQRWN
Sbjct  67   CDSAFHQLQWEASAGSSLVPIQSRPNKVLGFRTVSGSSRGPFGRVLDPRSKRVQRWN  123



>ref|XP_006585762.1| PREDICTED: cyclic nucleotide-gated ion channel 2-like isoform 
X2 [Glycine max]
Length=716

 Score =   123 bits (308),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 70/120 (58%), Positives = 79/120 (66%), Gaps = 14/120 (12%)
 Frame = +1

Query  253  SLSRWFGTILR-RKSV-QPDNSDDTY-----------DENPNFISTECYACTQVGVPVFH  393
            SL RW    LR R S+   D+S DT+           D+NP     ECYACTQVGVPVFH
Sbjct  6    SLLRWISKKLRPRNSISNGDSSSDTFHNGASTDTVVVDDNPFSSGVECYACTQVGVPVFH  65

Query  394  STSCDNA-HQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPFGRVLDPRSKRVQRWN  570
            STSCD+A HQ +WEASAGSSL+PI++RP  V    T      GPFGRVLDPRSKRVQRWN
Sbjct  66   STSCDSAYHQLQWEASAGSSLVPIQSRPKKVLGFRTVSGLTRGPFGRVLDPRSKRVQRWN  125



>ref|XP_010258180.1| PREDICTED: cyclic nucleotide-gated ion channel 2 [Nelumbo nucifera]
Length=709

 Score =   123 bits (308),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 78/118 (66%), Gaps = 5/118 (4%)
 Frame = +1

Query  226  MPSYPGLHFSLSRWFGTILRRKSVQPDNSDDTYDENPNFISTECYACTQVGVPVFHSTSC  405
            MP      FSL RW G  LR ++   ++ DD  ++NP+  S ECYACTQ+G P FHSTSC
Sbjct  1    MPELSEFFFSLPRWIGESLRLRNNLGEDDDD--EDNPSSHSVECYACTQLGAPAFHSTSC  58

Query  406  DNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHR---SGPFGRVLDPRSKRVQRWN  570
            D  H PEWEASAGSSLIPI+ R  ++  R ++   R   +  FGRVLDPRSKRV RWN
Sbjct  59   DRVHPPEWEASAGSSLIPIQYRADNLKPRGSESNRRRTSTWVFGRVLDPRSKRVHRWN  116



>ref|XP_007217012.1| hypothetical protein PRUPE_ppa002126mg [Prunus persica]
 gb|EMJ18211.1| hypothetical protein PRUPE_ppa002126mg [Prunus persica]
Length=712

 Score =   122 bits (307),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 67/115 (58%), Positives = 81/115 (70%), Gaps = 11/115 (10%)
 Frame = +1

Query  250  FSLSRWFGTILRRKSVQPDNSDDTYDEN--------PNFISTECYACTQVGVPVFHSTSC  405
            FSLSRW    LRR+S + D++D++++ N        P   S ECYACTQVGVPVFHSTSC
Sbjct  7    FSLSRW-TRALRRQSSRADDTDNSHNSNNIEDIINAPISNSVECYACTQVGVPVFHSTSC  65

Query  406  DNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPFGRVLDPRSKRVQRWN  570
            D AHQ +WEASAGSSL+PI++R  S   +       +GPFG VLDPRSKRVQRWN
Sbjct  66   DGAHQLQWEASAGSSLVPIQSR--SDLKKGLSRGLPAGPFGHVLDPRSKRVQRWN  118



>ref|XP_004306106.1| PREDICTED: cyclic nucleotide-gated ion channel 2 [Fragaria vesca 
subsp. vesca]
Length=709

 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 84/115 (73%), Gaps = 10/115 (9%)
 Frame = +1

Query  247  HFSLSRWFGTIL-RRKSVQP---DNSDDTYDENPNFIST---ECYACTQVGVPVFHSTSC  405
            +FSL RW  T+  R++S  P   DNS++  ++NP  IST   ECYACTQVGVPVFHSTSC
Sbjct  4    NFSLPRW--TVFHRQQSSGPSDSDNSNNVVEDNPISISTSVVECYACTQVGVPVFHSTSC  61

Query  406  DNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPFGRVLDPRSKRVQRWN  570
            D AHQP+WEASAGSSL+PI++R   +     ++    GPFG VLDPR+KRVQRWN
Sbjct  62   DGAHQPQWEASAGSSLVPIQSR-SDLKKGLRRNRLPVGPFGEVLDPRTKRVQRWN  115



>ref|XP_004491863.1| PREDICTED: cyclic nucleotide-gated ion channel 2-like [Cicer 
arietinum]
Length=712

 Score =   121 bits (303),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 75/119 (63%), Gaps = 14/119 (12%)
 Frame = +1

Query  250  FSLSRWFGTILRRKS-------VQPDNSDDT-----YDENPNFISTECYACTQVGVPVFH  393
            +SL RW G  L  ++       V   NSD T      D+NP     ECYACTQVGVPVFH
Sbjct  5    YSLPRWIGGKLLGRNPKSTINNVGDSNSDTTGVVVVTDDNPVTSVVECYACTQVGVPVFH  64

Query  394  STSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPFGRVLDPRSKRVQRWN  570
            STSCD+ HQPEWEASAGS L+PI+NRPG      T+     GP G VLDPRSKRVQ WN
Sbjct  65   STSCDSCHQPEWEASAGSYLVPIQNRPGKFARAVTR--ANWGPLGSVLDPRSKRVQIWN  121



>ref|XP_006287115.1| hypothetical protein CARUB_v10000276mg, partial [Capsella rubella]
 gb|EOA20013.1| hypothetical protein CARUB_v10000276mg, partial [Capsella rubella]
Length=774

 Score =   121 bits (304),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 80/125 (64%), Gaps = 15/125 (12%)
 Frame = +1

Query  226  MPSYPGLHFSLSRWFGTI---LRRKS--VQPDNSDDTY----DENPNFISTECYACTQVG  378
            MPS+P     +SRW G      RR++  +  +N  D+     DE P   S ECYACTQVG
Sbjct  51   MPSHPNF---ISRWIGLFSDKFRRQTTGIDENNGGDSTSSGSDETPVLSSVECYACTQVG  107

Query  379  VPVFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHR-SGPFGRVLDPRSKR  555
            VP FHSTSCD AH PEW ASAGSSL+PI+   GS+ +     F R  GPFG VLDPRSKR
Sbjct  108  VPAFHSTSCDQAHAPEWRASAGSSLVPIQE--GSLPNPLRARFRRLKGPFGEVLDPRSKR  165

Query  556  VQRWN  570
            VQRWN
Sbjct  166  VQRWN  170



>gb|EYU34629.1| hypothetical protein MIMGU_mgv1a002175mg [Erythranthe guttata]
Length=705

 Score =   120 bits (302),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 76/108 (70%), Gaps = 7/108 (6%)
 Frame = +1

Query  250  FSLSRWFGTILRRKSVQPDNSDDTY-DENPNFISTECYACTQVGVPVFHSTSCDNAHQPE  426
            FS+SRWFG I RR+S   D +DDT  +++PN  S ECYACTQVG PVFHSTSCD AHQPE
Sbjct  12   FSISRWFG-IFRRES---DITDDTSSNQSPN--SGECYACTQVGAPVFHSTSCDKAHQPE  65

Query  427  WEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPFGRVLDPRSKRVQRWN  570
            WEASAGSSL+PIK R  S T           P   V DPR+KRVQRWN
Sbjct  66   WEASAGSSLLPIKYRSTSETRTDGAGGGGRRPSAGVYDPRTKRVQRWN  113



>ref|XP_010420197.1| PREDICTED: cyclic nucleotide-gated ion channel 2-like [Camelina 
sativa]
Length=718

 Score =   120 bits (302),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 75/121 (62%), Gaps = 10/121 (8%)
 Frame = +1

Query  226  MPSYPGLHFSLSRWFGTILRRKSV---QPDNSDDTY---DENPNFISTECYACTQVGVPV  387
            MPS+P   F     F    RR++    + +  D TY   DE P   S ECYACTQVGVP 
Sbjct  1    MPSHPDFIFRWIGLFSEKFRRQTTGIEENNGGDSTYSGSDETPVLSSVECYACTQVGVPA  60

Query  388  FHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPFGRVLDPRSKRVQRW  567
            FHSTSCD AH PEW ASAGSSL+PI++  GS      +     GPFG VLDPRSKRVQRW
Sbjct  61   FHSTSCDQAHAPEWRASAGSSLVPIQD--GSSVRARVRRLK--GPFGEVLDPRSKRVQRW  116

Query  568  N  570
            N
Sbjct  117  N  117



>ref|XP_010492375.1| PREDICTED: cyclic nucleotide-gated ion channel 2-like [Camelina 
sativa]
Length=718

 Score =   120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 76/124 (61%), Gaps = 16/124 (13%)
 Frame = +1

Query  226  MPSYPGLHFSLSRWFGTI---LRRKSVQPDNSDDTY------DENPNFISTECYACTQVG  378
            MPS+P   F   RW G      RR++   + ++  Y      DE P   S ECYACTQVG
Sbjct  1    MPSHPNFIF---RWIGLFSEKFRRQTTGIEENNGGYSTSSGSDETPVLSSVECYACTQVG  57

Query  379  VPVFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPFGRVLDPRSKRV  558
            VP FHSTSCD AH PEW ASAGSSL+PI+   GS      +  +  GPFG VLDPRSKRV
Sbjct  58   VPAFHSTSCDQAHAPEWRASAGSSLVPIQE--GSSVRARVRRLN--GPFGEVLDPRSKRV  113

Query  559  QRWN  570
            QRWN
Sbjct  114  QRWN  117



>ref|XP_008230836.1| PREDICTED: LOW QUALITY PROTEIN: cyclic nucleotide-gated ion channel 
2 [Prunus mume]
Length=707

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 79/115 (69%), Gaps = 11/115 (10%)
 Frame = +1

Query  250  FSLSRWFGTILRRKSVQPDNSDDTYDEN--------PNFISTECYACTQVGVPVFHSTSC  405
            F LSRW    LRR+S + D++D++ + N        P   S ECYACTQVGVPVFHSTSC
Sbjct  7    FFLSRW-TRALRRQSSRADDTDNSSNLNNIEDIINAPISNSVECYACTQVGVPVFHSTSC  65

Query  406  DNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPFGRVLDPRSKRVQRWN  570
            D AHQ +WEASAGSSL+PI++R  S   +       +GPFG VLDPRSKRVQRWN
Sbjct  66   DGAHQLQWEASAGSSLVPIQSR--SDLKKGLSRGRPAGPFGHVLDPRSKRVQRWN  118



>ref|XP_006400062.1| hypothetical protein EUTSA_v10012798mg [Eutrema salsugineum]
 dbj|BAJ33868.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ41515.1| hypothetical protein EUTSA_v10012798mg [Eutrema salsugineum]
Length=722

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 70/128 (55%), Positives = 79/128 (62%), Gaps = 18/128 (14%)
 Frame = +1

Query  226  MPSYPGLHFSLSRWFGTI---LRRK-------SVQPDNSDDTY--DENPNFISTECYACT  369
            MPS P   F   RW G      RRK       S+  +NS ++   D+ P   S ECYACT
Sbjct  1    MPSQPNFIF---RWIGLFSDKFRRKTPGIEEISIVQNNSGESSSGDDTPVLSSVECYACT  57

Query  370  QVGVPVFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHR-SGPFGRVLDPR  546
            QVGVP FHSTSCD AH PEW ASAGSSL+PI+   GS  + +   F R  GPFG VLDPR
Sbjct  58   QVGVPAFHSTSCDQAHAPEWRASAGSSLVPIQE--GSAPNPTRTRFRRLKGPFGEVLDPR  115

