BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002E23

Length=543
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAD22104.1|  B12D protein                                            185   9e-57   Ipomoea batatas [batate]
ref|XP_011087179.1|  PREDICTED: uncharacterized protein LOC105168733    162   7e-48   Sesamum indicum [beniseed]
ref|XP_010942173.1|  PREDICTED: uncharacterized protein LOC105060...    160   3e-47   Elaeis guineensis
ref|XP_010929102.1|  PREDICTED: uncharacterized protein LOC105050689    160   4e-47   Elaeis guineensis
ref|XP_008779549.1|  PREDICTED: uncharacterized protein LOC103699287    159   8e-47   Phoenix dactylifera
gb|EPS70000.1|  hypothetical protein M569_04763                         158   2e-46   Genlisea aurea
ref|XP_009627555.1|  PREDICTED: uncharacterized protein LOC104118078    160   2e-46   
ref|NP_001057280.1|  Os06g0246000                                       158   3e-46   
ref|XP_008806317.1|  PREDICTED: uncharacterized protein LOC103719037    157   5e-46   Phoenix dactylifera
ref|XP_010470676.1|  PREDICTED: uncharacterized protein LOC104750563    159   7e-46   Camelina sativa [gold-of-pleasure]
ref|XP_002283743.1|  PREDICTED: uncharacterized protein LOC100263922    157   7e-46   Vitis vinifera
ref|XP_010100274.1|  hypothetical protein L484_027580                   157   8e-46   Morus notabilis
ref|XP_008792162.1|  PREDICTED: uncharacterized protein LOC103708847    157   1e-45   Phoenix dactylifera
ref|XP_009385140.1|  PREDICTED: uncharacterized protein LOC103972508    156   1e-45   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004233340.1|  PREDICTED: uncharacterized protein LOC101261386    156   2e-45   
ref|XP_008437938.1|  PREDICTED: uncharacterized protein LOC103483212    156   2e-45   Cucumis melo [Oriental melon]
ref|XP_010556171.1|  PREDICTED: uncharacterized protein LOC104825524    155   2e-45   Tarenaya hassleriana [spider flower]
ref|XP_006357136.1|  PREDICTED: uncharacterized protein LOC102583994    155   3e-45   Solanum tuberosum [potatoes]
ref|XP_008222037.1|  PREDICTED: uncharacterized protein LOC103321965    155   3e-45   Prunus mume [ume]
ref|XP_010027818.1|  PREDICTED: uncharacterized protein LOC104418237    155   3e-45   Eucalyptus grandis [rose gum]
ref|XP_008800943.1|  PREDICTED: uncharacterized protein LOC103715180    156   3e-45   Phoenix dactylifera
ref|XP_004152455.1|  PREDICTED: uncharacterized protein LOC101218501    155   3e-45   
ref|XP_006856912.1|  hypothetical protein AMTR_s00055p00220460          155   4e-45   Amborella trichopoda
ref|XP_010511712.1|  PREDICTED: uncharacterized protein LOC104787778    155   4e-45   Camelina sativa [gold-of-pleasure]
ref|XP_007226455.1|  hypothetical protein PRUPE_ppa024551mg             155   4e-45   Prunus persica
emb|CBI15096.3|  unnamed protein product                                155   5e-45   Vitis vinifera
ref|XP_010415343.1|  PREDICTED: uncharacterized protein LOC104701372    155   6e-45   Camelina sativa [gold-of-pleasure]
ref|XP_010913425.1|  PREDICTED: uncharacterized protein LOC105039118    154   1e-44   Elaeis guineensis
ref|XP_006655963.1|  PREDICTED: uncharacterized protein LOC102707968    154   1e-44   Oryza brachyantha
ref|XP_010027794.1|  PREDICTED: uncharacterized protein LOC104418219    154   1e-44   Eucalyptus grandis [rose gum]
ref|XP_004236155.1|  PREDICTED: uncharacterized protein LOC101260417    154   1e-44   Solanum lycopersicum
ref|XP_010930055.1|  PREDICTED: uncharacterized protein LOC105051361    154   1e-44   Elaeis guineensis
ref|XP_006344997.1|  PREDICTED: uncharacterized protein LOC102605944    154   2e-44   Solanum tuberosum [potatoes]
ref|XP_007138129.1|  hypothetical protein PHAVU_009G182600g             154   2e-44   Phaseolus vulgaris [French bean]
ref|XP_008798028.1|  PREDICTED: uncharacterized protein LOC103713044    154   2e-44   Phoenix dactylifera
ref|XP_009785405.1|  PREDICTED: uncharacterized protein LOC104233674    153   2e-44   Nicotiana sylvestris
ref|XP_002311729.1|  hypothetical protein POPTR_0008s17950g             153   2e-44   Populus trichocarpa [western balsam poplar]
ref|XP_004501964.1|  PREDICTED: uncharacterized protein LOC101508877    153   2e-44   Cicer arietinum [garbanzo]
ref|XP_011029641.1|  PREDICTED: uncharacterized protein LOC105129336    153   2e-44   Populus euphratica
gb|AGC24177.1|  unknown                                                 153   2e-44   Rehmannia glutinosa [Chinese foxglove]
ref|XP_009403647.1|  PREDICTED: uncharacterized protein LOC103987158    153   2e-44   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006338509.1|  PREDICTED: uncharacterized protein LOC102603775    153   3e-44   Solanum tuberosum [potatoes]
ref|NP_001148351.1|  LOC100281961                                       153   3e-44   Zea mays [maize]
ref|XP_003564009.1|  PREDICTED: uncharacterized protein LOC100821381    152   4e-44   Brachypodium distachyon [annual false brome]
ref|XP_011042304.1|  PREDICTED: uncharacterized protein LOC105138023    152   4e-44   Populus euphratica
ref|XP_002511469.1|  conserved hypothetical protein                     152   4e-44   Ricinus communis
ref|XP_010111964.1|  hypothetical protein L484_004741                   152   4e-44   Morus notabilis
ref|XP_010678668.1|  PREDICTED: uncharacterized protein LOC104894188    152   5e-44   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009615457.1|  PREDICTED: uncharacterized protein LOC104108174    152   5e-44   Nicotiana tomentosiformis
ref|XP_002314553.2|  hypothetical protein POPTR_0010s06550g             154   6e-44   Populus trichocarpa [western balsam poplar]
gb|ADB08699.1|  B12D-like protein                                       152   7e-44   Wolffia arrhiza
ref|XP_010272106.1|  PREDICTED: uncharacterized protein LOC104607987    152   7e-44   Nelumbo nucifera [Indian lotus]
ref|XP_002270661.1|  PREDICTED: uncharacterized protein LOC100259604    152   8e-44   Vitis vinifera
ref|XP_009760043.1|  PREDICTED: uncharacterized protein LOC104212451    152   8e-44   Nicotiana sylvestris
ref|XP_007163724.1|  hypothetical protein PHAVU_001G258900g             151   1e-43   Phaseolus vulgaris [French bean]
ref|XP_003527039.1|  PREDICTED: uncharacterized protein LOC100499787    151   1e-43   Glycine max [soybeans]
ref|XP_008340166.1|  PREDICTED: uncharacterized protein LOC103403120    151   2e-43   
ref|XP_007209803.1|  hypothetical protein PRUPE_ppa014036mg             151   2e-43   Prunus persica
ref|XP_011042649.1|  PREDICTED: uncharacterized protein LOC105138299    151   2e-43   Populus euphratica
ref|XP_009771458.1|  PREDICTED: uncharacterized protein LOC104221988    151   2e-43   Nicotiana sylvestris
gb|ACJ84101.1|  unknown                                                 151   2e-43   Medicago truncatula
gb|AFO59572.1|  B12D like protein                                       151   2e-43   Saccharum hybrid cultivar GT28
ref|XP_004232259.1|  PREDICTED: uncharacterized protein LOC101265497    151   2e-43   Solanum lycopersicum
ref|XP_011085792.1|  PREDICTED: uncharacterized protein LOC105167687    151   2e-43   Sesamum indicum [beniseed]
ref|XP_011098540.1|  PREDICTED: uncharacterized protein LOC105177185    151   2e-43   Sesamum indicum [beniseed]
gb|AEC10990.1|  b12d-like protein                                       150   2e-43   Camellia sinensis [black tea]
ref|XP_003551877.1|  PREDICTED: uncharacterized protein LOC100500344    150   2e-43   Glycine max [soybeans]
ref|XP_010942172.1|  PREDICTED: uncharacterized protein LOC105060...    151   3e-43   Elaeis guineensis
ref|XP_003523058.1|  PREDICTED: uncharacterized protein LOC100500534    150   3e-43   Glycine max [soybeans]
ref|NP_001152717.1|  LOC100286358                                       150   3e-43   Zea mays [maize]
ref|XP_002438146.1|  hypothetical protein SORBIDRAFT_10g008810          150   3e-43   Sorghum bicolor [broomcorn]
ref|XP_006845122.1|  hypothetical protein AMTR_s00005p00190110          150   3e-43   Amborella trichopoda
ref|XP_006439727.1|  hypothetical protein CICLE_v10023087mg             150   4e-43   Citrus clementina [clementine]
gb|ACU15396.1|  unknown                                                 150   4e-43   Glycine max [soybeans]
gb|AFK33307.1|  unknown                                                 150   6e-43   Medicago truncatula
emb|CDP02170.1|  unnamed protein product                                149   6e-43   Coffea canephora [robusta coffee]
emb|CAK22419.1|  B12D-like protein                                      149   6e-43   Beta vulgaris [beet]
ref|XP_002515002.1|  conserved hypothetical protein                     149   9e-43   
gb|KDP26755.1|  hypothetical protein JCGZ_17913                         149   1e-42   Jatropha curcas
ref|XP_008239697.1|  PREDICTED: uncharacterized protein LOC103338283    149   1e-42   Prunus mume [ume]
ref|XP_002318014.1|  senescence-associated family protein               149   1e-42   Populus trichocarpa [western balsam poplar]
gb|KHG12689.1|  Uncharacterized protein F383_19724                      149   1e-42   Gossypium arboreum [tree cotton]
ref|XP_006391239.1|  hypothetical protein EUTSA_v10019446mg             149   1e-42   Eutrema salsugineum [saltwater cress]
ref|XP_010907762.1|  PREDICTED: uncharacterized protein LOC105034337    149   1e-42   Elaeis guineensis
gb|ACU15648.1|  unknown                                                 149   1e-42   Glycine max [soybeans]
ref|XP_010546014.1|  PREDICTED: uncharacterized protein LOC104818223    149   1e-42   Tarenaya hassleriana [spider flower]
