BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002E24

Length=519
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006292807.1|  hypothetical protein CARUB_v10019058mg             303   2e-101   
ref|XP_006295105.1|  hypothetical protein CARUB_v10024180mg             301   2e-101   
ref|XP_006294957.1|  hypothetical protein CARUB_v10024013mg             303   2e-101   Capsella rubella
ref|XP_003632230.1|  PREDICTED: calmodulin-7 isoform X1                 301   3e-101   Vitis vinifera
emb|CDX77060.1|  BnaC04g38550D                                          301   4e-101   
ref|XP_009782645.1|  PREDICTED: calmodulin-7-like isoform X2            300   4e-101   Nicotiana sylvestris
ref|XP_009140755.1|  PREDICTED: calmodulin-7-like                       300   4e-101   Brassica rapa
sp|P27164.2|CALM3_PETHY  RecName: Full=Calmodulin-related protein       301   5e-101   Petunia x hybrida [garden petunia]
ref|XP_009782644.1|  PREDICTED: calmodulin-7-like isoform X1            300   5e-101   Nicotiana sylvestris
ref|XP_008811949.1|  PREDICTED: calmodulin-7 isoform X1                 300   8e-101   Phoenix dactylifera
ref|XP_007015563.1|  Calmodulin 5                                       300   8e-101   
ref|XP_007202636.1|  hypothetical protein PRUPE_ppa012070mg             300   1e-100   
gb|ADT89773.1|  calmodulin                                              298   1e-100   Elaeis guineensis
ref|XP_006446396.1|  hypothetical protein CICLE_v10016866mg             300   1e-100   
ref|NP_189967.1|  calmodulin 7                                          298   1e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006378996.1|  hypothetical protein POPTR_0009s02660g             299   1e-100   
ref|XP_006408585.1|  hypothetical protein EUTSA_v10002103mg             299   1e-100   Eutrema salsugineum [saltwater cress]
gb|KDP45998.1|  hypothetical protein JCGZ_14905                         299   1e-100   Jatropha curcas
gb|ADY38663.1|  calmodulin-related protein CAM53                        298   1e-100   Wolffia arrhiza
emb|CBI24333.3|  unnamed protein product                                298   1e-100   Vitis vinifera
gb|KDO66347.1|  hypothetical protein CISIN_1g0446441mg                  298   1e-100   Citrus sinensis [apfelsine]
ref|XP_003632229.1|  PREDICTED: calmodulin-7 isoform X2                 298   2e-100   Vitis vinifera
gb|AAQ63461.1|  calmodulin 4                                            298   2e-100   Daucus carota [carrots]
ref|NP_850097.1|  calmodulin 5                                          299   2e-100   Arabidopsis thaliana [mouse-ear cress]
gb|AAT73623.1|  calmodulin cam-210                                      298   2e-100   Daucus carota [carrots]
ref|XP_010551920.1|  PREDICTED: calmodulin-7-like                       298   2e-100   Tarenaya hassleriana [spider flower]
gb|KJB21751.1|  hypothetical protein B456_004G012100                    299   2e-100   Gossypium raimondii
ref|XP_010510825.1|  PREDICTED: calmodulin-5-like                       299   2e-100   Camelina sativa [gold-of-pleasure]
emb|CDY30947.1|  BnaA06g19660D                                          300   3e-100   Brassica napus [oilseed rape]
ref|NP_850860.1|  calmodulin 6                                          297   3e-100   Arabidopsis thaliana [mouse-ear cress]
gb|ACB32228.1|  calmodulin                                              297   3e-100   Beta vulgaris [beet]
tpg|DAA45101.1|  TPA: calmodulin3                                       298   3e-100   
ref|XP_002879035.1|  calmodulin-2                                       298   3e-100   Arabidopsis lyrata subsp. lyrata
gb|AFW78488.1|  calmodulin1                                             299   3e-100   
ref|XP_010417845.1|  PREDICTED: calmodulin-5 isoform X1                 298   3e-100   Camelina sativa [gold-of-pleasure]
ref|XP_009120715.1|  PREDICTED: LOW QUALITY PROTEIN: calmodulin         298   3e-100   
ref|NP_180271.1|  calmodulin 5                                          297   3e-100   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001049948.1|  Os03g0319300                                       297   4e-100   
ref|XP_004251248.1|  PREDICTED: calmodulin                              298   4e-100   Solanum lycopersicum
gb|ACG63497.1|  TCH                                                     297   5e-100   Ipomoea batatas [batate]
ref|XP_006369409.1|  calmodulin-like protein 6a                         297   5e-100   
ref|NP_001238237.1|  calmodulin                                         297   5e-100   Glycine max [soybeans]
tpg|DAA41801.1|  TPA: calmodulin                                        298   5e-100   
gb|AAT73618.1|  calmodulin cam-205                                      296   5e-100   Daucus carota [carrots]
ref|XP_008810798.1|  PREDICTED: calmodulin-7-like                       296   6e-100   Phoenix dactylifera
ref|XP_004249098.1|  PREDICTED: calmodulin                              296   6e-100   
emb|CAH57708.1|  calmodulin                                             296   6e-100   Quercus petraea [durmast oak]
gb|AAT73616.1|  calmodulin cam-203                                      296   6e-100   Daucus carota [carrots]
ref|XP_004252866.2|  PREDICTED: LOW QUALITY PROTEIN: calmodulin         297   8e-100   
gb|AAA16320.1|  calmodulin                                              296   8e-100   Bryonia dioica
gb|ABR21718.1|  calmodulin                                              296   9e-100   Actinidia melliana
ref|XP_009150282.1|  PREDICTED: calmodulin-like                         296   9e-100   Brassica rapa
ref|XP_004144099.1|  PREDICTED: calmodulin-related protein-like         296   9e-100   Cucumis sativus [cucumbers]
ref|XP_010553894.1|  PREDICTED: calmodulin-7-like                       296   9e-100   Tarenaya hassleriana [spider flower]
emb|CAA61980.1|  Calmodulin                                             296   1e-99    Bidens pilosa [beggar-ticks]
gb|AAT73614.1|  calmodulin cam-201                                      296   1e-99    Daucus carota [carrots]
ref|XP_010521595.1|  PREDICTED: calmodulin                              296   1e-99    Tarenaya hassleriana [spider flower]
gb|AAL79908.1|AF474074_1  calmodulin                                    295   1e-99    Stevia rebaudiana
gb|ACT53872.1|  calmodulin                                              295   1e-99    Saccharum officinarum [noble cane]
emb|CAC84562.1|  putative calmodulin                                    295   2e-99    Solanum commersonii
gb|KHN34595.1|  Calmodulin                                              295   2e-99    Glycine soja [wild soybean]
gb|AAT73619.1|  calmodulin cam-206                                      295   2e-99    Daucus carota [carrots]
gb|KFK26360.1|  hypothetical protein AALP_AA8G238300                    295   2e-99    Arabis alpina [alpine rockcress]
gb|AEG75427.1|  calmodulin                                              295   2e-99    Aquilaria microcarpa
ref|XP_009391621.1|  PREDICTED: calmodulin                              295   2e-99    Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001105490.1|  calmodulin                                         295   2e-99    
ref|XP_009405855.1|  PREDICTED: calmodulin                              295   2e-99    Musa acuminata subsp. malaccensis [pisang utan]
gb|AAC16663.1|  calmodulin                                              295   2e-99    Apium graveolens
gb|ACF84469.1|  unknown                                                 295   2e-99    Zea mays [maize]
sp|A2WNH1.2|CALM3_ORYSI  RecName: Full=Calmodulin-3; Short=CaM-3        295   2e-99    Oryza sativa Indica Group [Indian rice]
gb|AFK42378.1|  unknown                                                 295   2e-99    Medicago truncatula
ref|XP_009402452.1|  PREDICTED: calmodulin                              295   2e-99    Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001275359.1|  calmodulin-5/6/7/8                                 295   2e-99    Solanum tuberosum [potatoes]
ref|XP_004142655.1|  PREDICTED: calmodulin-like isoform 1               295   2e-99    
gb|AFA89864.1|  calmodulin 4                                            295   2e-99    Lilium longiflorum [Easter lily]
sp|P48976.2|CALM_MALDO  RecName: Full=Calmodulin; Short=CaM             295   2e-99    Malus domestica [apple tree]
gb|AAT73620.1|  caomodulin cam-207                                      295   3e-99    Daucus carota [carrots]
gb|ABR21756.1|  calmodulin                                              295   3e-99    Actinidia polygama
gb|AFK45794.1|  unknown                                                 295   3e-99    Lotus japonicus
ref|XP_003567308.1|  PREDICTED: calmodulin-3                            295   3e-99    Brachypodium distachyon [annual false brome]
gb|ACL13151.1|  calmodulin 1                                            295   3e-99    Capsicum annuum
ref|XP_009419686.1|  PREDICTED: calmodulin-like                         295   3e-99    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009393093.1|  PREDICTED: calmodulin-like                         295   3e-99    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009116373.1|  PREDICTED: calmodulin-5                            295   4e-99    Brassica rapa
gb|ABR21744.1|  calmodulin                                              295   4e-99    Actinidia deliciosa var. deliciosa
gb|ACU22802.1|  unknown                                                 295   4e-99    Glycine max [soybeans]
ref|NP_001167666.1|  calmodulin                                         294   4e-99    
emb|CDY55678.1|  BnaC06g43530D                                          294   4e-99    Brassica napus [oilseed rape]
gb|AFY26192.1|  calmodulin-1                                            294   5e-99    Vaccinium corymbosum [American blueberry]
gb|ABN79277.1|  calmodulin                                              294   5e-99    Noccaea caerulescens
gb|ADK23955.1|  calmodulin                                              294   5e-99    Aquilaria microcarpa
ref|NP_001055907.1|  Os05g0491100                                       294   5e-99    
gb|AGZ84228.1|  calmodulin                                              294   5e-99    Arachis hypogaea [goober]
gb|ABG82015.1|  calmodulin                                              294   6e-99    Vigna radiata var. radiata [golden gram]
gb|ABD60149.1|  calmodulin                                              294   6e-99    Vigna unguiculata
gb|ABR21762.1|  calmodulin                                              294   6e-99    Actinidia eriantha f. alba
gb|ABR21711.1|  calmodulin                                              294   6e-99    Actinidia deliciosa var. chlorocarpa
ref|XP_009417893.1|  PREDICTED: calmodulin-3                            294   7e-99    Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001042747.1|  Os01g0279300                                       294   7e-99    
ref|NP_001105547.1|  calmodulin2                                        294   7e-99    Zea mays [maize]
ref|XP_010673215.1|  PREDICTED: calmodulin                              294   7e-99    Beta vulgaris subsp. vulgaris [field beet]
gb|ABR21729.1|  calmodulin                                              294   7e-99    Actinidia melliana
gb|AAD10245.1|  calmodulin                                              294   7e-99    Phaseolus vulgaris [French bean]
gb|AAF73157.1|AF150059_1  calmodulin                                    294   7e-99    Brassica napus [oilseed rape]
ref|NP_001236109.1|  uncharacterized protein LOC100527439               294   8e-99    
gb|ABR21750.1|  calmodulin                                              293   8e-99    Actinidia melliana
ref|XP_009404694.1|  PREDICTED: calmodulin-like                         293   9e-99    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009380569.1|  PREDICTED: calmodulin-like                         295   9e-99    Musa acuminata subsp. malaccensis [pisang utan]
gb|ABR21725.1|  calmodulin                                              293   9e-99    Clematoclethra scandens subsp. tomentella
gb|ABR21746.1|  calmodulin                                              293   9e-99    Actinidia valvata
ref|NP_176814.1|  calmodulin 4                                          293   9e-99    Arabidopsis thaliana [mouse-ear cress]
gb|AFK42827.1|  unknown                                                 293   1e-98    Lotus japonicus
gb|ABR21708.1|  calmodulin                                              293   1e-98    Actinidia chinensis
gb|ABH12274.1|  calmodulin                                              293   1e-98    Betula halophila
ref|XP_003624801.1|  Calmodulin                                         293   1e-98    
sp|P04464.3|CALM_WHEAT  RecName: Full=Calmodulin; Short=CaM             293   1e-98    Triticum aestivum [Canadian hard winter wheat]
ref|NP_001105455.1|  calmodulin                                         293   1e-98    
gb|EMS51119.1|  Calmodulin                                              293   1e-98    Triticum urartu
tpg|DAA64211.1|  TPA: calmodulin                                        299   1e-98    
gb|ABR21719.1|  calmodulin                                              293   1e-98    Actinidia kolomikta [miyama-mata-tabi]
gb|AAT73609.1|  calmodulin                                              293   2e-98    Salvia miltiorrhiza [Chinese salvia]
gb|ABR21761.1|  calmodulin                                              293   2e-98    Actinidia eriantha f. alba
ref|XP_009105204.1|  PREDICTED: calmodulin-1                            293   2e-98    Brassica rapa
gb|ABR21709.1|  calmodulin                                              293   2e-98    Actinidia chinensis
emb|CAA67054.1|  calmodulin-2                                           293   2e-98    Capsicum annuum
ref|XP_009410443.1|  PREDICTED: calmodulin-3-like                       293   2e-98    Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001104884.1|  calmodulin                                         293   2e-98    
gb|AAX31386.1|  calmodulin                                              293   2e-98    Aegiceras corniculatum
sp|P04353.2|CALM_SPIOL  RecName: Full=Calmodulin; Short=CaM             293   2e-98    Spinacia oleracea
gb|ABR21767.1|  calmodulin                                              292   2e-98    Actinidia kolomikta [miyama-mata-tabi]
gb|ABG74924.1|  calmodulin                                              293   2e-98    Aegiceras corniculatum
gb|ABS12106.1|  calmodulin 1                                            292   3e-98    Morus nigra
gb|AAR99409.1|  calmodulin                                              292   3e-98    Arachis hypogaea [goober]
ref|NP_001105459.1|  calmodulin                                         292   3e-98    
gb|ABR21759.1|  calmodulin                                              292   3e-98    Actinidia deliciosa var. chlorocarpa
gb|ABR21731.1|  calmodulin                                              292   4e-98    Actinidia sabiifolia
gb|AAS78755.1|  calmodulin                                              292   4e-98    Arachis hypogaea [goober]
ref|XP_009123275.1|  PREDICTED: LOW QUALITY PROTEIN: calmodulin         292   4e-98    
gb|ABR21741.1|  calmodulin                                              292   4e-98    Actinidia deliciosa var. chlorocarpa
ref|XP_011080472.1|  PREDICTED: calmodulin                              292   4e-98    Sesamum indicum [beniseed]
gb|ACG31089.1|  calmodulin                                              291   5e-98    Zea mays [maize]
emb|CAA78057.1|  calmodulin                                             291   6e-98    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001268169.1|  calmodulin                                         291   6e-98    
gb|ABK22713.1|  unknown                                                 291   7e-98    Picea sitchensis
gb|ABR21730.1|  calmodulin                                              291   8e-98    Actinidia kolomikta [miyama-mata-tabi]
gb|ABR21728.1|  calmodulin                                              291   8e-98    Actinidia deliciosa var. chlorocarpa
gb|ABN71532.1|  calmodulin                                              291   8e-98    Cicer arietinum [garbanzo]
ref|XP_002963446.1|  hypothetical protein SELMODRAFT_141966             291   9e-98    Selaginella moellendorffii
tpg|DAA64212.1|  TPA: calmodulin                                        300   9e-98    
ref|XP_004958754.1|  PREDICTED: UPF0483 protein AGAP003155-like         300   9e-98    
gb|AAR99412.1|  calmodulin                                              291   1e-97    Arachis hypogaea [goober]
ref|XP_002461247.1|  hypothetical protein SORBIDRAFT_02g043510          300   1e-97    
ref|XP_004287204.1|  PREDICTED: calmodulin-7                            290   2e-97    Fragaria vesca subsp. vesca
gb|AAD34242.1|AF084394_1  calmodulin mutant SYNCAM10                    290   2e-97    synthetic construct
gb|ACF79629.1|  unknown                                                 299   2e-97    Zea mays [maize]
sp|Q39752.3|CALM_FAGSY  RecName: Full=Calmodulin; Short=CaM             290   3e-97    Fagus sylvatica
emb|CAA66159.1|  calmodulin-1                                           290   3e-97    Capsicum annuum
emb|CDX99690.1|  BnaC04g34470D                                          289   4e-97    
gb|ABR21727.1|  calmodulin                                              288   1e-96    Actinidia sabiifolia
dbj|BAF31994.1|  putative calmodulin                                    288   1e-96    Cryptomeria japonica
emb|CDY27651.1|  BnaUnng00010D                                          288   1e-96    Brassica napus [oilseed rape]
ref|XP_004984569.1|  PREDICTED: calmodulin-like isoform X2              288   2e-96    
ref|XP_009762209.1|  PREDICTED: calmodulin-7-like                       287   2e-96    Nicotiana sylvestris
ref|NP_001189724.1|  calmodulin 2                                       288   2e-96    Arabidopsis thaliana [mouse-ear cress]
gb|ACY00391.1|  calmodulin                                              287   3e-96    Knorringia sibirica
ref|XP_006658157.1|  PREDICTED: UPF0483 protein AGAP003155-like         296   3e-96    
gb|AAD34435.1|AF084451_1  calmodulin mutant SYNCAM32                    287   4e-96    synthetic construct
ref|XP_006854084.1|  hypothetical protein AMTR_s00048p00127800          287   4e-96    
gb|AAA72492.1|  VU1 calmodulin                                          287   4e-96    synthetic construct
prf||1109190A  calmodulin                                               287   4e-96 
ref|XP_004961666.1|  PREDICTED: calmodulin-2-like isoform X2            287   5e-96    
emb|CDY21220.1|  BnaC03g54040D                                          289   6e-96    Brassica napus [oilseed rape]
gb|ABK23242.1|  unknown                                                 286   6e-96    Picea sitchensis
gb|ABK22644.1|  unknown                                                 286   6e-96    Picea sitchensis
ref|XP_004493280.1|  PREDICTED: family of serine hydrolases 3-like      295   7e-96    
gb|AAD34265.1|AF084417_1  calmodulin mutant SYNCAM62                    286   7e-96    synthetic construct
gb|AAD34266.1|AF084418_1  calmodulin mutant SYNCAM63A                   286   7e-96    synthetic construct
gb|AAD34415.1|AF084431_1  calmodulin mutant SYNCAM9                     286   9e-96    synthetic construct
gb|EMS55430.1|  Calmodulin-related protein                              295   1e-95    Triticum urartu
gb|AAR99410.1|  calmodulin                                              286   1e-95    Arachis hypogaea [goober]
ref|XP_010271350.1|  PREDICTED: calmodulin                              286   1e-95    Nelumbo nucifera [Indian lotus]
gb|AAA32765.1|  calmodulin-3                                            285   1e-95    Arabidopsis thaliana [mouse-ear cress]
gb|AAC61858.1|  calmodulin mutant SYNCAM28                              285   1e-95    synthetic construct
gb|AAC61859.1|  calmodulin mutant SYNCAM29                              285   1e-95    synthetic construct
gb|AAD34433.1|AF084449_1  calmodulin mutant SYNCAM26                    285   1e-95    synthetic construct
gb|AAD34257.1|AF084409_1  calmodulin mutant SYNCAM55                    285   1e-95    synthetic construct
gb|AAD34421.1|AF084437_1  calmodulin mutant SYNCAM44                    285   1e-95    synthetic construct
gb|AAD34408.1|AF084424_1  calmodulin mutant SYNCAM3                     285   1e-95    synthetic construct
gb|AAD34419.1|AF084435_1  calmodulin mutant SYNCAM39                    285   1e-95    synthetic construct
gb|AAD34422.1|AF084438_1  calmodulin mutant SYNCAM45                    285   1e-95    synthetic construct
gb|AAD34430.1|AF084446_1  calmodulin mutant SYNCAM36                    285   2e-95    synthetic construct
gb|AFA89861.2|  calmodulin 1                                            285   2e-95    Lilium longiflorum [Easter lily]
gb|AAD34259.1|AF084411_1  calmodulin mutant SYNCAM57A                   285   2e-95    synthetic construct
gb|AAD34260.1|AF084412_1  calmodulin mutant SYNCAM57B                   285   2e-95    synthetic construct
gb|AAD34258.1|AF084410_1  calmodulin mutant SYNCAM56                    285   2e-95    synthetic construct
gb|EPS74177.1|  hypothetical protein M569_00573                         293   2e-95    Genlisea aurea
ref|NP_001185330.1|  calmodulin 4                                       285   2e-95    Arabidopsis thaliana [mouse-ear cress]
gb|AAD34412.1|AF084428_1  calmodulin mutant SYNCAM60                    285   2e-95    synthetic construct
gb|AAD34426.1|AF084442_1  calmodulin mutant SYNCAM14                    285   2e-95    synthetic construct
gb|AAD34413.1|AF084429_1  calmodulin mutant SYNCAM61                    285   2e-95    synthetic construct
gb|AAD34425.1|AF084441_1  calmodulin mutant SYNCAM13                    285   2e-95    synthetic construct
gb|AAD34407.1|AF084423_1  calmodulin mutant SYNCAM67                    285   2e-95    synthetic construct
gb|AAD34264.1|AF084416_1  calmodulin mutant SYNCAM58C                   285   2e-95    synthetic construct
pdb|1QTX|A  Chain A, The 1.65 Angstrom Structure Of Calmodulin Rs...    285   2e-95    Escherichia coli [E. coli]
gb|AAD34411.1|AF084427_1  calmodulin mutant SYNCAM7                     285   3e-95    synthetic construct
gb|AAD34431.1|AF084447_1  calmodulin mutant SYNCAM37                    285   3e-95    synthetic construct
gb|AAD34437.1|AF084453_1  calmodulin mutant SYNCAM34                    285   3e-95    synthetic construct
gb|AAD34436.1|AF084452_1  calmodulin mutant SYNCAM33                    285   3e-95    synthetic construct
gb|AAD34410.1|AF084426_1  calmodulin mutant SYNCAM16                    285   3e-95    synthetic construct
gb|AAD34434.1|AF084450_1  calmodulin mutant SYNCAM31                    285   3e-95    synthetic construct
gb|AAD34243.1|AF084395_1  calmodulin mutant SYNCAM11                    285   3e-95    synthetic construct
gb|AAD34432.1|AF084448_1  calmodulin mutant SYNCAM38                    285   3e-95    synthetic construct
gb|AAD34262.1|AF084414_1  calmodulin mutant SYNCAM57D                   285   3e-95    synthetic construct
gb|AAD34261.1|AF084413_1  calmodulin mutant SYNCAM57C                   284   4e-95    synthetic construct
gb|AAD34244.1|AF084396_1  calmodulin mutant SYNCAM30                    284   4e-95    synthetic construct
gb|ABR21726.1|  calmodulin                                              284   4e-95    Actinidia sabiifolia
gb|ABR21716.1|  calmodulin                                              284   4e-95    Actinidia sabiifolia
gb|KFK32437.1|  hypothetical protein AALP_AA6G241500                    285   4e-95    Arabis alpina [alpine rockcress]
gb|AAD34269.1|AF084421_1  calmodulin mutant SYNCAM71A                   284   4e-95    synthetic construct
gb|AAD34240.1|AF084392_1  calmodulin mutant SYNCAM4                     284   5e-95    synthetic construct
ref|XP_010645766.1|  PREDICTED: calmodulin                              284   5e-95    Vitis vinifera
gb|AAD34263.1|AF084415_1  calmodulin mutant SYNCAM58A                   284   5e-95    synthetic construct
gb|AAD34247.1|AF084399_1  calmodulin mutant SYNCAM47                    284   5e-95    synthetic construct
gb|AAD34428.1|AF084444_1  calmodulin mutant SYNCAM40                    284   5e-95    synthetic construct
gb|AAD34248.1|AF084400_1  calmodulin mutant SYNCAM48                    284   5e-95    synthetic construct
gb|AAD34246.1|AF084398_1  calmodulin mutant SYNCAM46                    284   5e-95    synthetic construct
ref|XP_006849452.1|  hypothetical protein AMTR_s00024p00073390          286   5e-95    
gb|AAD34409.1|AF084425_1  calmodulin mutant SYNCAM5                     284   7e-95    synthetic construct
ref|XP_010243681.1|  PREDICTED: calmodulin-like                         283   7e-95    Nelumbo nucifera [Indian lotus]
gb|ABK21279.1|  unknown                                                 283   8e-95    Picea sitchensis
gb|AAD34429.1|AF084445_1  calmodulin mutant SYNCAM17                    283   9e-95    synthetic construct
sp|O82018.3|CALM_MOUSC  RecName: Full=Calmodulin; Short=CaM             283   9e-95    Mougeotia scalaris
ref|XP_010271115.1|  PREDICTED: calmodulin-like                         283   9e-95    Nelumbo nucifera [Indian lotus]
gb|AAD34241.1|AF084393_1  calmodulin mutant SYNCAM6                     283   1e-94    synthetic construct
pdb|1VRK|A  Chain A, The 1.9 Angstrom Structure Of E84k-Calmoduli...    283   1e-94    synthetic construct
gb|EMT12142.1|  Calmodulin-related protein                              293   1e-94    
ref|XP_001765847.1|  predicted protein                                  283   1e-94    
ref|XP_004961665.1|  PREDICTED: calmodulin-2-like isoform X1            283   1e-94    
ref|XP_001760060.1|  predicted protein                                  283   2e-94    
gb|AAD34414.1|AF084430_1  calmodulin mutant SYNCAM8                     283   2e-94    synthetic construct
gb|AAM34757.1|AF510075_1  calmodulin 1                                  283   2e-94    Ceratopteris richardii
ref|XP_011073165.1|  PREDICTED: calmodulin                              282   2e-94    Sesamum indicum [beniseed]
gb|AAD34418.1|AF084434_1  calmodulin mutant SYNCAM24                    282   2e-94    synthetic construct
ref|XP_008798212.1|  PREDICTED: calmodulin                              282   2e-94    Phoenix dactylifera
ref|NP_001154754.1|  calmodulin 1                                       283   2e-94    Arabidopsis thaliana [mouse-ear cress]
gb|AAD34420.1|AF084436_1  calmodulin mutant SYNCAM43                    282   3e-94    synthetic construct
ref|NP_001234786.1|  calmodulin                                         282   3e-94    Solanum lycopersicum
gb|AAD34423.1|AF084439_1  calmodulin mutant SYNCAM12A                   282   4e-94    synthetic construct
gb|AAD34427.1|AF084443_1  calmodulin mutant SYNCAM15                    281   5e-94    synthetic construct
gb|EYU24499.1|  hypothetical protein MIMGU_mgv1a015687mg                281   6e-94    Erythranthe guttata [common monkey flower]
emb|CAM12360.1|  Z-box binding factor 3                                 281   6e-94    Arabidopsis thaliana [mouse-ear cress]
gb|AAL87099.1|AF466266_1  calmodulin                                    281   7e-94    Sonneratia paracaseolaris
ref|XP_006374229.1|  calmodulin-like protein 6a                         281   7e-94    Populus trichocarpa [western balsam poplar]
ref|XP_010069460.1|  PREDICTED: calmodulin                              281   9e-94    Eucalyptus grandis [rose gum]
gb|AAD34268.1|AF084420_1  calmodulin mutant SYNCAM64B                   281   9e-94    synthetic construct
gb|ACR15761.1|  calmodulin isoform 1                                    281   1e-93    Solanum tuberosum [potatoes]
ref|NP_001275042.1|  calmodulin-1                                       280   1e-93    Solanum tuberosum [potatoes]
sp|P13868.2|CALM1_SOLTU  RecName: Full=Calmodulin-1; Short=CaM-1        280   1e-93    Solanum tuberosum [potatoes]
gb|AAD34416.1|AF084432_1  calmodulin mutant SYNCAM12                    280   2e-93    synthetic construct
gb|AAD34239.1|AF084391_1  calmodulin mutant SYNCAM2                     280   2e-93    synthetic construct
ref|XP_003056131.1|  calmodulin                                         280   2e-93    Micromonas pusilla CCMP1545
ref|XP_002317717.1|  calmodulin-like protein 6a                         280   2e-93    Populus trichocarpa [western balsam poplar]
ref|XP_001758487.1|  predicted protein                                  280   2e-93    
ref|XP_010045123.1|  PREDICTED: calmodulin-like                         281   3e-93    Eucalyptus grandis [rose gum]
gb|ABA27137.1|  calmodulin 1                                            280   3e-93    Catharanthus roseus [chatas]
ref|XP_002984822.1|  hypothetical protein SELMODRAFT_181303             280   3e-93    Selaginella moellendorffii
gb|AAW02790.1|  calmodulin 2                                            279   3e-93    Codonopsis lanceolata
pdb|1QS7|A  Chain A, The 1.8 Angstrom Structure Of Calmodulin Rs2...    279   4e-93    Escherichia coli [E. coli]
gb|AAD34245.1|AF084397_1  calmodulin mutant SYNCAM35                    279   4e-93    synthetic construct
gb|AAD34250.1|AF084402_1  calmodulin mutant SYNCAM50                    279   5e-93    synthetic construct
ref|XP_001755625.1|  predicted protein                                  279   6e-93    
gb|AAD34267.1|AF084419_1  calmodulin mutant SYNCAM64A                   278   6e-93    synthetic construct
ref|XP_010936850.1|  PREDICTED: calmodulin                              278   7e-93    Elaeis guineensis
ref|XP_002507130.1|  calmodulin                                         278   7e-93    Micromonas commoda
ref|XP_002977832.1|  hypothetical protein SELMODRAFT_107557             278   7e-93    Selaginella moellendorffii
ref|XP_005648308.1|  EF-hand                                            278   7e-93    Coccomyxa subellipsoidea C-169
emb|CDY12321.1|  BnaA06g20230D                                          278   7e-93    Brassica napus [oilseed rape]
gb|AAQ20043.1|  calmodulin                                              278   8e-93    Pinctada fucata
ref|NP_001154755.1|  calmodulin 1                                       279   1e-92    Arabidopsis thaliana [mouse-ear cress]
gb|AAD34424.1|AF084440_1  calmodulin mutant SYNCAM18A                   278   1e-92    
ref|XP_005836584.1|  hypothetical protein GUITHDRAFT_151413             278   1e-92    
gb|AAD34252.1|AF084404_1  calmodulin mutant SYNCAM52                    278   1e-92    
gb|AAD34249.1|AF084401_1  calmodulin mutant SYNCAM49                    278   1e-92    
gb|ADP36946.1|  hypothetical protein                                    278   2e-92    
gb|AAD34253.1|AF084405_1  calmodulin mutant SYNCAM51A                   278   2e-92    
ref|XP_001763057.1|  predicted protein                                  278   2e-92    
gb|ABK94169.1|  unknown                                                 277   2e-92    
gb|AAW27335.1|  unknown                                                 277   2e-92    
gb|AAW24912.1|  unknown                                                 277   2e-92    
sp|A4UHC0.1|CALM_ALEFU  RecName: Full=Calmodulin; Short=CaM             277   2e-92    
ref|XP_010505874.1|  PREDICTED: calmodulin-2/4-like isoform X1          280   2e-92    
gb|AGS56987.1|  calmodulin                                              277   2e-92    
ref|XP_009702107.1|  PREDICTED: calmodulin-like                         278   2e-92    
sp|P27163.2|CALM2_PETHY  RecName: Full=Calmodulin-2; Short=CaM-2        277   3e-92    
gb|ACG31559.1|  calmodulin                                              277   3e-92    
gb|ETK82424.1|  calmodulin                                              279   3e-92    
gb|ABV22336.1|  calmodulin                                              277   3e-92    
ref|XP_003770562.1|  PREDICTED: calmodulin-like                         278   3e-92    
dbj|BAA94696.1|  calmodulin                                             277   4e-92    
ref|XP_002367258.1|  calmodulin                                         277   4e-92    
ref|NP_001290903.1|  calmodulin 2 (phosphorylase kinase, delta)         276   4e-92    
ref|XP_010966045.1|  PREDICTED: calmodulin                              280   4e-92    
gb|AAD34417.1|AF084433_1  calmodulin mutant SYNCAM18                    276   4e-92    
ref|XP_005605456.1|  PREDICTED: calmodulin                              277   4e-92    
ref|XP_003787945.1|  PREDICTED: calmodulin-like isoform 3               277   5e-92    
emb|CAA62150.1|  Calmodulin                                             276   5e-92    
ref|XP_006067530.1|  PREDICTED: calmodulin isoform X1                   276   6e-92    
sp|A8I1Q0.1|CALM_HETTR  RecName: Full=Calmodulin; Short=CaM             276   6e-92    
emb|CAA78058.1|  calmodulin                                             276   6e-92    
emb|CAH57706.1|  calmodulin                                             276   6e-92    
sp|Q40302.3|CALM_MACPY  RecName: Full=Calmodulin; Short=CaM             276   6e-92    
gb|AAD34251.1|AF084403_1  calmodulin mutant SYNCAM51                    276   6e-92    
sp|Q7T3T2.3|CALM_EPIAK  RecName: Full=Calmodulin; Short=CaM             276   6e-92    
ref|NP_001103834.1|  neo-calmodulin                                     276   6e-92    
ref|XP_001638581.1|  predicted protein                                  276   6e-92    
ref|XP_002767178.1|  calmodulin, putative                               276   6e-92    
sp|Q9GRJ1.3|CALM_LUMRU  RecName: Full=Calmodulin; Short=CaM             276   7e-92    
ref|XP_010412992.1|  PREDICTED: calmodulin-2/4-like                     278   7e-92    
ref|XP_006125556.1|  PREDICTED: calmodulin-like isoform X3              276   7e-92    
ref|XP_006678916.1|  calmodulin                                         276   8e-92    
gb|ELK12789.1|  Calmodulin                                              276   9e-92    
ref|XP_005787466.1|  hypothetical protein EMIHUDRAFT_373343             276   9e-92    
pdb|2WEL|D  Chain D, Crystal Structure Of Su6656-Bound CalciumCAL...    276   9e-92    
gb|ABR21754.1|  calmodulin                                              276   9e-92    
gb|ADW78835.1|  calmodulin 1                                            276   1e-91    
gb|AAD34254.1|AF084406_1  calmodulin mutant SYNCAM53                    276   1e-91    
gb|ADK25937.1|  calmodulin                                              275   1e-91    
gb|KFO18269.1|  Calmodulin                                              276   1e-91    
emb|CEL63520.1|  Calmodulin OS=Pleurotus ostreatus GN=CMD1 PE=2 SV=3    276   1e-91    
pdb|4DJC|A  Chain A, 1.35 A Crystal Structure Of The Nav1.5 Diii-...    276   1e-91    
ref|XP_010126793.1|  PREDICTED: calmodulin                              276   1e-91    
pdb|2YGG|B  Chain B, Complex Of Cambr And Cam                           275   1e-91    
ref|XP_004797282.1|  PREDICTED: calmodulin                              276   1e-91    
ref|XP_006799422.1|  PREDICTED: calmodulin-like                         278   1e-91    
ref|XP_009056065.1|  hypothetical protein LOTGIDRAFT_216228             275   1e-91    
ref|XP_805243.1|  calmodulin                                            275   1e-91    
gb|EHB00855.1|  Calmodulin                                              277   1e-91    
ref|XP_004607860.1|  PREDICTED: calmodulin                              276   1e-91    
ref|NP_001734.1|  calmodulin                                            275   1e-91    
ref|XP_002998616.1|  calmodulin                                         275   1e-91    
emb|CCW66691.1|  unnamed protein product                                275   1e-91    
ref|XP_004559359.1|  PREDICTED: calmodulin-like                         278   2e-91    
gb|ACI15835.1|  calmodulin                                              275   2e-91    
ref|XP_005933937.1|  PREDICTED: calmodulin-like                         278   2e-91    
gb|AAX37095.1|  calmodulin 2                                            275   2e-91    
ref|XP_005738790.1|  PREDICTED: calmodulin-like                         277   2e-91    
ref|XP_005383080.1|  PREDICTED: calmodulin-like                         275   2e-91    
pdb|2F2O|A  Chain A, Structure Of Calmodulin Bound To A Calcineur...    276   2e-91    
gb|ACT88125.1|  AT15141p                                                275   2e-91    
emb|CCW64575.1|  unnamed protein product                                275   2e-91    
ref|XP_829359.1|  calmodulin                                            275   2e-91    
pdb|2BE6|A  Chain A, 2.0 A Crystal Structure Of The Cav1.2 Iq Dom...    275   2e-91    
pdb|4HEX|A  Chain A, A Novel Conformation Of Calmodulin                 275   2e-91    
pdb|3WFN|B  Chain B, Crystal Structure Of Nav1.6 Iq Motif In Comp...    276   2e-91    
ref|XP_005779994.1|  hypothetical protein EMIHUDRAFT_443126             275   3e-91    
gb|ETE70432.1|  Calmodulin                                              276   3e-91    
ref|XP_010710170.1|  PREDICTED: calmodulin                              275   3e-91    
ref|XP_003743876.1|  PREDICTED: calmodulin-like                         280   3e-91    
ref|XP_005549624.1|  PREDICTED: calmodulin-like                         275   3e-91    
gb|ADP20511.1|  calmodulin isoform 3                                    275   3e-91    
emb|CDM84638.1|  unnamed protein product                                275   3e-91    
sp|O94739.3|CALM_PLEOS  RecName: Full=Calmodulin; Short=CaM             275   3e-91    
gb|EMD36290.1|  hypothetical protein CERSUDRAFT_95628                   275   3e-91    
ref|XP_003766688.1|  PREDICTED: calmodulin-like                         275   3e-91    
ref|XP_009031530.1|  hypothetical protein HELRODRAFT_185219             275   3e-91    
ref|XP_010986526.1|  PREDICTED: calmodulin                              278   3e-91    
ref|NP_001027633.1|  calmodulin                                         274   3e-91    
ref|XP_005483194.1|  PREDICTED: calmodulin                              276   3e-91    
ref|XP_010996006.1|  PREDICTED: calmodulin                              276   3e-91    
emb|CCD82978.1|  putative calmodulin                                    275   3e-91    
ref|XP_003799587.1|  PREDICTED: calmodulin-like                         275   3e-91    
ref|XP_001113485.1|  PREDICTED: calmodulin-like isoform 4               275   4e-91    
ref|XP_010392081.1|  PREDICTED: calmodulin                              275   4e-91    
ref|XP_006125555.1|  PREDICTED: calmodulin-like isoform X2              275   4e-91    
ref|XP_011436578.1|  PREDICTED: calmodulin isoform X1                   274   4e-91    
emb|CAD20350.1|  calmodulin 1                                           274   4e-91    
ref|NP_523710.1|  calmodulin, isoform A                                 274   4e-91    
ref|XP_006909678.1|  PREDICTED: calmodulin isoform X1                   274   4e-91    
pdb|1XFU|O  Chain O, Crystal Structure Of Anthrax Edema Factor (e...    274   4e-91    
gb|AEE62155.1|  unknown                                                 274   4e-91    
gb|EHB18285.1|  Calmodulin                                              276   4e-91    
ref|XP_009315838.1|  calmodulin                                         274   4e-91    
ref|XP_011390388.1|  putative calmodulin                                274   4e-91    
ref|XP_003976021.1|  PREDICTED: calmodulin-like                         274   5e-91    
gb|ELT88703.1|  hypothetical protein CAPTEDRAFT_157141                  274   5e-91    
sp|P11120.2|CALM_PLECO  RecName: Full=Calmodulin; Short=CaM             274   5e-91    
ref|XP_007876394.1|  hypothetical protein PFL1_00701                    274   5e-91    
sp|Q9U6D3.3|CALM_MYXGL  RecName: Full=Calmodulin; Short=CaM             274   5e-91    
dbj|BAE89379.1|  unnamed protein product                                274   5e-91    
gb|KIM80147.1|  hypothetical protein PILCRDRAFT_822664                  274   5e-91    
gb|ACH46218.1|  putative calmodulin variant 1                           274   5e-91    
ref|XP_007363432.1|  calmodulin                                         274   5e-91    
gb|KIP04073.1|  hypothetical protein PHLGIDRAFT_20072                   274   6e-91    
ref|XP_009581738.1|  PREDICTED: calmodulin                              275   6e-91    
ref|NP_001148310.1|  calmodulin                                         274   6e-91    
ref|XP_009284610.1|  PREDICTED: calmodulin                              275   6e-91    
ref|XP_009473363.1|  PREDICTED: calmodulin                              275   6e-91    
ref|XP_003277701.2|  PREDICTED: calmodulin                              273   6e-91    
ref|NP_503386.1|  Protein CMD-1                                         273   6e-91    
dbj|BAB28959.1|  unnamed protein product                                273   6e-91    
dbj|GAK68453.1|  calmodulin                                             273   7e-91    
sp|P02594.2|CALM_ELEEL  RecName: Full=Calmodulin; Short=CaM             273   7e-91    
ref|XP_004381852.1|  PREDICTED: calmodulin                              276   7e-91    
ref|XP_004011148.1|  PREDICTED: calmodulin                              274   7e-91    
gb|EPQ10746.1|  Calmodulin                                              275   7e-91    
sp|Q9UB37.3|CALM2_BRALA  RecName: Full=Calmodulin-2; Short=CaM 2        273   7e-91    
emb|CBY09922.1|  unnamed protein product                                273   7e-91    
ref|XP_010705120.1|  PREDICTED: calmodulin                              274   7e-91    
pir||S58314  calmodulin - moss (Physcomitrella patens)                  273   7e-91 
ref|XP_005901002.1|  PREDICTED: calmodulin isoform X1                   275   7e-91    
ref|XP_006122412.1|  PREDICTED: calmodulin                              273   7e-91    
emb|CAH91909.1|  hypothetical protein                                   273   7e-91    
ref|XP_010744456.1|  PREDICTED: calmodulin-A-like                       274   7e-91    
gb|AEJ07961.1|  calmodulin                                              273   7e-91    
ref|NP_001270011.1|  calmodulin 2 (phosphorylase kinase, delta)         273   7e-91    
ref|XP_007432500.1|  PREDICTED: calmodulin isoform X1                   275   7e-91    
ref|XP_808090.1|  calmodulin                                            273   7e-91    
emb|CCC53905.1|  putative calmodulin                                    273   7e-91    
ref|XP_006014812.1|  PREDICTED: calmodulin                              275   7e-91    
ref|XP_009929788.1|  PREDICTED: calmodulin-A                            274   8e-91    
ref|XP_003074444.1|  calmodulin mutant SYNCAM9 (ISS)                    277   8e-91    
sp|P21251.2|CALM_STIJA  RecName: Full=Calmodulin; Short=CaM             273   8e-91    
emb|CAX71443.1|  calmodulin 3b (phosphorylase kinase, delta)            273   8e-91    
gb|AAR10240.1|  similar to Drosophila melanogaster Cam                  273   8e-91    
ref|XP_007388040.1|  calmodulin                                         273   8e-91    
gb|ACH46215.1|  putative calmodulin variant 1                           273   8e-91    
ref|XP_009951281.1|  PREDICTED: calmodulin-A                            273   8e-91    
ref|XP_008310981.1|  PREDICTED: calmodulin                              275   8e-91    
ref|XP_005242003.1|  PREDICTED: calmodulin                              278   8e-91    
ref|NP_001119640.2|  calmodulin                                         273   8e-91    
ref|XP_004440456.1|  PREDICTED: calmodulin                              275   9e-91    
ref|XP_004672700.1|  PREDICTED: calmodulin                              273   9e-91    
ref|NP_001104289.1|  calmodulin                                         273   9e-91    
ref|XP_007323358.1|  hypothetical protein SERLADRAFT_401260             273   9e-91    
ref|XP_005009882.1|  PREDICTED: calmodulin                              273   9e-91    
ref|XP_005724908.1|  PREDICTED: calmodulin-like isoform X1              275   9e-91    
ref|XP_006108243.1|  PREDICTED: calmodulin-like                         274   9e-91    
ref|XP_008945137.1|  PREDICTED: calmodulin                              273   9e-91    
ref|XP_007072738.1|  PREDICTED: LOW QUALITY PROTEIN: calmodulin 1...    273   9e-91    
emb|CAG00117.1|  unnamed protein product                                273   1e-90    
gb|KIO32664.1|  hypothetical protein M407DRAFT_241346                   273   1e-90    
ref|XP_004391344.1|  PREDICTED: LOW QUALITY PROTEIN: calmodulin 1...    273   1e-90    
ref|XP_007397964.1|  hypothetical protein PHACADRAFT_259505             273   1e-90    
pdb|2VB6|B  Chain B, Myosin Vi (Md-Insert2-Cam, Delta Insert1) Po...    273   1e-90    
ref|NP_001159980.1|  calmodulin                                         273   1e-90    
ref|XP_005960325.1|  PREDICTED: calmodulin                              273   1e-90    
ref|XP_010134360.1|  PREDICTED: calmodulin-like protein 6               273   1e-90    
gb|EMP25763.1|  Calmodulin                                              273   1e-90    
ref|XP_005416368.1|  PREDICTED: calmodulin                              273   1e-90    
ref|XP_008931196.1|  PREDICTED: calmodulin                              274   1e-90    
pdb|4E50|A  Chain A, Calmodulin And Ng Peptide Complex                  274   1e-90    
dbj|BAE40191.1|  unnamed protein product                                273   1e-90    
ref|NP_001271050.1|  uncharacterized protein LOC101866377               273   1e-90    
ref|XP_006125554.1|  PREDICTED: calmodulin-like isoform X1              274   1e-90    
ref|NP_990336.1|  calmodulin                                            273   1e-90    
ref|XP_004401226.1|  PREDICTED: calmodulin-like                         273   1e-90    
pdb|1CDL|A  Chain A, Target Enzyme Recognition By Calmodulin: 2.4...    273   1e-90    
ref|XP_006125558.1|  PREDICTED: calmodulin isoform X2                   273   1e-90    
gb|ELK23986.1|  Calmodulin                                              273   1e-90    
gb|KIM43688.1|  hypothetical protein M413DRAFT_443596                   273   1e-90    
ref|XP_009983407.1|  PREDICTED: LOW QUALITY PROTEIN: calmodulin-A...    273   1e-90    
pdb|3EWT|A  Chain A, Crystal Structure Of Calmodulin Complexed Wi...    273   1e-90    
emb|CDQ70499.1|  unnamed protein product                                273   1e-90    
ref|XP_010186289.1|  PREDICTED: calmodulin-A                            275   1e-90    
ref|XP_009506234.1|  PREDICTED: calmodulin-A-like                       274   1e-90    
gb|EHB02604.1|  Calmodulin                                              278   1e-90    
ref|XP_008152665.1|  PREDICTED: calmodulin                              273   1e-90    
ref|XP_006972704.1|  PREDICTED: calmodulin-like                         273   1e-90    
dbj|BAE31579.1|  unnamed protein product                                273   1e-90    
ref|XP_007070442.1|  PREDICTED: calmodulin-like                         274   1e-90    
dbj|BAE31439.1|  unnamed protein product                                273   1e-90    
ref|XP_009674556.1|  PREDICTED: calmodulin                              273   1e-90    
ref|XP_002805228.1|  PREDICTED: calmodulin-like isoform 2               273   1e-90    
ref|XP_004914809.1|  PREDICTED: calmodulin-like isoform X2              273   1e-90    
ref|XP_001415905.1|  predicted protein                                  273   1e-90    
gb|ACH46245.1|  putative calmodulin variant 3                           273   1e-90    
gb|ACH46217.1|  putative calmodulin variant 1                           273   1e-90    
pdb|4E53|A  Chain A, Calmodulin And Nm Peptide Complex                  274   1e-90    
pdb|2LV6|A  Chain A, The Complex Between Ca-calmodulin And Skelet...    273   1e-90    
ref|XP_010003258.1|  PREDICTED: calmodulin                              273   1e-90    
ref|XP_011436588.1|  PREDICTED: calmodulin-like                         273   1e-90    
ref|XP_808089.1|  calmodulin                                            275   1e-90    
gb|AAA66182.1|  calmodulin                                              273   1e-90    
ref|XP_007650325.1|  PREDICTED: LOW QUALITY PROTEIN: calmodulin         273   1e-90    
sp|A8CEP3.1|CALM_SACJA  RecName: Full=Calmodulin; Short=CaM             273   1e-90    
gb|KIK15929.1|  hypothetical protein PISMIDRAFT_686871                  273   1e-90    
ref|XP_007441145.1|  PREDICTED: calmodulin-like                         274   1e-90    
emb|CCI42484.1|  unnamed protein product                                273   1e-90    
ref|XP_006868502.1|  PREDICTED: calmodulin                              273   1e-90    
gb|AEK21539.1|  calmodulin A                                            273   1e-90    
ref|XP_009069716.1|  PREDICTED: LOW QUALITY PROTEIN: calmodulin-A...    273   1e-90    
ref|XP_005857913.1|  PREDICTED: calmodulin                              273   1e-90    
gb|KIJ62263.1|  hypothetical protein HYDPIDRAFT_114750                  273   1e-90    
ref|XP_004710659.1|  PREDICTED: calmodulin                              273   1e-90    
ref|XP_002109063.1|  calmodulin                                         273   1e-90    
gb|AAY41437.1|  calmodulin 2                                            273   1e-90    
ref|XP_004867158.1|  PREDICTED: calmodulin isoform X3                   273   1e-90    
ref|XP_007532277.1|  PREDICTED: calmodulin                              273   2e-90    
ref|XP_008491074.1|  PREDICTED: calmodulin                              275   2e-90    
gb|ELR52666.1|  hypothetical protein M91_02221                          273   2e-90    