Query  547  SKRVQRWN  570
            SKRVQRWN
Sbjct  116  SKRVQRWN  123



>ref|XP_003531840.1| PREDICTED: cyclic nucleotide-gated ion channel 2-like isoform 
X1 [Glycine max]
Length=718

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 79/126 (63%), Gaps = 14/126 (11%)
 Frame = +1

Query  235  YPGLHFSLSRWFGTILR-RKSV-QPDNSDDTY-----------DENPNFISTECYACTQV  375
            Y  +   +  W    LR R S+   D+S DT+           D+NP     ECYACTQV
Sbjct  2    YQWIIVRVHMWISKKLRPRNSISNGDSSSDTFHNGASTDTVVVDDNPFSSGVECYACTQV  61

Query  376  GVPVFHSTSCDNA-HQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPFGRVLDPRSK  552
            GVPVFHSTSCD+A HQ +WEASAGSSL+PI++RP  V    T      GPFGRVLDPRSK
Sbjct  62   GVPVFHSTSCDSAYHQLQWEASAGSSLVPIQSRPKKVLGFRTVSGLTRGPFGRVLDPRSK  121

Query  553  RVQRWN  570
            RVQRWN
Sbjct  122  RVQRWN  127



>ref|XP_009365837.1| PREDICTED: cyclic nucleotide-gated ion channel 2-like isoform 
X2 [Pyrus x bretschneideri]
Length=713

 Score =   118 bits (296),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 81/117 (69%), Gaps = 12/117 (10%)
 Frame = +1

Query  247  HFSLSRWFGTILRRKSVQPDNSDDTYDEN--PNFI-------STECYACTQVGVPVFHST  399
            HFSL RW   +LRR++ Q D++++ ++ +   + I       S ECYACTQVGVP FHST
Sbjct  5    HFSLPRW-TRVLRRQNSQIDDAENNHNSSNIEDIINAPIVSNSVECYACTQVGVPAFHST  63

Query  400  SCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPFGRVLDPRSKRVQRWN  570
            SCD AHQP+WEASAGSSLIPI++R  S   +       +GPFG VLDPRSK VQRWN
Sbjct  64   SCDGAHQPQWEASAGSSLIPIQSR--SDLKKGISRRRPAGPFGPVLDPRSKLVQRWN  118



>gb|AIT39758.1| cyclic nucleotide gated ion channel 2 like, partial [Chrysanthemum 
boreale]
Length=688

 Score =   118 bits (296),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 74/98 (76%), Gaps = 9/98 (9%)
 Frame = +1

Query  304  DNSDDTYDENPNFISTECYACTQVGVPVFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSV  483
            D++D+  D+NP   +TECYACTQVGVPVFHSTSCDNA+QP+WEASAGSSL+PI++RPGS 
Sbjct  3    DSADELEDDNPISNTTECYACTQVGVPVFHSTSCDNANQPQWEASAGSSLVPIRDRPGSK  62

Query  484  T--------HRSTQDFHRS-GPFGRVLDPRSKRVQRWN  570
                      RS ++  R+   F RV DPRSK+VQRWN
Sbjct  63   IVPNLAANDGRSRRESQRNRNFFSRVYDPRSKQVQRWN  100



>ref|XP_009365836.1| PREDICTED: cyclic nucleotide-gated ion channel 2-like isoform 
X1 [Pyrus x bretschneideri]
Length=712

 Score =   118 bits (296),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 81/117 (69%), Gaps = 12/117 (10%)
 Frame = +1

Query  247  HFSLSRWFGTILRRKSVQPDNSDDTYDEN--PNFI-------STECYACTQVGVPVFHST  399
            HFSL RW   +LRR++ Q D++++ ++ +   + I       S ECYACTQVGVP FHST
Sbjct  5    HFSLPRW-TRVLRRQNSQIDDAENNHNSSNIEDIINAPIVSNSVECYACTQVGVPAFHST  63

Query  400  SCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPFGRVLDPRSKRVQRWN  570
            SCD AHQP+WEASAGSSLIPI++R  S   +       +GPFG VLDPRSK VQRWN
Sbjct  64   SCDGAHQPQWEASAGSSLIPIQSR--SDLKKGISRRRPAGPFGPVLDPRSKLVQRWN  118



>ref|XP_010453677.1| PREDICTED: cyclic nucleotide-gated ion channel 2 [Camelina sativa]
Length=722

 Score =   118 bits (296),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 73/121 (60%), Gaps = 6/121 (5%)
 Frame = +1

Query  226  MPSYPGLHFSLSRWFGTILRRKS--VQPDNSDDTY----DENPNFISTECYACTQVGVPV  387
            MPS+P   F     F    RR++  ++ +N  D+     DE P   S ECYACTQVGVP 
Sbjct  1    MPSHPNFIFRWIGLFSEKFRRQTTGIEENNGGDSTSSGSDETPVLSSVECYACTQVGVPA  60

Query  388  FHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPFGRVLDPRSKRVQRW  567
            FHSTSCD AH PEW ASAGSSL+PI+           +     GPFG VLDPRSKRVQRW
Sbjct  61   FHSTSCDQAHAPEWRASAGSSLVPIQEGSSVPNPVRARVRRLKGPFGEVLDPRSKRVQRW  120

Query  568  N  570
            N
Sbjct  121  N  121



>ref|NP_197045.1| cyclic nucleotide-gated ion channel 2 [Arabidopsis thaliana]
 sp|O65718.1|CNGC2_ARATH RecName: Full=Cyclic nucleotide-gated ion channel 2; Short=AtCNGC2; 
AltName: Full=Cyclic nucleotide- and calmodulin-regulated 
ion channel 2; AltName: Full=Protein DEFENSE NO DEATH 1 
[Arabidopsis thaliana]
 gb|AAF86351.1|AF280939_1 DND1 [Arabidopsis thaliana]
 emb|CAA76179.1| putative cyclic nucleotide-regulated ion channel [Arabidopsis 
thaliana]
 gb|AAC78613.1| cyclic nucleotide-gated cation channel [Arabidopsis thaliana]
 emb|CAC01740.1| cyclic nucleotide-gated cation channel [Arabidopsis thaliana]
 gb|AED92158.1| cyclic nucleotide-gated ion channel 2 [Arabidopsis thaliana]
Length=726

 Score =   118 bits (296),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 69/130 (53%), Positives = 78/130 (60%), Gaps = 20/130 (15%)
 Frame = +1

Query  226  MPSYPGLHFSLSRWFGTI---LRRKSVQPDNSDDT-----------YDENPNFISTECYA  363
            MPS+P   F   RW G      RR++   D + +             DE P   S ECYA
Sbjct  1    MPSHPNFIF---RWIGLFSDKFRRQTTGIDENSNLQINGGDSSSSGSDETPVLSSVECYA  57

Query  364  CTQVGVPVFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHR-SGPFGRVLD  540
            CTQVGVP FHSTSCD AH PEW ASAGSSL+PI+   GSV + +   F R  GPFG VLD
Sbjct  58   CTQVGVPAFHSTSCDQAHAPEWRASAGSSLVPIQE--GSVPNPARTRFRRLKGPFGEVLD  115

Query  541  PRSKRVQRWN  570
            PRSKRVQRWN
Sbjct  116  PRSKRVQRWN  125



>dbj|BAE99132.1| cyclic nucleotide-gated cation channel [Arabidopsis thaliana]
Length=726

 Score =   118 bits (295),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 69/130 (53%), Positives = 78/130 (60%), Gaps = 20/130 (15%)
 Frame = +1

Query  226  MPSYPGLHFSLSRWFGTI---LRRKSVQPDNSDDT-----------YDENPNFISTECYA  363
            MPS+P   F   RW G      RR++   D + +             DE P   S ECYA
Sbjct  1    MPSHPNFIF---RWIGLFSDKFRRQTTGIDENSNLQINGGDSSSSGSDETPVLSSIECYA  57

Query  364  CTQVGVPVFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHR-SGPFGRVLD  540
            CTQVGVP FHSTSCD AH PEW ASAGSSL+PI+   GSV + +   F R  GPFG VLD
Sbjct  58   CTQVGVPAFHSTSCDQAHAPEWRASAGSSLVPIQE--GSVPNPARTRFRRLKGPFGEVLD  115

Query  541  PRSKRVQRWN  570
            PRSKRVQRWN
Sbjct  116  PRSKRVQRWN  125



>ref|XP_008341626.1| PREDICTED: cyclic nucleotide-gated ion channel 2 [Malus domestica]
Length=712

 Score =   117 bits (293),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 80/117 (68%), Gaps = 12/117 (10%)
 Frame = +1

Query  247  HFSLSRWFGTILRRKSVQPDNSDDTYDEN--PNFIST-------ECYACTQVGVPVFHST  399
             F L RW   +LRR++ Q D++D+T++ N   + I+T       ECYACTQVGVP FHST
Sbjct  5    QFFLPRW-TRVLRRQNSQSDDTDNTHNSNNIEDIINTPIISNSVECYACTQVGVPAFHST  63

Query  400  SCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPFGRVLDPRSKRVQRWN  570
            SCD AHQP+WEASAGSSL PI++R  S   +       + PFG VLDPRSKRVQRWN
Sbjct  64   SCDAAHQPQWEASAGSSLXPIQSR--SDLKKGLSRHRPASPFGPVLDPRSKRVQRWN  118



>ref|XP_009360567.1| PREDICTED: cyclic nucleotide-gated ion channel 2-like [Pyrus 
x bretschneideri]
Length=712

 Score =   117 bits (293),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 82/117 (70%), Gaps = 12/117 (10%)
 Frame = +1

Query  247  HFSLSRWFGTILRRKSVQPDNSDDTYDEN--PNFIST-------ECYACTQVGVPVFHST  399
            +F L RW   +LRR++ Q D++++T++ N   + ++T       ECYACTQVGVP FHST
Sbjct  5    YFFLPRW-TRVLRRQNSQSDDTNNTHNSNNIEDIMNTPIISNSVECYACTQVGVPAFHST  63

Query  400  SCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPFGRVLDPRSKRVQRWN  570
            SCD AHQP+WEASAGSSLIPI++R  S   +       + PFG VLDPRSKRVQRWN
Sbjct  64   SCDAAHQPQWEASAGSSLIPIQSR--SDLKKGLSRHRPASPFGPVLDPRSKRVQRWN  118



>gb|KJB33476.1| hypothetical protein B456_006G012600 [Gossypium raimondii]
Length=694

 Score =   117 bits (292),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 68/92 (74%), Gaps = 5/92 (5%)
 Frame = +1

Query  310  SDDTYDENPNFISTECYACTQVGVPVFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTH  489
            S +  +ENP   + ECYACTQVGVPVFHSTSCD AH PEWEASAGSSL+PI+ R  S   
Sbjct  11   SGEGNEENPISYTVECYACTQVGVPVFHSTSCDQAHPPEWEASAGSSLVPIQARTASKQK  70

Query  490  RSTQ----DFHR-SGPFGRVLDPRSKRVQRWN  570
            ++ Q    +  R SGPFGRVLDPR+KRVQ WN
Sbjct  71   KTQQPAAPNTRRPSGPFGRVLDPRTKRVQNWN  102



>ref|XP_006482709.1| PREDICTED: cyclic nucleotide-gated ion channel 2-like [Citrus 
sinensis]
Length=713

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 66/125 (53%), Positives = 76/125 (61%), Gaps = 15/125 (12%)
 Frame = +1

Query  226  MPSYPGLHFSLSRWFGTILRRKSVQPDNSDDTYD----------ENPNFISTECYACTQV  375
            MPS+P L FSL RW   + R K V  D + +  +           N NF   ECYACTQV
Sbjct  1    MPSHPNLPFSLPRWIIELFRSKKVDGDQNGENNNDGNSDDNNPISNHNF---ECYACTQV  57