ref|XP_009588369.1|  PREDICTED: uncharacterized protein LOC104085953    149   2e-42   Nicotiana tomentosiformis
emb|CDP14927.1|  unnamed protein product                                149   2e-42   Coffea canephora [robusta coffee]
ref|XP_004965125.1|  PREDICTED: uncharacterized protein LOC101762161    148   2e-42   Setaria italica
gb|KHG26447.1|  Uncharacterized protein F383_04740                      148   2e-42   Gossypium arboreum [tree cotton]
ref|XP_004502329.1|  PREDICTED: uncharacterized protein LOC101491577    148   2e-42   Cicer arietinum [garbanzo]
gb|KJB30971.1|  hypothetical protein B456_005G172200                    148   3e-42   Gossypium raimondii
ref|XP_003538567.1|  PREDICTED: uncharacterized protein LOC100527541    148   3e-42   Glycine max [soybeans]
ref|XP_010255359.1|  PREDICTED: uncharacterized protein LOC104596051    147   4e-42   Nelumbo nucifera [Indian lotus]
ref|XP_008374479.1|  PREDICTED: uncharacterized protein LOC103437758    147   5e-42   Malus domestica [apple tree]
gb|KHN44408.1|  hypothetical protein glysoja_014449                     147   8e-42   Glycine soja [wild soybean]
gb|ACU16637.1|  unknown                                                 146   2e-41   Glycine max [soybeans]
ref|XP_010550670.1|  PREDICTED: uncharacterized protein LOC104821467    145   3e-41   Tarenaya hassleriana [spider flower]
ref|XP_007036078.1|  B12D protein                                       145   4e-41   Theobroma cacao [chocolate]
ref|XP_006404294.1|  hypothetical protein EUTSA_v10010862mg             145   4e-41   Eutrema salsugineum [saltwater cress]
gb|AFK36649.1|  unknown                                                 145   4e-41   Lotus japonicus
ref|XP_004142944.1|  PREDICTED: uncharacterized protein LOC101222643    144   7e-41   Cucumis sativus [cucumbers]
ref|XP_008351806.1|  PREDICTED: uncharacterized protein LOC103415246    144   1e-40   
gb|AFK42697.1|  unknown                                                 144   1e-40   Lotus japonicus
gb|KCW61991.1|  hypothetical protein EUGRSUZ_H04674                     145   1e-40   Eucalyptus grandis [rose gum]
gb|EMT09386.1|  hypothetical protein F775_07588                         143   2e-40   
ref|XP_010692143.1|  PREDICTED: uncharacterized protein LOC104905334    143   2e-40   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004504481.1|  PREDICTED: uncharacterized protein LOC101503540    143   3e-40   Cicer arietinum [garbanzo]
gb|KFK34105.1|  b12d protein                                            142   4e-40   Arabis alpina [alpine rockcress]
ref|XP_010515125.1|  PREDICTED: uncharacterized protein LOC104791023    142   5e-40   Camelina sativa [gold-of-pleasure]
ref|XP_004310038.1|  PREDICTED: uncharacterized protein LOC101295883    142   7e-40   Fragaria vesca subsp. vesca
emb|CAA54065.1|  HvB12D                                                 142   7e-40   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002875880.1|  hypothetical protein ARALYDRAFT_485174             141   9e-40   
ref|NP_190397.1|  B12D protein                                          141   1e-39   Arabidopsis thaliana [mouse-ear cress]
emb|CDY44977.1|  BnaCnng12070D                                          141   1e-39   Brassica napus [oilseed rape]
ref|XP_006290288.1|  hypothetical protein CARUB_v10018322mg             140   2e-39   Capsella rubella
ref|XP_009149843.1|  PREDICTED: uncharacterized protein LOC103873171    140   2e-39   Brassica rapa
ref|XP_003601829.1|  B12D protein                                       140   2e-39   Medicago truncatula
gb|EMS61978.1|  hypothetical protein TRIUR3_19930                       139   2e-38   Triticum urartu
gb|ACG48656.1|  B12D protein                                            139   2e-38   Zea mays [maize]
gb|KEH20547.1|  NADH-ubiquinone reductase complex 1 MLRQ subunit        138   2e-38   Medicago truncatula
ref|XP_007044988.1|  B12D protein                                       137   3e-38   Theobroma cacao [chocolate]
ref|XP_009150210.1|  PREDICTED: uncharacterized protein LOC103873555    137   3e-38   Brassica rapa
ref|XP_008651557.1|  PREDICTED: B12D protein isoform X1                 138   3e-38   Zea mays [maize]
ref|XP_002459694.1|  hypothetical protein SORBIDRAFT_02g008930          137   4e-38   Sorghum bicolor [broomcorn]
ref|XP_004299593.1|  PREDICTED: uncharacterized protein LOC101301782    137   7e-38   Fragaria vesca subsp. vesca
gb|ABK24106.1|  unknown                                                 137   8e-38   Picea sitchensis
gb|AFW76868.1|  hypothetical protein ZEAMMB73_758599                    137   1e-37   
gb|EMT27875.1|  hypothetical protein F775_28789                         134   8e-37   
ref|XP_006376832.1|  hypothetical protein POPTR_0012s07660g             133   1e-36   
ref|XP_011086732.1|  PREDICTED: uncharacterized protein LOC105168371    132   2e-36   Sesamum indicum [beniseed]
dbj|BAK01100.1|  predicted protein                                      133   2e-36   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004955942.1|  PREDICTED: uncharacterized protein LOC101785845    132   6e-36   Setaria italica
gb|EPS70497.1|  hypothetical protein M569_04271                         131   6e-36   Genlisea aurea
ref|XP_010249439.1|  PREDICTED: uncharacterized protein LOC104591985    131   8e-36   Nelumbo nucifera [Indian lotus]
gb|EMS45331.1|  hypothetical protein TRIUR3_29962                       131   1e-35   Triticum urartu
ref|XP_003557311.1|  PREDICTED: uncharacterized protein LOC100833199    131   2e-35   
dbj|BAK01669.1|  predicted protein                                      130   2e-35   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAC84633.1|  putative B12D protein                                  130   2e-35   Oryza sativa Japonica Group [Japonica rice]
emb|CDP13299.1|  unnamed protein product                                129   7e-35   Coffea canephora [robusta coffee]
ref|XP_006658464.1|  PREDICTED: uncharacterized protein LOC102702396    128   2e-34   Oryza brachyantha
ref|XP_006338343.1|  PREDICTED: uncharacterized protein LOC102603988    125   2e-33   Solanum tuberosum [potatoes]
ref|XP_006438116.1|  hypothetical protein CICLE_v10033501mg             124   4e-33   Citrus clementina [clementine]
ref|XP_009596991.1|  PREDICTED: uncharacterized protein LOC104092997    124   5e-33   Nicotiana tomentosiformis
ref|XP_006484337.1|  PREDICTED: uncharacterized protein LOC102622685    124   7e-33   
ref|XP_010694063.1|  PREDICTED: uncharacterized protein LOC104906928    123   9e-33   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004232140.1|  PREDICTED: uncharacterized protein LOC101252543    123   1e-32   Solanum lycopersicum
ref|NP_001151846.1|  B12D protein                                       122   2e-32   Zea mays [maize]
ref|XP_011099034.1|  PREDICTED: uncharacterized protein LOC105177540    122   2e-32   Sesamum indicum [beniseed]
gb|AAL17696.1|  B12D-like protein                                       124   3e-32   Castanea sativa
ref|XP_009792586.1|  PREDICTED: uncharacterized protein LOC104239607    122   3e-32   Nicotiana sylvestris
ref|XP_001779363.1|  predicted protein                                  122   5e-32   
gb|EYU29787.1|  hypothetical protein MIMGU_mgv1a021169mg                121   5e-32   Erythranthe guttata [common monkey flower]
ref|XP_008464582.1|  PREDICTED: uncharacterized protein LOC103502424    121   6e-32   Cucumis melo [Oriental melon]
ref|XP_010257978.1|  PREDICTED: uncharacterized protein LOC104597899    121   9e-32   Nelumbo nucifera [Indian lotus]
emb|CDP19974.1|  unnamed protein product                                120   2e-31   Coffea canephora [robusta coffee]
dbj|BAG94722.1|  unnamed protein product                                120   2e-31   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001059359.1|  Os07g0274400                                       120   2e-31   
gb|EYU20492.1|  hypothetical protein MIMGU_mgv1a026736mg                119   3e-31   Erythranthe guttata [common monkey flower]
ref|XP_007215204.1|  hypothetical protein PRUPE_ppa014104mg             119   3e-31   Prunus persica
gb|EYU25265.1|  hypothetical protein MIMGU_mgv1a024239mg                119   3e-31   Erythranthe guttata [common monkey flower]
ref|XP_008230281.1|  PREDICTED: uncharacterized protein LOC103329570    119   4e-31   Prunus mume [ume]
ref|XP_010099316.1|  hypothetical protein L484_018178                   119   5e-31   Morus notabilis
ref|XP_010260574.1|  PREDICTED: uncharacterized protein LOC104599651    119   7e-31   Nelumbo nucifera [Indian lotus]
ref|XP_001776158.1|  predicted protein                                  119   7e-31   
ref|XP_006856407.1|  hypothetical protein AMTR_s00047p00213990          118   8e-31   Amborella trichopoda
ref|XP_003531875.1|  PREDICTED: uncharacterized protein LOC100527287    118   8e-31   Glycine max [soybeans]
ref|XP_008362218.1|  PREDICTED: uncharacterized protein LOC103425898    118   8e-31   
ref|XP_011021065.1|  PREDICTED: uncharacterized protein LOC105123251    118   9e-31   Populus euphratica
ref|XP_008664404.1|  PREDICTED: uncharacterized protein LOC100383000    118   9e-31   Zea mays [maize]
dbj|BAK03592.1|  predicted protein                                      118   1e-30   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006373388.1|  germination family protein                         117   2e-30   Populus trichocarpa [western balsam poplar]
ref|XP_010029400.1|  PREDICTED: uncharacterized protein LOC104419...    117   2e-30   Eucalyptus grandis [rose gum]