>ref|XP_006292807.1| hypothetical protein CARUB_v10019058mg [Capsella rubella]
 gb|EOA25705.1| hypothetical protein CARUB_v10019058mg [Capsella rubella]
Length=215

 Score =   303 bits (776),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 148/148 (100%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMA  148



>ref|XP_006295105.1| hypothetical protein CARUB_v10024180mg [Capsella rubella]
 gb|EOA28003.1| hypothetical protein CARUB_v10024180mg [Capsella rubella]
Length=171

 Score =   301 bits (771),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 148/149 (99%), Positives = 149/149 (100%), Gaps = 0/149 (0%)
 Frame = +3

Query  72   TMADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            TMADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD
Sbjct  22   TMADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  81

Query  252  GNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTD  431
            GNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTD
Sbjct  82   GNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTD  141

Query  432  EEVDEMIREADVDGDGQINYEEFVKVMMA  518
            EEVDEMI+EADVDGDGQINYEEFVKVMMA
Sbjct  142  EEVDEMIKEADVDGDGQINYEEFVKVMMA  170


 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  95   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIKEADVD  154

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  155  GDGQINYEEFVKVMMAK  171



>ref|XP_006294957.1| hypothetical protein CARUB_v10024013mg [Capsella rubella]
 gb|EOA27855.1| hypothetical protein CARUB_v10024013mg [Capsella rubella]
Length=224

 Score =   303 bits (775),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 148/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +3

Query  69   LTMADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDA  248
            L MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDA
Sbjct  42   LKMADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDA  101

Query  249  DGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLT  428
            DGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLT
Sbjct  102  DGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLT  161

Query  429  DEEVDEMIREADVDGDGQINYEEFVKVMMA  518
            DEEVDEMI+EADVDGDGQINYEEFVKVMMA
Sbjct  162  DEEVDEMIKEADVDGDGQINYEEFVKVMMA  191


 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 59/100 (59%), Gaps = 1/100 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  116  MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIKEADVD  175

Query  252  GNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNG  371
            G+G I++ EF+ +M  K +        + +  V  K++NG
Sbjct  176  GDGQINYEEFVKVMMAKRRGKRVMTTRRSSNSVEYKEKNG  215


 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 52/79 (66%), Gaps = 2/79 (3%)
 Frame = +3

Query  279  FLNL-MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIR  455
            FL L MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI 
Sbjct  39   FLILKMADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMIN  97

Query  456  EADVDGDGQINYEEFVKVM  512
            E D DG+G I++ EF+ +M
Sbjct  98   EVDADGNGTIDFPEFLNLM  116



>ref|XP_003632230.1| PREDICTED: calmodulin-7 isoform X1 [Vitis vinifera]
Length=180

 Score =   301 bits (770),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 148/148 (100%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMA  148


 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 55/88 (63%), Gaps = 1/88 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARKMKDTDSEEELK  335
            G+G I++ EF+ +M  K +    EE+ K
Sbjct  133  GDGQINYEEFVKVMMAKRRKMRVEEKSK  160



>emb|CDX77060.1| BnaC04g38550D [Brassica napus]
Length=180

 Score =   301 bits (770),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 148/148 (100%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMA  148


 Score = 63.9 bits (154),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 51/79 (65%), Gaps = 1/79 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARKMK  308
            G+G I++ EF+ +M  K +
Sbjct  133  GDGQINYEEFVKVMMAKRR  151



>ref|XP_009782645.1| PREDICTED: calmodulin-7-like isoform X2 [Nicotiana sylvestris]
Length=180

 Score =   300 bits (769),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 148/148 (100%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMA  148


 Score = 65.5 bits (158),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 57/93 (61%), Gaps = 3/93 (3%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARKMKDTDSEEELKEAFRV  350
            G+G I++ EF+ +M  K +     EE K A+ +
Sbjct  133  GDGQINYEEFVKVMMAKRR--RRIEESKRAYSI  163



>ref|XP_009140755.1| PREDICTED: calmodulin-7-like [Brassica rapa]
 emb|CDY48191.1| BnaA04g15550D [Brassica napus]
Length=179

 Score =   300 bits (769),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 148/148 (100%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMA  148


 Score = 63.9 bits (154),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 51/79 (65%), Gaps = 1/79 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARKMK  308
            G+G I++ EF+ +M  K +
Sbjct  133  GDGQINYEEFVKVMMAKRR  151



>sp|P27164.2|CALM3_PETHY RecName: Full=Calmodulin-related protein [Petunia x hybrida]
 gb|AAA33705.1| calmodulin-related protein [Petunia x hybrida]
Length=184

 Score =   301 bits (770),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 148/148 (100%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMA  148


 Score = 64.7 bits (156),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 56/100 (56%), Gaps = 1/100 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNG  371
            G+G I++ EF+ +M    +    EE  +       +  NG
Sbjct  133  GDGQINYEEFVKVMMANRRRRRIEESKRSVNSNISRSNNG  172



>ref|XP_009782644.1| PREDICTED: calmodulin-7-like isoform X1 [Nicotiana sylvestris]
Length=181

 Score =   300 bits (769),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 148/148 (100%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMA  148



>ref|XP_008811949.1| PREDICTED: calmodulin-7 isoform X1 [Phoenix dactylifera]
Length=182

 Score =   300 bits (768),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 148/148 (100%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMA  148


 Score = 64.3 bits (155),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 51/79 (65%), Gaps = 1/79 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARKMK  308
            G+G I++ EF+ +M  K +
Sbjct  133  GDGQINYEEFVKVMMAKKR  151



>ref|XP_007015563.1| Calmodulin 5 [Theobroma cacao]
 gb|EOY33182.1| Calmodulin 5 [Theobroma cacao]
Length=184

 Score =   300 bits (768),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 148/148 (100%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMA  148


 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  133  GDGQINYEEFVKVMMAK  149



>ref|XP_007202636.1| hypothetical protein PRUPE_ppa012070mg [Prunus persica]
 gb|EMJ03835.1| hypothetical protein PRUPE_ppa012070mg [Prunus persica]
Length=184

 Score =   300 bits (767),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 149/152 (98%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = +3

Query  63   RALTMADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEV  242
            R   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEV
Sbjct  32   RQAPMADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEV  91

Query  243  DADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEK  422
            DADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEK
Sbjct  92   DADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEK  151

Query  423  LTDEEVDEMIREADVDGDGQINYEEFVKVMMA  518
            LTDEEVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  152  LTDEEVDEMIREADVDGDGQINYEEFVKVMMA  183