Query  376  GVPVFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPFGRVLDPRSKR  555
            GVPVFHSTSCD AHQPEWEASAGSSL+PI+ R   +  +  +    S  F  V DPRSKR
Sbjct  58   GVPVFHSTSCDQAHQPEWEASAGSSLVPIQARSKILGPKDGRP--ASATFAHVFDPRSKR  115

Query  556  VQRWN  570
            VQR N
Sbjct  116  VQRLN  120



>ref|XP_002873723.1| hypothetical protein ARALYDRAFT_488387 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49982.1| hypothetical protein ARALYDRAFT_488387 [Arabidopsis lyrata subsp. 
lyrata]
Length=726

 Score =   115 bits (289),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 68/130 (52%), Positives = 77/130 (59%), Gaps = 20/130 (15%)
 Frame = +1

Query  226  MPSYPGLHFSLSRWFGTI---LRRKSVQPDNSDDTY-----------DENPNFISTECYA  363
            MPS+P   F   RW G      RR++   D +   +           DE P   S ECYA
Sbjct  1    MPSHPNFIF---RWIGMFSEKFRRQTTGIDENSILHINGGDSSSSGSDETPVLSSVECYA  57

Query  364  CTQVGVPVFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHR-SGPFGRVLD  540
            CTQVGVP FHSTSCD AH PEW ASAGSSL+PI+    SV + +   F R  GPFG VLD
Sbjct  58   CTQVGVPAFHSTSCDQAHAPEWRASAGSSLVPIQE--ASVPNPARTRFRRLKGPFGEVLD  115

Query  541  PRSKRVQRWN  570
            PRSKRVQRWN
Sbjct  116  PRSKRVQRWN  125



>gb|EPS68594.1| hypothetical protein M569_06173, partial [Genlisea aurea]
Length=214

 Score =   109 bits (273),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 64/111 (58%), Gaps = 9/111 (8%)
 Frame = +1

Query  238  PGLHFSLSRWFGTILRRKSVQPDNSDDTYDENPNFISTECYACTQVGVPVFHSTSCDNAH  417
            P   F  SRW G  + R       +DD         S ECYACTQ+GVP FHSTSCD AH
Sbjct  6    PDRRFCFSRWSGIGMFRPESDVSGNDDGESSVTASGSGECYACTQLGVPAFHSTSCDKAH  65

Query  418  QPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPFGRVLDPRSKRVQRWN  570
            QPEWEA+AGS L PIKNRP             +G   RVLDPRSKRVQ WN
Sbjct  66   QPEWEATAGSHLQPIKNRPAK---------KLAGAGHRVLDPRSKRVQYWN  107



>ref|XP_006431246.1| hypothetical protein CICLE_v10011184mg [Citrus clementina]
 gb|ESR44486.1| hypothetical protein CICLE_v10011184mg [Citrus clementina]
Length=713

 Score =   114 bits (286),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 65/125 (52%), Positives = 75/125 (60%), Gaps = 15/125 (12%)
 Frame = +1

Query  226  MPSYPGLHFSLSRWFGTILRRKSVQPDNSDDTYD----------ENPNFISTECYACTQV  375
            MPS+P   FSL RW   + R K V  D + +  +           N NF   ECYACTQV
Sbjct  1    MPSHPNFPFSLPRWIIELFRSKKVDGDQNGENNNDGNSDDNNPISNHNF---ECYACTQV  57

Query  376  GVPVFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPFGRVLDPRSKR  555
            GVPVFHSTSCD AHQPEWEASAGSSL+PI+ R   +  +  +    S  F  V DPRSKR
Sbjct  58   GVPVFHSTSCDQAHQPEWEASAGSSLVPIQARSKILGPKDGRP--ASATFAHVFDPRSKR  115

Query  556  VQRWN  570
            VQR N
Sbjct  116  VQRLN  120



>gb|ACA58352.1| putative cyclic nucleotide-gated cation channel [Sandersonia 
aurantiaca]
Length=712

 Score =   113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 67/103 (65%), Gaps = 7/103 (7%)
 Frame = +1

Query  271  GTILRR---KSVQPDNSDDTYDENPNFISTECYACTQVGVPVFHSTSCDNAHQPEWEASA  441
            G+IL R   +S   D  + T        + ECYACTQ GVP FHSTSCD AH PEWEA A
Sbjct  16   GSILSRDHQRSRSSDEDNSTAAAAAQSPTAECYACTQAGVPAFHSTSCDKAHAPEWEAGA  75

Query  442  GSSLIPIKNRPGSVTHRSTQDFHRSGPFGRVLDPRSKRVQRWN  570
            GSSLIPIKNR  S+ +R       +  FGRVLDPRSKRVQRWN
Sbjct  76   GSSLIPIKNRSSSIKNR----LRPTWVFGRVLDPRSKRVQRWN  114



>ref|NP_974783.2| cyclic nucleotide-gated ion channel 2 [Arabidopsis thaliana]
 gb|AED92157.1| cyclic nucleotide-gated ion channel 2 [Arabidopsis thaliana]
Length=725

 Score =   114 bits (284),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 61/82 (74%), Gaps = 3/82 (4%)
 Frame = +1

Query  328  ENPNFISTECYACTQVGVPVFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDF  507
            E P   S ECYACTQVGVP FHSTSCD AH PEW ASAGSSL+PI+   GSV + +   F
Sbjct  45   ETPVLSSVECYACTQVGVPAFHSTSCDQAHAPEWRASAGSSLVPIQE--GSVPNPARTRF  102

Query  508  HR-SGPFGRVLDPRSKRVQRWN  570
             R  GPFG VLDPRSKRVQRWN
Sbjct  103  RRLKGPFGEVLDPRSKRVQRWN  124



>ref|XP_010029345.1| PREDICTED: cyclic nucleotide-gated ion channel 2 [Eucalyptus 
grandis]
 gb|KCW56240.1| hypothetical protein EUGRSUZ_I01988 [Eucalyptus grandis]
Length=719

 Score =   113 bits (283),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 67/126 (53%), Positives = 71/126 (56%), Gaps = 11/126 (9%)
 Frame = +1

Query  226  MPSYPGLHFSLSRWFGTIL-------RRKSVQPDNSDDTYDENPNFISTECYACTQVGVP  384
            MP  P   F L RW G  L                   + DENP   S ECYACTQVGVP
Sbjct  1    MPPRPAFLFFLPRWIGRQLGLLPGPGSDGGGGGGGGGSSGDENPVSHSIECYACTQVGVP  60

Query  385  VFHSTSCDNAH-QPEWEASAGSSLIPIK---NRPGSVTHRSTQDFHRSGPFGRVLDPRSK  552
            VFHSTSCD AH QPEWEASAGSSL+PI+                  + GPFGRVLDPRSK
Sbjct  61   VFHSTSCDRAHEQPEWEASAGSSLVPIQARAGPGAGKGAGRRGGQQQRGPFGRVLDPRSK  120

Query  553  RVQRWN  570
            RVQRWN
Sbjct  121  RVQRWN  126



>gb|KCW56239.1| hypothetical protein EUGRSUZ_I01988 [Eucalyptus grandis]
Length=719

 Score =   113 bits (283),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 67/126 (53%), Positives = 71/126 (56%), Gaps = 11/126 (9%)
 Frame = +1

Query  226  MPSYPGLHFSLSRWFGTIL-------RRKSVQPDNSDDTYDENPNFISTECYACTQVGVP  384
            MP  P   F L RW G  L                   + DENP   S ECYACTQVGVP
Sbjct  1    MPPRPAFLFFLPRWIGRQLGLLPGPGSDGGGGGGGGGSSGDENPVSHSIECYACTQVGVP  60

Query  385  VFHSTSCDNAH-QPEWEASAGSSLIPIK---NRPGSVTHRSTQDFHRSGPFGRVLDPRSK  552
            VFHSTSCD AH QPEWEASAGSSL+PI+                  + GPFGRVLDPRSK
Sbjct  61   VFHSTSCDRAHEQPEWEASAGSSLVPIQARAGPGAGKGAGRRGGQQQRGPFGRVLDPRSK  120

Query  553  RVQRWN  570
            RVQRWN
Sbjct  121  RVQRWN  126



>ref|XP_011098700.1| PREDICTED: cyclic nucleotide-gated ion channel 2-like [Sesamum 
indicum]
Length=706

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 75/110 (68%), Gaps = 6/110 (5%)
 Frame = +1

Query  247  HFSLSRWFGTILRRKSVQPDNSDDTYDENPNFISTECYACTQVGVPVFHSTSCDNAHQPE  426
            HFS SR  G ILR++S +  +  +    N    + ECYACTQVGVPVFHSTSCD AHQP 
Sbjct  9    HFSFSRCCG-ILRQESSEDSSESED---NQVSAAGECYACTQVGVPVFHSTSCDKAHQPV  64

Query  427  WEASAGSSLIPIKNR-PGSVTHRSTQDFHRSGP-FGRVLDPRSKRVQRWN  570
            WEASAGSSL+PIK+R PG     +        P FGRVLDPRSKRVQRWN
Sbjct  65   WEASAGSSLLPIKHRSPGQKASSAQSSTSPEKPTFGRVLDPRSKRVQRWN  114



>ref|XP_010550023.1| PREDICTED: cyclic nucleotide-gated ion channel 2 [Tarenaya hassleriana]
Length=728

 Score =   110 bits (274),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 72/129 (56%), Gaps = 19/129 (15%)
 Frame = +1

Query  226  MPSYPGLHFSLSRWFGTI---LRRKSVQPDNSDDTYDE----------NPNFISTECYAC  366
            MPS P   F   RW G      RR++   D++                 P   S ECYAC
Sbjct  1    MPSQPNFLF---RWLGLFSRKFRRETTATDSNTGGEVGGGGDSGGGDETPVLNSVECYAC  57

Query  367  TQVGVPVFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHR-SGPFGRVLDP  543
            TQ GVP FHSTSCD AH PEW ASAGSSL+PI+  PGS        + R SGPFG VLDP
Sbjct  58   TQAGVPAFHSTSCDQAHAPEWRASAGSSLVPIQ--PGSEAEPVRIRYRRPSGPFGEVLDP  115

Query  544  RSKRVQRWN  570
            R+KR QRWN
Sbjct  116  RTKRAQRWN  124



>ref|XP_007032655.1| Cyclic nucleotide-regulated ion channel family protein isoform 
1 [Theobroma cacao]
 gb|EOY03581.1| Cyclic nucleotide-regulated ion channel family protein isoform 
1 [Theobroma cacao]
Length=704

 Score =   108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 74/117 (63%), Gaps = 7/117 (6%)
 Frame = +1

Query  226  MPSYPGLHFSLSRWFGTILRRKSVQPDNSDDTYDENPNFISTECYACTQVGVPVFHSTSC  405
            MPS P   F  +RWFG + R      D+   +  +     S ECYACTQVGVPVFHSTSC
Sbjct  1    MPSLP---FPRNRWFG-LARTWGFNNDSRSSSEQDGSVSNSIECYACTQVGVPVFHSTSC  56

Query  406  DNAHQPEWEASAGSSLIPIK--NRPGSVTHRSTQDFHRSGPFGRVLDPRSKRVQRWN  570
            D+ HQP+WEA AGSSL P++  + P   + R+   F  SGPFG+ LDPRS  VQRWN
Sbjct  57   DSVHQPQWEAFAGSSLFPVQAASDPTKNSTRTRSRFS-SGPFGKALDPRSALVQRWN  112



>emb|CDY26422.1| BnaC09g42460D [Brassica napus]
Length=719

 Score =   107 bits (267),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 65/126 (52%), Positives = 74/126 (59%), Gaps = 16/126 (13%)
 Frame = +1