ref|XP_008379445.1|  PREDICTED: uncharacterized protein LOC103442440    117   2e-30   
ref|NP_001059360.2|  Os07g0274700                                       118   2e-30   
ref|XP_002281305.1|  PREDICTED: uncharacterized protein LOC100258293    117   3e-30   Vitis vinifera
ref|XP_010260461.1|  PREDICTED: uncharacterized protein LOC104599559    117   3e-30   Nelumbo nucifera [Indian lotus]
ref|XP_006658463.1|  PREDICTED: uncharacterized protein LOC102702117    117   4e-30   Oryza brachyantha
dbj|BAJ88884.1|  predicted protein                                      118   4e-30   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006340507.1|  PREDICTED: uncharacterized protein LOC102592850    117   4e-30   Solanum tuberosum [potatoes]
ref|XP_004137261.1|  PREDICTED: uncharacterized protein LOC101217963    116   5e-30   Cucumis sativus [cucumbers]
ref|XP_004304209.1|  PREDICTED: uncharacterized protein LOC101313329    116   5e-30   Fragaria vesca subsp. vesca
gb|KJB22813.1|  hypothetical protein B456_004G066900                    116   5e-30   Gossypium raimondii
ref|XP_002459693.1|  hypothetical protein SORBIDRAFT_02g008920          117   5e-30   Sorghum bicolor [broomcorn]
ref|XP_007032847.1|  B12D protein                                       116   6e-30   
ref|XP_006482419.1|  PREDICTED: uncharacterized protein LOC102612079    116   7e-30   Citrus sinensis [apfelsine]
ref|XP_004955938.1|  PREDICTED: uncharacterized protein LOC101784102    115   9e-30   Setaria italica
ref|XP_002531002.1|  conserved hypothetical protein                     115   1e-29   Ricinus communis
gb|KCW56312.1|  hypothetical protein EUGRSUZ_I02053                     120   1e-29   Eucalyptus grandis [rose gum]
ref|XP_010034410.1|  PREDICTED: uncharacterized protein LOC104423644    115   2e-29   
ref|XP_007139429.1|  hypothetical protein PHAVU_008G028700g             116   2e-29   Phaseolus vulgaris [French bean]
ref|XP_004491894.1|  PREDICTED: uncharacterized protein LOC101510215    115   2e-29   Cicer arietinum [garbanzo]
ref|XP_003561264.1|  PREDICTED: uncharacterized protein LOC100824762    114   3e-29   Brachypodium distachyon [annual false brome]
ref|XP_009419068.1|  PREDICTED: uncharacterized protein LOC103999135    114   4e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010514670.1|  PREDICTED: uncharacterized protein LOC104790592    114   5e-29   Camelina sativa [gold-of-pleasure]
ref|NP_001060222.2|  Os07g0604600                                       114   7e-29   
ref|XP_003552604.1|  PREDICTED: uncharacterized protein LOC100785946    113   9e-29   Glycine max [soybeans]
ref|XP_009151762.1|  PREDICTED: uncharacterized protein LOC103875065    113   1e-28   Brassica rapa
gb|KDP24288.1|  hypothetical protein JCGZ_25584                         113   1e-28   Jatropha curcas
gb|AFK43764.1|  unknown                                                 113   1e-28   Medicago truncatula
ref|NP_189632.1|  B12D protein                                          113   1e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002875526.1|  hypothetical protein ARALYDRAFT_323026             112   1e-28   Arabidopsis lyrata subsp. lyrata
ref|XP_010502994.1|  PREDICTED: uncharacterized protein LOC104780196    112   2e-28   Camelina sativa [gold-of-pleasure]
ref|XP_010553961.1|  PREDICTED: uncharacterized protein LOC104823885    112   2e-28   Tarenaya hassleriana [spider flower]
ref|XP_002305391.1|  germination family protein                         112   2e-28   Populus trichocarpa [western balsam poplar]
dbj|BAC83875.1|  unknown protein                                        112   2e-28   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010034411.1|  PREDICTED: uncharacterized protein LOC104423646    112   2e-28   
ref|XP_006395262.1|  hypothetical protein EUTSA_v10005671mg             112   2e-28   Eutrema salsugineum [saltwater cress]
ref|XP_006430939.1|  hypothetical protein CICLE_v10013823mg             112   3e-28   Citrus clementina [clementine]
gb|AFK44347.1|  unknown                                                 112   3e-28   Lotus japonicus
ref|XP_011008605.1|  PREDICTED: uncharacterized protein LOC105113935    111   5e-28   Populus euphratica
ref|XP_003562728.1|  PREDICTED: uncharacterized protein LOC100837236    111   6e-28   Brachypodium distachyon [annual false brome]
ref|XP_004958246.1|  PREDICTED: uncharacterized protein LOC101775472    109   3e-27   Setaria italica
ref|XP_006657932.1|  PREDICTED: uncharacterized protein LOC102705450    108   8e-27   Oryza brachyantha
ref|XP_008651396.1|  PREDICTED: B12D protein isoform X1                 107   1e-26   
ref|XP_008810952.1|  PREDICTED: uncharacterized protein LOC103722254    106   4e-26   
ref|XP_009406306.1|  PREDICTED: uncharacterized protein LOC103989230    106   4e-26   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001060223.1|  Os07g0604700                                       106   6e-26   
ref|XP_010029399.1|  PREDICTED: uncharacterized protein LOC104419...    105   1e-25   Eucalyptus grandis [rose gum]
gb|AAR13310.1|  B12D-like protein                                       106   1e-25   Phaseolus vulgaris [French bean]
ref|XP_006658786.1|  PREDICTED: uncharacterized protein LOC102700818    105   2e-25   Oryza brachyantha
ref|XP_002978639.1|  hypothetical protein SELMODRAFT_152721             104   3e-25   Selaginella moellendorffii
gb|EPS63516.1|  hypothetical protein M569_11268                         103   7e-25   Genlisea aurea
ref|XP_001757013.1|  predicted protein                                  101   4e-24   
ref|XP_010937886.1|  PREDICTED: uncharacterized protein LOC105057112    100   7e-24   Elaeis guineensis
gb|KEH35272.1|  NADH-ubiquinone reductase complex 1 MLRQ subunit      99.0    2e-23   Medicago truncatula
ref|NP_001147337.1|  B12D protein                                     97.8    8e-23   
tpg|DAA63528.1|  TPA: b12D protein                                    97.8    2e-22   
ref|XP_002961492.1|  hypothetical protein SELMODRAFT_76981            93.2    6e-21   
gb|KGN53786.1|  hypothetical protein Csa_4G129030                     92.4    7e-21   Cucumis sativus [cucumbers]
ref|XP_009351238.1|  PREDICTED: uncharacterized protein LOC103942755  91.3    2e-20   Pyrus x bretschneideri [bai li]
gb|EYU29509.1|  hypothetical protein MIMGU_mgv1a024878mg              91.7    2e-20   Erythranthe guttata [common monkey flower]
ref|NP_001050622.2|  Os03g0601500                                     90.5    6e-20   
emb|CDX85280.1|  BnaC07g25910D                                        88.6    2e-19   
gb|EMS53792.1|  hypothetical protein TRIUR3_24112                     90.1    2e-19   Triticum urartu
ref|XP_001772578.1|  predicted protein                                87.8    4e-19   
ref|XP_003601294.1|  B12D-like protein                                87.8    6e-19   
ref|XP_001416807.1|  predicted protein                                87.4    1e-18   Ostreococcus lucimarinus CCE9901
ref|XP_002460987.1|  hypothetical protein SORBIDRAFT_02g038760        86.3    1e-18   
gb|EMS56733.1|  Microspherule protein 1                               93.6    2e-18   Triticum urartu
ref|XP_007511902.1|  predicted protein                                86.7    2e-18   Bathycoccus prasinos
ref|XP_002975136.1|  hypothetical protein SELMODRAFT_102690           84.3    1e-17   
ref|XP_009394678.1|  PREDICTED: uncharacterized protein LOC103980120  84.0    1e-17   
ref|XP_008346823.1|  PREDICTED: putative cyclin-B3-1                  85.1    1e-17   
ref|XP_002887135.1|  hypothetical protein ARALYDRAFT_894514           83.2    5e-17   
gb|ACU13634.1|  unknown                                               81.6    2e-16   Glycine max [soybeans]
gb|EMS55237.1|  hypothetical protein TRIUR3_19745                     78.6    1e-15   Triticum urartu
ref|XP_002507620.1|  predicted protein                                73.9    1e-13   Micromonas commoda
gb|EEC81850.1|  hypothetical protein OsI_25618                        75.1    2e-13   Oryza sativa Indica Group [Indian rice]
emb|CEF97372.1|  NADH-ubiquinone reductase complex 1 MLRQ subunit     70.1    2e-12   Ostreococcus tauri
ref|XP_001754887.1|  predicted protein                                73.9    7e-12   
gb|AAP12919.2|  expressed protein                                     67.8    1e-11   Oryza sativa Japonica Group [Japonica rice]
gb|KDO50116.1|  hypothetical protein CISIN_1g036394mg                 64.3    2e-10   Citrus sinensis [apfelsine]
gb|ABF97493.1|  expressed protein                                     64.3    2e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_005648934.1|  hypothetical protein COCSUDRAFT_52948            62.8    9e-10   Coccomyxa subellipsoidea C-169
ref|NP_001168199.1|  uncharacterized protein LOC100381955             62.0    5e-09   
ref|XP_003054813.1|  predicted protein                                60.5    6e-09   Micromonas pusilla CCMP1545
gb|ABR25826.1|  b12d protein                                          57.4    3e-08   Oryza sativa Indica Group [Indian rice]
ref|XP_003078488.1|  B12D protein (ISS)                               58.2    6e-08   
emb|CBI16944.3|  unnamed protein product                              52.8    1e-06   Vitis vinifera
emb|CDY68030.1|  BnaC07g49150D                                        51.2    6e-06   Brassica napus [oilseed rape]
ref|XP_005648441.1|  hypothetical protein COCSUDRAFT_62427            50.1    3e-05   Coccomyxa subellipsoidea C-169
ref|XP_011395846.1|  hypothetical protein F751_0337                   46.6    6e-04   Auxenochlorella protothecoides