 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  108  MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  167

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  168  GDGQINYEEFVKVMMAK  184



>gb|ADT89773.1| calmodulin [Elaeis guineensis]
Length=152

 Score =   298 bits (764),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 148/148 (100%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMA  148


 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  133  GDGQINYEEFVKVMMAK  149



>ref|XP_006446396.1| hypothetical protein CICLE_v10016866mg [Citrus clementina]
 ref|XP_006446398.1| hypothetical protein CICLE_v10016866mg [Citrus clementina]
 ref|XP_006446399.1| hypothetical protein CICLE_v10016866mg [Citrus clementina]
 gb|ESR59636.1| hypothetical protein CICLE_v10016866mg [Citrus clementina]
 gb|ESR59638.1| hypothetical protein CICLE_v10016866mg [Citrus clementina]
 gb|ESR59639.1| hypothetical protein CICLE_v10016866mg [Citrus clementina]
Length=183

 Score =   300 bits (767),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 148/148 (100%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMA  148



>ref|NP_189967.1| calmodulin 7 [Arabidopsis thaliana]
 ref|XP_002307936.1| calmodulin 6 family protein [Populus trichocarpa]
 ref|XP_002314234.1| calmodulin-like protein 6a [Populus trichocarpa]
 ref|XP_002322582.1| calmodulin 6 family protein [Populus trichocarpa]
 ref|XP_002515603.1| calmodulin, putative [Ricinus communis]
 ref|XP_002527384.1| calmodulin, putative [Ricinus communis]
 ref|XP_002877296.1| hypothetical protein ARALYDRAFT_484819 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_004142178.1| PREDICTED: calmodulin-related protein-like [Cucumis sativus]
 ref|XP_004169960.1| PREDICTED: calmodulin-related protein-like [Cucumis sativus]
 ref|XP_004249344.1| PREDICTED: calmodulin-7 [Solanum lycopersicum]
 ref|XP_004288617.1| PREDICTED: calmodulin-7 [Fragaria vesca subsp. vesca]
 ref|XP_004489627.1| PREDICTED: calmodulin-like [Cicer arietinum]
 ref|XP_006339234.1| PREDICTED: calmodulin-1-like [Solanum tuberosum]
 ref|XP_006286601.1| hypothetical protein CARUB_v10002202mg [Capsella rubella]
 ref|XP_006430433.1| hypothetical protein CICLE_v10013029mg [Citrus clementina]
 ref|XP_006430434.1| hypothetical protein CICLE_v10013030mg [Citrus clementina]
 ref|XP_006446395.1| hypothetical protein CICLE_v10016866mg [Citrus clementina]
 ref|XP_006470427.1| PREDICTED: calmodulin-7-like [Citrus sinensis]
 ref|XP_006481977.1| PREDICTED: calmodulin-7-like [Citrus sinensis]
 ref|XP_006481978.1| PREDICTED: calmodulin-7-like [Citrus sinensis]
 ref|XP_007161842.1| hypothetical protein PHAVU_001G102700g [Phaseolus vulgaris]
 ref|XP_007212203.1| hypothetical protein PRUPE_ppa012912mg [Prunus persica]
 ref|XP_008240643.1| PREDICTED: calmodulin-7 [Prunus mume]
 ref|XP_008362433.1| PREDICTED: calmodulin-7 [Malus domestica]
 ref|XP_008392529.1| PREDICTED: calmodulin-7 [Malus domestica]
 ref|XP_008347105.1| PREDICTED: calmodulin-7 [Malus domestica]
 ref|XP_008449849.1| PREDICTED: calmodulin-7 [Cucumis melo]
 ref|XP_008786809.1| PREDICTED: calmodulin-7 [Phoenix dactylifera]
 ref|XP_008811950.1| PREDICTED: calmodulin-7 isoform X2 [Phoenix dactylifera]
 ref|XP_008777502.1| PREDICTED: calmodulin-7 [Phoenix dactylifera]
 ref|XP_009344980.1| PREDICTED: calmodulin-7 [Pyrus x bretschneideri]
 ref|XP_009345368.1| PREDICTED: calmodulin-7 [Pyrus x bretschneideri]
 ref|XP_009609538.1| PREDICTED: calmodulin-7 [Nicotiana tomentosiformis]
 ref|XP_009626334.1| PREDICTED: calmodulin-7 [Nicotiana tomentosiformis]
 ref|XP_009595177.1| PREDICTED: calmodulin-7 [Nicotiana tomentosiformis]
 ref|XP_009596008.1| PREDICTED: calmodulin-7 [Nicotiana tomentosiformis]
 ref|XP_009789056.1| PREDICTED: calmodulin-7 isoform X1 [Nicotiana sylvestris]
 ref|XP_009793724.1| PREDICTED: calmodulin-7 [Nicotiana sylvestris]
 ref|XP_009777145.1| PREDICTED: calmodulin-7 [Nicotiana sylvestris]
 ref|XP_010055427.1| PREDICTED: calmodulin-7 [Eucalyptus grandis]
 ref|XP_010031657.1| PREDICTED: calmodulin-7 [Eucalyptus grandis]
 ref|XP_010036419.1| PREDICTED: calmodulin-7 [Eucalyptus grandis]
 ref|XP_010093812.1| Calmodulin-related protein [Morus notabilis]
 ref|XP_010111286.1| Calmodulin-related protein [Morus notabilis]
 ref|XP_010251745.1| PREDICTED: calmodulin-7 [Nelumbo nucifera]
 ref|XP_010245162.1| PREDICTED: calmodulin-7 [Nelumbo nucifera]
 ref|XP_010503055.1| PREDICTED: calmodulin-7 [Camelina sativa]
 ref|XP_010514736.1| PREDICTED: calmodulin-7 [Camelina sativa]
 ref|XP_010420972.1| PREDICTED: calmodulin-7 [Camelina sativa]
 ref|XP_010425827.1| PREDICTED: calmodulin-7 [Camelina sativa]
 ref|XP_010454449.1| PREDICTED: calmodulin-7 [Camelina sativa]
 ref|XP_010493243.1| PREDICTED: calmodulin-7 [Camelina sativa]
 ref|XP_010535757.1| PREDICTED: calmodulin-7 [Tarenaya hassleriana]
 ref|XP_010541708.1| PREDICTED: calmodulin-7 [Tarenaya hassleriana]
 ref|XP_010554753.1| PREDICTED: calmodulin-7 [Tarenaya hassleriana]
 ref|XP_010525466.1| PREDICTED: calmodulin-7 [Tarenaya hassleriana]
 ref|XP_010922112.1| PREDICTED: calmodulin-7 [Elaeis guineensis]
 ref|XP_010938924.1| PREDICTED: calmodulin-7 [Elaeis guineensis]
 ref|XP_010904705.1| PREDICTED: calmodulin-7 [Elaeis guineensis]
 ref|XP_010909101.1| PREDICTED: calmodulin-7 [Elaeis guineensis]
 ref|XP_011040684.1| PREDICTED: calmodulin-7 [Populus euphratica]
 ref|XP_011041320.1| PREDICTED: calmodulin-7 [Populus euphratica]
 ref|XP_011042023.1| PREDICTED: calmodulin-7 [Populus euphratica]
 ref|XP_011070027.1| PREDICTED: calmodulin-7 [Sesamum indicum]
 ref|XP_011079163.1| PREDICTED: calmodulin-7 [Sesamum indicum]
 ref|XP_011090191.1| PREDICTED: calmodulin-7 [Sesamum indicum]
 ref|XP_011090192.1| PREDICTED: calmodulin-7 [Sesamum indicum]
 ref|XP_011090193.1| PREDICTED: calmodulin-7 [Sesamum indicum]
 sp|P59220.2|CALM7_ARATH RecName: Full=Calmodulin-7; Short=CaM-7 [Arabidopsis thaliana]
 sp|P62199.2|CALM1_PETHY RecName: Full=Calmodulin-1; Short=CaM-1 [Petunia x hybrida]
 sp|P62200.2|CALM1_DAUCA RecName: Full=Calmodulin-1/11/16; Short=CaM-1/11/16 [Daucus carota]
 sp|P62201.2|CALM_LILLO RecName: Full=Calmodulin; Short=CaM [Lilium longiflorum]
 sp|P62202.2|CALM_BRYDI RecName: Full=Calmodulin; Short=CaM; AltName: Full=BC329 [Bryonia 
dioica]
 sp|Q7Y052.4|CALM_EUPCH RecName: Full=Calmodulin; Short=CaM [Euphorbia characias]
 pdb|4AQR|A Chain A, Crystal Structure Of A Calmodulin In Complex With The 
Regulatory Domain Of A Plasma-Membrane Ca2+-Atpase
 pdb|4AQR|B Chain B, Crystal Structure Of A Calmodulin In Complex With The 
Regulatory Domain Of A Plasma-Membrane Ca2+-Atpase
 gb|AAD53313.1|AF178073_1 calmodulin 7 [Arabidopsis thaliana]
 gb|AAG11418.1|AF292108_1 calmodulin [Prunus avium]
 gb|AAM81202.1|AF494219_1 calmodulin 1 [Medicago truncatula]
 emb|CAA42423.1| calmodulin [Daucus carota]
 emb|CAA78301.1| calmodulin [Lilium longiflorum]
 gb|AAA33706.1| calmodulin [Petunia x hybrida]
 gb|AAA33397.1| calmodulin [Lilium longiflorum]
 emb|CAA43143.1| Calmodulin [Malus domestica]
 gb|AAA92681.1| calmodulin [Pisum sativum]
 emb|CAB83153.1| calmodulin 7 [Arabidopsis thaliana]
 gb|AAG27432.1| calmodulin [Elaeis guineensis]
 dbj|BAB61909.1| calmodulin NtCaM3 [Nicotiana tabacum]
 dbj|BAB61910.1| calmodulin NtCaM4 [Nicotiana tabacum]
 dbj|BAB61911.1| calmodulin NtCaM5 [Nicotiana tabacum]
 dbj|BAB61912.1| calmodulin NtCaM6 [Nicotiana tabacum]
 dbj|BAB61913.1| calmodulin NtCaM7 [Nicotiana tabacum]
 dbj|BAB61914.1| calmodulin NtCaM8 [Nicotiana tabacum]
 dbj|BAB61917.1| calmodulin NtCaM11 [Nicotiana tabacum]
 dbj|BAB61918.1| calmodulin NtCaM12 [Nicotiana tabacum]
 gb|AAM66013.1| calmodulin 7 [Arabidopsis thaliana]
 gb|AAP55717.2| calmodulin [Euphorbia characias]
 gb|AAS55460.1| calmodulin cam-11 [Daucus carota]
 gb|AAS55461.1| calmodulin cam-16 [Daucus carota]
 gb|AAT73615.1| calmodulin cam-202 [Daucus carota]
 gb|AAT73617.1| calmodulin cam-204 [Daucus carota]
 gb|AAT73621.1| calmodulin cam-208 [Daucus carota]
 gb|AAT73622.1| calmodulin cam-209 [Daucus carota]
 emb|CAH58629.1| calmodulin [Plantago major]
 emb|CAH58630.1| calmodulin [Plantago major]
 emb|CAH57707.1| calmodulin [Quercus petraea]
 gb|AAX63770.1| calmodulin [Populus tomentosa]
 gb|ABA27138.1| calmodulin 2 [Catharanthus roseus]
 gb|ABF58929.1| At3g43810 [Arabidopsis thaliana]
 dbj|BAE99131.1| calmodulin 7 [Arabidopsis thaliana]
 gb|ABK62856.1| calmodulin [Scoparia dulcis]
 gb|ABK92605.1| unknown [Populus trichocarpa]
 gb|ABK92620.1| unknown [Populus trichocarpa]
 gb|ABK92710.1| unknown [Populus trichocarpa]
 gb|ABK93215.1| unknown [Populus trichocarpa]
 gb|ABK93782.1| unknown [Populus trichocarpa]
 gb|ABK93953.1| unknown [Populus trichocarpa]
 gb|ABK94234.1| unknown [Populus trichocarpa]
 gb|ABK94353.1| unknown [Populus trichocarpa]
 gb|ABK94577.1| unknown [Populus trichocarpa]
 gb|ABK94668.1| unknown [Populus trichocarpa]
 gb|ABK94734.1| unknown [Populus trichocarpa]
 gb|ABK94820.1| unknown [Populus trichocarpa]
 gb|ABQ32302.1| putative calmodulin [Artemisia annua]
 emb|CAN63123.1| hypothetical protein VITISV_010766 [Vitis vinifera]
 gb|ABS12105.1| calmodulin 1 [Morus nigra]
 gb|ACD74910.1| calmodulin [Vitis quinquangularis]
 gb|ACH63215.1| calmodulin [Rheum australe]
 gb|EEE88189.1| calmodulin-like protein 6a [Populus trichocarpa]
 gb|EEE91459.1| calmodulin 6 family protein [Populus trichocarpa]
 gb|EEF04343.1| calmodulin 6 family protein [Populus trichocarpa]
 gb|EEF35009.1| calmodulin, putative [Ricinus communis]
 gb|EEF46748.1| calmodulin, putative [Ricinus communis]
 gb|ACN60147.1| calmodulin [Lonicera japonica]
 gb|ACO52511.1| calmodulin [Panax ginseng]
 gb|ACS96443.1| calmodulin 7 [Jatropha curcas]
 gb|ACT99605.1| calmodulin [Morus alba var. multicaulis]
 gb|ADB03783.1| calmodulin [Ipomoea batatas]
 gb|EFH53555.1| hypothetical protein ARALYDRAFT_484819 [Arabidopsis lyrata subsp. 
lyrata]
 gb|ADR80688.1| calmodulin [Hevea brasiliensis]
 gb|AEE77831.1| calmodulin 7 [Arabidopsis thaliana]
 gb|AEL29209.1| calmodulin [Betula platyphylla]
 gb|AEO19904.1| calmodulin 1 [Pyrus x bretschneideri]
 gb|AEO19905.1| calmodulin 2 [Pyrus x bretschneideri]
 gb|AFA89863.1| calmodulin 3 [Lilium longiflorum]
 gb|AFH96951.1| calmodulin [Eleutherococcus senticosus]
 gb|AFK40030.1| unknown [Medicago truncatula]
 gb|AFA89862.2| calmodulin 2 [Lilium longiflorum]
 gb|AFA89865.2| calmodulin 5 [Lilium longiflorum]
 gb|EMJ13402.1| hypothetical protein PRUPE_ppa012912mg [Prunus persica]
 gb|EOA19499.1| hypothetical protein CARUB_v10002202mg [Capsella rubella]
 gb|EPS72734.1| calmodulin [Genlisea aurea]
 gb|EPS72776.1| calmodulin [Genlisea aurea]
 gb|AGX27513.1| CAM6 [Populus tomentosa]
 gb|ESR43673.1| hypothetical protein CICLE_v10013029mg [Citrus clementina]
 gb|ESR43674.1| hypothetical protein CICLE_v10013030mg [Citrus clementina]
 gb|ESR59635.1| hypothetical protein CICLE_v10016866mg [Citrus clementina]
 gb|ESW33836.1| hypothetical protein PHAVU_001G102700g [Phaseolus vulgaris]
 gb|EXB54663.1| Calmodulin-related protein [Morus notabilis]
 gb|EXC30764.1| Calmodulin-related protein [Morus notabilis]
 gb|AHM26653.1| calmodulin 1 [Pyrus x bretschneideri]
 gb|EYU20849.1| hypothetical protein MIMGU_mgv1a015694mg [Erythranthe guttata]
 gb|EYU35667.1| hypothetical protein MIMGU_mgv1a015677mg [Erythranthe guttata]
 gb|EYU35968.1| hypothetical protein MIMGU_mgv1a015696mg [Erythranthe guttata]
 gb|EYU46162.1| hypothetical protein MIMGU_mgv1a015681mg [Erythranthe guttata]
 gb|KDO57356.1| hypothetical protein CISIN_1g0315341mg [Citrus sinensis]
 gb|KDP31736.1| hypothetical protein JCGZ_14893 [Jatropha curcas]
 gb|AES75093.2| EF hand calcium-binding family protein [Medicago truncatula]
 emb|CDP14348.1| unnamed protein product [Coffea canephora]
 emb|CDP09666.1| unnamed protein product [Coffea canephora]
 gb|KGN54050.1| hypothetical protein Csa_4G279790 [Cucumis sativus]
 gb|KHG00922.1| Calmodulin-related [Gossypium arboreum]
 gb|KHG09065.1| Calmodulin-related [Gossypium arboreum]
 gb|KHG21051.1| Calmodulin-related [Gossypium arboreum]
 gb|KJB09156.1| hypothetical protein B456_001G128100 [Gossypium raimondii]
 gb|KJB35532.1| hypothetical protein B456_006G118400 [Gossypium raimondii]
 gb|KJB55517.1| hypothetical protein B456_009G080400 [Gossypium raimondii]
 prf||1909349A calmodulin
Length=149

 Score =   298 bits (764),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 148/148 (100%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMA  148


 Score = 63.5 bits (153),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  133  GDGQINYEEFVKVMMAK  149



>ref|XP_006378996.1| hypothetical protein POPTR_0009s02660g [Populus trichocarpa]
 gb|ERP56793.1| hypothetical protein POPTR_0009s02660g [Populus trichocarpa]
Length=179

 Score =   299 bits (766),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 148/148 (100%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMA  148


 Score = 65.5 bits (158),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 58/88 (66%), Gaps = 5/88 (6%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLM---ARKMKDTDSEE  326
            G+G I++ EF+ +M    RKM+ +DS+E
Sbjct  133  GDGQINYEEFVKVMMAKKRKMR-SDSKE  159



>ref|XP_006408585.1| hypothetical protein EUTSA_v10002103mg [Eutrema salsugineum]
 gb|ESQ50038.1| hypothetical protein EUTSA_v10002103mg [Eutrema salsugineum]
Length=180

 Score =   299 bits (766),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 147/148 (99%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMI+EADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIKEADVDGDGQINYEEFVKVMMA  148


 Score = 65.1 bits (157),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 51/79 (65%), Gaps = 1/79 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIKEADVD  132

Query  252  GNGTIDFPEFLNLMARKMK  308
            G+G I++ EF+ +M  K +
Sbjct  133  GDGQINYEEFVKVMMAKRR  151



>gb|KDP45998.1| hypothetical protein JCGZ_14905 [Jatropha curcas]
Length=181

 Score =   299 bits (766),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 148/148 (100%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMA  148


 Score = 63.9 bits (154),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  133  GDGQINYEEFVKVMMAK  149



>gb|ADY38663.1| calmodulin-related protein CAM53 [Wolffia arrhiza]
Length=149

 Score =   298 bits (763),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 148/148 (100%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMA  148



>emb|CBI24333.3| unnamed protein product [Vitis vinifera]
Length=153

 Score =   298 bits (764),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 148/148 (100%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMA  148


 Score = 63.9 bits (154),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 51/79 (65%), Gaps = 1/79 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARKMK  308
            G+G I++ EF+ +M  K +
Sbjct  133  GDGQINYEEFVKVMMAKKR  151



>gb|KDO66347.1| hypothetical protein CISIN_1g0446441mg, partial [Citrus sinensis]
Length=148

 Score =   298 bits (763),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 148/148 (100%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMA  148



>ref|XP_003632229.1| PREDICTED: calmodulin-7 isoform X2 [Vitis vinifera]
Length=158

 Score =   298 bits (764),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 148/148 (100%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMA  148


 Score = 67.8 bits (164),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 58/91 (64%), Gaps = 6/91 (7%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARKMKDTDSEEELKEAF  344
            G+G I++ EF+ +M  KM+ T     ++EAF
Sbjct  133  GDGQINYEEFVKVMMAKMQGT-----MEEAF  158



>gb|AAQ63461.1| calmodulin 4 [Daucus carota]
 gb|AAQ63462.1| calmodulin 8 [Daucus carota]
Length=150

 Score =   298 bits (763),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 148/148 (100%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMA  148


 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  133  GDGQINYEEFVKVMMAK  149



>ref|NP_850097.1| calmodulin 5 [Arabidopsis thaliana]
 gb|AEC07925.1| calmodulin 5 [Arabidopsis thaliana]
Length=181

 Score =   299 bits (766),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 147/148 (99%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMI+EADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIKEADVDGDGQINYEEFVKVMMA  148


 Score = 64.7 bits (156),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 51/79 (65%), Gaps = 1/79 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIKEADVD  132

Query  252  GNGTIDFPEFLNLMARKMK  308
            G+G I++ EF+ +M  K +
Sbjct  133  GDGQINYEEFVKVMMAKRR  151



>gb|AAT73623.1| calmodulin cam-210 [Daucus carota]
Length=149

 Score =   298 bits (762),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 147/148 (99%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEM+READVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMVREADVDGDGQINYEEFVKVMMA  148


 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +M+ E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMVREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  133  GDGQINYEEFVKVMMAK  149



>ref|XP_010551920.1| PREDICTED: calmodulin-7-like [Tarenaya hassleriana]
 ref|XP_010528533.1| PREDICTED: calmodulin-7-like [Tarenaya hassleriana]
 ref|XP_010520482.1| PREDICTED: calmodulin-7-like [Tarenaya hassleriana]
Length=149

 Score =   298 bits (762),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 147/148 (99%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVK+MMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKIMMA  148


 Score = 63.9 bits (154),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  133  GDGQINYEEFVKIMMAK  149



>gb|KJB21751.1| hypothetical protein B456_004G012100 [Gossypium raimondii]
Length=179

 Score =   299 bits (765),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 147/148 (99%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINY+EFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYDEFVKVMMA  148


 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 52/80 (65%), Gaps = 1/80 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARKMKD  311
            G+G I++ EF+ +M  K K+
Sbjct  133  GDGQINYDEFVKVMMAKRKE  152



>ref|XP_010510825.1| PREDICTED: calmodulin-5-like [Camelina sativa]
Length=181

 Score =   299 bits (765),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 147/148 (99%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMI+EADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIKEADVDGDGQINYEEFVKVMMA  148


 Score = 64.3 bits (155),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 51/79 (65%), Gaps = 1/79 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIKEADVD  132

Query  252  GNGTIDFPEFLNLMARKMK  308
            G+G I++ EF+ +M  K +
Sbjct  133  GDGQINYEEFVKVMMAKRR  151



>emb|CDY30947.1| BnaA06g19660D [Brassica napus]
Length=209

 Score =   300 bits (767),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 146/148 (99%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEM+READVDGDGQINY+EFVKVMMA
Sbjct  121  EVDEMVREADVDGDGQINYDEFVKVMMA  148



>ref|NP_850860.1| calmodulin 6 [Arabidopsis thaliana]
 ref|XP_002874034.1| hypothetical protein ARALYDRAFT_489030 [Arabidopsis lyrata subsp. 
lyrata]
 sp|Q03509.2|CALM6_ARATH RecName: Full=Calmodulin-6; Short=CaM-6 [Arabidopsis thaliana]
 emb|CAA78059.1| calmodulin [Arabidopsis thaliana]
 gb|AAK91367.1| AT3g43810/T28A8_100 [Arabidopsis thaliana]
 gb|AAM16193.1| AT3g43810/T28A8_100 [Arabidopsis thaliana]
 gb|AAO73886.1| calmodulin-6 (CAM6) [Arabidopsis thaliana]
 gb|EFH50293.1| hypothetical protein ARALYDRAFT_489030 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AED92947.1| calmodulin 6 [Arabidopsis thaliana]
Length=149

 Score =   297 bits (761),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 147/148 (99%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKL+DE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLSDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMA  148


 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLSDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  133  GDGQINYEEFVKVMMAK  149



>gb|ACB32228.1| calmodulin [Beta vulgaris]
Length=149

 Score =   297 bits (761),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 147/148 (99%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQL+DDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLSDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMA  148


 Score = 63.5 bits (153),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  133  GDGQINYEEFVKVMMAK  149



>tpg|DAA45101.1| TPA: calmodulin3, partial [Zea mays]
Length=158

 Score =   298 bits (762),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 147/148 (99%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQI+EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDDQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMA  148



>ref|XP_002879035.1| calmodulin-2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55294.1| calmodulin-2 [Arabidopsis lyrata subsp. lyrata]
Length=181

 Score =   298 bits (764),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 147/148 (99%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMI+EADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIKEADVDGDGQINYEEFVKVMMA  148


 Score = 64.7 bits (156),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 51/79 (65%), Gaps = 1/79 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIKEADVD  132

Query  252  GNGTIDFPEFLNLMARKMK  308
            G+G I++ EF+ +M  K +
Sbjct  133  GDGQINYEEFVKVMMAKRR  151



>gb|AFW78488.1| calmodulin1 [Zea mays]
Length=198

 Score =   299 bits (765),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 146/148 (99%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTD+QI+EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDEQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMA  148


 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  133  GDGQINYEEFVKVMMAK  149



>ref|XP_010417845.1| PREDICTED: calmodulin-5 isoform X1 [Camelina sativa]
Length=181

 Score =   298 bits (764),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 147/148 (99%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMI+EADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIKEADVDGDGQINYEEFVKVMMA  148


 Score = 64.3 bits (155),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 51/79 (65%), Gaps = 1/79 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIKEADVD  132

Query  252  GNGTIDFPEFLNLMARKMK  308
            G+G I++ EF+ +M  K +
Sbjct  133  GDGQINYEEFVKVMMAKRR  151



>ref|XP_009120715.1| PREDICTED: LOW QUALITY PROTEIN: calmodulin [Brassica rapa]
Length=160

 Score =   298 bits (762),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 147/148 (99%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINY+EFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYDEFVKVMMA  148


 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 51/79 (65%), Gaps = 1/79 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARKMK  308
            G+G I++ EF+ +M  K K
Sbjct  133  GDGQINYDEFVKVMMAKXK  151