Query  226  MPSYPGLHFSLSRWFGTI---LRRKSV-------QPDNSDDTYDENPNFISTECYACTQV  375
            MPS+    F   RW G     LRR++           +S  + D+ P   S ECYACTQV
Sbjct  1    MPSHTNFLF---RWIGLFSQKLRRETTGISENNGGESSSSSSSDDTPVLSSGECYACTQV  57

Query  376  GVPVFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHR-SGPFGRVLDPRSK  552
            GVP FHSTSCD A+ PEW ASAGSSL+PI+   GS          R  GPFG VLDPRSK
Sbjct  58   GVPAFHSTSCDQANTPEWRASAGSSLVPIQE--GSAPDPVRARLRRLKGPFGEVLDPRSK  115

Query  553  RVQRWN  570
            RVQRWN
Sbjct  116  RVQRWN  121



>ref|XP_003621352.1| Cyclic nucleotide-gated ion channel [Medicago truncatula]
 gb|AES77570.1| cyclic nucleotide-gated ion channel protein, putative [Medicago 
truncatula]
Length=710

 Score =   106 bits (265),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 56/92 (61%), Positives = 64/92 (70%), Gaps = 8/92 (9%)
 Frame = +1

Query  304  DNSDD-----TYDENPNFISTECYACTQVGVPVFHSTSC-DNAHQPEWEASAGSSLIPIK  465
            D+SDD       D+NP     ECYACTQVGVPVFHSTSC D+ HQPEWEASAGS L+PI+
Sbjct  29   DSSDDPGVAVIADDNPVISMVECYACTQVGVPVFHSTSCADSCHQPEWEASAGSYLVPIQ  88

Query  466  NRPGSVTHRSTQDFHRSGPFGRVLDPRSKRVQ  561
            NRPG      ++     G  G+VLDPRSKRVQ
Sbjct  89   NRPGKFARAVSKP--NWGVLGKVLDPRSKRVQ  118



>ref|XP_007032656.1| Cyclic nucleotide-regulated ion channel family protein isoform 
2 [Theobroma cacao]
 gb|EOY03582.1| Cyclic nucleotide-regulated ion channel family protein isoform 
2 [Theobroma cacao]
Length=630

 Score =   106 bits (264),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 72/117 (62%), Gaps = 9/117 (8%)
 Frame = +1

Query  226  MPSYPGLHFSLSRWFGTILRRKSVQPDNSDDTYDENPNFISTECYACTQVGVPVFHSTSC  405
            MPS P       RWFG + R      D+   +  +     S ECYACTQVGVPVFHSTSC
Sbjct  1    MPSLP-----FPRWFG-LARTWGFNNDSRSSSEQDGSVSNSIECYACTQVGVPVFHSTSC  54

Query  406  DNAHQPEWEASAGSSLIPIK--NRPGSVTHRSTQDFHRSGPFGRVLDPRSKRVQRWN  570
            D+ HQP+WEA AGSSL P++  + P   + R+   F  SGPFG+ LDPRS  VQRWN
Sbjct  55   DSVHQPQWEAFAGSSLFPVQAASDPTKNSTRTRSRFS-SGPFGKALDPRSALVQRWN  110



>gb|KHG15403.1| Cyclic nucleotide-gated ion channel 2 -like protein [Gossypium 
arboreum]
 gb|KHG15493.1| Cyclic nucleotide-gated ion channel 2 -like protein [Gossypium 
arboreum]
 gb|KHG21471.1| Cyclic nucleotide-gated ion channel 2 -like protein [Gossypium 
arboreum]
Length=381

 Score =   103 bits (258),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 57/75 (76%), Gaps = 1/75 (1%)
 Frame = +1

Query  346  STECYACTQVGVPVFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPF  525
            S ECYACTQVGVPVFHSTSCD+ HQP+WEA AGSSL P++     + + +   + R GPF
Sbjct  20   SIECYACTQVGVPVFHSTSCDSVHQPQWEAYAGSSLFPMEATSDPIKNLTRARYTR-GPF  78

Query  526  GRVLDPRSKRVQRWN  570
            G++LDPRS  VQRWN
Sbjct  79   GKILDPRSGLVQRWN  93



>ref|XP_002323883.2| hypothetical protein POPTR_0017s12570g [Populus trichocarpa]
 gb|EEF04016.2| hypothetical protein POPTR_0017s12570g [Populus trichocarpa]
Length=705

 Score =   106 bits (264),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 73/115 (63%), Gaps = 8/115 (7%)
 Frame = +1

Query  244  LHFSLSRWFGTILRRKSVQPDNSDD-----TYDENPNFISTECYACTQVGVPVFHSTSCD  408
            + FSLS WF     R SV+  N        +   N  F STECYACTQVGVPVFHSTSCD
Sbjct  1    MSFSLSSWFRQ--SRGSVKYCNESKHSGSGSSSNNAVFDSTECYACTQVGVPVFHSTSCD  58

Query  409  NAHQPEWEASAGSSLIPIKNRPGSVTH-RSTQDFHRSGPFGRVLDPRSKRVQRWN  570
            + HQPEW+A AGSSL+PI  +   ++     Q  +  GPFG +LDPRSK V++WN
Sbjct  59   SVHQPEWQALAGSSLVPIHAKSDPISKPARCQTPNTKGPFGSILDPRSKWVKKWN  113



>ref|XP_010936396.1| PREDICTED: cyclic nucleotide-gated ion channel 2 [Elaeis guineensis]
Length=730

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 66/109 (61%), Gaps = 10/109 (9%)
 Frame = +1

Query  259  SRWFGTILRRKSVQPDNSDDTYDENPNFIS--TECYACTQVGVPVFHSTSCDNAHQPEWE  432
            +RW+  + RR    P+  DD  +E     S   ECYACTQ G P FHSTSCD AH PEWE
Sbjct  33   ARWWTRLPRRWRFHPEVGDDDDEEVAGTSSPAGECYACTQAGAPAFHSTSCDRAHAPEWE  92

Query  433  ASAGSSLIPIKNRPGSVTHRSTQDFHRSGP---FGRVLDPRSKRVQRWN  570
            ASAGSSLIPI+N  G    RS       GP   FG VLDPRS  VQRWN
Sbjct  93   ASAGSSLIPIQNTAGGGERRSGW-----GPAWVFGAVLDPRSGGVQRWN  136



>ref|XP_008780460.1| PREDICTED: cyclic nucleotide-gated ion channel 2-like, partial 
[Phoenix dactylifera]
Length=186

 Score =   100 bits (249),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/104 (51%), Positives = 61/104 (59%), Gaps = 2/104 (2%)
 Frame = +1

Query  259  SRWFGTILRRKSVQPDNSDDTYDENPNFISTECYACTQVGVPVFHSTSCDNAHQPEWEAS  438
            +RW+    RR   +     D  +   +    ECYACTQ G P FHSTSCD AH PEWEAS
Sbjct  37   ARWWARFSRRWKFRLGGVGDDDEAAASSPKGECYACTQAGAPAFHSTSCDRAHAPEWEAS  96

Query  439  AGSSLIPIKNRPGSVTHRSTQDFHRSGPFGRVLDPRSKRVQRWN  570
            AGSSLIPI+N  G+    S     R+  FG VLDPRS  VQ WN
Sbjct  97   AGSSLIPIQNTAGAGERLSGGRPARA--FGAVLDPRSGSVQMWN  138



>ref|XP_009416822.1| PREDICTED: cyclic nucleotide-gated ion channel 2-like [Musa acuminata 
subsp. malaccensis]
Length=718

 Score =   105 bits (263),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 59/123 (48%), Positives = 73/123 (59%), Gaps = 10/123 (8%)
 Frame = +1

Query  226  MPSYPGLHFSLSRWFGTILRRKSVQPDNSDDTYDEN-----PNFISTECYACTQVGVPVF  390
            +P    L   LSR  G + RRK V   +++D   E      P+  + ECYACTQ G P F
Sbjct  3    LPVTKLLRSFLSRSAGLLWRRKEVVSSDTEDGDYEGGNRTPPSVAAAECYACTQPGAPAF  62

Query  391  HSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPF---GRVLDPRSKRVQ  561
            HST+CD AH PEWEASAGSSLIPI  RP       +    +SG     G+VLDPRS++V+
Sbjct  63   HSTTCDRAHSPEWEASAGSSLIPI--RPSQTNVLRSLRPGKSGASLLGGQVLDPRSEKVR  120

Query  562  RWN  570
            RWN
Sbjct  121  RWN  123



>gb|KFK25788.1| hypothetical protein AALP_AA8G160300 [Arabis alpina]
Length=726

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 61/87 (70%), Gaps = 3/87 (3%)
 Frame = +1

Query  313  DDTYDENPNFISTECYACTQVGVPVFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHR  492
            +D   + P   S ECYACTQVGVP FHSTSCD A+ PEW ASAGSSL+PI+   GS  + 
Sbjct  42   EDMPVDAPVLTSVECYACTQVGVPAFHSTSCDQANAPEWRASAGSSLVPIQE--GSDPNP  99

Query  493  STQDFHR-SGPFGRVLDPRSKRVQRWN  570
                F R  GPFG VLDPRSKRVQRWN
Sbjct  100  IRTRFRRLKGPFGDVLDPRSKRVQRWN  126



>ref|XP_009121575.1| PREDICTED: cyclic nucleotide-gated ion channel 2 [Brassica rapa]
Length=719

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 65/125 (52%), Positives = 76/125 (61%), Gaps = 16/125 (13%)
 Frame = +1

Query  226  MPSYPGLHFSLSRWFGTI---LRRKSVQ-----PDNSDDTYDENPNFISTECYACTQVGV  381
            MPS+    F   RW G     LRR++ +        S  + D+ P   S ECYACTQVGV
Sbjct  1    MPSHTNFLF---RWIGLFSQKLRRETTEISENNGGESSSSSDDTPVLSSGECYACTQVGV  57

Query  382  PVFHSTSCDNAHQPEWEASAGSSLIPIK--NRPGSVTHRSTQDFHRSGPFGRVLDPRSKR  555
            P FHSTSCD A+ PEW ASAGSSL+PI+  + P  V  R  +     GPFG VLDPRSKR
Sbjct  58   PAFHSTSCDQANAPEWRASAGSSLVPIQEGSAPSPVRARIRR---LKGPFGEVLDPRSKR  114

Query  556  VQRWN  570
            VQRWN
Sbjct  115  VQRWN  119



>gb|KJB75662.1| hypothetical protein B456_012G050600 [Gossypium raimondii]
Length=513

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 64/94 (68%), Gaps = 10/94 (11%)
 Frame = +1

Query  304  DNSDDTYDENPNFISTECYACTQVGVPVFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSV  483
            D ++D    NP     ECYACTQVG+PVFHSTSCD AH PEWEA AGSSL+PI  R   +
Sbjct  31   DINEDNLIPNP----IECYACTQVGLPVFHSTSCDQAHPPEWEAYAGSSLVPIHAR-ACL  85

Query  484  THRSTQDFHR--SGPFG---RVLDPRSKRVQRWN  570
               STQ   R  SGPFG    VLDPRSKRVQ+WN
Sbjct  86   QKNSTQAATRQPSGPFGGRRGVLDPRSKRVQKWN  119



>ref|XP_011035831.1| PREDICTED: cyclic nucleotide-gated ion channel 2-like [Populus 
euphratica]
Length=704

 Score =   104 bits (259),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 70/111 (63%), Gaps = 7/111 (6%)
 Frame = +1

Query  253  SLSRWFGTILRRKSVQPDNSDD----TYDENPNFISTECYACTQVGVPVFHSTSCDNAHQ  420
            SLS WF     R SV+  N       +   N    STECYACTQVGVPVFHSTSCD+AHQ
Sbjct  4    SLSGWFRQ--SRGSVKYCNESKHSSSSSSNNAVLDSTECYACTQVGVPVFHSTSCDSAHQ  61