>gb|AAD22104.1| B12D protein [Ipomoea batatas]
Length=90

 Score =   185 bits (469),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 87/90 (97%), Positives = 89/90 (99%), Gaps = 0/90 (0%)
 Frame = +3

Query  24   MASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKY  203
            MA+SRWIRPEVYPLFAAM VAVGICGFQLIRN+TTNPEVRVNKEGRAAGVLENYEEGKKY
Sbjct  1    MATSRWIRPEVYPLFAAMSVAVGICGFQLIRNLTTNPEVRVNKEGRAAGVLENYEEGKKY  60

Query  204  AEHSLRKFVRNKSPEIMPSLNRFFSDPQRN  293
            AEHSLRKFVRNKSPEIMPSLNRFFSDPQRN
Sbjct  61   AEHSLRKFVRNKSPEIMPSLNRFFSDPQRN  90



>ref|XP_011087179.1| PREDICTED: uncharacterized protein LOC105168733 [Sesamum indicum]
Length=89

 Score =   162 bits (410),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 73/88 (83%), Positives = 82/88 (93%), Gaps = 0/88 (0%)
 Frame = +3

Query  24   MASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKY  203
            MA SRWIRPEVYPLFAAMGVAVGICGFQL+RNI  NPEVRVNKEGRAAGVLEN+ EG+KY
Sbjct  1    MAHSRWIRPEVYPLFAAMGVAVGICGFQLVRNICINPEVRVNKEGRAAGVLENFAEGQKY  60

Query  204  AEHSLRKFVRNKSPEIMPSLNRFFSDPQ  287
            +EH+L+KFVRN+ PEIMPS+N FF+DPQ
Sbjct  61   SEHALKKFVRNRRPEIMPSINSFFTDPQ  88



>ref|XP_010942173.1| PREDICTED: uncharacterized protein LOC105060250 isoform X2 [Elaeis 
guineensis]
Length=91

 Score =   160 bits (406),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 71/91 (78%), Positives = 85/91 (93%), Gaps = 0/91 (0%)
 Frame = +3

Query  15   LSSMASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEG  194
            ++S  ++RW+RPEVYPLFAA+GVAVGICGFQL+RNI  NPEVRV+KEGRAAGVLENY EG
Sbjct  1    MASSTANRWLRPEVYPLFAAVGVAVGICGFQLVRNICINPEVRVSKEGRAAGVLENYAEG  60

Query  195  KKYAEHSLRKFVRNKSPEIMPSLNRFFSDPQ  287
            +KYAEH LR+FVRNK+PEIMPS+NRFF+DP+
Sbjct  61   QKYAEHGLRRFVRNKAPEIMPSINRFFADPK  91



>ref|XP_010929102.1| PREDICTED: uncharacterized protein LOC105050689 [Elaeis guineensis]
Length=91

 Score =   160 bits (405),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 72/91 (79%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = +3

Query  15   LSSMASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEG  194
            ++S   +RW+RPEVYPLFAA+GVAVGICGFQL+RNI  NPEVRV+KEGRAAGVLENY EG
Sbjct  1    MASSTVNRWLRPEVYPLFAAVGVAVGICGFQLVRNICINPEVRVSKEGRAAGVLENYAEG  60

Query  195  KKYAEHSLRKFVRNKSPEIMPSLNRFFSDPQ  287
            +KYAEH LRKFVRNK+PEIMPS+NRFF+DP+
Sbjct  61   EKYAEHGLRKFVRNKAPEIMPSINRFFADPK  91



>ref|XP_008779549.1| PREDICTED: uncharacterized protein LOC103699287 [Phoenix dactylifera]
Length=91

 Score =   159 bits (403),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 71/91 (78%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = +3

Query  15   LSSMASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEG  194
            ++S   SRW+RPEVYPLFAA+GVAVGICGFQL+RNI  NPEVRV+KEGRAAGVLEN+ EG
Sbjct  1    MASSTVSRWLRPEVYPLFAAVGVAVGICGFQLVRNICINPEVRVSKEGRAAGVLENFAEG  60

Query  195  KKYAEHSLRKFVRNKSPEIMPSLNRFFSDPQ  287
            +KYAEH LRKFVRNK+PEI+PS+NRFF+DP+
Sbjct  61   QKYAEHGLRKFVRNKAPEILPSINRFFADPK  91



>gb|EPS70000.1| hypothetical protein M569_04763, partial [Genlisea aurea]
Length=86

 Score =   158 bits (400),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 73/86 (85%), Positives = 79/86 (92%), Gaps = 0/86 (0%)
 Frame = +3

Query  27   ASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYA  206
            A+SRWIRPEVYPLFAAMG+AVGICGFQLIRNIT NPEVRVNK  R+AGVLEN+EEG KY 
Sbjct  1    AASRWIRPEVYPLFAAMGIAVGICGFQLIRNITGNPEVRVNKRDRSAGVLENFEEGHKYK  60

Query  207  EHSLRKFVRNKSPEIMPSLNRFFSDP  284
            EHSLRKFVRN+ PEIMP+LN FFSDP
Sbjct  61   EHSLRKFVRNRKPEIMPALNSFFSDP  86



>ref|XP_009627555.1| PREDICTED: uncharacterized protein LOC104118078 [Nicotiana tomentosiformis]
Length=149

 Score =   160 bits (405),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 71/94 (76%), Positives = 86/94 (91%), Gaps = 0/94 (0%)
 Frame = +3

Query  12   QLSSMASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEE  191
            QL SMA++RW+RPEVYPLFAA+GVA+GICG QL+RN+  NPEVRV+KE RAAGVLEN+EE
Sbjct  56   QLLSMATNRWLRPEVYPLFAAVGVAIGICGLQLVRNMRINPEVRVSKEKRAAGVLENFEE  115

Query  192  GKKYAEHSLRKFVRNKSPEIMPSLNRFFSDPQRN  293
            G+KYAEH++RKF R++ PEI PSLNRFFSDPQ+N
Sbjct  116  GEKYAEHAVRKFARSRPPEIFPSLNRFFSDPQKN  149



>ref|NP_001057280.1| Os06g0246000 [Oryza sativa Japonica Group]
 gb|AAB65433.1| HvB12D homolog [Oryza sativa]
 gb|AAL76334.1| putative G-box binding protein [Oryza sativa]
 dbj|BAD45657.1| G-box binding protein-like [Oryza sativa Japonica Group]
 dbj|BAF19194.1| Os06g0246000 [Oryza sativa Japonica Group]
 gb|ABR25364.1| senescence associated protein [Oryza sativa Indica Group]
 gb|ACJ54927.1| G-box binding protein [Oryza sativa Japonica Group]
 dbj|BAG94133.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99740.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00561.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC80316.1| hypothetical protein OsI_22358 [Oryza sativa Indica Group]
 gb|EEE65438.1| hypothetical protein OsJ_20800 [Oryza sativa Japonica Group]
Length=89

 Score =   158 bits (399),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 83/89 (93%), Gaps = 0/89 (0%)
 Frame = +3

Query  24   MASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKY  203
            MASSRW+RPEVYPLFAAMGVAVGICGFQL RNIT NPEVRVNK GRAAGVLEN+EEG++Y
Sbjct  1    MASSRWVRPEVYPLFAAMGVAVGICGFQLFRNITGNPEVRVNKVGRAAGVLENHEEGRRY  60

Query  204  AEHSLRKFVRNKSPEIMPSLNRFFSDPQR  290
            AEH LR +VR+K+PEIMP++N+FF++P +
Sbjct  61   AEHGLRNYVRDKTPEIMPAINKFFTEPTK  89



>ref|XP_008806317.1| PREDICTED: uncharacterized protein LOC103719037 [Phoenix dactylifera]
Length=91

 Score =   157 bits (398),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 70/91 (77%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = +3

Query  15   LSSMASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEG  194
            ++S   +RW+RPEVYPLFAA+GVAVGICGFQL+RNI  NPEVRV+KEGRAAGVLEN+ EG
Sbjct  1    MASSTVNRWLRPEVYPLFAAVGVAVGICGFQLVRNICINPEVRVSKEGRAAGVLENHAEG  60

Query  195  KKYAEHSLRKFVRNKSPEIMPSLNRFFSDPQ  287
            +KYAEH LR+FVRNK+PEIMPS+NRFF+DP+
Sbjct  61   EKYAEHGLRRFVRNKAPEIMPSINRFFADPK  91



>ref|XP_010470676.1| PREDICTED: uncharacterized protein LOC104750563 [Camelina sativa]
Length=134

 Score =   159 bits (401),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 71/90 (79%), Positives = 82/90 (91%), Gaps = 0/90 (0%)
 Frame = +3

Query  18   SSMASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGK  197
            S MASSRWIRPEVYPLFAA+GVAVGICG QL+RNI+TNPEVRV KE R AG+LEN+ EG+
Sbjct  44   SDMASSRWIRPEVYPLFAAVGVAVGICGMQLVRNISTNPEVRVTKENRTAGILENHAEGE  103

Query  198  KYAEHSLRKFVRNKSPEIMPSLNRFFSDPQ  287
            +YAEH LRKFVRNK+P+IMPS+N FFSDP+
Sbjct  104  RYAEHGLRKFVRNKAPQIMPSINGFFSDPK  133



>ref|XP_002283743.1| PREDICTED: uncharacterized protein LOC100263922 [Vitis vinifera]
Length=93

 Score =   157 bits (397),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 70/93 (75%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = +3

Query  15   LSSMASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEG  194
            ++S   +RW+RPEVYPLFAAMGVAVGICGFQL+RNI  NP+VRV+KE RAAGVLEN+ EG
Sbjct  1    MASSTMNRWLRPEVYPLFAAMGVAVGICGFQLVRNICINPDVRVSKENRAAGVLENFTEG  60

Query  195  KKYAEHSLRKFVRNKSPEIMPSLNRFFSDPQRN  293
            +KY+EH LRK+VRNKSPEIMPS+N FFSDP++N
Sbjct  61   QKYSEHFLRKYVRNKSPEIMPSINSFFSDPEKN  93