>ref|NP_180271.1| calmodulin 5 [Arabidopsis thaliana]
 ref|NP_191239.1| calmodulin 3 [Arabidopsis thaliana]
 ref|NP_850344.1| calmodulin 2 [Arabidopsis thaliana]
 ref|XP_002878109.1| calmodulin-2 [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002879909.1| calmodulin-2 [Arabidopsis lyrata subsp. lyrata]
 ref|XP_006290285.1| hypothetical protein CARUB_v10018192mg [Capsella rubella]
 ref|XP_006402949.1| hypothetical protein EUTSA_v10006295mg [Eutrema salsugineum]
 ref|XP_006411378.1| hypothetical protein EUTSA_v10017373mg [Eutrema salsugineum]
 ref|XP_009133468.1| PREDICTED: calmodulin-5 [Brassica rapa]
 ref|XP_009139073.1| PREDICTED: calmodulin-5 [Brassica rapa]
 ref|XP_009104021.1| PREDICTED: calmodulin-5 [Brassica rapa]
 ref|XP_010504586.1| PREDICTED: calmodulin-5 [Camelina sativa]
 ref|XP_010508758.1| PREDICTED: calmodulin-5 [Camelina sativa]
 ref|XP_010516281.1| PREDICTED: calmodulin-5 [Camelina sativa]
 ref|XP_010417846.1| PREDICTED: calmodulin-5 isoform X2 [Camelina sativa]
 ref|XP_010427517.1| PREDICTED: calmodulin-5 [Camelina sativa]
 sp|Q682T9.1|CALM5_ARATH RecName: Full=Calmodulin-5; Short=CaM-5 [Arabidopsis thaliana]
 sp|P0DH97.1|CALM2_ARATH RecName: Full=Calmodulin-2; Short=CaM-2 [Arabidopsis thaliana]
 sp|P0DH98.1|CALM3_ARATH RecName: Full=Calmodulin-3; Short=CaM-3 [Arabidopsis thaliana]
 pir||S53006 calmodulin - leaf mustard
 gb|AAA32763.1| calmodulin-2 [Arabidopsis thaliana]
 gb|AAA32764.1| calmodulin-3 [Arabidopsis thaliana]
 emb|CAA47690.1| calmodulin [Arabidopsis thaliana]
 gb|AAA19571.1| calmodulin [Brassica napus]
 gb|AAA87347.1| calmodulin [Brassica juncea]
 dbj|BAA08283.1| calmodulin [Arabidopsis thaliana]
 gb|AAD12000.1| calmodulin (cam2) [Arabidopsis thaliana]
 gb|AAC77861.1| calmodulin [Arabidopsis thaliana]
 emb|CAC00743.1| calmodulin-3 [Arabidopsis thaliana]
 gb|AAK76722.1| putative calmodulin-3 protein [Arabidopsis thaliana]
 gb|AAL09806.1| AT3g56800/T8M16_130 [Arabidopsis thaliana]
 gb|AAL38355.1| calmodulin (cam2) [Arabidopsis thaliana]
 gb|AAM14240.1| putative calmodulin-3 protein [Arabidopsis thaliana]
 gb|AAM62881.1| calmodulin-3 [Arabidopsis thaliana]
 gb|AAM91152.1| calmodulin cam2 [Arabidopsis thaliana]
 gb|AAN86184.1| putative calmodulin [Arabidopsis thaliana]
 dbj|BAD43041.1| calmodulin [Arabidopsis thaliana]
 dbj|BAD44618.1| calmodulin [Arabidopsis thaliana]
 gb|EFH54368.1| calmodulin-2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56168.1| calmodulin-2 [Arabidopsis lyrata subsp. lyrata]
 dbj|BAJ33744.1| unnamed protein product [Thellungiella halophila]
 dbj|BAJ34240.1| unnamed protein product [Thellungiella halophila]
 gb|AEC07924.1| calmodulin 5 [Arabidopsis thaliana]
 gb|AEC09932.1| calmodulin 2 [Arabidopsis thaliana]
 gb|AEE79567.1| calmodulin 3 [Arabidopsis thaliana]
 gb|EOA23183.1| hypothetical protein CARUB_v10018192mg [Capsella rubella]
 gb|ESQ44402.1| hypothetical protein EUTSA_v10006295mg [Eutrema salsugineum]
 gb|ESQ52831.1| hypothetical protein EUTSA_v10017373mg [Eutrema salsugineum]
 gb|KFK34917.1| hypothetical protein AALP_AA5G210400 [Arabis alpina]
 gb|KFK36958.1| hypothetical protein AALP_AA4G194800 [Arabis alpina]
 emb|CDY51259.1| BnaCnng20380D [Brassica napus]
 emb|CDY47377.1| BnaC04g24860D [Brassica napus]
 emb|CDY35428.1| BnaA03g19320D [Brassica napus]
 emb|CDY27197.1| BnaA09g36050D [Brassica napus]
 emb|CDY22503.1| BnaC03g23130D [Brassica napus]
 emb|CDX76012.1| BnaA04g02760D [Brassica napus]
 emb|CDX67656.1| BnaA07g16960D [Brassica napus]
 prf||1803520A calmodulin 2
Length=149

 Score =   297 bits (761),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 147/148 (99%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMI+EADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIKEADVDGDGQINYEEFVKVMMA  148


 Score = 63.5 bits (153),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIKEADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  133  GDGQINYEEFVKVMMAK  149



>ref|NP_001049948.1| Os03g0319300 [Oryza sativa Japonica Group]
 ref|NP_001060691.1| Os07g0687200 [Oryza sativa Japonica Group]
 ref|NP_001136954.1| uncharacterized protein LOC100217114 [Zea mays]
 ref|NP_001042688.2| Os01g0267900 [Oryza sativa Japonica Group]
 ref|NP_001237883.1| calmodulin-2 [Glycine max]
 ref|NP_001266025.1| uncharacterized protein LOC101494641 [Cicer arietinum]
 ref|NP_001281081.1| uncharacterized protein LOC100192601 [Zea mays]
 ref|XP_002467948.1| hypothetical protein SORBIDRAFT_01g037010 [Sorghum bicolor]
 ref|XP_002441298.1| hypothetical protein SORBIDRAFT_09g024040 [Sorghum bicolor]
 ref|XP_003562430.1| PREDICTED: calmodulin [Brachypodium distachyon]
 ref|XP_003566831.1| PREDICTED: calmodulin [Brachypodium distachyon]
 ref|XP_004967736.1| PREDICTED: calmodulin-like [Setaria italica]
 ref|XP_004984568.1| PREDICTED: calmodulin-like isoform X1 [Setaria italica]
 ref|XP_006644038.1| PREDICTED: calmodulin-1-like [Oryza brachyantha]
 ref|XP_006649997.1| PREDICTED: calmodulin-1-like [Oryza brachyantha]
 ref|XP_008655487.1| PREDICTED: calmodulin [Zea mays]
 ref|XP_008660204.1| PREDICTED: calmodulin [Zea mays]
 ref|XP_010228691.1| PREDICTED: calmodulin [Brachypodium distachyon]
 sp|P62162.2|CALM_HORVU RecName: Full=Calmodulin; Short=CaM [Hordeum vulgare]
 sp|P62163.2|CALM2_SOYBN RecName: Full=Calmodulin-2; Short=CaM-2 [Glycine max]
 sp|A2WN93.2|CALM1_ORYSI RecName: Full=Calmodulin-1; Short=CaM-1 [Oryza sativa Indica 
Group]
 sp|Q0JNS6.2|CALM1_ORYSJ RecName: Full=Calmodulin-1; Short=CaM-1 [Oryza sativa Japonica 
Group]
 gb|AAL35329.1|AF441191_1 calmodulin [Oryza sativa]
 emb|CAA78287.1| calmodulin [Oryza sativa Indica Group]
 gb|AAA32938.1| calmodulin [Hordeum vulgare]
 gb|AAA03580.1| calmodulin [Glycine max]
 gb|AAA33901.1| calmodulin [Oryza sativa Indica Group]
 gb|AAA34237.1| calmodulin [Vigna radiata]
 gb|AAB36130.1| auxin-regulated calmodulin [Vigna radiata]
 emb|CAA70982.1| CaM protein [Cicer arietinum]
 gb|AAC49578.1| calmodulin TaCaM1-1 [Triticum aestivum]
 gb|AAC49579.1| calmodulin TaCaM1-2 [Triticum aestivum]
 gb|AAC49580.1| calmodulin TaCaM1-3 [Triticum aestivum]
 gb|AAC49584.1| calmodulin TaCaM3-1 [Triticum aestivum]
 gb|AAC49585.1| calmodulin TaCaM3-2 [Triticum aestivum]
 gb|AAC49586.1| calmodulin TaCaM3-3 [Triticum aestivum]
 gb|AAC49587.1| calmodulin TaCaM4-1 [Triticum aestivum]
 gb|AAC36059.1| calmodulin [Oryza sativa]
 dbj|BAA88540.1| calmodulin [Oryza sativa Japonica Group]
 dbj|BAC10352.1| calmodulin [Oryza sativa Japonica Group]
 dbj|BAD30293.1| calmodulin [Oryza sativa Japonica Group]
 gb|ABF95646.1| Calmodulin, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF11862.1| Os03g0319300 [Oryza sativa Japonica Group]
 dbj|BAF22605.1| Os07g0687200 [Oryza sativa Japonica Group]
 gb|EAY89788.1| hypothetical protein OsI_11331 [Oryza sativa Indica Group]
 gb|EAZ26731.1| hypothetical protein OsJ_10641 [Oryza sativa Japonica Group]
 gb|ABR25762.1| calmodulin, putative [Oryza sativa Indica Group]
 gb|ACF79610.1| unknown [Zea mays]
 gb|ACF82959.1| unknown [Zea mays]
 gb|ACF83645.1| unknown [Zea mays]
 gb|ACF83876.1| unknown [Zea mays]
 gb|ACG25000.1| calmodulin [Zea mays]
 gb|ACG32312.1| calmodulin [Zea mays]
 gb|ACG33186.1| calmodulin [Zea mays]
 gb|ACG43585.1| calmodulin [Zea mays]
 gb|ACG46140.1| calmodulin [Zea mays]
 dbj|BAG91765.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG92729.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH01268.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|ACJ84166.1| unknown [Medicago truncatula]
 gb|EEC70374.1| hypothetical protein OsI_01318 [Oryza sativa Indica Group]
 gb|EEC82716.1| hypothetical protein OsI_27397 [Oryza sativa Indica Group]
 gb|EEE67848.1| hypothetical protein OsJ_25643 [Oryza sativa Japonica Group]
 gb|EER94946.1| hypothetical protein SORBIDRAFT_01g037010 [Sorghum bicolor]
 gb|EES19728.1| hypothetical protein SORBIDRAFT_09g024040 [Sorghum bicolor]
 gb|ACT53871.1| calmodulin [Saccharum officinarum]
 gb|ACU19990.1| unknown [Glycine max]
 dbj|BAF04602.2| Os01g0267900 [Oryza sativa Japonica Group]
 dbj|BAJ85012.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ99627.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88874.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|AFK47371.1| unknown [Medicago truncatula]
 gb|AFW79590.1| calmodulin [Zea mays]
 gb|AFW88536.1| calmodulin [Zea mays]
 tpg|DAA41802.1| TPA: calmodulin [Zea mays]
 tpg|DAA45102.1| TPA: calmodulin3 [Zea mays]
 tpg|DAA64210.1| TPA: calmodulin [Zea mays]
 gb|EMS51651.1| Calmodulin-related protein [Triticum urartu]
 gb|EMT28170.1| Calmodulin-related protein [Aegilops tauschii]
 gb|AGT16211.1| calmodulin [Saccharum hybrid cultivar R570]
 gb|AGT16609.1| calmodulin [Saccharum hybrid cultivar R570]
 gb|AGT17164.1| calmodulin [Saccharum hybrid cultivar R570]
 emb|CDM82802.1| unnamed protein product [Triticum aestivum]
 prf||1604476A calmodulin
 prf||2121384B calmodulin
Length=149

 Score =   297 bits (760),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 147/148 (99%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQI+EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDDQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMA  148


 Score = 63.5 bits (153),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  133  GDGQINYEEFVKVMMAK  149



>ref|XP_004251248.1| PREDICTED: calmodulin [Solanum lycopersicum]
Length=180

 Score =   298 bits (763),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 147/148 (99%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINY+EFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYDEFVKVMMA  148


 Score = 64.7 bits (156),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 53/81 (65%), Gaps = 3/81 (4%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLM--ARKMK  308
            G+G I++ EF+ +M   R+MK
Sbjct  133  GDGQINYDEFVKVMMAKRRMK  153



>gb|ACG63497.1| TCH [Ipomoea batatas]
Length=149

 Score =   297 bits (760),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 147/148 (99%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MAD+LTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADKLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMA  148


 Score = 63.9 bits (154),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  133  GDGQINYEEFVKVMMAK  149



>ref|XP_006369409.1| calmodulin-like protein 6a [Populus trichocarpa]
 ref|XP_011008391.1| PREDICTED: calmodulin [Populus euphratica]
 sp|P93171.3|CALM_HELAN RecName: Full=Calmodulin; Short=CaM [Helianthus annuus]
 gb|AAB68399.1| calmodulin [Helianthus annuus]
 gb|ERP65978.1| calmodulin-like protein 6a [Populus trichocarpa]
Length=149

 Score =   297 bits (760),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 147/148 (99%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLT+DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTEDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMA  148


 Score = 63.9 bits (154),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  133  GDGQINYEEFVKVMMAK  149



>ref|NP_001238237.1| calmodulin [Glycine max]
 ref|NP_001236711.1| calmodulin [Glycine max]
 ref|NP_001242690.1| uncharacterized protein LOC100817351 [Glycine max]
 ref|XP_003519492.1| PREDICTED: calmodulin-like [Glycine max]
 ref|XP_003545473.1| PREDICTED: calmodulin-like isoform 1 [Glycine max]
 ref|XP_003617142.1| Calmodulin [Medicago truncatula]
 ref|XP_004491196.1| PREDICTED: calmodulin-like [Cicer arietinum]
 ref|XP_006832892.1| hypothetical protein AMTR_s00095p00113890 [Amborella trichopoda]
 ref|XP_007141556.1| hypothetical protein PHAVU_008G206000g [Phaseolus vulgaris]
 ref|XP_007151806.1| hypothetical protein PHAVU_004G076400g [Phaseolus vulgaris]
 sp|P17928.2|CALM_MEDSA RecName: Full=Calmodulin; Short=CaM [Medicago sativa]
 gb|AAM81203.1|AF494220_1 calmodulin 2 [Medicago truncatula]
 emb|CAA36644.1| unnamed protein product [Medicago sativa]
 gb|AAA34013.1| calmodulin [Glycine max]
 gb|AAA34014.1| calmodulin [Glycine max]
 gb|AAA34238.1| calmodulin [Vigna radiata]
 gb|AAD10244.1| calmodulin [Phaseolus vulgaris]
 gb|ACJ84019.1| unknown [Medicago truncatula]
 gb|ACU13174.1| unknown [Glycine max]
 gb|AET00101.1| EF hand calcium-binding family protein [Medicago truncatula]
 gb|AFK39142.1| unknown [Medicago truncatula]
 gb|AFK45641.1| unknown [Lotus japonicus]
 gb|ERM98170.1| hypothetical protein AMTR_s00095p00113890 [Amborella trichopoda]
 gb|ESW13550.1| hypothetical protein PHAVU_008G206000g [Phaseolus vulgaris]
 gb|ESW23800.1| hypothetical protein PHAVU_004G076400g [Phaseolus vulgaris]
 gb|KHN15001.1| Calmodulin [Glycine soja]
 gb|KHN22536.1| Calmodulin [Glycine soja]
 gb|KHN24729.1| Calmodulin [Glycine soja]
 gb|KHN26018.1| Calmodulin [Glycine soja]
 gb|KHN38426.1| Calmodulin [Glycine soja]
 gb|KHN42153.1| Calmodulin [Glycine soja]
 gb|KHN43683.1| Calmodulin [Glycine soja]
 prf||2121384A calmodulin
 prf||2121384C calmodulin
Length=149

 Score =   297 bits (760),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 147/148 (99%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTD+QISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDEQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMA  148


 Score = 63.9 bits (154),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  133  GDGQINYEEFVKVMMAK  149



>tpg|DAA41801.1| TPA: calmodulin, partial [Zea mays]
Length=182

 Score =   298 bits (763),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 147/148 (99%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQI+EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDDQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMA  148


 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 50/78 (64%), Gaps = 1/78 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARKM  305
            G+G I++ EF+ +M  K 
Sbjct  133  GDGQINYEEFVKVMMAKW  150



>gb|AAT73618.1| calmodulin cam-205 [Daucus carota]
Length=149

 Score =   296 bits (759),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 147/148 (99%), Positives = 147/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQISEFKEAFSLFDKDGDGCI TKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCIATKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMA  148


 Score = 63.5 bits (153),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  133  GDGQINYEEFVKVMMAK  149



>ref|XP_008810798.1| PREDICTED: calmodulin-7-like [Phoenix dactylifera]
Length=149

 Score =   296 bits (759),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 147/148 (99%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDS+EELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSDEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMA  148


 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSDEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  133  GDGQINYEEFVKVMMAK  149



>ref|XP_004249098.1| PREDICTED: calmodulin [Solanum lycopersicum]
 ref|XP_006340365.1| PREDICTED: calmodulin-like [Solanum tuberosum]
 ref|XP_006364752.1| PREDICTED: calmodulin-like [Solanum tuberosum]
 ref|XP_006419159.1| hypothetical protein EUTSA_v10002700mg [Eutrema salsugineum]
 ref|XP_009126509.1| PREDICTED: calmodulin [Brassica rapa]
 ref|XP_009131839.1| PREDICTED: calmodulin [Brassica rapa]
 ref|XP_009630239.1| PREDICTED: calmodulin [Nicotiana tomentosiformis]
 ref|XP_009757652.1| PREDICTED: calmodulin [Nicotiana sylvestris]
 ref|XP_010557478.1| PREDICTED: calmodulin [Tarenaya hassleriana]
 sp|P93087.3|CALM_CAPAN RecName: Full=Calmodulin; Short=CaM [Capsicum annuum]
 gb|AAB46588.1| calmodulin [Capsicum annuum]
 gb|AAF65511.1| calmodulin [Capsicum annuum]
 dbj|BAB61915.1| calmodulin NtCaM9 [Nicotiana tabacum]
 dbj|BAB61916.1| calmodulin NtCaM10 [Nicotiana tabacum]
 emb|CAD20351.1| calmodulin 2 [Brassica oleracea]
 gb|AAS13433.1| calmodulin [Nicotiana attenuata]
 gb|AAT40502.1| Calmodulin , putative [Solanum demissum]
 gb|ABA81860.1| calmodulin-like [Solanum tuberosum]
 gb|ABE11610.1| calmodulin [Solanum chacoense]
 gb|ACF93134.1| calmodulin [Camellia oleifera]
 gb|ACM89455.1| calmodulin 2 [Camellia oleifera]
 gb|AFA26559.1| calmodulin [Brassica oleracea]
 gb|AFA26560.1| calmodulin [Brassica oleracea]
 gb|AFA26561.1| calmodulin [Brassica oleracea]
 gb|AFA26562.1| calmodulin [Brassica oleracea]
 gb|AFW90602.1| calmodulin [Solanum tuberosum]
 gb|ESQ37595.1| hypothetical protein EUTSA_v10002700mg [Eutrema salsugineum]
 gb|EYU35666.1| hypothetical protein MIMGU_mgv1a015693mg [Erythranthe guttata]
 gb|KFK33864.1| hypothetical protein AALP_AA5G069900 [Arabis alpina]
 emb|CDY16599.1| BnaC09g36740D [Brassica napus]
 emb|CDY09106.1| BnaA02g05320D [Brassica napus]
 emb|CDX88824.1| BnaA03g08250D [Brassica napus]
 emb|CDX87950.1| BnaC03g54460D [Brassica napus]
 emb|CDX70966.1| BnaC03g10500D [Brassica napus]
 gb|KJB21750.1| hypothetical protein B456_004G012100 [Gossypium raimondii]
Length=149

 Score =   296 bits (759),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 147/148 (99%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINY+EFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYDEFVKVMMA  148


 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  133  GDGQINYDEFVKVMMAK  149



>emb|CAH57708.1| calmodulin [Quercus petraea]
Length=149

 Score =   296 bits (759),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 147/148 (99%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTD+
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDD  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMA  148


 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDDEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  133  GDGQINYEEFVKVMMAK  149



>gb|AAT73616.1| calmodulin cam-203 [Daucus carota]
Length=149

 Score =   296 bits (759),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 147/148 (99%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDG+INYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGRINYEEFVKVMMA  148


 Score = 63.5 bits (153),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  133  GDGRINYEEFVKVMMAK  149



>ref|XP_004252866.2| PREDICTED: LOW QUALITY PROTEIN: calmodulin [Solanum lycopersicum]
Length=178

 Score =   297 bits (761),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 147/148 (99%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINY+EFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYDEFVKVMMA  148


 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  133  GDGQINYDEFVKVMMAK  149



>gb|AAA16320.1| calmodulin [Bryonia dioica]
Length=149

 Score =   296 bits (758),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 147/148 (99%), Positives = 147/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQ NYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQTNYEEFVKVMMA  148


 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 49/77 (64%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G  ++ EF+ +M  K
Sbjct  133  GDGQTNYEEFVKVMMAK  149



>gb|ABR21718.1| calmodulin [Actinidia melliana]
 gb|ABR21724.1| calmodulin [Clematoclethra scandens subsp. tomentella]
 gb|ABR21745.1| calmodulin [Actinidia polygama]
 gb|ABR21747.1| calmodulin [Actinidia melliana]
 gb|ABR21757.1| calmodulin [Actinidia polygama]
Length=148

 Score =   296 bits (758),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 147/148 (99%), Positives = 147/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MAD LTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADSLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMA  148



>ref|XP_009150282.1| PREDICTED: calmodulin-like [Brassica rapa]
 ref|XP_009103571.1| PREDICTED: calmodulin-like [Brassica rapa]
 emb|CDY56411.1| BnaC04g54820D [Brassica napus]
 emb|CDY04474.1| BnaA07g13000D [Brassica napus]
Length=149

 Score =   296 bits (758),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 146/148 (99%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEM+READVDGDGQINY+EFVKVMMA
Sbjct  121  EVDEMVREADVDGDGQINYDEFVKVMMA  148


 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +M+ E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMVREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  133  GDGQINYDEFVKVMMAK  149



>ref|XP_004144099.1| PREDICTED: calmodulin-related protein-like [Cucumis sativus]
 ref|XP_004159338.1| PREDICTED: calmodulin-related protein-like [Cucumis sativus]
 ref|XP_008451038.1| PREDICTED: calmodulin-7-like [Cucumis melo]
 gb|KGN66386.1| hypothetical protein Csa_1G600260 [Cucumis sativus]
Length=149

 Score =   296 bits (758),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 146/148 (99%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MA+QLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MAEQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVK+MMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKIMMA  148


 Score = 63.9 bits (154),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  133  GDGQINYEEFVKIMMAK  149



>ref|XP_010553894.1| PREDICTED: calmodulin-7-like [Tarenaya hassleriana]
 gb|ADN96172.1| calmodulin [Malus pumila]
Length=149

 Score =   296 bits (758),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 146/148 (99%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EV+EMIREADVDGDGQINYEEFVK+MMA
Sbjct  121  EVEEMIREADVDGDGQINYEEFVKIMMA  148


 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 51/77 (66%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+++MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVEEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  133  GDGQINYEEFVKIMMAK  149



>emb|CAA61980.1| Calmodulin [Bidens pilosa]
Length=149

 Score =   296 bits (757),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 147/148 (99%), Positives = 147/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISA ELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISARELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMA  148


 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 51/77 (66%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+ +EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISARELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  133  GDGQINYEEFVKVMMAK  149



>gb|AAT73614.1| calmodulin cam-201 [Daucus carota]
Length=149

 Score =   296 bits (757),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 147/148 (99%), Positives = 147/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINY EFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYVEFVKVMMA  148


 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  133  GDGQINYVEFVKVMMAK  149



>ref|XP_010521595.1| PREDICTED: calmodulin [Tarenaya hassleriana]
Length=178

 Score =   296 bits (759),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 146/148 (99%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTD+QISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMI+EVDADG
Sbjct  1    MADQLTDEQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMIHEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMA  148


 Score = 65.1 bits (157),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 51/79 (65%), Gaps = 1/79 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARKMK  308
            G+G I++ EF+ +M  K +
Sbjct  133  GDGQINYEEFVKVMMAKRR  151



>gb|AAL79908.1|AF474074_1 calmodulin [Stevia rebaudiana]
 gb|AAL73544.1| calmodulin [Stevia rebaudiana]
 gb|AAV88359.1| calmodulin [Hevea brasiliensis]
 gb|AAV88360.1| calmodulin [Hevea brasiliensis]
 gb|ABR21707.1| calmodulin [Actinidia chinensis]
 gb|ABR21710.1| calmodulin [Actinidia deliciosa var. deliciosa]
 gb|ABR21712.1| calmodulin [Actinidia eriantha f. alba]
 gb|ABR21713.1| calmodulin [Actinidia eriantha var. eriantha]
 gb|ABR21714.1| calmodulin [Actinidia eriantha var. eriantha]
 gb|ABR21715.1| calmodulin [Actinidia sabiifolia]
 gb|ABR21717.1| calmodulin [Actinidia sabiifolia]
 gb|ABR21720.1| calmodulin [Actinidia arguta]
 gb|ABR21721.1| calmodulin [Actinidia sabiifolia]
 gb|ABR21722.1| calmodulin [Actinidia polygama]
 gb|ABR21723.1| calmodulin [Actinidia valvata]
 gb|ABR21736.1| calmodulin [Clematoclethra scandens subsp. tomentella]
 gb|ABR21737.1| calmodulin [Clematoclethra scandens subsp. tomentella]
 gb|ABR21738.1| calmodulin [Clematoclethra scandens subsp. tomentella]
 gb|ABR21739.1| calmodulin [Actinidia deliciosa var. deliciosa]
 gb|ABR21740.1| calmodulin [Actinidia eriantha var. eriantha]
 gb|ABR21742.1| calmodulin [Actinidia chinensis]
 gb|ABR21743.1| calmodulin [Actinidia sabiifolia]
 gb|ABR21748.1| calmodulin [Actinidia deliciosa var. deliciosa]
 gb|ABR21749.1| calmodulin [Actinidia sabiifolia]
 gb|ABR21751.1| calmodulin [Actinidia kolomikta]
 gb|ABR21752.1| calmodulin [Actinidia polygama]
 gb|ABR21753.1| calmodulin [Actinidia eriantha var. eriantha]
 gb|ABR21755.1| calmodulin [Actinidia arguta]
 gb|ABR21758.1| calmodulin [Actinidia chinensis]
 gb|ABR21760.1| calmodulin [Actinidia eriantha f. alba]
 gb|ABR21763.1| calmodulin [Actinidia deliciosa var. deliciosa]
 gb|ABR21764.1| calmodulin [Actinidia melliana]
 gb|ABR21766.1| calmodulin [Clematoclethra scandens subsp. tomentella]
 gb|ABR21768.1| calmodulin [Actinidia polygama]
 gb|ABR21770.1| calmodulin [Saurauia tristyla]
Length=148

 Score =   295 bits (756),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 147/148 (99%), Positives = 147/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MAD LTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADPLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMA  148



>gb|ACT53872.1| calmodulin [Saccharum officinarum]
Length=149

 Score =   295 bits (756),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 146/148 (99%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQI+EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQD+INEVDADG
Sbjct  1    MADQLTDDQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDIINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMA  148


 Score = 63.9 bits (154),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  133  GDGQINYEEFVKVMMAK  149



>emb|CAC84562.1| putative calmodulin [Solanum commersonii]
Length=149

 Score =   295 bits (756),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 146/148 (99%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTE+ELQDMINEVDADG
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTESELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNL+ARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLVARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMA  148


 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 45/69 (65%), Gaps = 0/69 (0%)
 Frame = +3

Query  96   DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFP  275
            D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D DG+G I++ 
Sbjct  81   DSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYE  140

Query  276  EFLNLMARK  302
            EF+ +M  K
Sbjct  141  EFVKVMMAK  149



>gb|KHN34595.1| Calmodulin [Glycine soja]
Length=149

 Score =   295 bits (756),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 146/148 (99%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MA+QLTD+QISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MANQLTDEQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMA  148


 Score = 63.9 bits (154),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  133  GDGQINYEEFVKVMMAK  149



>gb|AAT73619.1| calmodulin cam-206 [Daucus carota]
Length=149

 Score =   295 bits (756),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 147/148 (99%), Positives = 147/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDS EELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSGEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMA  148


 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSGEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  133  GDGQINYEEFVKVMMAK  149



>gb|KFK26360.1| hypothetical protein AALP_AA8G238300 [Arabis alpina]
 emb|CDY65072.1| BnaCnng45820D [Brassica napus]
Length=149

 Score =   295 bits (756),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 146/148 (99%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMI+EADVDGDGQINY+EFVKVMMA
Sbjct  121  EVDEMIKEADVDGDGQINYDEFVKVMMA  148


 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIKEADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  133  GDGQINYDEFVKVMMAK  149



>gb|AEG75427.1| calmodulin [Aquilaria microcarpa]
Length=149

 Score =   295 bits (756),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 146/148 (99%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMA+KMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMAKKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINY+EFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYDEFVKVMMA  148


 Score = 63.5 bits (153),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MAKKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  133  GDGQINYDEFVKVMMAK  149



>ref|XP_009391621.1| PREDICTED: calmodulin [Musa acuminata subsp. malaccensis]
 ref|XP_009399942.1| PREDICTED: calmodulin [Musa acuminata subsp. malaccensis]
 ref|XP_009419839.1| PREDICTED: calmodulin [Musa acuminata subsp. malaccensis]
Length=149

 Score =   295 bits (756),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 146/148 (99%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MA+QLTDDQI+EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MAEQLTDDQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMA  148