Query  421  PEWEASAGSSLIPIKNRPGSVTH-RSTQDFHRSGPFGRVLDPRSKRVQRWN  570
            PEW+A AGSSL+PI  +   ++     Q     GPFG +LDPRSK V++WN
Sbjct  62   PEWQALAGSSLVPIHAKSDPISKPARCQTPTTKGPFGSILDPRSKWVKKWN  112



>emb|CDX69525.1| BnaA10g18740D [Brassica napus]
Length=719

 Score =   104 bits (259),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 65/125 (52%), Positives = 75/125 (60%), Gaps = 16/125 (13%)
 Frame = +1

Query  226  MPSYPGLHFSLSRWFGTI---LRRKSV-----QPDNSDDTYDENPNFISTECYACTQVGV  381
            MPS+    F   RW G     LRR++          S  + D+ P   S ECYACTQVGV
Sbjct  1    MPSHTNFLF---RWIGLFSQKLRRETTGISENNGGESSSSSDDTPVLSSGECYACTQVGV  57

Query  382  PVFHSTSCDNAHQPEWEASAGSSLIPIK--NRPGSVTHRSTQDFHRSGPFGRVLDPRSKR  555
            P FHSTSCD A+ PEW ASAGSSL+PI+  + P  V  R  +     GPFG VLDPRSKR
Sbjct  58   PAFHSTSCDQANAPEWRASAGSSLVPIQEGSAPSPVRARIRR---LKGPFGEVLDPRSKR  114

Query  556  VQRWN  570
            VQRWN
Sbjct  115  VQRWN  119



>gb|KJB75661.1| hypothetical protein B456_012G050600 [Gossypium raimondii]
Length=695

 Score =   103 bits (256),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 64/94 (68%), Gaps = 10/94 (11%)
 Frame = +1

Query  304  DNSDDTYDENPNFISTECYACTQVGVPVFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSV  483
            D ++D    NP     ECYACTQVG+PVFHSTSCD AH PEWEA AGSSL+PI  R   +
Sbjct  31   DINEDNLIPNP----IECYACTQVGLPVFHSTSCDQAHPPEWEAYAGSSLVPIHAR-ACL  85

Query  484  THRSTQDFHR--SGPFG---RVLDPRSKRVQRWN  570
               STQ   R  SGPFG    VLDPRSKRVQ+WN
Sbjct  86   QKNSTQAATRQPSGPFGGRRGVLDPRSKRVQKWN  119



>gb|KJB33474.1| hypothetical protein B456_006G012500 [Gossypium raimondii]
Length=542

 Score =   102 bits (255),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 65/92 (71%), Gaps = 1/92 (1%)
 Frame = +1

Query  295  VQPDNSDDTYDENPNFISTECYACTQVGVPVFHSTSCDNAHQPEWEASAGSSLIPIKNRP  474
            ++ D+   +  + P   S ECYACTQVGVPVFHSTSCD+ HQP+WEA AGSSL P++   
Sbjct  3    LKKDSRSSSERDGPVSSSIECYACTQVGVPVFHSTSCDSVHQPQWEAYAGSSLFPMEATS  62

Query  475  GSVTHRSTQDFHRSGPFGRVLDPRSKRVQRWN  570
              + +  T+  + +GPFG++LDPRS  V+RWN
Sbjct  63   DPIKNL-TRARYTTGPFGKILDPRSGLVRRWN  93



>gb|KJB33473.1| hypothetical protein B456_006G012500 [Gossypium raimondii]
Length=688

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 65/92 (71%), Gaps = 1/92 (1%)
 Frame = +1

Query  295  VQPDNSDDTYDENPNFISTECYACTQVGVPVFHSTSCDNAHQPEWEASAGSSLIPIKNRP  474
            ++ D+   +  + P   S ECYACTQVGVPVFHSTSCD+ HQP+WEA AGSSL P++   
Sbjct  3    LKKDSRSSSERDGPVSSSIECYACTQVGVPVFHSTSCDSVHQPQWEAYAGSSLFPMEATS  62

Query  475  GSVTHRSTQDFHRSGPFGRVLDPRSKRVQRWN  570
              + +  T+  + +GPFG++LDPRS  V+RWN
Sbjct  63   DPIKN-LTRARYTTGPFGKILDPRSGLVRRWN  93



>gb|KHG01341.1| Cyclic nucleotide-gated ion channel 2 -like protein [Gossypium 
arboreum]
Length=695

 Score =   100 bits (250),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 63/94 (67%), Gaps = 10/94 (11%)
 Frame = +1

Query  304  DNSDDTYDENPNFISTECYACTQVGVPVFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSV  483
            D ++D    NP     ECYACTQVG+PVFHSTSCD AH PEWEA AGSSL+PI  R   +
Sbjct  31   DINEDNLIPNP----IECYACTQVGLPVFHSTSCDQAHPPEWEAYAGSSLVPIHAR-ACL  85

Query  484  THRSTQDFHR--SGPFG---RVLDPRSKRVQRWN  570
               ST    R  SGPFG    VLDPRSKRVQ+WN
Sbjct  86   EKNSTLAATRQPSGPFGGRRGVLDPRSKRVQKWN  119



>emb|CDP02280.1| unnamed protein product [Coffea canephora]
Length=717

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 56/106 (53%), Positives = 65/106 (61%), Gaps = 9/106 (8%)
 Frame = +1

Query  256  LSRWFGTILRRKSVQPDNSDDTYDENPNFISTECYACTQVGVPVFHSTSCDNAHQPEWEA  435
            L  W     +R  + P +SD   D++       CYACTQVGVPVFHST+CD  HQPEWEA
Sbjct  10   LCLWIAKQFQR--LNPCSSDLEADDS--IYPYACYACTQVGVPVFHSTTCDPDHQPEWEA  65

Query  436  SAGSSLIPIKNRPGSVTHRSTQDFHRSGPF-GRVLDPRSKRVQRWN  570
            SAGSSL+PI  R      R+  +    G   GRVLDPRS RVQRWN
Sbjct  66   SAGSSLLPINCRKS----RTGDNPSPPGLLPGRVLDPRSARVQRWN  107



>ref|XP_008785948.1| PREDICTED: cyclic nucleotide-gated ion channel 2-like isoform 
X2 [Phoenix dactylifera]
Length=644

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 70/126 (56%), Gaps = 16/126 (13%)
 Frame = +1

Query  226  MPSYPGLHFSLSRWFGTILRRK------SVQPDNSDDTYDENPNF-ISTECYACTQVGVP  384
            M  +   H  LSRW G    RK           + +     NP    + ECYACTQ GVP
Sbjct  1    MSLFSEFHSFLSRWVGAFRHRKIRSDDDDDTDSSKESGGGSNPIPPAAVECYACTQPGVP  60

Query  385  VFHSTSCDNAHQPEWEASAGSSLIPIKN----RPGSVTHRSTQDFHRSGPFGRVLDPRSK  552
             FHSTSCD AH PEWEASAGSSLIPI++    RP  +  R       S  FG VLDPRSK
Sbjct  61   AFHSTSCDRAHTPEWEASAGSSLIPIRSQPAPRPAGLQRRPN-----SWIFGSVLDPRSK  115

Query  553  RVQRWN  570
            +V+RWN
Sbjct  116  QVRRWN  121



>ref|XP_008785947.1| PREDICTED: cyclic nucleotide-gated ion channel 2-like isoform 
X1 [Phoenix dactylifera]
Length=716

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 70/126 (56%), Gaps = 16/126 (13%)
 Frame = +1

Query  226  MPSYPGLHFSLSRWFGTILRRK------SVQPDNSDDTYDENPNF-ISTECYACTQVGVP  384
            M  +   H  LSRW G    RK           + +     NP    + ECYACTQ GVP
Sbjct  1    MSLFSEFHSFLSRWVGAFRHRKIRSDDDDDTDSSKESGGGSNPIPPAAVECYACTQPGVP  60

Query  385  VFHSTSCDNAHQPEWEASAGSSLIPIKN----RPGSVTHRSTQDFHRSGPFGRVLDPRSK  552
             FHSTSCD AH PEWEASAGSSLIPI++    RP  +  R       S  FG VLDPRSK
Sbjct  61   AFHSTSCDRAHTPEWEASAGSSLIPIRSQPAPRPAGLQRRPN-----SWIFGSVLDPRSK  115

Query  553  RVQRWN  570
            +V+RWN
Sbjct  116  QVRRWN  121



>ref|XP_010089586.1| hypothetical protein L484_020976 [Morus notabilis]
 gb|EXB38057.1| hypothetical protein L484_020976 [Morus notabilis]
Length=717

 Score = 98.2 bits (243),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 62/139 (45%), Positives = 74/139 (53%), Gaps = 27/139 (19%)
 Frame = +1

Query  226  MPSYPG-LHFSLSRWFGTIL------------------RRKSVQPDNSDDTYDENPNFIS  348
            MPS+   L  SLSRW GT+                   +  +   D+       +P   +
Sbjct  1    MPSHSNPLLSSLSRWIGTLCSHNFKNDYSSSSSSNNNNKNIAAAADHDISATVSSP---A  57

Query  349  TECYACTQVGVPVFHSTSCDNA-HQPEWEASAGSSLIPIKNR----PGSVTHRSTQDFHR  513
             ECYACTQVGVP FHSTSCD A HQP+WEA AG+SLIPI +R             Q    
Sbjct  58   GECYACTQVGVPAFHSTSCDRAGHQPQWEACAGTSLIPISSRTDLKKDLFVAAKKQQRPP  117

Query  514  SGPFGRVLDPRSKRVQRWN  570
            +G FGRV+DPRSKRV RWN
Sbjct  118  AGAFGRVIDPRSKRVHRWN  136



>ref|XP_010551827.1| PREDICTED: cyclic nucleotide-gated ion channel 2-like isoform 
X2 [Tarenaya hassleriana]
Length=650

 Score = 97.8 bits (242),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 56/115 (49%), Positives = 69/115 (60%), Gaps = 5/115 (4%)
 Frame = +1

Query  226  MPSYPGLHFSLSRWFGTILRRKSVQPDNSDDTYDENPNFISTECYACTQVGVPVFHSTSC  405
            M S P + F   R F    R ++  P  S +T    P   S ECYACT+ GVP FHSTSC
Sbjct  1    MTSQPSVFFRWFRVFARKFRWETTAPVKSPET----PVLSSVECYACTRPGVPAFHSTSC  56

Query  406  DNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPFGRVLDPRSKRVQRWN  570
            D+    EW ASAGSSL+PI++ P     R+ Q     GPFG VLDPR+KRV++WN
Sbjct  57   DHPQALEWRASAGSSLVPIQHGPDPKPVRA-QKKRPLGPFGVVLDPRTKRVRKWN  110



>ref|XP_010551825.1| PREDICTED: cyclic nucleotide-gated ion channel 2-like isoform 
X1 [Tarenaya hassleriana]
Length=677

 Score = 97.8 bits (242),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 56/115 (49%), Positives = 69/115 (60%), Gaps = 5/115 (4%)
 Frame = +1

Query  226  MPSYPGLHFSLSRWFGTILRRKSVQPDNSDDTYDENPNFISTECYACTQVGVPVFHSTSC  405
            M S P + F   R F    R ++  P  S +T    P   S ECYACT+ GVP FHSTSC
Sbjct  1    MTSQPSVFFRWFRVFARKFRWETTAPVKSPET----PVLSSVECYACTRPGVPAFHSTSC  56

Query  406  DNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPFGRVLDPRSKRVQRWN  570
            D+    EW ASAGSSL+PI++ P     R+ Q     GPFG VLDPR+KRV++WN
Sbjct  57   DHPQALEWRASAGSSLVPIQHGPDPKPVRA-QKKRPLGPFGVVLDPRTKRVRKWN  110