>ref|XP_010100274.1| hypothetical protein L484_027580 [Morus notabilis]
 gb|EXB82408.1| hypothetical protein L484_027580 [Morus notabilis]
Length=92

 Score =   157 bits (397),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 71/90 (79%), Positives = 82/90 (91%), Gaps = 0/90 (0%)
 Frame = +3

Query  18   SSMASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGK  197
            SS   SRW+RPEVYPLFAA+GVAVGICG QLIRNITTNPEVRV KE RAAG+L+N+EEG+
Sbjct  3    SSSTFSRWLRPEVYPLFAAVGVAVGICGMQLIRNITTNPEVRVTKENRAAGILDNFEEGE  62

Query  198  KYAEHSLRKFVRNKSPEIMPSLNRFFSDPQ  287
            +Y++HSLRKFVRNKSP+IMP+LN FFSDP 
Sbjct  63   RYSQHSLRKFVRNKSPQIMPNLNNFFSDPN  92



>ref|XP_008792162.1| PREDICTED: uncharacterized protein LOC103708847 [Phoenix dactylifera]
Length=91

 Score =   157 bits (396),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 71/91 (78%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = +3

Query  15   LSSMASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEG  194
            ++S  SSRW+RPEVYPLFAA+G AVGIC  QLIRNITTNPEVRV KE RAAGVL+N+ EG
Sbjct  1    MASFTSSRWLRPEVYPLFAAVGTAVGICCMQLIRNITTNPEVRVTKENRAAGVLDNFSEG  60

Query  195  KKYAEHSLRKFVRNKSPEIMPSLNRFFSDPQ  287
            +KYAEH LRKF+RNK+PEIMPSLN+FFSDP 
Sbjct  61   EKYAEHGLRKFLRNKNPEIMPSLNKFFSDPN  91



>ref|XP_009385140.1| PREDICTED: uncharacterized protein LOC103972508 [Musa acuminata 
subsp. malaccensis]
Length=91

 Score =   156 bits (395),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 85/91 (93%), Gaps = 0/91 (0%)
 Frame = +3

Query  15   LSSMASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEG  194
            ++S   SRW+RP+VYPLFAA+GVAVGICG QL+RNI+TNP+VRVNK+ RAAGVLEN+ EG
Sbjct  1    MASSTFSRWLRPDVYPLFAAVGVAVGICGVQLVRNISTNPQVRVNKQNRAAGVLENFGEG  60

Query  195  KKYAEHSLRKFVRNKSPEIMPSLNRFFSDPQ  287
            +KYAEHSLRKFVRNK+PEIMP++N+FFSDP+
Sbjct  61   EKYAEHSLRKFVRNKAPEIMPAVNKFFSDPK  91



>ref|XP_004233340.1| PREDICTED: uncharacterized protein LOC101261386 [Solanum lycopersicum]
Length=91

 Score =   156 bits (395),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 71/91 (78%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +3

Query  15   LSSMASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEG  194
            ++S   +RW+RPEVYPLFAA+GVAVGICGFQLIRN+  NPEVRVNKE RAAGVLEN+ EG
Sbjct  1    MASSTVNRWLRPEVYPLFAAVGVAVGICGFQLIRNVCINPEVRVNKENRAAGVLENFSEG  60

Query  195  KKYAEHSLRKFVRNKSPEIMPSLNRFFSDPQ  287
            +KYAEH LRKFVRN+SPEIMPS+N FFSDP+
Sbjct  61   EKYAEHGLRKFVRNRSPEIMPSINGFFSDPK  91



>ref|XP_008437938.1| PREDICTED: uncharacterized protein LOC103483212 [Cucumis melo]
Length=94

 Score =   156 bits (394),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 71/87 (82%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = +3

Query  33   SRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEH  212
            SRW+RPEVYPLFAA+GVAVGICGFQLIRNI  NPEVRV+KE RAAGVL+N+ EG+KY+EH
Sbjct  8    SRWLRPEVYPLFAAVGVAVGICGFQLIRNICINPEVRVSKENRAAGVLDNFAEGEKYSEH  67

Query  213  SLRKFVRNKSPEIMPSLNRFFSDPQRN  293
             LRKFVRNKSPEIMPS+N FF+DP RN
Sbjct  68   FLRKFVRNKSPEIMPSINNFFTDPSRN  94



>ref|XP_010556171.1| PREDICTED: uncharacterized protein LOC104825524 [Tarenaya hassleriana]
Length=88

 Score =   155 bits (393),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 70/88 (80%), Positives = 80/88 (91%), Gaps = 0/88 (0%)
 Frame = +3

Query  24   MASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKY  203
            M +SRWIRPEVYPLFA++GVAVGICG QL+RNI +NPEVRV KE RAAG+LEN+EEG+KY
Sbjct  1    MTASRWIRPEVYPLFASVGVAVGICGMQLVRNICSNPEVRVTKENRAAGILENFEEGEKY  60

Query  204  AEHSLRKFVRNKSPEIMPSLNRFFSDPQ  287
             EH LRKFVR+KSPEIMPS+N FFSDPQ
Sbjct  61   KEHRLRKFVRSKSPEIMPSINSFFSDPQ  88



>ref|XP_006357136.1| PREDICTED: uncharacterized protein LOC102583994 [Solanum tuberosum]
Length=91

 Score =   155 bits (393),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 70/91 (77%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +3

Query  15   LSSMASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEG  194
            +SS   +RW+RPEVYPLFAA+GVAVGICGFQL+RN+  NPEVRV KE RAAGVLEN+ EG
Sbjct  1    MSSSTVNRWLRPEVYPLFAAVGVAVGICGFQLVRNVCINPEVRVTKENRAAGVLENFSEG  60

Query  195  KKYAEHSLRKFVRNKSPEIMPSLNRFFSDPQ  287
            +KYAEH+LRKFVRN+SPEIMPS+N FFSDP+
Sbjct  61   EKYAEHTLRKFVRNRSPEIMPSINGFFSDPK  91



>ref|XP_008222037.1| PREDICTED: uncharacterized protein LOC103321965 [Prunus mume]
Length=91

 Score =   155 bits (393),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 68/88 (77%), Positives = 82/88 (93%), Gaps = 0/88 (0%)
 Frame = +3

Query  24   MASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKY  203
            MASSRW++PEVYPLF A+GVAVGICG QL+RNI TNPEVRVNKE RAAGVL+N+ EG++Y
Sbjct  1    MASSRWLKPEVYPLFVAVGVAVGICGMQLVRNIYTNPEVRVNKEKRAAGVLDNHAEGERY  60

Query  204  AEHSLRKFVRNKSPEIMPSLNRFFSDPQ  287
            AEH LRK+VRNK+P+IMP++N+FFSDPQ
Sbjct  61   AEHRLRKYVRNKTPQIMPTINKFFSDPQ  88



>ref|XP_010027818.1| PREDICTED: uncharacterized protein LOC104418237 [Eucalyptus grandis]
 gb|KCW83385.1| hypothetical protein EUGRSUZ_B00320 [Eucalyptus grandis]
Length=90

 Score =   155 bits (393),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 71/90 (79%), Positives = 81/90 (90%), Gaps = 0/90 (0%)
 Frame = +3

Query  24   MASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKY  203
            MA +RWIRPEVYPLFAA+GVAVGICGF L+R+I  NPEVRV KE RAAGVL+N++EG+KY
Sbjct  1    MAGNRWIRPEVYPLFAAVGVAVGICGFSLVRHICINPEVRVTKENRAAGVLDNFKEGEKY  60

Query  204  AEHSLRKFVRNKSPEIMPSLNRFFSDPQRN  293
            AEHSLRKFVRN+SPEIMPSLN FF+ P RN
Sbjct  61   AEHSLRKFVRNRSPEIMPSLNSFFTSPDRN  90



>ref|XP_008800943.1| PREDICTED: uncharacterized protein LOC103715180 [Phoenix dactylifera]
Length=121

 Score =   156 bits (395),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 69/94 (73%), Positives = 84/94 (89%), Gaps = 0/94 (0%)
 Frame = +3

Query  6    ATQLSSMASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENY  185
            A  ++S  +SRW++PEVYPLFAA+GVAVGICG QL+RNITTNPEVRV K+ RAAGVL+N+
Sbjct  28   AAPMASSTTSRWLKPEVYPLFAAVGVAVGICGMQLVRNITTNPEVRVTKQNRAAGVLDNF  87

Query  186  EEGKKYAEHSLRKFVRNKSPEIMPSLNRFFSDPQ  287
             EG+KYAEH LRKF+RNKSPEIMPS+N+FFS+P 
Sbjct  88   AEGEKYAEHGLRKFIRNKSPEIMPSVNKFFSNPN  121



>ref|XP_004152455.1| PREDICTED: uncharacterized protein LOC101218501 [Cucumis sativus]
 ref|XP_004157801.1| PREDICTED: uncharacterized LOC101218501 [Cucumis sativus]
 gb|KGN64280.1| hypothetical protein Csa_1G045780 [Cucumis sativus]
Length=94

 Score =   155 bits (393),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 71/87 (82%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = +3

Query  33   SRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEH  212
            SRW+RPEVYPLFAA+GVAVGICGFQLIRNI  NPEVRV KE RAAGVL+N+ EG+KY+EH
Sbjct  8    SRWLRPEVYPLFAAVGVAVGICGFQLIRNICINPEVRVTKENRAAGVLDNFAEGEKYSEH  67

Query  213  SLRKFVRNKSPEIMPSLNRFFSDPQRN  293
             LRKFVRNKSPEIMPS+N FF+DP RN
Sbjct  68   FLRKFVRNKSPEIMPSINNFFTDPNRN  94



>ref|XP_006856912.1| hypothetical protein AMTR_s00055p00220460 [Amborella trichopoda]
 gb|ERN18379.1| hypothetical protein AMTR_s00055p00220460 [Amborella trichopoda]
Length=91

 Score =   155 bits (392),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +3

Query  15   LSSMASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEG  194
            + S + SRW+RPEVYPLFAA+GVAVGICGFQL+RNI  NPEVRVNKE RAAG+LEN+ EG
Sbjct  1    MGSSSLSRWLRPEVYPLFAAVGVAVGICGFQLVRNICINPEVRVNKEARAAGILENFTEG  60