 Score = 63.9 bits (154),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  133  GDGQINYEEFVKVMMAK  149



>ref|NP_001105490.1| calmodulin [Zea mays]
 ref|XP_004961667.1| PREDICTED: calmodulin-2-like isoform X3 [Setaria italica]
 ref|XP_007146213.1| hypothetical protein PHAVU_006G021800g [Phaseolus vulgaris]
 emb|CAA46150.1| calmodulin [Oryza sativa]
 emb|CAA74307.1| calmodulin [Zea mays]
 gb|AAD10246.1| calmodulin [Phaseolus vulgaris]
 gb|ABK56718.1| unknown [Hordeum vulgare]
 gb|ACF87450.1| unknown [Zea mays]
 gb|ACG24747.1| calmodulin [Zea mays]
 gb|ACG27341.1| calmodulin [Zea mays]
 dbj|BAJ85642.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ99455.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|AFW78486.1| calmodulin1 isoform 1 [Zea mays]
 gb|AFW78487.1| calmodulin1 isoform 2 [Zea mays]
 gb|AFW82363.1| calmodulin isoform 1 [Zea mays]
 gb|AFW82364.1| calmodulin isoform 2 [Zea mays]
 gb|AFW90531.1| calmodulin [Phaseolus vulgaris]
 gb|EMS61705.1| Calmodulin [Triticum urartu]
 gb|EMT03295.1| Calmodulin [Aegilops tauschii]
 gb|ESW18207.1| hypothetical protein PHAVU_006G021800g [Phaseolus vulgaris]
 gb|AHY21740.1| calmodulin [Triticum turgidum subsp. durum]
Length=149

 Score =   295 bits (756),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 146/148 (99%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTD+QI+EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDEQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMA  148


 Score = 63.9 bits (154),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  133  GDGQINYEEFVKVMMAK  149



>ref|XP_009405855.1| PREDICTED: calmodulin [Musa acuminata subsp. malaccensis]
 ref|XP_009384966.1| PREDICTED: calmodulin [Musa acuminata subsp. malaccensis]
Length=149

 Score =   295 bits (756),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 146/148 (99%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MA+QLTD+QISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MAEQLTDEQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMA  148


 Score = 63.9 bits (154),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  133  GDGQINYEEFVKVMMAK  149



>gb|AAC16663.1| calmodulin [Apium graveolens]
Length=150

 Score =   295 bits (756),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 147/148 (99%), Positives = 147/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAF VFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFLVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMA  148



>gb|ACF84469.1| unknown [Zea mays]
Length=149

 Score =   295 bits (756),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 146/148 (99%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQI+EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDDQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDG+INYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGRINYEEFVKVMMA  148


 Score = 63.5 bits (153),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  133  GDGRINYEEFVKVMMAK  149



>sp|A2WNH1.2|CALM3_ORYSI RecName: Full=Calmodulin-3; Short=CaM-3 [Oryza sativa Indica 
Group]
 emb|CAA78288.1| calmodulin [Oryza sativa Indica Group]
 gb|AAA33900.1| calmodulin [Oryza sativa Indica Group]
 gb|EEC70407.1| hypothetical protein OsI_01399 [Oryza sativa Indica Group]
Length=149

 Score =   295 bits (756),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 146/148 (99%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQI+EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDDQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINY+EFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYDEFVKVMMA  148


 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  133  GDGQINYDEFVKVMMAK  149



>gb|AFK42378.1| unknown [Medicago truncatula]
Length=149

 Score =   295 bits (755),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 147/148 (99%), Positives = 147/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFI AAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFIFAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMA  148


 Score = 62.0 bits (149),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 49/77 (64%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I   EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFIFAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  133  GDGQINYEEFVKVMMAK  149



>ref|XP_009402452.1| PREDICTED: calmodulin [Musa acuminata subsp. malaccensis]
Length=149

 Score =   295 bits (755),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 146/148 (99%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MA+QLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MAEQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINY+EFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYDEFVKVMMA  148


 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  133  GDGQINYDEFVKVMMAK  149



>ref|NP_001275359.1| calmodulin-5/6/7/8 [Solanum tuberosum]
 ref|XP_004228488.1| PREDICTED: calmodulin-5/6/7/8 [Solanum lycopersicum]
 sp|Q7DMN9.3|CALM5_SOLTU RecName: Full=Calmodulin-5/6/7/8; Short=CaM-5/6/7/8 [Solanum 
tuberosum]
 pdb|1RFJ|A Chain A, Crystal Structure Of Potato Calmodulin Pcm6
 gb|AAA62351.1| calmodulin [Solanum tuberosum]
 gb|AAA85155.1| calmodulin [Solanum tuberosum]
 gb|AAA85156.1| calmodulin [Solanum tuberosum]
 gb|AAA85157.1| calmodulin [Solanum tuberosum]
 emb|CAC84561.1| putative calmodulin [Solanum commersonii]
 gb|ABA40458.1| calmodulin 5/6/7/8-like protein [Solanum tuberosum]
 gb|ABA46768.1| putative calmodulin-like protein [Solanum tuberosum]
Length=149

 Score =   295 bits (755),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 146/148 (99%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLT+DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTEDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINY+EFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYDEFVKVMMA  148


 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  133  GDGQINYDEFVKVMMAK  149



>ref|XP_004142655.1| PREDICTED: calmodulin-like isoform 1 [Cucumis sativus]
 ref|XP_004142656.1| PREDICTED: calmodulin-like isoform 2 [Cucumis sativus]
 ref|XP_004172209.1| PREDICTED: calmodulin-like isoform 1 [Cucumis sativus]
 ref|XP_004172210.1| PREDICTED: calmodulin-like isoform 2 [Cucumis sativus]
 ref|XP_008464615.1| PREDICTED: calmodulin [Cucumis melo]
 gb|KGN54503.1| hypothetical protein Csa_4G340540 [Cucumis sativus]
Length=149

 Score =   295 bits (755),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 146/148 (99%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTEE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINY+EFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYDEFVKVMMA  148


 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  TE E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTEEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  133  GDGQINYDEFVKVMMAK  149



>gb|AFA89864.1| calmodulin 4 [Lilium longiflorum]
 gb|KHF98916.1| Calmodulin [Gossypium arboreum]
 gb|KHG12364.1| Calmodulin [Gossypium arboreum]
 gb|KJB83641.1| hypothetical protein B456_013G256400 [Gossypium raimondii]
Length=149

 Score =   295 bits (755),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 146/148 (99%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTD+QISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDEQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINY+EFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYDEFVKVMMA  148


 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  133  GDGQINYDEFVKVMMAK  149



>sp|P48976.2|CALM_MALDO RecName: Full=Calmodulin; Short=CaM [Malus domestica]
 emb|CAA43142.1| Calmodulin [Malus domestica]
Length=149

 Score =   295 bits (755),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 147/148 (99%), Positives = 147/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPE LNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEPLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMA  148


 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  133  GDGQINYEEFVKVMMAK  149



>gb|AAT73620.1| caomodulin cam-207 [Daucus carota]
Length=149

 Score =   295 bits (755),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 147/148 (99%), Positives = 147/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVM SLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMGSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMA  148


 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  133  GDGQINYEEFVKVMMAK  149



>gb|ABR21756.1| calmodulin [Actinidia polygama]
Length=148

 Score =   295 bits (755),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 146/148 (99%), Positives = 147/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MAD LTDDQI+EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADSLTDDQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMA  148



>gb|AFK45794.1| unknown [Lotus japonicus]
Length=149

 Score =   295 bits (754),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 147/148 (99%), Positives = 147/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQISEFKEAFSLFDKDGDG ITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGSITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMA  148


 Score = 63.9 bits (154),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  133  GDGQINYEEFVKVMMAK  149



>ref|XP_003567308.1| PREDICTED: calmodulin-3 [Brachypodium distachyon]
 gb|AAC49582.1| calmodulin TaCaM2-2 [Triticum aestivum]
 gb|AAC49583.1| calmodulin TaCaM2-3 [Triticum aestivum]
 gb|EMS58580.1| Calmodulin-3 [Triticum urartu]
 emb|CDM82931.1| unnamed protein product [Triticum aestivum]
Length=149

 Score =   295 bits (754),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 145/148 (98%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQI+EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDDQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEM+READVDGDGQINY+EFVKVMMA
Sbjct  121  EVDEMVREADVDGDGQINYDEFVKVMMA  148


 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +M+ E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMVREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  133  GDGQINYDEFVKVMMAK  149



>gb|ACL13151.1| calmodulin 1 [Capsicum annuum]
Length=149

 Score =   295 bits (754),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 146/148 (99%), Positives = 147/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMA+KMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMAKKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREAD DGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADFDGDGQINYEEFVKVMMA  148


 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MAKKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADFD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  133  GDGQINYEEFVKVMMAK  149



>ref|XP_009419686.1| PREDICTED: calmodulin-like [Musa acuminata subsp. malaccensis]
Length=149

 Score =   295 bits (754),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 145/148 (98%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MA+QLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MAEQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINY+EFVK+MMA
Sbjct  121  EVDEMIREADVDGDGQINYDEFVKIMMA  148


 Score = 63.5 bits (153),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  133  GDGQINYDEFVKIMMAK  149



>ref|XP_009393093.1| PREDICTED: calmodulin-like [Musa acuminata subsp. malaccensis]
Length=149

 Score =   295 bits (754),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 145/148 (98%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MA+QLTD+QISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MAEQLTDEQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVK+MMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKIMMA  148


 Score = 64.3 bits (155),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  133  GDGQINYEEFVKIMMAK  149



>ref|XP_009116373.1| PREDICTED: calmodulin-5 [Brassica rapa]
Length=149

 Score =   295 bits (754),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 146/148 (99%), Positives = 147/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMI+ ADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIKVADVDGDGQINYEEFVKVMMA  148


 Score = 60.8 bits (146),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 49/77 (64%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI   D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIKVADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  133  GDGQINYEEFVKVMMAK  149



>gb|ABR21744.1| calmodulin [Actinidia deliciosa var. deliciosa]
Length=148

 Score =   295 bits (754),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 146/148 (99%), Positives = 146/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MAD LTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADSLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEE VKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEELVKVMMA  148



>gb|ACU22802.1| unknown [Glycine max]
Length=149

 Score =   295 bits (754),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 146/148 (99%), Positives = 147/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTD+QISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDEQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVM NLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMINLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMA  148


 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMINLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  133  GDGQINYEEFVKVMMAK  149



>ref|NP_001167666.1| calmodulin [Zea mays]
 gb|ACG30831.1| calmodulin [Zea mays]
Length=149

 Score =   294 bits (753),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 146/148 (99%), Positives = 147/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQI+EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDDQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINY EFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYVEFVKVMMA  148


 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  133  GDGQINYVEFVKVMMAK  149



>emb|CDY55678.1| BnaC06g43530D [Brassica napus]
Length=149

 Score =   294 bits (753),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 144/148 (97%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTD+QISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDEQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMA+KMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMAKKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEM+READVDGDGQINYEEFVK+MMA
Sbjct  121  EVDEMVREADVDGDGQINYEEFVKIMMA  148


 Score = 63.9 bits (154),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +M+ E D D
Sbjct  73   MAKKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMVREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  133  GDGQINYEEFVKIMMAK  149



>gb|AFY26192.1| calmodulin-1 [Vaccinium corymbosum]
Length=149

 Score =   294 bits (753),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 146/148 (99%), Positives = 147/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDK+QNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKNQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINY EFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYVEFVKVMMA  148


 Score = 62.0 bits (149),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDK+ +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKNQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  133  GDGQINYVEFVKVMMAK  149



>gb|ABN79277.1| calmodulin [Noccaea caerulescens]
Length=149

 Score =   294 bits (753),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 145/148 (98%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKL+DE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLSDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMI+EADVDGDGQINY+EFVKVMMA
Sbjct  121  EVDEMIKEADVDGDGQINYDEFVKVMMA  148


 Score = 62.4 bits (150),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLSDEEVDEMIKEADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  133  GDGQINYDEFVKVMMAK  149



>gb|ADK23955.1| calmodulin [Aquilaria microcarpa]
 gb|ADK23956.1| calmodulin [Aquilaria microcarpa]
 gb|AEG75428.1| calmodulin [Aquilaria microcarpa]
Length=149

 Score =   294 bits (753),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 146/148 (99%), Positives = 147/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQISEFKEAFSLFDKDGDG ITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGSITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEM+READVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMVREADVDGDGQINYEEFVKVMMA  148


 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +M+ E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMVREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  133  GDGQINYEEFVKVMMAK  149



>ref|NP_001055907.1| Os05g0491100 [Oryza sativa Japonica Group]
 ref|XP_006654579.1| PREDICTED: calmodulin-2-like [Oryza brachyantha]
 sp|Q6F332.3|CALM2_ORYSJ RecName: Full=Calmodulin-2; Short=CaM-2 [Oryza sativa Japonica 
Group]
 sp|A2Y609.1|CALM2_ORYSI RecName: Full=Calmodulin-2; Short=CaM-2 [Oryza sativa Indica 
Group]
 gb|AAL35328.1|AF441190_1 calmodulin [Oryza sativa]
 gb|AAC36058.1| calmodulin [Oryza sativa]
 gb|AAT69643.1| putative calmodulin [Oryza sativa Japonica Group]
 dbj|BAF17821.1| Os05g0491100 [Oryza sativa Japonica Group]
 gb|EAY98519.1| hypothetical protein OsI_20431 [Oryza sativa Indica Group]
 dbj|BAG87023.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99558.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00572.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64193.1| hypothetical protein OsJ_19025 [Oryza sativa Japonica Group]
Length=149

 Score =   294 bits (753),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 145/148 (98%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTD+QI+EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDEQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMA+KMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMAKKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMA  148


 Score = 64.3 bits (155),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MAKKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  133  GDGQINYEEFVKVMMAK  149



>gb|AGZ84228.1| calmodulin [Arachis hypogaea]
Length=149

 Score =   294 bits (753),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 146/148 (99%), Positives = 147/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MAD LTD+QISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADPLTDEQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMA  148


 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  133  GDGQINYEEFVKVMMAK  149



>gb|ABG82015.1| calmodulin [Vigna radiata var. radiata]
Length=148

 Score =   294 bits (752),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 146/148 (99%), Positives = 147/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MAD LTDDQI+EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADPLTDDQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMA  148



>gb|ABD60149.1| calmodulin [Vigna unguiculata]
 gb|ABQ45408.1| calmodulin [Triticum aestivum]
Length=148

 Score =   294 bits (752),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 146/148 (99%), Positives = 147/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MAD LTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADPLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAA+LRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAKLRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMA  148



>gb|ABR21762.1| calmodulin [Actinidia eriantha f. alba]
Length=148

 Score =   294 bits (752),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 146/148 (99%), Positives = 147/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MAD LTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMI+EVDADG
Sbjct  1    MADPLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMISEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMA  148



>gb|ABR21711.1| calmodulin [Actinidia deliciosa var. chlorocarpa]
Length=148

 Score =   294 bits (752),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 146/148 (99%), Positives = 147/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MAD LTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADPLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFL+LMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLSLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMA  148



>ref|XP_009417893.1| PREDICTED: calmodulin-3 [Musa acuminata subsp. malaccensis]
Length=149

 Score =   294 bits (752),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 145/148 (98%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MA+QLTDDQI+EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MAEQLTDDQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINY+EFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYDEFVKVMMA  148


 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  133  GDGQINYDEFVKVMMAK  149



>ref|NP_001042747.1| Os01g0279300 [Oryza sativa Japonica Group]
 sp|Q0JNL7.1|CALM3_ORYSJ RecName: Full=Calmodulin-3; Short=CaM-3 [Oryza sativa Japonica 
Group]
 dbj|BAA87825.1| calmodulin [Oryza sativa Japonica Group]
 dbj|BAF04661.1| Os01g0279300 [Oryza sativa Japonica Group]
 dbj|BAG86763.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE54334.1| hypothetical protein OsJ_01307 [Oryza sativa Japonica Group]
Length=149

 Score =   294 bits (752),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 145/148 (98%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQI+EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDDQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EV+EMIREADVDGDGQINY+EFVKVMMA
Sbjct  121  EVEEMIREADVDGDGQINYDEFVKVMMA  148


 Score = 64.3 bits (155),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 51/77 (66%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+++MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVEEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  133  GDGQINYDEFVKVMMAK  149



>ref|NP_001105547.1| calmodulin2 [Zea mays]
 emb|CAA54583.1| calmodulin [Zea mays]
 gb|ACR34795.1| unknown [Zea mays]
 tpg|DAA54034.1| TPA: calmodulin2 [Zea mays]
Length=149

 Score =   294 bits (752),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 145/148 (98%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTD+QI+EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDEQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINY+EFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYDEFVKVMMA  148


 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  133  GDGQINYDEFVKVMMAK  149



>ref|XP_010673215.1| PREDICTED: calmodulin [Beta vulgaris subsp. vulgaris]
Length=149

 Score =   294 bits (752),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 145/148 (98%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MA+QLTD+QI+EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MAEQLTDEQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMA  148


 Score = 63.9 bits (154),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  133  GDGQINYEEFVKVMMAK  149



>gb|ABR21729.1| calmodulin [Actinidia melliana]
 gb|ABR21732.1| calmodulin [Actinidia deliciosa var. deliciosa]
 gb|ABR21733.1| calmodulin [Actinidia eriantha var. eriantha]
 gb|ABR21734.1| calmodulin [Actinidia eriantha var. eriantha]
 gb|ABR21735.1| calmodulin [Actinidia eriantha var. eriantha]
 gb|ABR21765.1| calmodulin [Actinidia kolomikta]
Length=148

 Score =   294 bits (752),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 146/148 (99%), Positives = 147/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MAD LTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADPLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDS+EELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSDEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMA  148



>gb|AAD10245.1| calmodulin [Phaseolus vulgaris]
Length=149

 Score =   294 bits (752),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 146/148 (99%), Positives = 147/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTD+QISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDEQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLT E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTYE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMA  148


 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 49/77 (64%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T  E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTYEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  133  GDGQINYEEFVKVMMAK  149



>gb|AAF73157.1|AF150059_1 calmodulin [Brassica napus]
Length=149

 Score =   294 bits (752),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 146/148 (99%), Positives = 147/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISA ELRHVMTNLGEKLTD+
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISADELRHVMTNLGEKLTDD  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMA  148


 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISADELRHVMTNLGEKLTDDEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  133  GDGQINYEEFVKVMMAK  149



>ref|NP_001236109.1| uncharacterized protein LOC100527439 [Glycine max]
 gb|ACU16530.1| unknown [Glycine max]
Length=149

 Score =   294 bits (752),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 145/148 (98%), Positives = 147/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MA+QLTD+QISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MANQLTDEQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMM 
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMT  148


 Score = 63.9 bits (154),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  133  GDGQINYEEFVKVMMTK  149



>gb|ABR21750.1| calmodulin [Actinidia melliana]
Length=148

 Score =   293 bits (751),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 146/148 (99%), Positives = 146/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MAD LTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMIN VDADG
Sbjct  1    MADSLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINGVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMA  148



>ref|XP_009404694.1| PREDICTED: calmodulin-like [Musa acuminata subsp. malaccensis]
Length=149

 Score =   293 bits (751),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 145/148 (98%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MA+QLTD+QISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MAEQLTDEQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINY+EFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYDEFVKVMMA  148


 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  133  GDGQINYDEFVKVMMAK  149



>ref|XP_009380569.1| PREDICTED: calmodulin-like [Musa acuminata subsp. malaccensis]
Length=194

 Score =   295 bits (756),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 146/152 (96%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = +3

Query  63   RALTMADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEV  242
            R   MA+QLTDDQI+EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEV
Sbjct  42   RGGGMAEQLTDDQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEV  101

Query  243  DADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEK  422
            DADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEK
Sbjct  102  DADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEK  161

Query  423  LTDEEVDEMIREADVDGDGQINYEEFVKVMMA  518
            LTDEEVDEMIREADVDGDGQINYEEFVK+MMA
Sbjct  162  LTDEEVDEMIREADVDGDGQINYEEFVKIMMA  193


 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  118  MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  177

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  178  GDGQINYEEFVKIMMAK  194



>gb|ABR21725.1| calmodulin [Clematoclethra scandens subsp. tomentella]
Length=148

 Score =   293 bits (751),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 146/148 (99%), Positives = 146/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MAD LTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADPLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVM NLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMANLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMA  148



>gb|ABR21746.1| calmodulin [Actinidia valvata]
Length=148

 Score =   293 bits (751),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 146/148 (99%), Positives = 146/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MAD LTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADPLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEA RVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEALRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMA  148



>ref|NP_176814.1| calmodulin 4 [Arabidopsis thaliana]
 ref|NP_198594.1| calmodulin 1 [Arabidopsis thaliana]
 ref|XP_002870564.1| hypothetical protein ARALYDRAFT_915929 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_002888498.1| hypothetical protein ARALYDRAFT_894287 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_006284698.1| hypothetical protein CARUB_v10005958mg [Capsella rubella]
 ref|XP_006302967.1| hypothetical protein CARUB_v10021106mg [Capsella rubella]
 ref|XP_006391396.1| hypothetical protein EUTSA_v10019293mg [Eutrema salsugineum]
 ref|XP_006405835.1| hypothetical protein EUTSA_v10027976mg [Eutrema salsugineum]
 ref|XP_010511465.1| PREDICTED: calmodulin-1 [Camelina sativa]
 ref|XP_010415183.1| PREDICTED: calmodulin-1 [Camelina sativa]
 ref|XP_010435687.1| PREDICTED: calmodulin-1 [Camelina sativa]
 ref|XP_010440887.1| PREDICTED: calmodulin-1 [Camelina sativa]
 ref|XP_010450539.1| PREDICTED: calmodulin-1 [Camelina sativa]
 ref|XP_010470516.1| PREDICTED: calmodulin-1 [Camelina sativa]
 sp|P0DH95.1|CALM1_ARATH RecName: Full=Calmodulin-1; Short=CaM-1 [Arabidopsis thaliana]
 sp|P0DH96.1|CALM4_ARATH RecName: Full=Calmodulin-4; Short=CaM-4 [Arabidopsis thaliana]
 gb|AAG51164.1|AC074025_14 calmodulin [Arabidopsis thaliana]
 gb|AAG52168.1|AC020665_13 calmodulin-4; 77432-76078 [Arabidopsis thaliana]
 gb|AAK44108.1|AF370293_1 putative calmodulin-4 protein [Arabidopsis thaliana]
 dbj|BAB10354.1| calmodulin-like protein [Arabidopsis thaliana]
 gb|AAK82538.1| AT5g37780/K22F20_20 [Arabidopsis thaliana]
 gb|AAL24291.1| Unknown protein [Arabidopsis thaliana]
 gb|AAL62019.1| AT5g37780/K22F20_20 [Arabidopsis thaliana]
 gb|AAL66935.1| unknown protein [Arabidopsis thaliana]
 gb|AAM44950.1| putative calmodulin-4 protein [Arabidopsis thaliana]
 gb|AAM66012.1| calmodulin CAM1 [Arabidopsis thaliana]
 gb|EFH46823.1| hypothetical protein ARALYDRAFT_915929 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64757.1| hypothetical protein ARALYDRAFT_894287 [Arabidopsis lyrata subsp. 
lyrata]
 dbj|BAJ34428.1| unnamed protein product [Thellungiella halophila]
 gb|AED94230.1| calmodulin 1 [Arabidopsis thaliana]
 gb|AEE34505.1| calmodulin 4 [Arabidopsis thaliana]
 gb|EOA17596.1| hypothetical protein CARUB_v10005958mg [Capsella rubella]
 gb|EOA35865.1| hypothetical protein CARUB_v10021106mg [Capsella rubella]
 gb|ESQ28682.1| hypothetical protein EUTSA_v10019293mg [Eutrema salsugineum]
 gb|ESQ47288.1| hypothetical protein EUTSA_v10027976mg [Eutrema salsugineum]
Length=149

 Score =   293 bits (751),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 144/148 (97%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTD+QISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDEQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMA+KMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMAKKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EV+EMIREADVDGDGQINYEEFVK+MMA
Sbjct  121  EVEEMIREADVDGDGQINYEEFVKIMMA  148


 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 51/77 (66%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+++MI E D D
Sbjct  73   MAKKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVEEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  133  GDGQINYEEFVKIMMAK  149



>gb|AFK42827.1| unknown [Lotus japonicus]
Length=149

 Score =   293 bits (751),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 146/148 (99%), Positives = 146/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQISEFKE FSLFDKDGDG ITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDDQISEFKEVFSLFDKDGDGSITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMA  148


 Score = 63.9 bits (154),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  133  GDGQINYEEFVKVMMAK  149



>gb|ABR21708.1| calmodulin [Actinidia chinensis]
Length=148

 Score =   293 bits (751),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 145/148 (98%), Positives = 147/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MAD LTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADPLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEE+LKEAFR+FDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEKLKEAFRIFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMA  148



>gb|ABH12274.1| calmodulin [Betula halophila]
Length=149

 Score =   293 bits (751),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 146/148 (99%), Positives = 147/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNL+ARKMKDTDSEEELKEAFRVFDKDQNGFISAAELR VMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLIARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRRVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMA  148


 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = +3

Query  108  EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLN  287
            E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D DG+G I++ EF+ 
Sbjct  85   ELKEAFRVFDKDQNGFISAAELRRVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  144

Query  288  LMARK  302
            +M  K
Sbjct  145  VMMAK  149



>ref|XP_003624801.1| Calmodulin [Medicago truncatula]
 gb|AES81019.1| EF hand calcium-binding family protein [Medicago truncatula]
Length=149

 Score =   293 bits (751),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 146/148 (99%), Positives = 147/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQISEFKEAFSLFDKDGDG ITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGSITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINY+EFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYDEFVKVMMA  148


 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  133  GDGQINYDEFVKVMMAK  149



>sp|P04464.3|CALM_WHEAT RecName: Full=Calmodulin; Short=CaM [Triticum aestivum]
Length=149

 Score =   293 bits (751),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 145/148 (98%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTD+QI+EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDEQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQ+GFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQDGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMA  148


 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD DG I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQDGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  133  GDGQINYEEFVKVMMAK  149



>ref|NP_001105455.1| calmodulin [Zea mays]
 sp|P41040.2|CALM_MAIZE RecName: Full=Calmodulin; Short=CaM [Zea mays]
 emb|CAA52602.1| Calmodulin [Zea mays]
Length=149

 Score =   293 bits (750),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 145/148 (98%), Positives = 147/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTD+QI+EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDEQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPE LNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPELLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMA  148


 Score = 63.9 bits (154),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  133  GDGQINYEEFVKVMMAK  149



>gb|EMS51119.1| Calmodulin [Triticum urartu]
Length=149

 Score =   293 bits (750),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 145/148 (98%), Positives = 147/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQI+EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDDQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NG IDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTD+
Sbjct  61   NGIIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDD  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMA  148


 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDDEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  133  GDGQINYEEFVKVMMAK  149



>tpg|DAA64211.1| TPA: calmodulin [Zea mays]
Length=312

 Score =   299 bits (765),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 147/148 (99%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQI+EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDDQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMA  148


 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 51/78 (65%), Gaps = 1/78 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARKM  305
            G+G I++ EF+ +M  K+
Sbjct  133  GDGQINYEEFVKVMMAKV  150



>gb|ABR21719.1| calmodulin [Actinidia kolomikta]
Length=148

 Score =   293 bits (750),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 146/148 (99%), Positives = 146/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MAD LTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADPLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEE LKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEVLKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMA  148



>gb|AAT73609.1| calmodulin [Salvia miltiorrhiza]
Length=148

 Score =   293 bits (750),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 145/148 (98%), Positives = 147/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MAD LTD+QISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADPLTDEQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFD+DQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDRDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMA  148