>ref|XP_008777824.1| PREDICTED: cyclic nucleotide-gated ion channel 2-like [Phoenix 
dactylifera]
Length=718

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 54/75 (72%), Gaps = 0/75 (0%)
 Frame = +1

Query  346  STECYACTQVGVPVFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPF  525
            + ECYACTQ GVP FHSTSCD AH PEWEASAGSSLIPI+    +    + +    S  F
Sbjct  49   AVECYACTQPGVPAFHSTSCDRAHTPEWEASAGSSLIPIQAAQPAARPAAHRRRPNSWIF  108

Query  526  GRVLDPRSKRVQRWN  570
            G VLDPRS+RV+RWN
Sbjct  109  GSVLDPRSQRVRRWN  123



>gb|KGN52496.1| hypothetical protein Csa_5G638350 [Cucumis sativus]
Length=688

 Score = 95.1 bits (235),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 55/74 (74%), Gaps = 5/74 (7%)
 Frame = +1

Query  352  ECYACTQVGVPVFHSTSCDNAH-QPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPFG  528
            ECYACTQVGVP FHSTSCD+AH QPEWEASAGSSL+PI+    S   R +     +G FG
Sbjct  29   ECYACTQVGVPAFHSTSCDHAHQQPEWEASAGSSLVPIQPTKSSPAPRHSS----AGCFG  84

Query  529  RVLDPRSKRVQRWN  570
             VLDPR K VQRWN
Sbjct  85   TVLDPRKKPVQRWN  98



>ref|XP_004141458.1| PREDICTED: cyclic nucleotide-gated ion channel 2-like [Cucumis 
sativus]
Length=684

 Score = 95.1 bits (235),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 55/74 (74%), Gaps = 5/74 (7%)
 Frame = +1

Query  352  ECYACTQVGVPVFHSTSCDNAH-QPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPFG  528
            ECYACTQVGVP FHSTSCD+AH QPEWEASAGSSL+PI+    S   R +     +G FG
Sbjct  25   ECYACTQVGVPAFHSTSCDHAHQQPEWEASAGSSLVPIQPTKSSPAPRHSS----AGCFG  80

Query  529  RVLDPRSKRVQRWN  570
             VLDPR K VQRWN
Sbjct  81   TVLDPRKKPVQRWN  94



>ref|XP_010229614.1| PREDICTED: cyclic nucleotide-gated ion channel 2 isoform X1 [Brachypodium 
distachyon]
Length=732

 Score = 95.1 bits (235),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 41/73 (56%), Positives = 50/73 (68%), Gaps = 0/73 (0%)
 Frame = +1

Query  352  ECYACTQVGVPVFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPFGR  531
            ECYACTQ GVP FHST+CD  H P+W+A AGSSL+P++++       +         FG 
Sbjct  63   ECYACTQPGVPAFHSTTCDQVHSPDWDADAGSSLVPVQSQQAHPAAGAGAVAAARWLFGP  122

Query  532  VLDPRSKRVQRWN  570
            VLDPRSKRVQRWN
Sbjct  123  VLDPRSKRVQRWN  135



>ref|XP_010229618.1| PREDICTED: cyclic nucleotide-gated ion channel 2 isoform X2 [Brachypodium 
distachyon]
Length=731

 Score = 95.1 bits (235),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 41/73 (56%), Positives = 50/73 (68%), Gaps = 0/73 (0%)
 Frame = +1

Query  352  ECYACTQVGVPVFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPFGR  531
            ECYACTQ GVP FHST+CD  H P+W+A AGSSL+P++++       +         FG 
Sbjct  62   ECYACTQPGVPAFHSTTCDQVHSPDWDADAGSSLVPVQSQQAHPAAGAGAVAAARWLFGP  121

Query  532  VLDPRSKRVQRWN  570
            VLDPRSKRVQRWN
Sbjct  122  VLDPRSKRVQRWN  134



>ref|XP_008459361.1| PREDICTED: cyclic nucleotide-gated ion channel 2 [Cucumis melo]
Length=688

 Score = 94.4 bits (233),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 50/75 (67%), Positives = 55/75 (73%), Gaps = 5/75 (7%)
 Frame = +1

Query  349  TECYACTQVGVPVFHSTSCDNAH-QPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPF  525
             ECYACTQVGVP FHSTSCD+AH QPEWEASAGSSL+PI+    S   R +     +G F
Sbjct  28   VECYACTQVGVPAFHSTSCDHAHQQPEWEASAGSSLVPIQPTKSSPPPRHSS----AGCF  83

Query  526  GRVLDPRSKRVQRWN  570
            G VLDPR K VQRWN
Sbjct  84   GTVLDPRKKPVQRWN  98



>ref|XP_009419077.1| PREDICTED: cyclic nucleotide-gated ion channel 2-like [Musa acuminata 
subsp. malaccensis]
Length=717

 Score = 94.4 bits (233),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 53/81 (65%), Gaps = 4/81 (5%)
 Frame = +1

Query  334  PNFISTECYACTQVGVPVFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHR  513
            P+  + ECYACTQ GVP FHST+CD  H PEWEASAGSSLIPI  RP            +
Sbjct  44   PSMATAECYACTQRGVPAFHSTTCDRVHSPEWEASAGSSLIPI--RPSQTNVLQNLRLSK  101

Query  514  SGPFGR--VLDPRSKRVQRWN  570
            S    R  VLDPRS++VQRWN
Sbjct  102  SASLLRGPVLDPRSEKVQRWN  122



>ref|XP_010904936.1| PREDICTED: cyclic nucleotide-gated ion channel 2-like [Elaeis 
guineensis]
Length=774

 Score = 94.4 bits (233),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 65/114 (57%), Gaps = 11/114 (10%)
 Frame = +1

Query  262  RWFGTILRRKSVQPDNSDD---TYDENPNFIST---ECYACTQVGVPVFHSTSCDNAHQP  423
            RW+  +LRR   +    DD     D      S+   +CYACTQ G P FHSTSCD AH P
Sbjct  52   RWWTRLLRRWKFRLGGDDDEPAVGDGGTTAASSTAGDCYACTQAGAPAFHSTSCDRAHPP  111

Query  424  EWEASAGSSLIPIKN--RPGSVTHRSTQDFHRSGP---FGRVLDPRSKRVQRWN  570
            EWEASAGSSLIPI+N  R  S      +   R  P   FG VLDPRS  VQ+WN
Sbjct  112  EWEASAGSSLIPIQNTARSSSAAGAGERRKARWRPAWVFGAVLDPRSGGVQQWN  165



>gb|EEC76211.1| hypothetical protein OsI_13606 [Oryza sativa Indica Group]
 gb|EEE59963.1| hypothetical protein OsJ_12656 [Oryza sativa Japonica Group]
Length=726

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 43/73 (59%), Positives = 52/73 (71%), Gaps = 2/73 (3%)
 Frame = +1

Query  352  ECYACTQVGVPVFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPFGR  531
            ECYACTQ GVP FHST+CD  H P+W+A AGSSL+P++ +P +  H +         FG 
Sbjct  59   ECYACTQPGVPSFHSTTCDQVHSPDWDADAGSSLVPVQAQPSAAHHAAAAAARWV--FGP  116

Query  532  VLDPRSKRVQRWN  570
            VLDPRSKRVQRWN
Sbjct  117  VLDPRSKRVQRWN  129



>ref|XP_010674211.1| PREDICTED: cyclic nucleotide-gated ion channel 2 [Beta vulgaris 
subsp. vulgaris]
Length=715

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 56/80 (70%), Gaps = 7/80 (9%)
 Frame = +1

Query  349  TECYACTQVGVPVFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHR-----  513
             ECYACTQVGVPVFHSTSCD A QPEWEASAGSSL P + R  ++  RS Q         
Sbjct  48   IECYACTQVGVPVFHSTSCDRADQPEWEASAGSSLYPTRTRS-NLRSRSKQARGSRLRKW  106

Query  514  -SGPFGRVLDPRSKRVQRWN  570
             SG FG +LDPRS+RV+ WN
Sbjct  107  PSGLFGPILDPRSERVRWWN  126



>ref|XP_008680983.1| PREDICTED: uncharacterized protein LOC100191751 isoform X1 [Zea 
mays]
Length=725

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 42/75 (56%), Positives = 51/75 (68%), Gaps = 0/75 (0%)
 Frame = +1

Query  346  STECYACTQVGVPVFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPF  525
            S ECYACTQ GVP FHST+CD  H P+W+A AGSSL+P++ +  +    +         F
Sbjct  51   SGECYACTQPGVPAFHSTACDQVHSPDWDADAGSSLVPVQAQQQAQPAAAAAQHAARWLF  110

Query  526  GRVLDPRSKRVQRWN  570
            G VLDPRSKRVQRWN
Sbjct  111  GPVLDPRSKRVQRWN  125



>gb|AFW67569.1| hypothetical protein ZEAMMB73_354655 [Zea mays]
Length=745

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 42/75 (56%), Positives = 51/75 (68%), Gaps = 0/75 (0%)
 Frame = +1

Query  346  STECYACTQVGVPVFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPF  525
            S ECYACTQ GVP FHST+CD  H P+W+A AGSSL+P++ +  +    +         F
Sbjct  71   SGECYACTQPGVPAFHSTACDQVHSPDWDADAGSSLVPVQAQQQAQPAAAAAQHAARWLF  130

Query  526  GRVLDPRSKRVQRWN  570
            G VLDPRSKRVQRWN
Sbjct  131  GPVLDPRSKRVQRWN  145



>dbj|BAJ99130.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=721

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 42/73 (58%), Positives = 50/73 (68%), Gaps = 2/73 (3%)
 Frame = +1

Query  352  ECYACTQVGVPVFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPFGR  531
            ECYACTQ GVP FHST+CD  H P W+A AGSSL+P++ +P  +   +         FG 
Sbjct  51   ECYACTQPGVPAFHSTTCDQVHSPGWDADAGSSLVPVRAQP--LPGAAAAVAAARWLFGP  108

Query  532  VLDPRSKRVQRWN  570
            VLDPRSKRVQRWN
Sbjct  109  VLDPRSKRVQRWN  121



>ref|XP_011085718.1| PREDICTED: cyclic nucleotide-gated ion channel 2-like isoform 
X3 [Sesamum indicum]
Length=584

 Score = 91.3 bits (225),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 68/106 (64%), Gaps = 18/106 (17%)
 Frame = +1

Query  253  SLSRWFGTILRRKSVQPDNSDDTYDENPNFISTECYACTQVGVPVFHSTSCDNAHQPEWE  432
            ++S+  G + R       +SDD + E P    T+CYACTQVGVPVFHST+CD  H+PEWE
Sbjct  10   AMSKLIGKLFR-------SSDDDFTEYP----TDCYACTQVGVPVFHSTTCDPVHKPEWE  58

Query  433  ASAGSSLIPIKNRPGSVTHRSTQDFHRSGPFGRVLDPRSKRVQRWN  570
            ASAGSSL+PI       T RS+++   +     ++DPRS  VQRWN
Sbjct  59   ASAGSSLVPI-------TSRSSRNSSAAKNRRLIVDPRSTNVQRWN  97



>ref|XP_002466423.1| hypothetical protein SORBIDRAFT_01g007550 [Sorghum bicolor]
 gb|EER93421.1| hypothetical protein SORBIDRAFT_01g007550 [Sorghum bicolor]
Length=729

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 45/78 (58%), Positives = 53/78 (68%), Gaps = 4/78 (5%)
 Frame = +1