Query  195  KKYAEHSLRKFVRNKSPEIMPSLNRFFSDPQ  287
            ++YAEHSLRKFVRN+SPEIMPS+N +F+DP+
Sbjct  61   ERYAEHSLRKFVRNRSPEIMPSINGYFTDPK  91



>ref|XP_010511712.1| PREDICTED: uncharacterized protein LOC104787778 [Camelina sativa]
Length=89

 Score =   155 bits (392),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 69/88 (78%), Positives = 81/88 (92%), Gaps = 0/88 (0%)
 Frame = +3

Query  24   MASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKY  203
            MASSRWIRPEVYPLFAA+GVAVGICG QL+RNI+TNPEVRV KE R AG+L+N+ EG++Y
Sbjct  1    MASSRWIRPEVYPLFAAVGVAVGICGMQLVRNISTNPEVRVTKENRTAGILDNHAEGERY  60

Query  204  AEHSLRKFVRNKSPEIMPSLNRFFSDPQ  287
            AEH LRKFVRNK+P+IMPS+N FFSDP+
Sbjct  61   AEHGLRKFVRNKAPQIMPSINGFFSDPK  88



>ref|XP_007226455.1| hypothetical protein PRUPE_ppa024551mg [Prunus persica]
 gb|EMJ27654.1| hypothetical protein PRUPE_ppa024551mg [Prunus persica]
Length=91

 Score =   155 bits (392),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 67/88 (76%), Positives = 82/88 (93%), Gaps = 0/88 (0%)
 Frame = +3

Query  24   MASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKY  203
            MASSRW++PEVYPLFAA+G AVGICG QL+RNI TNP+VRVNKE RAAGVL+N+ EG++Y
Sbjct  1    MASSRWLKPEVYPLFAAVGAAVGICGMQLVRNIYTNPDVRVNKENRAAGVLDNHAEGERY  60

Query  204  AEHSLRKFVRNKSPEIMPSLNRFFSDPQ  287
            AEH LRK+VRNK+P+IMP++N+FFSDPQ
Sbjct  61   AEHGLRKYVRNKTPQIMPTINKFFSDPQ  88



>emb|CBI15096.3| unnamed protein product [Vitis vinifera]
Length=88

 Score =   155 bits (391),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 69/87 (79%), Positives = 81/87 (93%), Gaps = 0/87 (0%)
 Frame = +3

Query  33   SRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEH  212
            +RW+RPEVYPLFAAMGVAVGICGFQL+RNI  NP+VRV+KE RAAGVLEN+ EG+KY+EH
Sbjct  2    NRWLRPEVYPLFAAMGVAVGICGFQLVRNICINPDVRVSKENRAAGVLENFTEGQKYSEH  61

Query  213  SLRKFVRNKSPEIMPSLNRFFSDPQRN  293
             LRK+VRNKSPEIMPS+N FFSDP++N
Sbjct  62   FLRKYVRNKSPEIMPSINSFFSDPEKN  88



>ref|XP_010415343.1| PREDICTED: uncharacterized protein LOC104701372 [Camelina sativa]
Length=89

 Score =   155 bits (391),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 69/88 (78%), Positives = 80/88 (91%), Gaps = 0/88 (0%)
 Frame = +3

Query  24   MASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKY  203
            MASSRWIRPEVYPLFA +GVAVGICG QL+RNI+TNPEVRV KE R AG+LEN+ EG++Y
Sbjct  1    MASSRWIRPEVYPLFATVGVAVGICGMQLVRNISTNPEVRVTKENRTAGILENHAEGERY  60

Query  204  AEHSLRKFVRNKSPEIMPSLNRFFSDPQ  287
            AEH LRKFVRNK+P+IMPS+N FFSDP+
Sbjct  61   AEHGLRKFVRNKAPQIMPSINGFFSDPK  88



>ref|XP_010913425.1| PREDICTED: uncharacterized protein LOC105039118 [Elaeis guineensis]
Length=92

 Score =   154 bits (390),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 68/90 (76%), Positives = 83/90 (92%), Gaps = 0/90 (0%)
 Frame = +3

Query  18   SSMASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGK  197
            S+  ++RW+RPEVYPLFAA+GVAVGICGFQL+RNI  NPEVRV+KEGRAAGVLENY EG+
Sbjct  3    SASTANRWLRPEVYPLFAAVGVAVGICGFQLVRNICINPEVRVSKEGRAAGVLENYAEGE  62

Query  198  KYAEHSLRKFVRNKSPEIMPSLNRFFSDPQ  287
            KYAEH LRKF+R ++PEIMPS+NRFF++P+
Sbjct  63   KYAEHGLRKFLRTRAPEIMPSINRFFANPK  92



>ref|XP_006655963.1| PREDICTED: uncharacterized protein LOC102707968 [Oryza brachyantha]
Length=88

 Score =   154 bits (389),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 68/88 (77%), Positives = 81/88 (92%), Gaps = 0/88 (0%)
 Frame = +3

Query  24   MASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKY  203
            MA+SRW+RPEVYPLFAAMGVAV ICG QL RNIT NPEVRVNK GRAAGVLEN+EEG++Y
Sbjct  1    MAASRWVRPEVYPLFAAMGVAVAICGMQLFRNITGNPEVRVNKVGRAAGVLENHEEGRRY  60

Query  204  AEHSLRKFVRNKSPEIMPSLNRFFSDPQ  287
            AEH LR FVR+K+PEIMP++N+FF++P+
Sbjct  61   AEHGLRNFVRDKTPEIMPTINKFFTEPK  88



>ref|XP_010027794.1| PREDICTED: uncharacterized protein LOC104418219 [Eucalyptus grandis]
 gb|KCW83389.1| hypothetical protein EUGRSUZ_B00324 [Eucalyptus grandis]
Length=90

 Score =   154 bits (389),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 70/90 (78%), Positives = 80/90 (89%), Gaps = 0/90 (0%)
 Frame = +3

Query  24   MASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKY  203
            MA +RWIRPEVYPLFAA+GVAVGICGF L+R+I  NPEVRV KE RAAGVL+N++EG+KY
Sbjct  1    MAGNRWIRPEVYPLFAAVGVAVGICGFSLVRHICINPEVRVTKENRAAGVLDNFKEGEKY  60

Query  204  AEHSLRKFVRNKSPEIMPSLNRFFSDPQRN  293
             EHSLRKFVRN+SPEIMPSLN FF+ P RN
Sbjct  61   TEHSLRKFVRNRSPEIMPSLNSFFTSPDRN  90



>ref|XP_004236155.1| PREDICTED: uncharacterized protein LOC101260417 [Solanum lycopersicum]
Length=90

 Score =   154 bits (389),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 67/90 (74%), Positives = 83/90 (92%), Gaps = 0/90 (0%)
 Frame = +3

Query  24   MASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKY  203
            MA++RW+RPEVYPLFAA+GVA+GICG QL+RN+  NPEVRVNKE RAAG+LEN+EEG+KY
Sbjct  1    MATNRWLRPEVYPLFAAVGVAIGICGLQLVRNMRINPEVRVNKEKRAAGILENFEEGEKY  60

Query  204  AEHSLRKFVRNKSPEIMPSLNRFFSDPQRN  293
            AEH++RKF R++ PEI P+LNRFFSDPQ+N
Sbjct  61   AEHAIRKFARSRPPEIFPNLNRFFSDPQKN  90



>ref|XP_010930055.1| PREDICTED: uncharacterized protein LOC105051361 [Elaeis guineensis]
Length=91

 Score =   154 bits (388),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = +3

Query  15   LSSMASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEG  194
            ++S  SSRW+RPEVYPLFAA+G AVGIC  QL+RNITTNPEVRV KE RAAGVLEN+ EG
Sbjct  1    MASFTSSRWLRPEVYPLFAAVGTAVGICCMQLVRNITTNPEVRVTKENRAAGVLENFSEG  60

Query  195  KKYAEHSLRKFVRNKSPEIMPSLNRFFSDPQ  287
            ++YAEH LRKF+R+K+PEIMPSLN+FFSDP 
Sbjct  61   ERYAEHGLRKFLRSKNPEIMPSLNKFFSDPN  91



>ref|XP_006344997.1| PREDICTED: uncharacterized protein LOC102605944 [Solanum tuberosum]
Length=90

 Score =   154 bits (388),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 67/90 (74%), Positives = 83/90 (92%), Gaps = 0/90 (0%)
 Frame = +3

Query  24   MASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKY  203
            MA++RW+RPEVYPLFAA+GVA+GICG QL+RN+  NPEVRVNKE RAAG+LEN+EEG+KY
Sbjct  1    MATNRWLRPEVYPLFAAVGVAIGICGLQLVRNMRINPEVRVNKEKRAAGILENFEEGEKY  60

Query  204  AEHSLRKFVRNKSPEIMPSLNRFFSDPQRN  293
            AEH++RKF R++ PEI P+LNRFFSDPQ+N
Sbjct  61   AEHAVRKFARSRPPEIFPNLNRFFSDPQKN  90



>ref|XP_007138129.1| hypothetical protein PHAVU_009G182600g [Phaseolus vulgaris]
 gb|ESW10123.1| hypothetical protein PHAVU_009G182600g [Phaseolus vulgaris]
Length=89

 Score =   154 bits (388),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 69/88 (78%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +3

Query  30   SSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAE  209
            ++RW+RPEVYPLFAA+G AVGICGFQL+RNI  NPEVRVNKEGR AGVLEN+ EG+KY E
Sbjct  2    ANRWLRPEVYPLFAAVGAAVGICGFQLVRNICINPEVRVNKEGRKAGVLENFSEGEKYTE  61

Query  210  HSLRKFVRNKSPEIMPSLNRFFSDPQRN  293
            H LRK+VRN+SPEIMPSLN FF+DP RN
Sbjct  62   HFLRKYVRNRSPEIMPSLNSFFADPSRN  89



>ref|XP_008798028.1| PREDICTED: uncharacterized protein LOC103713044 [Phoenix dactylifera]
Length=92

 Score =   154 bits (388),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 68/90 (76%), Positives = 81/90 (90%), Gaps = 0/90 (0%)
 Frame = +3