>gb|ABR21761.1| calmodulin [Actinidia eriantha f. alba]
Length=148

 Score =   293 bits (749),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 146/148 (99%), Positives = 146/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MAD LTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADPLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAE RHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAEPRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMA  148



>ref|XP_009105204.1| PREDICTED: calmodulin-1 [Brassica rapa]
 emb|CDX96148.1| BnaA07g25830D [Brassica napus]
Length=149

 Score =   293 bits (749),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 143/148 (97%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTD+QISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDEQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMA+KMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMAKKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EV+EM+READVDGDGQINYEEFVK+MMA
Sbjct  121  EVEEMVREADVDGDGQINYEEFVKIMMA  148


 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 51/77 (66%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+++M+ E D D
Sbjct  73   MAKKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVEEMVREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  133  GDGQINYEEFVKIMMAK  149



>gb|ABR21709.1| calmodulin [Actinidia chinensis]
Length=148

 Score =   293 bits (749),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 146/148 (99%), Positives = 146/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MAD LTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADPLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEE KEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEERKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMA  148



>emb|CAA67054.1| calmodulin-2 [Capsicum annuum]
Length=149

 Score =   293 bits (749),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 146/148 (99%), Positives = 147/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFL LMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLILMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINY+EFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYDEFVKVMMA  148


 Score = 63.9 bits (154),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 51/79 (65%), Gaps = 1/79 (1%)
 Frame = +3

Query  69   LTMADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVD  245
            + MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D
Sbjct  71   ILMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREAD  130

Query  246  ADGNGTIDFPEFLNLMARK  302
             DG+G I++ EF+ +M  K
Sbjct  131  VDGDGQINYDEFVKVMMAK  149



>ref|XP_009410443.1| PREDICTED: calmodulin-3-like [Musa acuminata subsp. malaccensis]
Length=149

 Score =   293 bits (749),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 144/148 (97%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MA+QLTDDQI+EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MAEQLTDDQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEEL+EAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELREAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINY+EFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYDEFVKVMMA  148


 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELREAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  133  GDGQINYDEFVKVMMAK  149



>ref|NP_001104884.1| calmodulin [Zea mays]
 gb|AAB86496.1| calmodulin [Zea mays]
Length=149

 Score =   293 bits (749),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 145/148 (98%), Positives = 147/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTD+QI+EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDEQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDK QNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKGQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMA  148


 Score = 61.2 bits (147),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 49/77 (64%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDK  +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKGQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  133  GDGQINYEEFVKVMMAK  149



>gb|AAX31386.1| calmodulin [Aegiceras corniculatum]
Length=149

 Score =   293 bits (749),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 144/148 (97%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLT+DQISEF+EAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTEDQISEFREAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMA+KM+DTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMAKKMEDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMA  148


 Score = 63.9 bits (154),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MAKKMEDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  133  GDGQINYEEFVKVMMAK  149



>sp|P04353.2|CALM_SPIOL RecName: Full=Calmodulin; Short=CaM [Spinacia oleracea]
Length=149

 Score =   293 bits (749),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 144/148 (97%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MA++LTD+QI+EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MAZZLTDEQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMA  148


 Score = 63.9 bits (154),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  133  GDGQINYEEFVKVMMAK  149



>gb|ABR21767.1| calmodulin [Actinidia kolomikta]
Length=148

 Score =   292 bits (748),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 145/148 (98%), Positives = 147/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MAD LTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADPLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDS+EELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSDEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYE+FVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEKFVKVMMA  148



>gb|ABG74924.1| calmodulin [Aegiceras corniculatum]
Length=151

 Score =   293 bits (749),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 144/150 (96%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +3

Query  69   LTMADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDA  248
            + MADQLT+DQISEF+EAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDA
Sbjct  1    MGMADQLTEDQISEFREAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDA  60

Query  249  DGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLT  428
            DGNGTIDFPEFLNLMA+KM+DTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLT
Sbjct  61   DGNGTIDFPEFLNLMAKKMEDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLT  120

Query  429  DEEVDEMIREADVDGDGQINYEEFVKVMMA  518
            DEEVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  DEEVDEMIREADVDGDGQINYEEFVKVMMA  150


 Score = 63.9 bits (154),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  75   MAKKMEDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  134

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  135  GDGQINYEEFVKVMMAK  151



>gb|ABS12106.1| calmodulin 1 [Morus nigra]
Length=149

 Score =   292 bits (748),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 146/148 (99%), Positives = 146/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTD EEELKEAFRVFDKDQNGFI AAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDFEEELKEAFRVFDKDQNGFIFAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMA  148


 Score = 61.2 bits (147),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +3

Query  108  EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLN  287
            E KEAF +FDKD +G I   EL  VM +LG+  T+ E+ +MI E D DG+G I++ EF+ 
Sbjct  85   ELKEAFRVFDKDQNGFIFAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  144

Query  288  LMARK  302
            +M  K
Sbjct  145  VMMAK  149



>gb|AAR99409.1| calmodulin [Arachis hypogaea]
Length=148

 Score =   292 bits (748),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 145/148 (98%), Positives = 146/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MAD LTD+QISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADPLTDEQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRV DKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVLDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMA  148



>ref|NP_001105459.1| calmodulin [Zea mays]
 emb|CAA54582.1| calmodulin [Zea mays]
Length=149

 Score =   292 bits (748),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 144/148 (97%), Positives = 147/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQ +EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDDQTAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAA++RHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAADVRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMA  148


 Score = 60.8 bits (146),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  ++  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAADVRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  133  GDGQINYEEFVKVMMAK  149



>gb|ABR21759.1| calmodulin [Actinidia deliciosa var. chlorocarpa]
Length=148

 Score =   292 bits (747),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 145/148 (98%), Positives = 146/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MAD LTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADPLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            +G IDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   SGAIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMA  148



>gb|ABR21731.1| calmodulin [Actinidia sabiifolia]
Length=148

 Score =   292 bits (747),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 145/148 (98%), Positives = 146/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MAD LTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADPLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDS+EELKEAFRVFDKDQNGFI AAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSDEELKEAFRVFDKDQNGFIPAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMA  148



>gb|AAS78755.1| calmodulin [Arachis hypogaea]
Length=148

 Score =   292 bits (747),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 145/148 (98%), Positives = 146/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MAD LTD+QISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADPLTDEQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTID PEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDIPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMA  148



>ref|XP_009123275.1| PREDICTED: LOW QUALITY PROTEIN: calmodulin [Brassica rapa]
Length=149

 Score =   292 bits (747),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 144/148 (97%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLG+KLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGKKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            E+DEMIREADVDGDG+INY+EFVKVMMA
Sbjct  121  EMDEMIREADVDGDGRINYDEFVKVMMA  148


 Score = 63.5 bits (153),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGKKLTDEEMDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  133  GDGRINYDEFVKVMMAK  149



>gb|ABR21741.1| calmodulin [Actinidia deliciosa var. chlorocarpa]
Length=148

 Score =   292 bits (747),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 145/148 (98%), Positives = 146/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MAD LTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADPLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKM+DTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMRDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQI YEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQIRYEEFVKVMMA  148



>ref|XP_011080472.1| PREDICTED: calmodulin [Sesamum indicum]
Length=149

 Score =   292 bits (747),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 145/148 (98%), Positives = 147/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQISEFKEAFSLFDKDGDG ITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGSITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREAD+DGDGQINY+EFVKVMMA
Sbjct  121  EVDEMIREADMDGDGQINYDEFVKVMMA  148


 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADMD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  133  GDGQINYDEFVKVMMAK  149



>gb|ACG31089.1| calmodulin [Zea mays]
Length=149

 Score =   291 bits (746),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 144/148 (97%), Positives = 147/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTD+QI+EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDEQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINY+EFVK MMA
Sbjct  121  EVDEMIREADVDGDGQINYDEFVKXMMA  148


 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 49/77 (64%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+  M  K
Sbjct  133  GDGQINYDEFVKXMMAK  149



>emb|CAA78057.1| calmodulin [Arabidopsis thaliana]
Length=149

 Score =   291 bits (746),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 143/148 (97%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTD+QISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDEQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMA+KMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMAKKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EV+EMIREADVDGDGQIN+EEFVK+MMA
Sbjct  121  EVEEMIREADVDGDGQINHEEFVKIMMA  148


 Score = 63.9 bits (154),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+++MI E D D
Sbjct  73   MAKKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVEEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I+  EF+ +M  K
Sbjct  133  GDGQINHEEFVKIMMAK  149



>ref|NP_001268169.1| calmodulin [Vitis vinifera]
 gb|AAL58535.1| calmodulin [Vitis vinifera]
Length=149

 Score =   291 bits (746),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 144/148 (97%), Positives = 146/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQISEFKEAFSLFDKDGDGCI TKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCIATKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPE LNLMARKMKDTDSEEELK++FRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPESLNLMARKMKDTDSEEELKKSFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMA  148


 Score = 61.2 bits (147),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E K++F +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKKSFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  133  GDGQINYEEFVKVMMAK  149



>gb|ABK22713.1| unknown [Picea sitchensis]
 gb|ABK24260.1| unknown [Picea sitchensis]
 gb|ACN40036.1| unknown [Picea sitchensis]
 gb|ACN40323.1| unknown [Picea sitchensis]
Length=154

 Score =   291 bits (746),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 144/151 (95%), Positives = 148/151 (98%), Gaps = 0/151 (0%)
 Frame = +3

Query  66   ALTMADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVD  245
            A  + +QLT++QISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVD
Sbjct  3    ASRIVEQLTEEQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVD  62

Query  246  ADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKL  425
            ADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKL
Sbjct  63   ADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKL  122

Query  426  TDEEVDEMIREADVDGDGQINYEEFVKVMMA  518
            TDEEVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  123  TDEEVDEMIREADVDGDGQINYEEFVKVMMA  153


 Score = 64.3 bits (155),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  78   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  137

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  138  GDGQINYEEFVKVMMAK  154



>gb|ABR21730.1| calmodulin [Actinidia kolomikta]
Length=148

 Score =   291 bits (745),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 145/148 (98%), Positives = 146/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MAD LTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADPLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDS+EELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSDEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVM A
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMRA  148



>gb|ABR21728.1| calmodulin [Actinidia deliciosa var. chlorocarpa]
Length=148

 Score =   291 bits (745),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 145/148 (98%), Positives = 146/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MAD LTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADPLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMA KMKDTDS+EELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMALKMKDTDSDEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMA  148



>gb|ABN71532.1| calmodulin [Cicer arietinum]
Length=150

 Score =   291 bits (745),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 144/146 (99%), Positives = 145/146 (99%), Gaps = 0/146 (0%)
 Frame = +3

Query  81   DQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNG  260
            DQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNG
Sbjct  4    DQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNG  63

Query  261  TIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEV  440
            TIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEV
Sbjct  64   TIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEV  123

Query  441  DEMIREADVDGDGQINYEEFVKVMMA  518
            DEMIREADVDGDGQINYEEFV +MMA
Sbjct  124  DEMIREADVDGDGQINYEEFVNLMMA  149


 Score = 67.4 bits (163),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 51/77 (66%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  74   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  133

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+NLM  K
Sbjct  134  GDGQINYEEFVNLMMAK  150


 Score = 64.7 bits (156),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 47/74 (64%), Gaps = 0/74 (0%)
 Frame = +3

Query  291  MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  470
            MAR     D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  1    MARDQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  60

Query  471  GDGQINYEEFVKVM  512
            G+G I++ EF+ +M
Sbjct  61   GNGTIDFPEFLNLM  74



>ref|XP_002963446.1| hypothetical protein SELMODRAFT_141966 [Selaginella moellendorffii]
 ref|XP_002971581.1| hypothetical protein SELMODRAFT_172372 [Selaginella moellendorffii]
 gb|EFJ27330.1| hypothetical protein SELMODRAFT_172372 [Selaginella moellendorffii]
 gb|EFJ35317.1| hypothetical protein SELMODRAFT_141966 [Selaginella moellendorffii]
Length=149

 Score =   291 bits (745),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 143/148 (97%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLT+DQI+EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTEDQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTD+
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDD  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVK+M+A
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKMMLA  148


 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDDEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  133  GDGQINYEEFVKMMLAK  149



>tpg|DAA64212.1| TPA: calmodulin [Zea mays]
Length=396

 Score =   300 bits (768),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 147/148 (99%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQI+EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDDQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMA  148


 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 51/78 (65%), Gaps = 1/78 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARKM  305
            G+G I++ EF+ +M  K+
Sbjct  133  GDGQINYEEFVKVMMAKV  150



>ref|XP_004958754.1| PREDICTED: UPF0483 protein AGAP003155-like [Setaria italica]
Length=396

 Score =   300 bits (768),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 147/148 (99%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQI+EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDDQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMA  148


 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 51/78 (65%), Gaps = 1/78 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARKM  305
            G+G I++ EF+ +M  K+
Sbjct  133  GDGQINYEEFVKVMMAKV  150



>gb|AAR99412.1| calmodulin [Arachis hypogaea]
Length=148

 Score =   291 bits (744),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 145/148 (98%), Positives = 146/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MAD LTD+QISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADPLTDEQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLG KLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGGKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMA  148



>ref|XP_002461247.1| hypothetical protein SORBIDRAFT_02g043510 [Sorghum bicolor]
 gb|EER97768.1| hypothetical protein SORBIDRAFT_02g043510 [Sorghum bicolor]
Length=414

 Score =   300 bits (769),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 147/148 (99%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQI+EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDDQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMA  148


 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 51/78 (65%), Gaps = 1/78 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARKM  305
            G+G I++ EF+ +M  K+
Sbjct  133  GDGQINYEEFVKVMMAKV  150



>ref|XP_004287204.1| PREDICTED: calmodulin-7 [Fragaria vesca subsp. vesca]
Length=149

 Score =   290 bits (743),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 143/148 (97%), Positives = 146/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTE ELQDMINEVDAD 
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEVELQDMINEVDADS  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISA+ELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISASELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EV+EMI+EADVDGDGQINYEEFVKVMMA
Sbjct  121  EVNEMIQEADVDGDGQINYEEFVKVMMA  148


 Score = 64.3 bits (155),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISASELRHVMTNLGEKLTDEEVNEMIQEADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  133  GDGQINYEEFVKVMMAK  149



>gb|AAD34242.1|AF084394_1 calmodulin mutant SYNCAM10 [synthetic construct]
Length=149

 Score =   290 bits (742),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 143/148 (97%), Positives = 147/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTD+QI+EFKEAFSLFDKDGDG ITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQ+NYEEFV+VMMA
Sbjct  121  EVDEMIREADVDGDGQVNYEEFVQVMMA  148


 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G +++ EF+ +M  K
Sbjct  133  GDGQVNYEEFVQVMMAK  149



>gb|ACF79629.1| unknown [Zea mays]
Length=402

 Score =   299 bits (765),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 147/148 (99%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQI+EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDDQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMA  148


 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  133  GDGQINYEEFVKVMMAK  149



>sp|Q39752.3|CALM_FAGSY RecName: Full=Calmodulin; Short=CaM [Fagus sylvatica]
 emb|CAA66215.1| CaMF-1 [Fagus sylvatica]
Length=148

 Score =   290 bits (741),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 146/148 (99%), Positives = 146/148 (99%), Gaps = 1/148 (1%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVD DG
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDRDG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTD 
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTD-  119

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  120  EVDEMIREADVDGDGQINYEEFVKVMMA  147


 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (65%), Gaps = 2/77 (3%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTD-EVDEMIREADVD  131

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  132  GDGQINYEEFVKVMMAK  148



>emb|CAA66159.1| calmodulin-1 [Capsicum annuum]
Length=150

 Score =   290 bits (741),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 146/149 (98%), Positives = 147/149 (99%), Gaps = 1/149 (1%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTD-  431
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTD 
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  432  EEVDEMIREADVDGDGQINYEEFVKVMMA  518
            EEVDEMIREADVDGDGQI Y+EFVKVMMA
Sbjct  121  EEVDEMIREADVDGDGQIQYDEFVKVMMA  149


 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 49/78 (63%), Gaps = 2/78 (3%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPT-EAELQDMINEVDA  248
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T E E+ +MI E D 
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEEVDEMIREADV  132

Query  249  DGNGTIDFPEFLNLMARK  302
            DG+G I + EF+ +M  K
Sbjct  133  DGDGQIQYDEFVKVMMAK  150



>emb|CDX99690.1| BnaC04g34470D [Brassica napus]
Length=149

 Score =   289 bits (740),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 141/148 (95%), Positives = 147/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MA+QLTD+QISEFKEAF LFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MAEQLTDEQISEFKEAFGLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMA+KMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMAKKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EV+EM+READVDGDGQINYEEFVK+MMA
Sbjct  121  EVEEMVREADVDGDGQINYEEFVKIMMA  148


 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 51/77 (66%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+++M+ E D D
Sbjct  73   MAKKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVEEMVREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  133  GDGQINYEEFVKIMMAK  149



>gb|ABR21727.1| calmodulin [Actinidia sabiifolia]
Length=148

 Score =   288 bits (738),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 143/148 (97%), Positives = 144/148 (97%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MAD LTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADPLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDS+EELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSDEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREA VDGDGQINYEE V VMMA
Sbjct  121  EVDEMIREASVDGDGQINYEELVTVMMA  148



>dbj|BAF31994.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF31995.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF31996.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF31997.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF31998.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF31999.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF32000.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF32001.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF32002.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF32003.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF32004.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF32005.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF32006.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF32007.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF32008.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF32009.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF32010.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF32011.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF32012.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF32013.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF32014.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF32015.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF32016.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF32017.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF32018.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF32019.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF32020.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF32021.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF32022.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF32023.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF32024.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF32025.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF32026.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF32027.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF32028.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF32029.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF32030.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF32031.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF32032.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF32033.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF32034.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF32035.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF32036.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF32037.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF32038.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF32039.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF32040.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF32041.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF32140.1| putative calmodulin [Taxodium distichum]
 gb|ACJ77055.1| putative calmodulin [Taxodium distichum var. distichum]
 gb|ACJ77056.1| putative calmodulin [Taxodium distichum var. distichum]
 gb|ACJ77057.1| putative calmodulin [Taxodium distichum var. distichum]
 gb|ACJ77058.1| putative calmodulin [Taxodium distichum var. distichum]
 gb|ACJ77059.1| putative calmodulin [Taxodium distichum var. distichum]
 gb|ACJ77060.1| putative calmodulin [Taxodium distichum var. distichum]
 gb|ACJ77061.1| putative calmodulin [Taxodium distichum var. distichum]
 gb|ACJ77062.1| putative calmodulin [Taxodium distichum var. distichum]
 gb|ACJ77063.1| putative calmodulin [Taxodium distichum var. distichum]
 gb|ACJ77064.1| putative calmodulin [Taxodium distichum var. distichum]
 gb|ACJ77065.1| putative calmodulin [Taxodium distichum var. distichum]
 gb|ACJ77066.1| putative calmodulin [Taxodium distichum var. distichum]
 gb|ACJ77067.1| putative calmodulin [Taxodium distichum var. distichum]
 gb|ACJ77068.1| putative calmodulin [Taxodium distichum var. distichum]
 gb|ACJ77069.1| putative calmodulin [Taxodium distichum var. distichum]
 gb|ACJ77070.1| putative calmodulin [Taxodium distichum var. distichum]
 gb|ACJ77071.1| putative calmodulin [Taxodium distichum var. distichum]
 gb|ACJ77072.1| putative calmodulin [Taxodium distichum var. imbricarium]
 gb|ACJ77073.1| putative calmodulin [Taxodium distichum var. imbricarium]
 gb|ACJ77074.1| putative calmodulin [Taxodium distichum var. imbricarium]
 gb|ACJ77075.1| putative calmodulin [Taxodium distichum var. imbricarium]
 gb|ACJ77076.1| putative calmodulin [Taxodium distichum var. imbricarium]
 gb|ACJ77077.1| putative calmodulin [Taxodium distichum var. imbricarium]
 gb|ACJ77078.1| putative calmodulin [Taxodium distichum var. imbricarium]
 gb|ACJ77079.1| putative calmodulin [Taxodium distichum var. imbricarium]
 gb|ACJ77080.1| putative calmodulin [Taxodium distichum var. imbricarium]
 gb|ACJ77081.1| putative calmodulin [Taxodium distichum var. imbricarium]
 gb|ACJ77082.1| putative calmodulin [Taxodium distichum var. imbricarium]
 gb|ACJ77083.1| putative calmodulin [Taxodium distichum var. distichum]
 gb|ACJ77084.1| putative calmodulin [Taxodium distichum var. distichum]
 gb|ACJ77085.1| putative calmodulin [Taxodium distichum var. distichum]
 gb|ACJ77086.1| putative calmodulin [Taxodium distichum var. distichum]
 gb|ACJ77087.1| putative calmodulin [Taxodium distichum var. distichum]
 gb|ACJ77088.1| putative calmodulin [Taxodium distichum var. distichum]
 gb|ACJ77089.1| putative calmodulin [Taxodium distichum var. distichum]
Length=149

 Score =   288 bits (738),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 140/148 (95%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MA+QLT+DQI+EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MAEQLTEDQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAF+VFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQ+NYEEFV++M+A
Sbjct  121  EVDEMIREADVDGDGQVNYEEFVRMMLA  148


 Score = 63.5 bits (153),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G +++ EF+ +M  K
Sbjct  133  GDGQVNYEEFVRMMLAK  149



>emb|CDY27651.1| BnaUnng00010D [Brassica napus]
Length=150

 Score =   288 bits (737),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 143/149 (96%), Positives = 148/149 (99%), Gaps = 1/149 (1%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGC-ITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MADQLTD+QISEFKEAFSLFDKDGDGC ITTKELGTVMRSLGQNPTEAELQDMINEVDAD
Sbjct  1    MADQLTDEQISEFKEAFSLFDKDGDGCCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  60

Query  252  GNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTD  431
            GNGTIDFPEFLNLMA+KMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTD
Sbjct  61   GNGTIDFPEFLNLMAKKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTD  120

Query  432  EEVDEMIREADVDGDGQINYEEFVKVMMA  518
            EEV+EM+READVDGDGQINYEEFVK+MMA
Sbjct  121  EEVEEMVREADVDGDGQINYEEFVKIMMA  149


 Score = 64.7 bits (156),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 51/77 (66%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+++M+ E D D
Sbjct  74   MAKKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVEEMVREADVD  133

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  134  GDGQINYEEFVKIMMAK  150



>ref|XP_004984569.1| PREDICTED: calmodulin-like isoform X2 [Setaria italica]
Length=159

 Score =   288 bits (737),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 147/158 (93%), Positives = 148/158 (94%), Gaps = 10/158 (6%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDG----------CITTKELGTVMRSLGQNPTEAELQ  224
            MADQLTDDQI+EFKEAFSLFDKDGDG          CITTKELGTVMRSLGQNPTEAELQ
Sbjct  1    MADQLTDDQIAEFKEAFSLFDKDGDGELTRLPPYCGCITTKELGTVMRSLGQNPTEAELQ  60

Query  225  DMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVM  404
            DMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVM
Sbjct  61   DMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVM  120

Query  405  TNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMA  518
            TNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  TNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMA  158


 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  83   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  142

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  143  GDGQINYEEFVKVMMAK  159



>ref|XP_009762209.1| PREDICTED: calmodulin-7-like [Nicotiana sylvestris]
Length=149

 Score =   287 bits (735),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 143/148 (97%), Positives = 144/148 (97%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNP E ELQDMINEVDADG
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPIEVELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDF EFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRH+MTNLGEKLTDE
Sbjct  61   NGTIDFSEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHIMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMI EADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMICEADVDGDGQINYEEFVKVMMA  148



>ref|NP_001189724.1| calmodulin 2 [Arabidopsis thaliana]
 gb|AEC09933.1| calmodulin 2 [Arabidopsis thaliana]
Length=161

 Score =   288 bits (737),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 147/160 (92%), Positives = 148/160 (93%), Gaps = 12/160 (8%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDG------------CITTKELGTVMRSLGQNPTEAE  218
            MADQLTDDQISEFKEAFSLFDKDGDG            CITTKELGTVMRSLGQNPTEAE
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGMLHPPFPSIIVGCITTKELGTVMRSLGQNPTEAE  60

Query  219  LQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRH  398
            LQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRH
Sbjct  61   LQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRH  120

Query  399  VMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMA  518
            VMTNLGEKLTDEEVDEMI+EADVDGDGQINYEEFVKVMMA
Sbjct  121  VMTNLGEKLTDEEVDEMIKEADVDGDGQINYEEFVKVMMA  160


 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  85   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIKEADVD  144

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  145  GDGQINYEEFVKVMMAK  161



>gb|ACY00391.1| calmodulin [Knorringia sibirica]
Length=149

 Score =   287 bits (734),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 141/148 (95%), Positives = 146/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MA+QLTDDQISE KEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDM+NEVDADG
Sbjct  1    MAEQLTDDQISELKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMLNEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFP FLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPGFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            +VDEM+READVDGDGQINY+EFVKVMMA
Sbjct  121  DVDEMVREADVDGDGQINYDEFVKVMMA  148


 Score = 61.2 bits (147),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ ++ +M+ E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEDVDEMVREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  133  GDGQINYDEFVKVMMAK  149



>ref|XP_006658157.1| PREDICTED: UPF0483 protein AGAP003155-like [Oryza brachyantha]
Length=398

 Score =   296 bits (757),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 144/148 (97%), Positives = 147/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTD+QI+EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDNQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFIS AELRHVMTNLGEKL+DE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISGAELRHVMTNLGEKLSDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMA  148


 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 57/88 (65%), Gaps = 1/88 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISGAELRHVMTNLGEKLSDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARKMKDTDSEEELK  335
            G+G I++ EF+ +M  K+   + E+++K
Sbjct  133  GDGQINYEEFVKVMMAKIIHMEHEKKVK  160



>gb|AAD34435.1|AF084451_1 calmodulin mutant SYNCAM32 [synthetic construct]
Length=149

 Score =   287 bits (734),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 142/148 (96%), Positives = 146/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTD+QI+EFKEAFSLFDKDGDG ITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDEQIAEFKEAFSLFDKDGDGWITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKD NGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQ+NYEEFV+VMMA
Sbjct  121  EVDEMIREADVDGDGQVNYEEFVQVMMA  148


 Score = 66.6 bits (161),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 51/77 (66%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKDG+G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G +++ EF+ +M  K
Sbjct  133  GDGQVNYEEFVQVMMAK  149



>ref|XP_006854084.1| hypothetical protein AMTR_s00048p00127800 [Amborella trichopoda]
 gb|ERN15551.1| hypothetical protein AMTR_s00048p00127800 [Amborella trichopoda]
Length=149

 Score =   287 bits (734),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 139/148 (94%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MA+QLT++QISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MAEQLTEEQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAF+VFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EV+EMIREADVDGDGQ+NYEEFV++M+A
Sbjct  121  EVEEMIREADVDGDGQVNYEEFVRMMLA  148


 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 51/77 (66%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+++MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDEEVEEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G +++ EF+ +M  K
Sbjct  133  GDGQVNYEEFVRMMLAK  149



>gb|AAA72492.1| VU1 calmodulin [synthetic construct]
 gb|AAA72766.1| camodulin [synthetic construct]
Length=149

 Score =   287 bits (734),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 142/148 (96%), Positives = 146/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTD+QI+EFKEAFSLFDKDGDG ITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKD NGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQ+NYEEFV+VMMA
Sbjct  121  EVDEMIREADVDGDGQVNYEEFVQVMMA  148


 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 51/77 (66%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKDG+G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G +++ EF+ +M  K
Sbjct  133  GDGQVNYEEFVQVMMAK  149



>prf||1109190A calmodulin
Length=149

 Score =   287 bits (734),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 144/148 (97%), Positives = 147/148 (99%), Gaps = 1/148 (1%)
 Frame = +3

Query  78   ADQLTDDQ-ISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            ADQLTD+Q I+EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    ADQLTDEQNIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQ+GFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQDGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMA  148