Query  346  STECYACTQVGVPVFHSTSCDNAHQPEWEASAGSSLIPIKN---RPGSVTHRSTQDFHRS  516
            S ECYACTQ GVP FHST+CD  H P+W+A AGSSL+P++    +P S   +      R 
Sbjct  52   SGECYACTQPGVPAFHSTTCDQVHLPDWDADAGSSLVPVQAQQVQPASSAAQHAGAAAR-  110

Query  517  GPFGRVLDPRSKRVQRWN  570
              FG VLDPRSKRVQRWN
Sbjct  111  WLFGPVLDPRSKRVQRWN  128



>ref|XP_011085714.1| PREDICTED: cyclic nucleotide-gated ion channel 2-like isoform 
X1 [Sesamum indicum]
Length=688

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 68/106 (64%), Gaps = 18/106 (17%)
 Frame = +1

Query  253  SLSRWFGTILRRKSVQPDNSDDTYDENPNFISTECYACTQVGVPVFHSTSCDNAHQPEWE  432
            ++S+  G + R       +SDD + E P    T+CYACTQVGVPVFHST+CD  H+PEWE
Sbjct  10   AMSKLIGKLFR-------SSDDDFTEYP----TDCYACTQVGVPVFHSTTCDPVHKPEWE  58

Query  433  ASAGSSLIPIKNRPGSVTHRSTQDFHRSGPFGRVLDPRSKRVQRWN  570
            ASAGSSL+PI       T RS+++   +     ++DPRS  VQRWN
Sbjct  59   ASAGSSLVPI-------TSRSSRNSSAAKNRRLIVDPRSTNVQRWN  97



>ref|XP_008792776.1| PREDICTED: cyclic nucleotide-gated ion channel 2 [Phoenix dactylifera]
Length=757

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 62/107 (58%), Gaps = 12/107 (11%)
 Frame = +1

Query  265  WFGTILRRKSVQPDNSDDTYDENPNFISTECYACTQVGVPVFHSTSCDNAHQPEWEASAG  444
            W+  +LRR   +     D  DE     + +CYACTQ G P FHSTSCD AH  EWEA AG
Sbjct  50   WWTRLLRRWKFRLGGDAD--DERA---AGDCYACTQAGAPAFHSTSCDGAHALEWEAGAG  104

Query  445  SSLIPIKNRPGSVTHRSTQDFHRSG-----PFGRVLDPRSKRVQRWN  570
            SSL+PI+N   +    + +   R+G      FG VLDPRS  VQRWN
Sbjct  105  SSLMPIQNTARASASGAGE--RRTGRRPALVFGAVLDPRSGGVQRWN  149



>ref|XP_011085717.1| PREDICTED: cyclic nucleotide-gated ion channel 2-like isoform 
X2 [Sesamum indicum]
Length=686

 Score = 89.4 bits (220),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 49/88 (56%), Positives = 61/88 (69%), Gaps = 11/88 (13%)
 Frame = +1

Query  307  NSDDTYDENPNFISTECYACTQVGVPVFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVT  486
            +SDD + E P    T+CYACTQVGVPVFHST+CD  H+PEWEASAGSSL+PI       T
Sbjct  19   SSDDDFTEYP----TDCYACTQVGVPVFHSTTCDPVHKPEWEASAGSSLVPI-------T  67

Query  487  HRSTQDFHRSGPFGRVLDPRSKRVQRWN  570
             RS+++   +     ++DPRS  VQRWN
Sbjct  68   SRSSRNSSAAKNRRLIVDPRSTNVQRWN  95



>dbj|BAM44882.1| cyclic nucleotide gated channel 2 [Phragmites australis]
Length=701

 Score = 89.0 bits (219),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 43/78 (55%), Positives = 50/78 (64%), Gaps = 5/78 (6%)
 Frame = +1

Query  352  ECYACTQVGVPVFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGP---  522
            ECYACTQ GVP FHST+CD  H P+W+A AGSSL+P++              H +G    
Sbjct  52   ECYACTQPGVPAFHSTTCDQVHSPDWDADAGSSLVPVQAHQAQSASALAAAHHHAGAAAR  111

Query  523  --FGRVLDPRSKRVQRWN  570
              FG VLDPRSKRVQRWN
Sbjct  112  WLFGPVLDPRSKRVQRWN  129



>dbj|BAM44883.1| cyclic nucleotide gated channel 2 [Phragmites australis]
Length=726

 Score = 89.0 bits (219),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 43/78 (55%), Positives = 50/78 (64%), Gaps = 5/78 (6%)
 Frame = +1

Query  352  ECYACTQVGVPVFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGP---  522
            ECYACTQ GVP FHST+CD  H P+W+A AGSSL+P++              H +G    
Sbjct  52   ECYACTQPGVPAFHSTTCDQVHSPDWDADAGSSLVPVQAHQAQSASALAAAHHHAGAAAR  111

Query  523  --FGRVLDPRSKRVQRWN  570
              FG VLDPRSKRVQRWN
Sbjct  112  WLFGPVLDPRSKRVQRWN  129



>dbj|BAM44881.1| cyclic nucleotide gated channel 2 [Phragmites australis]
Length=726

 Score = 89.0 bits (219),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 43/78 (55%), Positives = 50/78 (64%), Gaps = 5/78 (6%)
 Frame = +1

Query  352  ECYACTQVGVPVFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGP---  522
            ECYACTQ GVP FHST+CD  H P+W+A AGSSL+P++              H +G    
Sbjct  52   ECYACTQPGVPAFHSTTCDQVHSPDWDADAGSSLVPVQAHQAQSASALAAAHHHAGAAAR  111

Query  523  --FGRVLDPRSKRVQRWN  570
              FG VLDPRSKRVQRWN
Sbjct  112  WLFGPVLDPRSKRVQRWN  129



>gb|AAK16188.1|AC079887_20 putative cyclic nucleotide and calmodulin-regulated ion channel 
protein [Oryza sativa Japonica Group]
 gb|ABF98977.1| Cyclic nucleotide-gated ion channel 2, putative, expressed [Oryza 
sativa Japonica Group]
Length=782

 Score = 88.6 bits (218),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 52/73 (71%), Gaps = 2/73 (3%)
 Frame = +1

Query  352  ECYACTQVGVPVFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPFGR  531
            ECYACTQ GVP FHST+CD  H P+W+A AGSSL+P++ +P +  H +         FG 
Sbjct  59   ECYACTQPGVPSFHSTTCDQVHSPDWDADAGSSLVPVQAQPSAAHHAAAAAAR--WVFGP  116

Query  532  VLDPRSKRVQRWN  570
            VLDPRSKRVQRWN
Sbjct  117  VLDPRSKRVQRWN  129



>ref|XP_004981703.1| PREDICTED: cyclic nucleotide-gated ion channel 2-like [Setaria 
italica]
Length=728

 Score = 88.6 bits (218),  Expect = 9e-17, Method: Composition-based stats.
 Identities = 42/80 (53%), Positives = 53/80 (66%), Gaps = 4/80 (5%)
 Frame = +1

Query  343  ISTECYACTQVGVPVFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGP  522
            ++ ECYACTQ GVP FHST+CD  H P W+A AGSSL+P++ +    +  ++   H    
Sbjct  50   LAGECYACTQPGVPAFHSTTCDQVHSPGWDADAGSSLVPVRAQQAQASPSASAAQHAGAA  109

Query  523  ----FGRVLDPRSKRVQRWN  570
                FG VLDPRSKRVQRWN
Sbjct  110  ARWLFGPVLDPRSKRVQRWN  129



>ref|XP_010109131.1| hypothetical protein L484_017070 [Morus notabilis]
 gb|EXC21060.1| hypothetical protein L484_017070 [Morus notabilis]
Length=221

 Score = 84.3 bits (207),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 68/108 (63%), Gaps = 9/108 (8%)
 Frame = +1

Query  253  SLSRWFGTILRRKSVQPDNSDDTYDENPNFISTECYACTQVGVPVFHSTSCDNAHQPEWE  432
            +L RW   + +  +     +D+  +E P F  +ECYACT VGVPVFHS+ CD++ +P WE
Sbjct  3    TLPRWNELLFKNTTTIRGRNDE--NEAPIF-DSECYACTHVGVPVFHSSRCDSSTEPNWE  59

Query  433  ASAGSSLIPIKNRPGSVTHRSTQDFHR--SGPFGRVLDPRSKRVQRWN  570
            ASAGSSL P +    ++T R+ +   R  S   G V+DPR+K V+RWN
Sbjct  60   ASAGSSLRPFR----ALTSRAHRAILRTQSSLAGGVVDPRTKGVKRWN  103



>ref|XP_008666400.1| PREDICTED: uncharacterized protein LOC100272382 isoform X2 [Zea 
mays]
 tpg|DAA51484.1| TPA: hypothetical protein ZEAMMB73_065991 [Zea mays]
Length=705

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 39/75 (52%), Positives = 51/75 (68%), Gaps = 2/75 (3%)
 Frame = +1

Query  352  ECYACTQVGVPVFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPF--  525
            ECYACTQ GVP FHST+CD  H P+W+A AGSSL+P++ +  +    +      +  +  
Sbjct  59   ECYACTQPGVPAFHSTTCDQVHSPDWDADAGSSLVPVQGQAQAAAAAAAPRQRHAARWLL  118

Query  526  GRVLDPRSKRVQRWN  570
            G VLDPRS+RVQRWN
Sbjct  119  GPVLDPRSRRVQRWN  133



>ref|XP_008666390.1| PREDICTED: uncharacterized protein LOC100272382 isoform X1 [Zea 
mays]
 tpg|DAA51485.1| TPA: hypothetical protein ZEAMMB73_065991 [Zea mays]
Length=730

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 39/75 (52%), Positives = 51/75 (68%), Gaps = 2/75 (3%)
 Frame = +1

Query  352  ECYACTQVGVPVFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPF--  525
            ECYACTQ GVP FHST+CD  H P+W+A AGSSL+P++ +  +    +      +  +  
Sbjct  59   ECYACTQPGVPAFHSTTCDQVHSPDWDADAGSSLVPVQGQAQAAAAAAAPRQRHAARWLL  118

Query  526  GRVLDPRSKRVQRWN  570
            G VLDPRS+RVQRWN
Sbjct  119  GPVLDPRSRRVQRWN  133



>dbj|BAM44884.1| cyclic nucleotide gated channel 2 [Phragmites australis]
Length=726

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 42/80 (53%), Positives = 48/80 (60%), Gaps = 7/80 (9%)
 Frame = +1

Query  352  ECYACTQVGVPVFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGP---  522
            ECYACTQ GVP FHST+CD  H P+W+A AGSSL+P++         S            
Sbjct  50   ECYACTQPGVPAFHSTTCDQVHSPDWDADAGSSLVPVQAHQAQSASASALAAAHHHAGAA  109

Query  523  ----FGRVLDPRSKRVQRWN  570
                FG VLDPRSKRVQRWN
Sbjct  110  ARWLFGPVLDPRSKRVQRWN  129



>dbj|BAM44886.1| cyclic nucleotide gated channel 2 [Phragmites australis]
Length=728

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 42/80 (53%), Positives = 48/80 (60%), Gaps = 7/80 (9%)
 Frame = +1

Query  352  ECYACTQVGVPVFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGP---  522
            ECYACTQ GVP FHST+CD  H P+W+A AGSSL+P++         S            
Sbjct  52   ECYACTQPGVPAFHSTTCDQVHSPDWDADAGSSLVPVQAHQAQSASASALAAAHHHAGAA  111

Query  523  ----FGRVLDPRSKRVQRWN  570
                FG VLDPRSKRVQRWN
Sbjct  112  ARWLFGPVLDPRSKRVQRWN  131



>dbj|BAM44885.1| cyclic nucleotide gated channel 2 [Phragmites australis]
Length=728

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 42/80 (53%), Positives = 48/80 (60%), Gaps = 7/80 (9%)
 Frame = +1