Query  18   SSMASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGK  197
            S+   +RW+RPEVYPLFAA+GVAVGICGFQL+RNI  NPEVRV+KEGRAAGVLENY EG+
Sbjct  3    SASTVNRWLRPEVYPLFAAVGVAVGICGFQLVRNICINPEVRVSKEGRAAGVLENYAEGE  62

Query  198  KYAEHSLRKFVRNKSPEIMPSLNRFFSDPQ  287
             YAEH LRKF+R ++PEIMPS+NRFF+DP+
Sbjct  63   TYAEHGLRKFLRTRTPEIMPSINRFFADPK  92



>ref|XP_009785405.1| PREDICTED: uncharacterized protein LOC104233674 [Nicotiana sylvestris]
Length=90

 Score =   153 bits (387),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 67/90 (74%), Positives = 83/90 (92%), Gaps = 0/90 (0%)
 Frame = +3

Query  24   MASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKY  203
            MA++RW+RPEVYPLFAA+GVA+GICG QL+RN+  NPEVRV+KE RAAGVL+N+EEG+KY
Sbjct  1    MATNRWLRPEVYPLFAAVGVAIGICGLQLVRNMRINPEVRVSKEKRAAGVLDNFEEGQKY  60

Query  204  AEHSLRKFVRNKSPEIMPSLNRFFSDPQRN  293
            AEH++RKF R++ PEI PSLNRFFSDPQ+N
Sbjct  61   AEHAVRKFARSRPPEIFPSLNRFFSDPQKN  90



>ref|XP_002311729.1| hypothetical protein POPTR_0008s17950g [Populus trichocarpa]
 gb|EEE89096.1| hypothetical protein POPTR_0008s17950g [Populus trichocarpa]
Length=92

 Score =   153 bits (387),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 69/88 (78%), Positives = 80/88 (91%), Gaps = 0/88 (0%)
 Frame = +3

Query  24   MASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKY  203
            MASSRWIRPEV+PLFA++GVAVGIC  QL+RNI TNPEVRV KE RAAGVL+N++EG+KY
Sbjct  1    MASSRWIRPEVFPLFASVGVAVGICAMQLVRNICTNPEVRVTKENRAAGVLDNFKEGEKY  60

Query  204  AEHSLRKFVRNKSPEIMPSLNRFFSDPQ  287
            AEH LRKFVRNK+P+IMPS+N FFSDP 
Sbjct  61   AEHGLRKFVRNKTPQIMPSINGFFSDPD  88



>ref|XP_004501964.1| PREDICTED: uncharacterized protein LOC101508877 [Cicer arietinum]
Length=89

 Score =   153 bits (387),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 68/88 (77%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +3

Query  30   SSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAE  209
            +SRW+RPEVYPLFAA+GVAVGICGFQL+RNI  NPEVRVNK+ RAAGVLEN+ EG+KY E
Sbjct  2    ASRWVRPEVYPLFAAVGVAVGICGFQLVRNICINPEVRVNKQTRAAGVLENFSEGEKYTE  61

Query  210  HSLRKFVRNKSPEIMPSLNRFFSDPQRN  293
            H LRKF RN+SPEIMP++N FF+DP RN
Sbjct  62   HLLRKFSRNRSPEIMPTINSFFTDPSRN  89



>ref|XP_011029641.1| PREDICTED: uncharacterized protein LOC105129336 [Populus euphratica]
 ref|XP_011029642.1| PREDICTED: uncharacterized protein LOC105129336 [Populus euphratica]
Length=92

 Score =   153 bits (387),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 69/88 (78%), Positives = 80/88 (91%), Gaps = 0/88 (0%)
 Frame = +3

Query  24   MASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKY  203
            MASSRWIRPEV+PLFA++GVAVGIC  QL+RNI TNPEVRV KE RAAGVL+N++EG+KY
Sbjct  1    MASSRWIRPEVFPLFASVGVAVGICAMQLVRNICTNPEVRVTKENRAAGVLDNFKEGEKY  60

Query  204  AEHSLRKFVRNKSPEIMPSLNRFFSDPQ  287
            AEH LRKFVRNK+P+IMPS+N FFSDP 
Sbjct  61   AEHGLRKFVRNKTPQIMPSINGFFSDPD  88



>gb|AGC24177.1| unknown [Rehmannia glutinosa]
Length=93

 Score =   153 bits (387),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 69/90 (77%), Positives = 80/90 (89%), Gaps = 0/90 (0%)
 Frame = +3

Query  18   SSMASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGK  197
            SS    RW+RPEVYPLFAA+GVAVGICG QLIRNIT NPEVRV KE RAAGVL+++ EG+
Sbjct  3    SSTTLKRWLRPEVYPLFAAVGVAVGICGMQLIRNITINPEVRVTKENRAAGVLDDFAEGE  62

Query  198  KYAEHSLRKFVRNKSPEIMPSLNRFFSDPQ  287
            KYAEH+LRK+VRN+SPEIMPSLN FF+DP+
Sbjct  63   KYAEHALRKYVRNRSPEIMPSLNSFFTDPK  92



>ref|XP_009403647.1| PREDICTED: uncharacterized protein LOC103987158 [Musa acuminata 
subsp. malaccensis]
Length=91

 Score =   153 bits (387),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 69/87 (79%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = +3

Query  24   MASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKY  203
            M SSRW+RPEV+PLFAA+G AVGICG QLIRNI  NPEVRV KE RAAGVL+N++EG+KY
Sbjct  1    MVSSRWVRPEVFPLFAAVGTAVGICGMQLIRNICINPEVRVTKENRAAGVLDNFQEGEKY  60

Query  204  AEHSLRKFVRNKSPEIMPSLNRFFSDP  284
            AEH LRKFVRNKSP+IMPSLN +FSDP
Sbjct  61   AEHGLRKFVRNKSPQIMPSLNNYFSDP  87



>ref|XP_006338509.1| PREDICTED: uncharacterized protein LOC102603775 [Solanum tuberosum]
Length=91

 Score =   153 bits (386),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = +3

Query  15   LSSMASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEG  194
            ++S   +RW+RPEVYPLFAA+GVAVGICG QL+RNI TNPEVRV KE RAAGVL+N+ EG
Sbjct  1    MASSTINRWLRPEVYPLFAAVGVAVGICGMQLVRNICTNPEVRVTKENRAAGVLDNFSEG  60

Query  195  KKYAEHSLRKFVRNKSPEIMPSLNRFFSDPQ  287
            +KY+EH+LRKFVRNKSPEIMPS+N FFSDP 
Sbjct  61   EKYSEHALRKFVRNKSPEIMPSINGFFSDPN  91



>ref|NP_001148351.1| LOC100281961 [Zea mays]
 gb|ACG30961.1| B12D protein [Zea mays]
 gb|AFW85170.1| b12D protein [Zea mays]
Length=87

 Score =   153 bits (386),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 67/86 (78%), Positives = 79/86 (92%), Gaps = 0/86 (0%)
 Frame = +3

Query  30   SSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAE  209
            +SRW+RPEVYPLFAAMGVAVGICGFQL RNIT NPEVRVNK GRAAGVLEN+EEG++YA 
Sbjct  2    ASRWVRPEVYPLFAAMGVAVGICGFQLFRNITGNPEVRVNKAGRAAGVLENHEEGRRYAM  61

Query  210  HSLRKFVRNKSPEIMPSLNRFFSDPQ  287
            H LR FV +K+PEIMP++N+FF+DP+
Sbjct  62   HGLRSFVHDKTPEIMPAINKFFTDPK  87



>ref|XP_003564009.1| PREDICTED: uncharacterized protein LOC100821381 [Brachypodium 
distachyon]
Length=88

 Score =   152 bits (385),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 81/88 (92%), Gaps = 0/88 (0%)
 Frame = +3

Query  24   MASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKY  203
            MA+S+W+RPEVYPLFAA GVAVGIC FQL+RNIT NPEVRV+K GRAAGVL+N+EEG++Y
Sbjct  1    MAASKWVRPEVYPLFAATGVAVGICAFQLLRNITGNPEVRVSKVGRAAGVLDNHEEGRRY  60

Query  204  AEHSLRKFVRNKSPEIMPSLNRFFSDPQ  287
            AEH LR FVR+K+PEIMP +N+FF+DP+
Sbjct  61   AEHGLRSFVRDKTPEIMPGINKFFTDPK  88



>ref|XP_011042304.1| PREDICTED: uncharacterized protein LOC105138023 [Populus euphratica]
Length=92

 Score =   152 bits (385),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 68/88 (77%), Positives = 81/88 (92%), Gaps = 0/88 (0%)
 Frame = +3

Query  24   MASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKY  203
            MASSRWIRPEV+PLFA++GVAVGICG QL+RNITTNPEVRV KE RAAGVL+N++EG+KY
Sbjct  1    MASSRWIRPEVFPLFASVGVAVGICGMQLLRNITTNPEVRVTKENRAAGVLDNFKEGEKY  60

Query  204  AEHSLRKFVRNKSPEIMPSLNRFFSDPQ  287
            AEH LRK+VR ++P+IMPS+N FFSDP 
Sbjct  61   AEHGLRKYVRKRTPQIMPSINGFFSDPD  88



>ref|XP_002511469.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF52071.1| conserved hypothetical protein [Ricinus communis]
Length=88

 Score =   152 bits (385),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 69/88 (78%), Positives = 81/88 (92%), Gaps = 0/88 (0%)
 Frame = +3

Query  24   MASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKY  203
            MA +RWIRPEVYPLFAAMGVAVGIC FQL+RNI  NPEVRVNK+ RAAGVLEN++EG+KY
Sbjct  1    MAGNRWIRPEVYPLFAAMGVAVGICSFQLVRNICINPEVRVNKQNRAAGVLENFKEGEKY  60

Query  204  AEHSLRKFVRNKSPEIMPSLNRFFSDPQ  287
            +E+ LRKFVRNK+PEIMPS+NRFF++P 
Sbjct  61   SENFLRKFVRNKTPEIMPSINRFFTEPN  88



>ref|XP_010111964.1| hypothetical protein L484_004741 [Morus notabilis]
 gb|EXC32238.1| hypothetical protein L484_004741 [Morus notabilis]
Length=93