 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD DG I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQDGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  133  GDGQINYEEFVKVMMAK  149



>ref|XP_004961666.1| PREDICTED: calmodulin-2-like isoform X2 [Setaria italica]
Length=159

 Score =   287 bits (734),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 146/158 (92%), Positives = 148/158 (94%), Gaps = 10/158 (6%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDG----------CITTKELGTVMRSLGQNPTEAELQ  224
            MADQLTD+QI+EFKEAFSLFDKDGDG          CITTKELGTVMRSLGQNPTEAELQ
Sbjct  1    MADQLTDEQIAEFKEAFSLFDKDGDGTLWFLFPLAGCITTKELGTVMRSLGQNPTEAELQ  60

Query  225  DMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVM  404
            DMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVM
Sbjct  61   DMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVM  120

Query  405  TNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMA  518
            TNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  TNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMA  158


 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  83   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  142

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  143  GDGQINYEEFVKVMMAK  159



>emb|CDY21220.1| BnaC03g54040D [Brassica napus]
Length=221

 Score =   289 bits (740),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 145/160 (91%), Positives = 147/160 (92%), Gaps = 12/160 (8%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDG------------CITTKELGTVMRSLGQNPTEAE  218
            MADQLTDDQISEFKEAFSLFDKDGD             CITTKELGTVMRSLGQNPTEAE
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDALLLTLLTIAFIRCITTKELGTVMRSLGQNPTEAE  60

Query  219  LQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRH  398
            LQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRH
Sbjct  61   LQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRH  120

Query  399  VMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMA  518
            VMTNLGEKLTDEEVDEM+READVDGDGQINY+EFVKVMMA
Sbjct  121  VMTNLGEKLTDEEVDEMVREADVDGDGQINYDEFVKVMMA  160



>gb|ABK23242.1| unknown [Picea sitchensis]
 gb|ABR18064.1| unknown [Picea sitchensis]
Length=149

 Score =   286 bits (733),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 139/148 (94%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MA+QLT+DQI+EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMI+EVDADG
Sbjct  1    MAEQLTEDQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMISEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAF+VFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQ+NYEEFV++M+A
Sbjct  121  EVDEMIREADVDGDGQVNYEEFVRMMLA  148


 Score = 63.5 bits (153),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G +++ EF+ +M  K
Sbjct  133  GDGQVNYEEFVRMMLAK  149



>gb|ABK22644.1| unknown [Picea sitchensis]
 gb|ABK22770.1| unknown [Picea sitchensis]
 gb|ABK26860.1| unknown [Picea sitchensis]
 gb|ACN40005.1| unknown [Picea sitchensis]
 gb|ACN40939.1| unknown [Picea sitchensis]
 gb|ACN41083.1| unknown [Picea sitchensis]
Length=149

 Score =   286 bits (732),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 142/148 (96%), Positives = 146/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            M D+LT++QISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MMDKLTEEQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDF EFLNLMARK+KDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFAEFLNLMARKVKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMA  148


 Score = 63.9 bits (154),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKVKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  133  GDGQINYEEFVKVMMAK  149



>ref|XP_004493280.1| PREDICTED: family of serine hydrolases 3-like [Cicer arietinum]
Length=405

 Score =   295 bits (756),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 146/148 (99%), Positives = 147/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQISEFKEAFSLFDKDGDG ITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGSITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINY+EFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYDEFVKVMMA  148


 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 56/88 (64%), Gaps = 1/88 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARKMKDTDSEEELK  335
            G+G I++ EF+ +M  K   ++  +++K
Sbjct  133  GDGQINYDEFVKVMMAKQDLSEHGKKMK  160



>gb|AAD34265.1|AF084417_1 calmodulin mutant SYNCAM62 [synthetic construct]
Length=149

 Score =   286 bits (732),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 141/148 (95%), Positives = 146/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTD+QI+EFKEAFSLFDKDGDG ITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEE+LKEAFRVFDKD NGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEQLKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQ+NYEEFV+VMMA
Sbjct  121  EVDEMIREADVDGDGQVNYEEFVQVMMA  148


 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 51/77 (66%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   + KEAF +FDKDG+G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEQLKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G +++ EF+ +M  K
Sbjct  133  GDGQVNYEEFVQVMMAK  149



>gb|AAD34266.1|AF084418_1 calmodulin mutant SYNCAM63A [synthetic construct]
Length=149

 Score =   286 bits (732),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 141/148 (95%), Positives = 146/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTD+QI+EFKEAFSLFDKDGDG ITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKD NGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            +VDEMIREADVDGDGQ+NYEEFV+VMMA
Sbjct  121  QVDEMIREADVDGDGQVNYEEFVQVMMA  148


 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 51/77 (66%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKDG+G I+  EL  VM +LG+  T+ ++ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEQVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G +++ EF+ +M  K
Sbjct  133  GDGQVNYEEFVQVMMAK  149



>gb|AAD34415.1|AF084431_1 calmodulin mutant SYNCAM9 [synthetic construct]
Length=149

 Score =   286 bits (731),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 141/148 (95%), Positives = 146/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTD+QI+EFKEAFSLFDKDGDG ITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKD NG+ISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDGNGWISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQ+NYEEFV+VMMA
Sbjct  121  EVDEMIREADVDGDGQVNYEEFVQVMMA  148


 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 51/77 (66%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKDG+G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDGNGWISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G +++ EF+ +M  K
Sbjct  133  GDGQVNYEEFVQVMMAK  149



>gb|EMS55430.1| Calmodulin-related protein [Triticum urartu]
Length=428

 Score =   295 bits (756),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 144/146 (99%), Positives = 146/146 (100%), Gaps = 0/146 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQI+EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDDQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVM  512
            EVDEMIREADVDGDGQINYEEFVKV+
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVL  146


 Score = 60.8 bits (146),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 50/75 (67%), Gaps = 1/75 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMA  296
            G+G I++ EF+ +++
Sbjct  133  GDGQINYEEFVKVLS  147



>gb|AAR99410.1| calmodulin [Arachis hypogaea]
Length=148

 Score =   286 bits (731),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 142/148 (96%), Positives = 143/148 (97%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MAD LTD+QISEFKEAFSL DKDGDGCITTKELG V RSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADPLTDEQISEFKEAFSLLDKDGDGCITTKELGAVTRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNL ARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLTARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMA  148



>ref|XP_010271350.1| PREDICTED: calmodulin [Nelumbo nucifera]
Length=149

 Score =   286 bits (731),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 139/148 (94%), Positives = 147/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MA+QLT++QISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD 
Sbjct  1    MAEQLTEEQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADQ  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAF+VFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQ+NYEEFV++M+A
Sbjct  121  EVDEMIREADVDGDGQVNYEEFVRMMLA  148


 Score = 63.9 bits (154),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G +++ EF+ +M  K
Sbjct  133  GDGQVNYEEFVRMMLAK  149



>gb|AAA32765.1| calmodulin-3, partial [Arabidopsis thaliana]
Length=143

 Score =   285 bits (730),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 141/142 (99%), Positives = 142/142 (100%), Gaps = 0/142 (0%)
 Frame = +3

Query  93   DDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDF  272
            DDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDF
Sbjct  1    DDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDF  60

Query  273  PEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMI  452
            PEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMI
Sbjct  61   PEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMI  120

Query  453  READVDGDGQINYEEFVKVMMA  518
            +EADVDGDGQINYEEFVKVMMA
Sbjct  121  KEADVDGDGQINYEEFVKVMMA  142


 Score = 63.9 bits (154),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  67   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIKEADVD  126

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  127  GDGQINYEEFVKVMMAK  143



>gb|AAC61858.1| calmodulin mutant SYNCAM28 [synthetic construct]
Length=149

 Score =   285 bits (730),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 141/148 (95%), Positives = 146/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTD+QI+EFKEAFSLFDKDGDG ITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEE+LKEAFRVFDKD NGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEKLKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQ+NYEEFV+VMMA
Sbjct  121  EVDEMIREADVDGDGQVNYEEFVQVMMA  148


 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 51/77 (66%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   + KEAF +FDKDG+G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEKLKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G +++ EF+ +M  K
Sbjct  133  GDGQVNYEEFVQVMMAK  149



>gb|AAC61859.1| calmodulin mutant SYNCAM29 [synthetic construct]
Length=149

 Score =   285 bits (730),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 141/148 (95%), Positives = 146/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTD+QI+EFKEAFSLFDKDGDG ITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKD NGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            +VDEMIREADVDGDGQ+NYEEFV+VMMA
Sbjct  121  KVDEMIREADVDGDGQVNYEEFVQVMMA  148


 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 51/77 (66%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKDG+G I+  EL  VM +LG+  T+ ++ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEKVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G +++ EF+ +M  K
Sbjct  133  GDGQVNYEEFVQVMMAK  149



>gb|AAD34433.1|AF084449_1 calmodulin mutant SYNCAM26 [synthetic construct]
Length=149

 Score =   285 bits (730),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 141/148 (95%), Positives = 146/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTD+QI++FKEAFSLFDKDGDG ITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDEQIAKFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKD NGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQ+NYEEFV+VMMA
Sbjct  121  EVDEMIREADVDGDGQVNYEEFVQVMMA  148


 Score = 66.6 bits (161),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 51/77 (66%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKDG+G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G +++ EF+ +M  K
Sbjct  133  GDGQVNYEEFVQVMMAK  149



>gb|AAD34257.1|AF084409_1 calmodulin mutant SYNCAM55 [synthetic construct]
Length=149

 Score =   285 bits (730),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 141/148 (95%), Positives = 146/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTD+QI+EFKEAFSLFDKDGDG ITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELK+AFRVFDKD NGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKKAFRVFDKDGNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQ+NYEEFV+VMMA
Sbjct  121  EVDEMIREADVDGDGQVNYEEFVQVMMA  148


 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 51/77 (66%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E K+AF +FDKDG+G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKKAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G +++ EF+ +M  K
Sbjct  133  GDGQVNYEEFVQVMMAK  149



>gb|AAD34421.1|AF084437_1 calmodulin mutant SYNCAM44 [synthetic construct]
Length=149

 Score =   285 bits (730),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 141/148 (95%), Positives = 146/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTD+QI+EFKEAFSLFDKDGDG ITTKELGTVMRSLGQNPTEA+LQDMINEVDADG
Sbjct  1    MADQLTDEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAKLQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKD NGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQ+NYEEFV+VMMA
Sbjct  121  EVDEMIREADVDGDGQVNYEEFVQVMMA  148


 Score = 66.6 bits (161),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 51/77 (66%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKDG+G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G +++ EF+ +M  K
Sbjct  133  GDGQVNYEEFVQVMMAK  149



>gb|AAD34408.1|AF084424_1 calmodulin mutant SYNCAM3 [synthetic construct]
Length=149

 Score =   285 bits (730),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 141/148 (95%), Positives = 146/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTD+QI+EFKEAFSLFDKDGDG ITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKD NGFISAAELRHVMTNLGE+LTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDGNGFISAAELRHVMTNLGERLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQ+NYEEFV+VMMA
Sbjct  121  EVDEMIREADVDGDGQVNYEEFVQVMMA  148


 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 51/77 (66%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKDG+G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDGNGFISAAELRHVMTNLGERLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G +++ EF+ +M  K
Sbjct  133  GDGQVNYEEFVQVMMAK  149



>gb|AAD34419.1|AF084435_1 calmodulin mutant SYNCAM39 [synthetic construct]
Length=149

 Score =   285 bits (730),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 141/148 (95%), Positives = 146/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTD+QI+EFKEAFSLFDKDGDG ITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDS+EELKEAFRVFDKD NGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSKEELKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQ+NYEEFV+VMMA
Sbjct  121  EVDEMIREADVDGDGQVNYEEFVQVMMA  148


 Score = 67.0 bits (162),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 51/77 (66%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKDG+G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSKEELKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G +++ EF+ +M  K
Sbjct  133  GDGQVNYEEFVQVMMAK  149



>gb|AAD34422.1|AF084438_1 calmodulin mutant SYNCAM45 [synthetic construct]
Length=149

 Score =   285 bits (730),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 141/148 (95%), Positives = 146/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTD+QI+EFKEAFSLFDKDGDG ITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSE+ELKEAFRVFDKD NGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEKELKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQ+NYEEFV+VMMA
Sbjct  121  EVDEMIREADVDGDGQVNYEEFVQVMMA  148


 Score = 66.6 bits (161),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 51/77 (66%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKDG+G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEKELKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G +++ EF+ +M  K
Sbjct  133  GDGQVNYEEFVQVMMAK  149



>gb|AAD34430.1|AF084446_1 calmodulin mutant SYNCAM36 [synthetic construct]
Length=149

 Score =   285 bits (730),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 141/148 (95%), Positives = 146/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTD+QI+EFKEAFSLFDKDGDG ITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKD NGFI+AAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDGNGFIAAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQ+NYEEFV+VMMA
Sbjct  121  EVDEMIREADVDGDGQVNYEEFVQVMMA  148


 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKDG+G I   EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDGNGFIAAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G +++ EF+ +M  K
Sbjct  133  GDGQVNYEEFVQVMMAK  149



>gb|AFA89861.2| calmodulin 1 [Lilium longiflorum]
Length=149

 Score =   285 bits (730),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 139/148 (94%), Positives = 147/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLT+DQI+EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD 
Sbjct  1    MADQLTEDQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADQ  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAF+VFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREAD+DGDGQ+NYEEFV++M+A
Sbjct  121  EVDEMIREADMDGDGQVNYEEFVRMMLA  148


 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADMD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G +++ EF+ +M  K
Sbjct  133  GDGQVNYEEFVRMMLAK  149



>gb|AAD34259.1|AF084411_1 calmodulin mutant SYNCAM57A [synthetic construct]
Length=149

 Score =   285 bits (729),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 141/148 (95%), Positives = 145/148 (98%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTD+QI+EFKEAFSLFDKDGDG ITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMAR MKDTDSEEELKEAFRVFDKD NGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARAMKDTDSEEELKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQ+NYEEFV+VMMA
Sbjct  121  EVDEMIREADVDGDGQVNYEEFVQVMMA  148


 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA  + D D   E KEAF +FDKDG+G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARAMKDTDSEEELKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G +++ EF+ +M  K
Sbjct  133  GDGQVNYEEFVQVMMAK  149



>gb|AAD34260.1|AF084412_1 calmodulin mutant SYNCAM57B [synthetic construct]
Length=149

 Score =   285 bits (729),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 141/148 (95%), Positives = 146/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTD+QI+EFKEAFSLFDKDGDG ITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMAR+MKDTDSEEELKEAFRVFDKD NGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMAREMKDTDSEEELKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQ+NYEEFV+VMMA
Sbjct  121  EVDEMIREADVDGDGQVNYEEFVQVMMA  148


 Score = 66.6 bits (161),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 51/77 (66%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKDG+G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MAREMKDTDSEEELKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G +++ EF+ +M  K
Sbjct  133  GDGQVNYEEFVQVMMAK  149



>gb|AAD34258.1|AF084410_1 calmodulin mutant SYNCAM56 [synthetic construct]
Length=149

 Score =   285 bits (729),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 141/148 (95%), Positives = 145/148 (98%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTD+QI+EFKEAFSLFDKDGDG ITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELK AFRVFDKD NGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKTAFRVFDKDGNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQ+NYEEFV+VMMA
Sbjct  121  EVDEMIREADVDGDGQVNYEEFVQVMMA  148


 Score = 64.3 bits (155),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E K AF +FDKDG+G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKTAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G +++ EF+ +M  K
Sbjct  133  GDGQVNYEEFVQVMMAK  149



>gb|EPS74177.1| hypothetical protein M569_00573 [Genlisea aurea]
Length=360

 Score =   293 bits (749),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 144/144 (100%), Positives = 144/144 (100%), Gaps = 0/144 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVK  506
            EVDEMIREADVDGDGQINYEEFVK
Sbjct  121  EVDEMIREADVDGDGQINYEEFVK  144


 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 49/74 (66%), Gaps = 1/74 (1%)
 Frame = +3

Query  291  MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  470
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  1    MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  59

Query  471  GDGQINYEEFVKVM  512
            G+G I++ EF+ +M
Sbjct  60   GNGTIDFPEFLNLM  73



>ref|NP_001185330.1| calmodulin 4 [Arabidopsis thaliana]
 gb|AEE34506.1| calmodulin 4 [Arabidopsis thaliana]
Length=159

 Score =   285 bits (730),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 144/158 (91%), Positives = 148/158 (94%), Gaps = 10/158 (6%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGD----------GCITTKELGTVMRSLGQNPTEAELQ  224
            MADQLTD+QISEFKEAFSLFDKDGD          GCITTKELGTVMRSLGQNPTEAELQ
Sbjct  1    MADQLTDEQISEFKEAFSLFDKDGDDSISDSGDSCGCITTKELGTVMRSLGQNPTEAELQ  60

Query  225  DMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVM  404
            DMINEVDADGNGTIDFPEFLNLMA+KMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVM
Sbjct  61   DMINEVDADGNGTIDFPEFLNLMAKKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVM  120

Query  405  TNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMA  518
            TNLGEKLTDEEV+EMIREADVDGDGQINYEEFVK+MMA
Sbjct  121  TNLGEKLTDEEVEEMIREADVDGDGQINYEEFVKIMMA  158


 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 51/77 (66%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+++MI E D D
Sbjct  83   MAKKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVEEMIREADVD  142

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  143  GDGQINYEEFVKIMMAK  159



>gb|AAD34412.1|AF084428_1 calmodulin mutant SYNCAM60 [synthetic construct]
Length=149

 Score =   285 bits (729),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 141/148 (95%), Positives = 145/148 (98%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTD+QI+EFKEAFSLFDKDGDG ITTK LGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDEQIAEFKEAFSLFDKDGDGTITTKALGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKD NGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQ+NYEEFV+VMMA
Sbjct  121  EVDEMIREADVDGDGQVNYEEFVQVMMA  148


 Score = 66.6 bits (161),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 51/77 (66%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKDG+G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G +++ EF+ +M  K
Sbjct  133  GDGQVNYEEFVQVMMAK  149



>gb|AAD34426.1|AF084442_1 calmodulin mutant SYNCAM14 [synthetic construct]
Length=149

 Score =   285 bits (729),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 141/148 (95%), Positives = 145/148 (98%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTD+QI+EFKEAFSLFDKDGDG ITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKD NGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQ+NYE FV+VMMA
Sbjct  121  EVDEMIREADVDGDGQVNYEAFVQVMMA  148


 Score = 64.3 bits (155),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKDG+G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G +++  F+ +M  K
Sbjct  133  GDGQVNYEAFVQVMMAK  149



>gb|AAD34413.1|AF084429_1 calmodulin mutant SYNCAM61 [synthetic construct]
Length=149

 Score =   285 bits (729),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 141/148 (95%), Positives = 145/148 (98%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTD+QI+EFKEAFSLFDKDGDG ITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKD NGFISAA LRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDGNGFISAAALRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQ+NYEEFV+VMMA
Sbjct  121  EVDEMIREADVDGDGQVNYEEFVQVMMA  148


 Score = 64.3 bits (155),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKDG+G I+   L  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDGNGFISAAALRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G +++ EF+ +M  K
Sbjct  133  GDGQVNYEEFVQVMMAK  149



>gb|AAD34425.1|AF084441_1 calmodulin mutant SYNCAM13 [synthetic construct]
Length=149

 Score =   285 bits (729),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 141/148 (95%), Positives = 145/148 (98%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTD+QI+EFKEAFSLFDKDGDG ITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFP FLNLMARKMKDTDSEEELKEAFRVFDKD NGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPAFLNLMARKMKDTDSEEELKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQ+NYEEFV+VMMA
Sbjct  121  EVDEMIREADVDGDGQVNYEEFVQVMMA  148


 Score = 66.6 bits (161),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 51/77 (66%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKDG+G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G +++ EF+ +M  K
Sbjct  133  GDGQVNYEEFVQVMMAK  149



>gb|AAD34407.1|AF084423_1 calmodulin mutant SYNCAM67 [synthetic construct]
Length=149

 Score =   285 bits (729),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 141/148 (95%), Positives = 145/148 (98%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTD+QI+EFKEAFSLFDKDGDG ITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEE LKEAFRVFDKD NGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEWLKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQ+NYEEFV+VMMA
Sbjct  121  EVDEMIREADVDGDGQVNYEEFVQVMMA  148


 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 51/77 (66%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTDDQISEF-KEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D    E+ KEAF +FDKDG+G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEWLKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G +++ EF+ +M  K
Sbjct  133  GDGQVNYEEFVQVMMAK  149



>gb|AAD34264.1|AF084416_1 calmodulin mutant SYNCAM58C [synthetic construct]
Length=149

 Score =   285 bits (729),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 141/148 (95%), Positives = 145/148 (98%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTD+QI+EFKEAFSLFDKDGDG ITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKD NGFISAAELRHVMTNLGE LTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDGNGFISAAELRHVMTNLGENLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQ+NYEEFV+VMMA
Sbjct  121  EVDEMIREADVDGDGQVNYEEFVQVMMA  148


 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 52/77 (68%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKDG+G I+  EL  VM +LG+N T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDGNGFISAAELRHVMTNLGENLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G +++ EF+ +M  K
Sbjct  133  GDGQVNYEEFVQVMMAK  149



>pdb|1QTX|A Chain A, The 1.65 Angstrom Structure Of Calmodulin Rs20 Peptide 
Complex
Length=148

 Score =   285 bits (728),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 141/147 (96%), Positives = 145/147 (99%), Gaps = 0/147 (0%)
 Frame = +3

Query  78   ADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGN  257
            ADQLTD+QI+EFKEAFSLFDKDGDG ITTKELGTVMRSLGQNPTEAELQDMINEVDADGN
Sbjct  1    ADQLTDEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGN  60

Query  258  GTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  437
            GTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKD NGFISAAELRHVMTNLGEKLTDEE
Sbjct  61   GTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEE  120

Query  438  VDEMIREADVDGDGQINYEEFVKVMMA  518
            VDEMIREADVDGDGQ+NYEEFV+VMMA
Sbjct  121  VDEMIREADVDGDGQVNYEEFVQVMMA  147


 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 51/77 (66%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKDG+G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  72   MARKMKDTDSEEELKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  131

Query  252  GNGTIDFPEFLNLMARK  302
            G+G +++ EF+ +M  K
Sbjct  132  GDGQVNYEEFVQVMMAK  148



>gb|AAD34411.1|AF084427_1 calmodulin mutant SYNCAM7 [synthetic construct]
Length=149

 Score =   285 bits (728),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 141/148 (95%), Positives = 145/148 (98%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTD+QI+EFKEAFSLFDKDGDG ITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKE FRVFDKD NGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEPFRVFDKDGNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQ+NYEEFV+VMMA
Sbjct  121  EVDEMIREADVDGDGQVNYEEFVQVMMA  148


 Score = 64.7 bits (156),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KE F +FDKDG+G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEPFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G +++ EF+ +M  K
Sbjct  133  GDGQVNYEEFVQVMMAK  149



>gb|AAD34431.1|AF084447_1 calmodulin mutant SYNCAM37 [synthetic construct]
Length=149

 Score =   285 bits (728),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 141/148 (95%), Positives = 145/148 (98%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTD+QI+EFKEAFSLFDKDGDG ITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKD NGFI AAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDGNGFIGAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQ+NYEEFV+VMMA
Sbjct  121  EVDEMIREADVDGDGQVNYEEFVQVMMA  148


 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKDG+G I   EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDGNGFIGAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G +++ EF+ +M  K
Sbjct  133  GDGQVNYEEFVQVMMAK  149



>gb|AAD34437.1|AF084453_1 calmodulin mutant SYNCAM34 [synthetic construct]
Length=149

 Score =   285 bits (728),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 141/148 (95%), Positives = 145/148 (98%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTD+QI+EFKEAFSLFDKDGDG ITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKD NGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDG +NYEEFV+VMMA
Sbjct  121  EVDEMIREADVDGDGWVNYEEFVQVMMA  148


 Score = 66.6 bits (161),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 51/77 (66%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKDG+G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G +++ EF+ +M  K
Sbjct  133  GDGWVNYEEFVQVMMAK  149



>gb|AAD34436.1|AF084452_1 calmodulin mutant SYNCAM33 [synthetic construct]
Length=149

 Score =   285 bits (728),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 141/148 (95%), Positives = 145/148 (98%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTD+QI+EFKEAFSLFDKDGDG ITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NG IDFPEFLNLMARKMKDTDSEEELKEAFRVFDKD NGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGWIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQ+NYEEFV+VMMA
Sbjct  121  EVDEMIREADVDGDGQVNYEEFVQVMMA  148


 Score = 66.6 bits (161),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 51/77 (66%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKDG+G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G +++ EF+ +M  K
Sbjct  133  GDGQVNYEEFVQVMMAK  149



>gb|AAD34410.1|AF084426_1 calmodulin mutant SYNCAM16 [synthetic construct]
Length=149

 Score =   285 bits (728),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 141/148 (95%), Positives = 145/148 (98%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTD+QI+EFKEAFSLFDKDGDG ITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKD NGFISAAELRHVMTNLGE LTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDGNGFISAAELRHVMTNLGEYLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQ+NYEEFV+VMMA
Sbjct  121  EVDEMIREADVDGDGQVNYEEFVQVMMA  148


 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 51/77 (66%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKDG+G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDGNGFISAAELRHVMTNLGEYLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G +++ EF+ +M  K
Sbjct  133  GDGQVNYEEFVQVMMAK  149



>gb|AAD34434.1|AF084450_1 calmodulin mutant SYNCAM31 [synthetic construct]
Length=149

 Score =   285 bits (728),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 141/148 (95%), Positives = 145/148 (98%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTD+QI+EFKEAFSLFDKDGDG ITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTD EEELKEAFRVFDKD NGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDWEEELKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQ+NYEEFV+VMMA
Sbjct  121  EVDEMIREADVDGDGQVNYEEFVQVMMA  148


 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 51/77 (66%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKDG+G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDWEEELKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G +++ EF+ +M  K
Sbjct  133  GDGQVNYEEFVQVMMAK  149



>gb|AAD34243.1|AF084395_1 calmodulin mutant SYNCAM11 [synthetic construct]
Length=149

 Score =   285 bits (728),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 141/148 (95%), Positives = 145/148 (98%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTD+QI+EFKEAFSLFDKDGDG ITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMAR MKDTDSEEELKEAFRVFDKD NGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARPMKDTDSEEELKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQ+NYEEFV+VMMA
Sbjct  121  EVDEMIREADVDGDGQVNYEEFVQVMMA  148


 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA  + D D   E KEAF +FDKDG+G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARPMKDTDSEEELKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G +++ EF+ +M  K
Sbjct  133  GDGQVNYEEFVQVMMAK  149



>gb|AAD34432.1|AF084448_1 calmodulin mutant SYNCAM38 [synthetic construct]
Length=149

 Score =   285 bits (728),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 141/148 (95%), Positives = 145/148 (98%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTD+QI+EFKEAFSLFDKDGDG ITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKD NGFI AAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDGNGFIYAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQ+NYEEFV+VMMA
Sbjct  121  EVDEMIREADVDGDGQVNYEEFVQVMMA  148


 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKDG+G I   EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDGNGFIYAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G +++ EF+ +M  K
Sbjct  133  GDGQVNYEEFVQVMMAK  149



>gb|AAD34262.1|AF084414_1 calmodulin mutant SYNCAM57D [synthetic construct]
Length=149

 Score =   285 bits (728),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 141/148 (95%), Positives = 145/148 (98%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTD+QI+EFKEAFSLFDKDGDG ITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMAR MKDTDSEEELKEAFRVFDKD NGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARVMKDTDSEEELKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQ+NYEEFV+VMMA
Sbjct  121  EVDEMIREADVDGDGQVNYEEFVQVMMA  148


 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 46/69 (67%), Gaps = 0/69 (0%)
 Frame = +3