Query  352  ECYACTQVGVPVFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGP---  522
            ECYACTQ GVP FHST+CD  H P+W+A AGSSL+P++         S            
Sbjct  52   ECYACTQPGVPAFHSTTCDQVHSPDWDADAGSSLVPVQAHQAQSASASALAAAHHHAGAA  111

Query  523  ----FGRVLDPRSKRVQRWN  570
                FG VLDPRSKRVQRWN
Sbjct  112  ARWLFGPVLDPRSKRVQRWN  131



>ref|XP_010034400.1| PREDICTED: cyclic nucleotide-gated ion channel 2-like [Eucalyptus 
grandis]
Length=696

 Score = 86.7 bits (213),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 52/117 (44%), Positives = 67/117 (57%), Gaps = 8/117 (7%)
 Frame = +1

Query  226  MPSYPGLHFSLSRWFGTILRRKSVQPDNSDDTYDENPNFISTECYAC-TQVGVPVFHSTS  402
            MP +P   FSL RW     + +     +++          + EC+AC TQVGVP FHST+
Sbjct  1    MPYHPNSGFSLPRWISEFFKPRM----SAESATAMAGLAAAVECHACSTQVGVPAFHSTT  56

Query  403  CDNA-HQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPFGRVLDPRSKRVQRWN  570
            CD A HQP W A AGSSL+ I+  PG     S +    +GPFG VLDPRS  V++WN
Sbjct  57   CDGAHHQPRWVAFAGSSLVRIQAWPGPGDGASRR--RPAGPFGSVLDPRSPEVKKWN  111



>gb|KCW51913.1| hypothetical protein EUGRSUZ_J01368 [Eucalyptus grandis]
Length=666

 Score = 86.7 bits (213),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 44/77 (57%), Positives = 53/77 (69%), Gaps = 4/77 (5%)
 Frame = +1

Query  346  STECYAC-TQVGVPVFHSTSCDNA-HQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSG  519
            + EC+AC TQVGVP FHST+CD A HQP W A AGSSL+ I+  PG     S +    +G
Sbjct  7    AVECHACSTQVGVPAFHSTTCDGAHHQPRWVAFAGSSLVRIQAWPGPGDGASRR--RPAG  64

Query  520  PFGRVLDPRSKRVQRWN  570
            PFG VLDPRS  V++WN
Sbjct  65   PFGSVLDPRSPEVKKWN  81



>ref|XP_010939040.1| PREDICTED: LOW QUALITY PROTEIN: cyclic nucleotide-gated ion channel 
2-like [Elaeis guineensis]
Length=721

 Score = 83.6 bits (205),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 53/81 (65%), Gaps = 7/81 (9%)
 Frame = +1

Query  346  STECYACTQVGVPVFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPF  525
            + ECYACTQ GVP FHSTSCD AH PEWEA AGSSLIPI+ +P +      +  + S  F
Sbjct  47   AVECYACTQPGVPAFHSTSCDRAHTPEWEAGAGSSLIPIQTQPAARPAVRRRRPN-SWIF  105

Query  526  GRVLDPRS------KRVQRWN  570
            G VLDPRS       RV+ WN
Sbjct  106  GSVLDPRSXXXXXXXRVRLWN  126



>ref|XP_009405110.1| PREDICTED: cyclic nucleotide-gated ion channel 2-like [Musa acuminata 
subsp. malaccensis]
Length=728

 Score = 82.8 bits (203),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 64/110 (58%), Gaps = 8/110 (7%)
 Frame = +1

Query  259  SRWFGTILRRKSVQPDNSDDTYDENPNFISTECYACTQVGVPVFHSTSCDNAHQPEWEAS  438
            SRW   I+R      D++  +        + ECYACTQ GVP FHSTSCD AH  EWEA+
Sbjct  29   SRWVHKIVRCWRTDDDDASGSGGGGAGSAAVECYACTQAGVPAFHSTSCDRAHPLEWEAN  88

Query  439  AGSSLIPIKNRPGSVTHRSTQDFHR------SGPFGRVLDPRSKRVQRWN  570
            AGSS+IPI++   +   R T+   R      +  FG VLDPRS  VQ+WN
Sbjct  89   AGSSMIPIQHHVAA--RRPTEGAGRRRRRRPAWVFGPVLDPRSGGVQQWN  136



>ref|XP_008234503.1| PREDICTED: cyclic nucleotide-gated ion channel 2-like [Prunus 
mume]
Length=684

 Score = 79.7 bits (195),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 64/108 (59%), Gaps = 10/108 (9%)
 Frame = +1

Query  253  SLSRWFGTILRRKSVQPDNSDDTYDENPNFISTECYACTQVGVPVFHSTSCDNAHQPE--  426
            SL RW    ++      ++SDD   ++P F S ECYAC QVGVPVFHST CD  HQP+  
Sbjct  3    SLPRWKLNQVKHCCNNINDSDD--QDDPIFNSKECYACNQVGVPVFHSTRCDPTHQPQLR  60

Query  427  WEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPFGRVLDPRSKRVQRWN  570
            WE +AGSS+  ++  P  +  R  QD  R     R +DPRS  V+RWN
Sbjct  61   WERTAGSSMTLLRI-PTDLKCRP-QDLTRP----RAIDPRSSNVKRWN  102



>ref|XP_008357023.1| PREDICTED: cyclic nucleotide-gated ion channel 2-like [Malus 
domestica]
Length=229

 Score = 76.6 bits (187),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 44/88 (50%), Positives = 52/88 (59%), Gaps = 16/88 (18%)
 Frame = +1

Query  325  DENPNFISTECYACTQVGVPVFHSTSCDNAHQP--EWEASAGSSLIPIKNRPGSVTHRST  498
            +++  F S ECYACTQVGVPVFHST CD  HQP  +WE SAGSS+          T   T
Sbjct  25   NDDAIFNSKECYACTQVGVPVFHSTRCDPIHQPHLQWERSAGSSM----------TRVHT  74

Query  499  QDFHRSGPFG----RVLDPRSKRVQRWN  570
               H  GP      R +DPRS+ V+RWN
Sbjct  75   PTTHNCGPHDLTRTRAIDPRSQNVKRWN  102



>ref|XP_007220842.1| hypothetical protein PRUPE_ppa024719mg [Prunus persica]
 gb|EMJ22041.1| hypothetical protein PRUPE_ppa024719mg [Prunus persica]
Length=728

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 48/91 (53%), Positives = 55/91 (60%), Gaps = 18/91 (20%)
 Frame = +1

Query  310  SDDTYDENPNFISTECYACTQVGVPVFHSTSCDNAHQPE--WEASAGSSL--IPIKNRPG  477
            SDD   E+P F S ECYACTQVGVPVFHST CD  HQP+  WE +AGSS+    +K RP 
Sbjct  70   SDDL--EDPIFNSKECYACTQVGVPVFHSTRCDPTHQPQLRWERTAGSSMTRTDLKCRP-  126

Query  478  SVTHRSTQDFHRSGPFGRVLDPRSKRVQRWN  570
                   QD  R     R +DPRS  V+ WN
Sbjct  127  -------QDLTRP----RAIDPRSSSVKSWN  146



>ref|XP_009370501.1| PREDICTED: cyclic nucleotide-gated ion channel 2-like [Pyrus 
x bretschneideri]
Length=684

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 58/96 (60%), Gaps = 13/96 (14%)
 Frame = +1

Query  304  DNSD----DTYD-ENPNFISTECYACTQVGVPVFHSTSCDNAHQP--EWEASAGSSLIPI  462
            DNS+    + YD ++  F S ECYACTQVGVPVFHST CD  HQP  +WE SAGSS+   
Sbjct  13   DNSNGGITEAYDNDDAIFNSKECYACTQVGVPVFHSTRCDPIHQPHLQWERSAGSSM---  69

Query  463  KNRPGSVTHRSTQDFHRSGPFGRVLDPRSKRVQRWN  570
              R  + T  +      +G     +DPRS+ V+RWN
Sbjct  70   -TRVHTPTTLNCGPHDLTGT--HAIDPRSQNVKRWN  102



>ref|XP_009372825.1| PREDICTED: cyclic nucleotide-gated ion channel 2-like [Pyrus 
x bretschneideri]
Length=684

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 43/88 (49%), Positives = 54/88 (61%), Gaps = 9/88 (10%)
 Frame = +1

Query  316  DTYD-ENPNFISTECYACTQVGVPVFHSTSCDNAHQP--EWEASAGSSLIPIKNRPGSVT  486
            + YD ++  F S ECYACTQVGVPVFHST CD  HQP  +WE SAGSS+     R  + T
Sbjct  21   EAYDNDDAIFNSKECYACTQVGVPVFHSTRCDPIHQPHLQWERSAGSSM----TRVHTPT  76

Query  487  HRSTQDFHRSGPFGRVLDPRSKRVQRWN  570
              +      +G     +DPRS+ V+RWN
Sbjct  77   TLNCGPHDLTGT--HAIDPRSQNVKRWN  102



>ref|XP_010923647.1| PREDICTED: cyclic nucleotide-gated ion channel 2-like [Elaeis 
guineensis]
Length=683

 Score = 70.5 bits (171),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 29/35 (83%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  346  STECYACTQVGVPVFHSTSCDNAHQPEWEASAGSS  450
            + ECYACTQ GVP FHSTSCD AH PEWEASAGSS
Sbjct  50   AVECYACTQPGVPAFHSTSCDRAHTPEWEASAGSS  84



>ref|XP_006651833.1| PREDICTED: cyclic nucleotide-gated ion channel 2-like [Oryza 
brachyantha]
Length=676

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 26/37 (70%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +1

Query  352  ECYACTQVGVPVFHSTSCDNAHQPEWEASAGSSLIPI  462
            ECYACTQ GVP FHST+CD  H P+W+A AGSSL+P+
Sbjct  61   ECYACTQPGVPAFHSTTCDQVHLPDWDADAGSSLVPV  97



>ref|XP_006848733.1| hypothetical protein AMTR_s00177p00064020 [Amborella trichopoda]
 gb|ERN10314.1| hypothetical protein AMTR_s00177p00064020 [Amborella trichopoda]
Length=191

 Score = 65.5 bits (158),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 47/74 (64%), Gaps = 7/74 (9%)
 Frame = +1

Query  355  CYACTQVGVPVFHSTSCDNAH-QPEWEASAGSSLIPIKNRPGSVT-HRSTQDFHRSGPFG  528
            CYACTQ G P FHS SC++ + Q  W+  +GS LIPIK    +V  HR+     R+    
Sbjct  11   CYACTQAGAPAFHSISCEHTNGQLHWDPGSGSHLIPIKPSLSTVQPHRA-----RAHGTS  65

Query  529  RVLDPRSKRVQRWN  570
            +VLDPRS +VQ+WN
Sbjct  66   KVLDPRSPKVQKWN  79



>ref|XP_004309022.1| PREDICTED: cyclic nucleotide-gated ion channel 2-like [Fragaria 
vesca subsp. vesca]
Length=663

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 49/112 (44%), Gaps = 40/112 (36%)
 Frame = +1

Query  250  FSLSRWFGTILRRKSVQPDNSDDTYDENPNFISTECYACTQVGVPVFHSTSCDNAHQPEW  429
             SLSRW             N +   D+   F S ECYACTQ G+P FHS  C        
Sbjct  5    LSLSRW-------------NINANGDDPFEFSSPECYACTQAGLPAFHSNRC--------  43

Query  430  EASAGSSLIPIKNRPGSVTHRSTQDFHRSGPFG-----RVLDPRSKRVQRWN  570
              SAGSSL P            T D   + P G     RV+DPRS  V+RWN
Sbjct  44   --SAGSSLTP------------TTDLKCNPPPGHLSRTRVIDPRSNYVKRWN  81



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 669314531515