Query  96   DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFP  275
            D   E KEAF +FDKDG+G I+  EL  VM +LG+  T+ E+ +MI E D DG+G +++ 
Sbjct  81   DSEEELKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQVNYE  140

Query  276  EFLNLMARK  302
            EF+ +M  K
Sbjct  141  EFVQVMMAK  149



>gb|AAD34261.1|AF084413_1 calmodulin mutant SYNCAM57C [synthetic construct]
Length=149

 Score =   284 bits (727),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 141/148 (95%), Positives = 145/148 (98%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTD+QI+EFKEAFSLFDKDGDG ITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMAR MKDTDSEEELKEAFRVFDKD NGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARGMKDTDSEEELKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQ+NYEEFV+VMMA
Sbjct  121  EVDEMIREADVDGDGQVNYEEFVQVMMA  148


 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 46/69 (67%), Gaps = 0/69 (0%)
 Frame = +3

Query  96   DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFP  275
            D   E KEAF +FDKDG+G I+  EL  VM +LG+  T+ E+ +MI E D DG+G +++ 
Sbjct  81   DSEEELKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQVNYE  140

Query  276  EFLNLMARK  302
            EF+ +M  K
Sbjct  141  EFVQVMMAK  149



>gb|AAD34244.1|AF084396_1 calmodulin mutant SYNCAM30 [synthetic construct]
Length=149

 Score =   284 bits (727),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 141/148 (95%), Positives = 145/148 (98%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTD+QI+EFKEAFSLFDKDGDG ITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTD EEELKEAFRVFDKD NGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDREEELKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQ+NYEEFV+VMMA
Sbjct  121  EVDEMIREADVDGDGQVNYEEFVQVMMA  148


 Score = 67.0 bits (162),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 52/77 (68%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D+  E KEAF +FDKDG+G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDREEELKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G +++ EF+ +M  K
Sbjct  133  GDGQVNYEEFVQVMMAK  149



>gb|ABR21726.1| calmodulin [Actinidia sabiifolia]
Length=148

 Score =   284 bits (727),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 142/148 (96%), Positives = 143/148 (97%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MAD LTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADPLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDS+EELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSDEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVD  GQINYEE V VMMA
Sbjct  121  EVDEMIREADVDVAGQINYEELVTVMMA  148



>gb|ABR21716.1| calmodulin [Actinidia sabiifolia]
Length=148

 Score =   284 bits (727),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 142/148 (96%), Positives = 144/148 (97%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MAD LTDDQISEFKEAFSLFDKDGDG ITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADPLTDDQISEFKEAFSLFDKDGDGRITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAE RHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAEHRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            ++DEMIR ADVDGDGQINYEEFVKVMMA
Sbjct  121  DIDEMIRAADVDGDGQINYEEFVKVMMA  148



>gb|KFK32437.1| hypothetical protein AALP_AA6G241500 [Arabis alpina]
Length=180

 Score =   285 bits (730),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 141/148 (95%), Positives = 143/148 (97%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            M DQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MGDQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            N TIDFPEFL LMARKM+DTDSEEELKEAFRVFDKDQNGFISAAELR VMTN+GEKLTDE
Sbjct  61   NRTIDFPEFLTLMARKMQDTDSEEELKEAFRVFDKDQNGFISAAELRRVMTNIGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINY EFVKVMMA
Sbjct  121  EVDEMIREADVDGDGQINYPEFVKVMMA  148


 Score = 67.8 bits (164),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 52/79 (66%), Gaps = 1/79 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM ++G+  T+ E+ +MI E D D
Sbjct  73   MARKMQDTDSEEELKEAFRVFDKDQNGFISAAELRRVMTNIGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARKMK  308
            G+G I++PEF+ +M  K +
Sbjct  133  GDGQINYPEFVKVMMAKRR  151



>gb|AAD34269.1|AF084421_1 calmodulin mutant SYNCAM71A [synthetic construct]
Length=149

 Score =   284 bits (727),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 141/148 (95%), Positives = 145/148 (98%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTD+QI+EFKEAFSLFDKDGDG ITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKD NGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQ+NYEEFV+VM A
Sbjct  121  EVDEMIREADVDGDGQVNYEEFVQVMSA  148


 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 52/77 (68%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKDG+G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G +++ EF+ +M+ K
Sbjct  133  GDGQVNYEEFVQVMSAK  149



>gb|AAD34240.1|AF084392_1 calmodulin mutant SYNCAM4 [synthetic construct]
Length=149

 Score =   284 bits (727),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 141/148 (95%), Positives = 145/148 (98%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTD+QI+EFKEAFSLFDKDGDG ITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKD NGFISAAELRHVMTNLGE LTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDGNGFISAAELRHVMTNLGEILTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQ+NYEEFV+VMMA
Sbjct  121  EVDEMIREADVDGDGQVNYEEFVQVMMA  148


 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 51/77 (66%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKDG+G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDGNGFISAAELRHVMTNLGEILTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G +++ EF+ +M  K
Sbjct  133  GDGQVNYEEFVQVMMAK  149



>ref|XP_010645766.1| PREDICTED: calmodulin [Vitis vinifera]
 emb|CAN72522.1| hypothetical protein VITISV_019208 [Vitis vinifera]
 emb|CBI38257.3| unnamed protein product [Vitis vinifera]
 emb|CDO98639.1| unnamed protein product [Coffea canephora]
Length=149

 Score =   284 bits (727),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 138/148 (93%), Positives = 147/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MA+QLT++QI+EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD 
Sbjct  1    MAEQLTEEQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADQ  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAF+VFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQ+NYEEFV++M+A
Sbjct  121  EVDEMIREADVDGDGQVNYEEFVRMMLA  148


 Score = 63.9 bits (154),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G +++ EF+ +M  K
Sbjct  133  GDGQVNYEEFVRMMLAK  149



>gb|AAD34263.1|AF084415_1 calmodulin mutant SYNCAM58A [synthetic construct]
Length=149

 Score =   284 bits (727),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 141/148 (95%), Positives = 145/148 (98%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTD+QI+EFKEAFSLFDKDGDG ITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKD NGFISAAELRHVMTNLGE LTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDGNGFISAAELRHVMTNLGEDLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQ+NYEEFV+VMMA
Sbjct  121  EVDEMIREADVDGDGQVNYEEFVQVMMA  148


 Score = 66.6 bits (161),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 52/77 (68%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKDG+G I+  EL  VM +LG++ T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDGNGFISAAELRHVMTNLGEDLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G +++ EF+ +M  K
Sbjct  133  GDGQVNYEEFVQVMMAK  149



>gb|AAD34247.1|AF084399_1 calmodulin mutant SYNCAM47 [synthetic construct]
Length=149

 Score =   284 bits (727),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 140/148 (95%), Positives = 146/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTD+QI+EFKEAFSLFDKDGDG ITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDS+E+LKEAFRVFDKD NGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSKEKLKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQ+NYEEFV+VMMA
Sbjct  121  EVDEMIREADVDGDGQVNYEEFVQVMMA  148


 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 51/77 (66%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   + KEAF +FDKDG+G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSKEKLKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G +++ EF+ +M  K
Sbjct  133  GDGQVNYEEFVQVMMAK  149



>gb|AAD34428.1|AF084444_1 calmodulin mutant SYNCAM40 [synthetic construct]
Length=149

 Score =   284 bits (727),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 140/148 (95%), Positives = 146/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTD+QI+EFKEAFSLFDKDGDG ITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEE+LKEAFRVFDKD NGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEKLKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            +VDEMIREADVDGDGQ+NYEEFV+VMMA
Sbjct  121  KVDEMIREADVDGDGQVNYEEFVQVMMA  148


 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 51/77 (66%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   + KEAF +FDKDG+G I+  EL  VM +LG+  T+ ++ +MI E D D
Sbjct  73   MARKMKDTDSEEKLKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEKVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G +++ EF+ +M  K
Sbjct  133  GDGQVNYEEFVQVMMAK  149



>gb|AAD34248.1|AF084400_1 calmodulin mutant SYNCAM48 [synthetic construct]
Length=149

 Score =   284 bits (727),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 140/148 (95%), Positives = 146/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTD+QI+EFKEAFSLFDKDGDG ITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSE++LKEAFRVFDKD NGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEKKLKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQ+NYEEFV+VMMA
Sbjct  121  EVDEMIREADVDGDGQVNYEEFVQVMMA  148


 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 51/77 (66%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   + KEAF +FDKDG+G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEKKLKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G +++ EF+ +M  K
Sbjct  133  GDGQVNYEEFVQVMMAK  149



>gb|AAD34246.1|AF084398_1 calmodulin mutant SYNCAM46 [synthetic construct]
Length=149

 Score =   284 bits (727),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 140/148 (95%), Positives = 146/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTD+QI+EFKEAFSLFDKDGDG ITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDS++ELKEAFRVFDKD NGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSKKELKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQ+NYEEFV+VMMA
Sbjct  121  EVDEMIREADVDGDGQVNYEEFVQVMMA  148


 Score = 67.4 bits (163),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 51/77 (66%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKDG+G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSKKELKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G +++ EF+ +M  K
Sbjct  133  GDGQVNYEEFVQVMMAK  149



>ref|XP_006849452.1| hypothetical protein AMTR_s00024p00073390 [Amborella trichopoda]
 gb|ERN11033.1| hypothetical protein AMTR_s00024p00073390 [Amborella trichopoda]
Length=218

 Score =   286 bits (733),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 139/148 (94%), Positives = 147/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MA+QLT++QISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MAEQLTEEQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAF+VFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREAD DGDGQ+NYEEFV++M+A
Sbjct  121  EVDEMIREADTDGDGQVNYEEFVRMMLA  148


 Score = 64.7 bits (156),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 51/79 (65%), Gaps = 1/79 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADTD  132

Query  252  GNGTIDFPEFLNLMARKMK  308
            G+G +++ EF+ +M  K K
Sbjct  133  GDGQVNYEEFVRMMLAKFK  151



>gb|AAD34409.1|AF084425_1 calmodulin mutant SYNCAM5 [synthetic construct]
Length=149

 Score =   284 bits (726),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 141/148 (95%), Positives = 145/148 (98%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTD+QI+EFKEAFSLFDKDGDG ITTKEL TVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDEQIAEFKEAFSLFDKDGDGTITTKELVTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKD NGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQ+NYEEFV+VMMA
Sbjct  121  EVDEMIREADVDGDGQVNYEEFVQVMMA  148


 Score = 66.6 bits (161),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 51/77 (66%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKDG+G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G +++ EF+ +M  K
Sbjct  133  GDGQVNYEEFVQVMMAK  149



>ref|XP_010243681.1| PREDICTED: calmodulin-like [Nelumbo nucifera]
Length=149

 Score =   283 bits (725),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 137/148 (93%), Positives = 147/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MA+QLT++QISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD 
Sbjct  1    MAEQLTEEQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADQ  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAF+VFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EV+EMIREAD+DGDGQ+NYEEFV++M+A
Sbjct  121  EVEEMIREADIDGDGQVNYEEFVRMMLA  148


 Score = 64.7 bits (156),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 51/77 (66%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+++MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDEEVEEMIREADID  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G +++ EF+ +M  K
Sbjct  133  GDGQVNYEEFVRMMLAK  149



>gb|ABK21279.1| unknown [Picea sitchensis]
Length=149

 Score =   283 bits (725),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 138/148 (93%), Positives = 147/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MA+QLT+DQI+EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMI+EVDADG
Sbjct  1    MAEQLTEDQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMISEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAF+VFDKDQNGFISAAELRHVMTNLGEKLTD 
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDG  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQ+NYEEFV++M+A
Sbjct  121  EVDEMIREADVDGDGQVNYEEFVRMMLA  148


 Score = 64.3 bits (155),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDGEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G +++ EF+ +M  K
Sbjct  133  GDGQVNYEEFVRMMLAK  149



>gb|AAD34429.1|AF084445_1 calmodulin mutant SYNCAM17 [synthetic construct]
Length=149

 Score =   283 bits (725),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 141/148 (95%), Positives = 145/148 (98%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTD+QI+EFKEAFSLFDKDGDG ITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKD NGFI AAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDGNGFIFAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQ+NYEEFV+VMMA
Sbjct  121  EVDEMIREADVDGDGQVNYEEFVQVMMA  148


 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKDG+G I   EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDGNGFIFAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G +++ EF+ +M  K
Sbjct  133  GDGQVNYEEFVQVMMAK  149



>sp|O82018.3|CALM_MOUSC RecName: Full=Calmodulin; Short=CaM [Mougeotia scalaris]
 emb|CAA74111.1| Calmodulin [Mougeotia scalaris]
Length=149

 Score =   283 bits (725),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 138/148 (93%), Positives = 146/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLT++QI+EFKEAFSLFDKDGDG ITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTEEQIAEFKEAFSLFDKDGDGSITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAF+VFDKDQNG+ISAA+ RHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFKVFDKDQNGYISAADWRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQ+NYEEFVK+MMA
Sbjct  121  EVDEMIREADVDGDGQVNYEEFVKMMMA  148


 Score = 61.2 bits (147),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 49/77 (64%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  +   VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFKVFDKDQNGYISAADWRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G +++ EF+ +M  K
Sbjct  133  GDGQVNYEEFVKMMMAK  149



>ref|XP_010271115.1| PREDICTED: calmodulin-like [Nelumbo nucifera]
Length=149

 Score =   283 bits (725),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 138/148 (93%), Positives = 146/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MA+QLT++QISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD 
Sbjct  1    MAEQLTEEQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADQ  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAF+VFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQ+NYEEFV++M+ 
Sbjct  121  EVDEMIREADVDGDGQVNYEEFVRMMLG  148


 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G +++ EF+ +M  K
Sbjct  133  GDGQVNYEEFVRMMLGK  149



>gb|AAD34241.1|AF084393_1 calmodulin mutant SYNCAM6 [synthetic construct]
Length=149

 Score =   283 bits (724),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 140/148 (95%), Positives = 145/148 (98%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTD+QI+EFKEAFSLFDKDGDG ITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMAR +KDTDSEEELKEAFRVFDKD NGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARPLKDTDSEEELKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQ+NYEEFV+VMMA
Sbjct  121  EVDEMIREADVDGDGQVNYEEFVQVMMA  148


 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA  L D D   E KEAF +FDKDG+G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARPLKDTDSEEELKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G +++ EF+ +M  K
Sbjct  133  GDGQVNYEEFVQVMMAK  149



>pdb|1VRK|A Chain A, The 1.9 Angstrom Structure Of E84k-Calmodulin Rs20 Peptide 
Complex
Length=148

 Score =   283 bits (724),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 140/147 (95%), Positives = 145/147 (99%), Gaps = 0/147 (0%)
 Frame = +3

Query  78   ADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGN  257
            ADQLTD+QI+EFKEAFSLFDKDGDG ITTKELGTVMRSLGQNPTEAELQDMINEVDADGN
Sbjct  1    ADQLTDEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGN  60

Query  258  GTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  437
            GTIDFPEFLNLMARKMKDTDSEE+LKEAFRVFDKD NGFISAAELRHVMTNLGEKLTDEE
Sbjct  61   GTIDFPEFLNLMARKMKDTDSEEKLKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEE  120

Query  438  VDEMIREADVDGDGQINYEEFVKVMMA  518
            VDEMIREADVDGDGQ+NYEEFV+VMMA
Sbjct  121  VDEMIREADVDGDGQVNYEEFVQVMMA  147


 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 51/77 (66%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   + KEAF +FDKDG+G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  72   MARKMKDTDSEEKLKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  131

Query  252  GNGTIDFPEFLNLMARK  302
            G+G +++ EF+ +M  K
Sbjct  132  GDGQVNYEEFVQVMMAK  148



>gb|EMT12142.1| Calmodulin-related protein [Aegilops tauschii]
Length=418

 Score =   293 bits (749),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 143/144 (99%), Positives = 144/144 (100%), Gaps = 0/144 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQI+EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDDQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVK  506
            EVDEMIREADVDGDGQINYEEFVK
Sbjct  121  EVDEMIREADVDGDGQINYEEFVK  144


 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 49/74 (66%), Gaps = 1/74 (1%)
 Frame = +3

Query  291  MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  470
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  1    MADQLTD-DQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  59

Query  471  GDGQINYEEFVKVM  512
            G+G I++ EF+ +M
Sbjct  60   GNGTIDFPEFLNLM  73



>ref|XP_001765847.1| predicted protein [Physcomitrella patens]
 gb|EDQ69438.1| predicted protein [Physcomitrella patens]
Length=149

 Score =   283 bits (724),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 138/148 (93%), Positives = 146/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MA+ LT++QI+EFKEAFSLFDKDGDG ITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MAEHLTEEQIAEFKEAFSLFDKDGDGSITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAF+VFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQ+NYEEFV++MMA
Sbjct  121  EVDEMIREADVDGDGQVNYEEFVRMMMA  148


 Score = 64.3 bits (155),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G +++ EF+ +M  K
Sbjct  133  GDGQVNYEEFVRMMMAK  149



>ref|XP_004961665.1| PREDICTED: calmodulin-2-like isoform X1 [Setaria italica]
Length=170

 Score =   283 bits (725),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 146/169 (86%), Positives = 148/169 (88%), Gaps = 21/169 (12%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDG---------------------CITTKELGTVMRS  191
            MADQLTD+QI+EFKEAFSLFDKDGDG                     CITTKELGTVMRS
Sbjct  1    MADQLTDEQIAEFKEAFSLFDKDGDGTRLPPSPASIRPLWFLFPLAGCITTKELGTVMRS  60

Query  192  LGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNG  371
            LGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNG
Sbjct  61   LGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNG  120

Query  372  FISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMA  518
            FISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMA
Sbjct  121  FISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMA  169


 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  94   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  153

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  154  GDGQINYEEFVKVMMAK  170



>ref|XP_001760060.1| predicted protein [Physcomitrella patens]
 gb|EDQ75185.1| predicted protein [Physcomitrella patens]
Length=149

 Score =   283 bits (723),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 140/148 (95%), Positives = 145/148 (98%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            M +QLT+DQI+EFKEAFSLFDKDGDG ITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MVEQLTEDQIAEFKEAFSLFDKDGDGSITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDF EFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTD+
Sbjct  61   NGTIDFAEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDD  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQINYEEFVK+MMA
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKMMMA  148


 Score = 64.3 bits (155),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDDEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  133  GDGQINYEEFVKMMMAK  149



>gb|AAD34414.1|AF084430_1 calmodulin mutant SYNCAM8 [synthetic construct]
Length=149

 Score =   283 bits (723),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 139/148 (94%), Positives = 146/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTD+QI+EFKEAFSLFDKDGDG ITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDS+++LKEAFRVFDKD NGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSKKKLKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQ+NYEEFV+VMMA
Sbjct  121  EVDEMIREADVDGDGQVNYEEFVQVMMA  148


 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 51/77 (66%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   + KEAF +FDKDG+G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSKKKLKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G +++ EF+ +M  K
Sbjct  133  GDGQVNYEEFVQVMMAK  149



>gb|AAM34757.1|AF510075_1 calmodulin 1 [Ceratopteris richardii]
Length=149

 Score =   283 bits (723),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 137/148 (93%), Positives = 146/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MA+QLT DQI+EFKEAF LFDKDGDGCITTKELGTVMRSLGQNPTEAELQ+MINEVDADG
Sbjct  1    MAEQLTTDQIAEFKEAFGLFDKDGDGCITTKELGTVMRSLGQNPTEAELQEMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAF+VFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQ+NYEEFV++M++
Sbjct  121  EVDEMIREADVDGDGQVNYEEFVRMMLS  148


 Score = 63.9 bits (154),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G +++ EF+ +M  K
Sbjct  133  GDGQVNYEEFVRMMLSK  149



>ref|XP_011073165.1| PREDICTED: calmodulin [Sesamum indicum]
Length=149

 Score =   282 bits (722),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 137/148 (93%), Positives = 146/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MA+QLT++QI+EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD 
Sbjct  1    MAEQLTEEQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADQ  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKD DSEEELKEAF+VFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDADSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQ+NYEEFV++M+A
Sbjct  121  EVDEMIREADVDGDGQVNYEEFVRMMLA  148


 Score = 63.9 bits (154),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDADSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G +++ EF+ +M  K
Sbjct  133  GDGQVNYEEFVRMMLAK  149



>gb|AAD34418.1|AF084434_1 calmodulin mutant SYNCAM24 [synthetic construct]
Length=149

 Score =   282 bits (722),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 140/148 (95%), Positives = 144/148 (97%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLT  +I+EFKEAFSLFDKDGDG ITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTKKKIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKD NGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQ+NYEEFV+VMMA
Sbjct  121  EVDEMIREADVDGDGQVNYEEFVQVMMA  148


 Score = 66.6 bits (161),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 51/77 (66%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKDG+G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G +++ EF+ +M  K
Sbjct  133  GDGQVNYEEFVQVMMAK  149



>ref|XP_008798212.1| PREDICTED: calmodulin [Phoenix dactylifera]
Length=149

 Score =   282 bits (722),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 136/148 (92%), Positives = 147/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MA+QLT++QI+EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD 
Sbjct  1    MAEQLTEEQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADQ  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAF+VFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EV+EMIREAD+DGDGQ+NYEEFV++M+A
Sbjct  121  EVEEMIREADIDGDGQVNYEEFVRMMLA  148


 Score = 64.7 bits (156),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 51/77 (66%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+++MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDEEVEEMIREADID  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G +++ EF+ +M  K
Sbjct  133  GDGQVNYEEFVRMMLAK  149



>ref|NP_001154754.1| calmodulin 1 [Arabidopsis thaliana]
 gb|AED94231.1| calmodulin 1 [Arabidopsis thaliana]
Length=164

 Score =   283 bits (723),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 144/163 (88%), Positives = 148/163 (91%), Gaps = 15/163 (9%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGD---------------GCITTKELGTVMRSLGQNPT  209
            MADQLTD+QISEFKEAFSLFDKDGD               GCITTKELGTVMRSLGQNPT
Sbjct  1    MADQLTDEQISEFKEAFSLFDKDGDALNMCLLVANLFRFGGCITTKELGTVMRSLGQNPT  60

Query  210  EAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAE  389
            EAELQDMINEVDADGNGTIDFPEFLNLMA+KMKDTDSEEELKEAFRVFDKDQNGFISAAE
Sbjct  61   EAELQDMINEVDADGNGTIDFPEFLNLMAKKMKDTDSEEELKEAFRVFDKDQNGFISAAE  120

Query  390  LRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMA  518
            LRHVMTNLGEKLTDEEV+EMIREADVDGDGQINYEEFVK+MMA
Sbjct  121  LRHVMTNLGEKLTDEEVEEMIREADVDGDGQINYEEFVKIMMA  163


 Score = 65.1 bits (157),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 51/77 (66%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+++MI E D D
Sbjct  88   MAKKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVEEMIREADVD  147

Query  252  GNGTIDFPEFLNLMARK  302
            G+G I++ EF+ +M  K
Sbjct  148  GDGQINYEEFVKIMMAK  164



>gb|AAD34420.1|AF084436_1 calmodulin mutant SYNCAM43 [synthetic construct]
Length=149

 Score =   282 bits (721),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 139/148 (94%), Positives = 145/148 (98%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTD+QI+EFKEAFSLFDKDGDG ITTKELGTVMRSLGQNPT+ +LQDMINEVDADG
Sbjct  1    MADQLTDEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTKKKLQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKD NGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQ+NYEEFV+VMMA
Sbjct  121  EVDEMIREADVDGDGQVNYEEFVQVMMA  148


 Score = 66.6 bits (161),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 51/77 (66%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKDG+G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G +++ EF+ +M  K
Sbjct  133  GDGQVNYEEFVQVMMAK  149



>ref|NP_001234786.1| calmodulin [Solanum lycopersicum]
 ref|XP_009589661.1| PREDICTED: calmodulin [Nicotiana tomentosiformis]
 ref|XP_009776698.1| PREDICTED: calmodulin [Nicotiana sylvestris]
 sp|P27161.2|CALM_SOLLC RecName: Full=Calmodulin; Short=CaM [Solanum lycopersicum]
 gb|AAA34144.1| calmodulin [Solanum lycopersicum]
 emb|CAA09302.1| calmodulin 3 protein [Capsicum annuum]
 dbj|BAB61907.1| calmodulin NtCaM1 [Nicotiana tabacum]
 dbj|BAB61908.1| calmodulin NtCaM2 [Nicotiana tabacum]
 emb|CAC84563.1| putative calmodulin [Solanum commersonii]
Length=149

 Score =   282 bits (721),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 136/148 (92%), Positives = 147/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MA+QLT++QI+EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMI+EVDAD 
Sbjct  1    MAEQLTEEQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMISEVDADQ  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAF+VFDKDQNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREAD+DGDGQ+NYEEFV++M+A
Sbjct  121  EVDEMIREADIDGDGQVNYEEFVRMMLA  148


 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADID  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G +++ EF+ +M  K
Sbjct  133  GDGQVNYEEFVRMMLAK  149



>gb|AAD34423.1|AF084439_1 calmodulin mutant SYNCAM12A [synthetic construct]
Length=149

 Score =   282 bits (721),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 139/148 (94%), Positives = 145/148 (98%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTD+QI+EFKEAFSLFDKDGDG ITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKD NGFISAAELRHVMTNLGEKLT +
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTKK  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            +VDEMIREADVDGDGQ+NYEEFV+VMMA
Sbjct  121  KVDEMIREADVDGDGQVNYEEFVQVMMA  148


 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 51/77 (66%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKDG+G I+  EL  VM +LG+  T+ ++ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTKKKVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G +++ EF+ +M  K
Sbjct  133  GDGQVNYEEFVQVMMAK  149



>gb|AAD34427.1|AF084443_1 calmodulin mutant SYNCAM15 [synthetic construct]
Length=152

 Score =   281 bits (720),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 142/151 (94%), Positives = 146/151 (97%), Gaps = 3/151 (2%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTD+QI+EFKEAFSLFDKDGDG ITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPEFLNLMARKMKDTD---SEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKL  425
            NGTIDFPEFLNLMARKMKDTD   SEEELKEAFRVFDKD NGFISAAELRHVMTNLGEKL
Sbjct  61   NGTIDFPEFLNLMARKMKDTDKGKSEEELKEAFRVFDKDGNGFISAAELRHVMTNLGEKL  120

Query  426  TDEEVDEMIREADVDGDGQINYEEFVKVMMA  518
            TDEEVDEMIREADVDGDGQ+NYEEFV+VMMA
Sbjct  121  TDEEVDEMIREADVDGDGQVNYEEFVQVMMA  151


 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = +3

Query  108  EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLN  287
            E KEAF +FDKDG+G I+  EL  VM +LG+  T+ E+ +MI E D DG+G +++ EF+ 
Sbjct  88   ELKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQVNYEEFVQ  147

Query  288  LMARK  302
            +M  K
Sbjct  148  VMMAK  152



>gb|EYU24499.1| hypothetical protein MIMGU_mgv1a015687mg [Erythranthe guttata]
Length=149

 Score =   281 bits (719),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 136/148 (92%), Positives = 146/148 (99%), Gaps = 0/148 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MA+QLT++QI+EFKEAFSLFDKDGDGCIT+KELGTVMRSLGQNPTEAELQDMINEVDAD 
Sbjct  1    MAEQLTEEQIAEFKEAFSLFDKDGDGCITSKELGTVMRSLGQNPTEAELQDMINEVDADQ  60

Query  255  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  434
            NGTIDFPEFLNLMARKMKDTDSEEELKEAF+VFDKDQNGFISAAELRHVM NLGEKLTDE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMANLGEKLTDE  120

Query  435  EVDEMIREADVDGDGQINYEEFVKVMMA  518
            EVDEMIREADVDGDGQ+NYEEFV++M+A
Sbjct  121  EVDEMIREADVDGDGQVNYEEFVRMMLA  148


 Score = 63.9 bits (154),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMANLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEFLNLMARK  302
            G+G +++ EF+ +M  K
Sbjct  133  GDGQVNYEEFVRMMLAK  149



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 566636427000