 Score =   152 bits (385),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 66/93 (71%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = +3

Query  15   LSSMASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEG  194
            ++S A+S+W+RPEVYPLFAA+GVA+GICGFQL+RNI  NPEVRV+KE RAAGVL+N+ EG
Sbjct  1    MASSAASKWLRPEVYPLFAAVGVAIGICGFQLVRNICINPEVRVSKETRAAGVLDNFAEG  60

Query  195  KKYAEHSLRKFVRNKSPEIMPSLNRFFSDPQRN  293
            +KY+EH LRK+VRN++PEIMPS+N FF+DP R+
Sbjct  61   EKYSEHFLRKYVRNRAPEIMPSINSFFTDPNRS  93



>ref|XP_010678668.1| PREDICTED: uncharacterized protein LOC104894188 [Beta vulgaris 
subsp. vulgaris]
Length=91

 Score =   152 bits (385),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 71/91 (78%), Positives = 82/91 (90%), Gaps = 1/91 (1%)
 Frame = +3

Query  24   MAS-SRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKK  200
            MAS +RW+RPEVYPLFAA+GVAVGICG QL+RNI  NPEVRV+KE RAAGVLEN+ EG+K
Sbjct  1    MASVNRWVRPEVYPLFAAVGVAVGICGVQLVRNICINPEVRVSKENRAAGVLENFSEGEK  60

Query  201  YAEHSLRKFVRNKSPEIMPSLNRFFSDPQRN  293
            YAEH LRK+VRNK+PEIMPS+N FF+DP RN
Sbjct  61   YAEHFLRKYVRNKTPEIMPSINSFFADPTRN  91



>ref|XP_009615457.1| PREDICTED: uncharacterized protein LOC104108174 [Nicotiana tomentosiformis]
Length=91

 Score =   152 bits (385),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = +3

Query  15   LSSMASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEG  194
            ++S   +RW+RPEVYPLFAA+GVAVGICG QL+RNI  NPEVRV KE RAAGVL+N+ EG
Sbjct  1    MASSTLNRWLRPEVYPLFAAVGVAVGICGMQLVRNICGNPEVRVTKENRAAGVLDNFSEG  60

Query  195  KKYAEHSLRKFVRNKSPEIMPSLNRFFSDPQ  287
            +KYAEH+LRKFVRNKSPEIMPS+N FFSDP+
Sbjct  61   EKYAEHALRKFVRNKSPEIMPSINGFFSDPK  91



>ref|XP_002314553.2| hypothetical protein POPTR_0010s06550g [Populus trichocarpa]
 gb|EEF00724.2| hypothetical protein POPTR_0010s06550g [Populus trichocarpa]
Length=163

 Score =   154 bits (390),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 69/90 (77%), Positives = 82/90 (91%), Gaps = 0/90 (0%)
 Frame = +3

Query  18   SSMASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGK  197
            SSMA SRWIRPEV+PLFA++GVAVGICG QL+RNITTNPEVRV KE RAAGVL+N++EG+
Sbjct  70   SSMAPSRWIRPEVFPLFASVGVAVGICGMQLLRNITTNPEVRVTKENRAAGVLDNFKEGE  129

Query  198  KYAEHSLRKFVRNKSPEIMPSLNRFFSDPQ  287
            KYAEH LRK+VR ++P+IMPS+N FFSDP 
Sbjct  130  KYAEHGLRKYVRKRTPQIMPSINGFFSDPD  159



>gb|ADB08699.1| B12D-like protein [Wolffia arrhiza]
 gb|AEI83500.1| B12D [Wolffia arrhiza]
 gb|AEQ39050.1| putative B12D-like protein [Wolffia arrhiza]
Length=91

 Score =   152 bits (384),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = +3

Query  15   LSSMASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEG  194
            ++S A +RW+RPEVYPLFAA+GVAVGICGFQL+RN+  NPEVRV+KEGRA+GVLEN+ EG
Sbjct  1    MASSAVNRWVRPEVYPLFAAVGVAVGICGFQLVRNVCINPEVRVSKEGRASGVLENFAEG  60

Query  195  KKYAEHSLRKFVRNKSPEIMPSLNRFFSDPQ  287
            ++YAEHSLRKF+RNK PEIMPS+N FF++P+
Sbjct  61   ERYAEHSLRKFLRNKRPEIMPSINGFFANPK  91



>ref|XP_010272106.1| PREDICTED: uncharacterized protein LOC104607987 [Nelumbo nucifera]
Length=90

 Score =   152 bits (384),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 70/90 (78%), Positives = 83/90 (92%), Gaps = 2/90 (2%)
 Frame = +3

Query  24   MASS--RWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGK  197
            MASS  RW+RPEVYPLFAA+GVAVGICGFQL+RNI  NPEVRV+KE RAAGVLEN+ EG+
Sbjct  1    MASSVNRWLRPEVYPLFAAVGVAVGICGFQLVRNICINPEVRVSKETRAAGVLENFSEGE  60

Query  198  KYAEHSLRKFVRNKSPEIMPSLNRFFSDPQ  287
            KYAEH+LRKFVRN++PEIMPS+N FF++P+
Sbjct  61   KYAEHTLRKFVRNRTPEIMPSINNFFTNPK  90



>ref|XP_002270661.1| PREDICTED: uncharacterized protein LOC100259604 [Vitis vinifera]
 emb|CBI27548.3| unnamed protein product [Vitis vinifera]
Length=93

 Score =   152 bits (384),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 67/90 (74%), Positives = 80/90 (89%), Gaps = 0/90 (0%)
 Frame = +3

Query  15   LSSMASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEG  194
            ++S   +RW+RPEVYPLFAA+GVAVGICG QL+RNI TNPEVRV K+ R AGVLEN+EEG
Sbjct  1    MASSTVNRWLRPEVYPLFAAVGVAVGICGMQLVRNICTNPEVRVTKQNRTAGVLENFEEG  60

Query  195  KKYAEHSLRKFVRNKSPEIMPSLNRFFSDP  284
            ++YAEH LRKFVRNK P+IMPS+N+FFSDP
Sbjct  61   ERYAEHRLRKFVRNKEPQIMPSINKFFSDP  90



>ref|XP_009760043.1| PREDICTED: uncharacterized protein LOC104212451 [Nicotiana sylvestris]
Length=92

 Score =   152 bits (383),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 68/90 (76%), Positives = 81/90 (90%), Gaps = 0/90 (0%)
 Frame = +3

Query  18   SSMASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGK  197
            +S   +RW+RPEVYPLFAA+GVAVGICGFQL+RNI  NPEVRV KE RAAGVL+N+ EG+
Sbjct  3    ASSTINRWLRPEVYPLFAAVGVAVGICGFQLVRNICINPEVRVTKENRAAGVLDNFTEGE  62

Query  198  KYAEHSLRKFVRNKSPEIMPSLNRFFSDPQ  287
            KYAEH+LRKFVRN++PEIMPS+N FFSDP+
Sbjct  63   KYAEHALRKFVRNRAPEIMPSINGFFSDPK  92



>ref|XP_007163724.1| hypothetical protein PHAVU_001G258900g [Phaseolus vulgaris]
 gb|ESW35718.1| hypothetical protein PHAVU_001G258900g [Phaseolus vulgaris]
Length=89

 Score =   151 bits (382),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 82/87 (94%), Gaps = 0/87 (0%)
 Frame = +3

Query  24   MASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKY  203
            MA++RW++PEVYPLFAA+GVAVGICG QL+RNITTNPEVRV K+ RAAG+LEN+EEG+KY
Sbjct  1    MAANRWLKPEVYPLFAAVGVAVGICGMQLVRNITTNPEVRVTKQNRAAGILENFEEGEKY  60

Query  204  AEHSLRKFVRNKSPEIMPSLNRFFSDP  284
            +EHSLRK+VR K+P+IMPS+N FFS+P
Sbjct  61   SEHSLRKYVRGKNPQIMPSVNNFFSEP  87



>ref|XP_003527039.1| PREDICTED: uncharacterized protein LOC100499787 [Glycine max]
 gb|KHN19346.1| hypothetical protein glysoja_012266 [Glycine soja]
Length=89

 Score =   151 bits (382),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 67/88 (76%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +3

Query  30   SSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAE  209
            ++ W+RPEVYPLFAA+G AVGICGFQL+RNI  NPEVRVNKEGR AGVLEN+ EG+KYAE
Sbjct  2    ANHWLRPEVYPLFAAVGAAVGICGFQLVRNICINPEVRVNKEGRKAGVLENFAEGEKYAE  61

Query  210  HSLRKFVRNKSPEIMPSLNRFFSDPQRN  293
            H LRK+VRN++PEIMPS+N FF+DP RN
Sbjct  62   HFLRKYVRNRTPEIMPSINSFFADPSRN  89



>ref|XP_008340166.1| PREDICTED: uncharacterized protein LOC103403120 [Malus domestica]
 ref|XP_008361836.1| PREDICTED: uncharacterized protein LOC103425520 [Malus domestica]
Length=92

 Score =   151 bits (382),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 81/87 (93%), Gaps = 0/87 (0%)
 Frame = +3

Query  27   ASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYA  206
            +SSRWIRPEV+PLFAA+GVAVGICG QL+RNIT+NPEVRV K+ R AGVLEN+EEG++YA
Sbjct  3    SSSRWIRPEVFPLFAAVGVAVGICGMQLVRNITSNPEVRVTKQNRTAGVLENHEEGERYA  62

Query  207  EHSLRKFVRNKSPEIMPSLNRFFSDPQ  287
            EH LRK+VR ++P+IMPS+N++FSDPQ
Sbjct  63   EHGLRKYVRTRAPQIMPSINKYFSDPQ  89



>ref|XP_007209803.1| hypothetical protein PRUPE_ppa014036mg [Prunus persica]
 gb|EMJ11002.1| hypothetical protein PRUPE_ppa014036mg [Prunus persica]
Length=90

 Score =   151 bits (381),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 69/90 (77%), Positives = 79/90 (88%), Gaps = 0/90 (0%)
 Frame = +3

Query  24   MASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKY  203
            MA +RW+RPEVYPLFAA GVAVGICG  L R+IT NPEVRV+KE RAAG+LEN++EG+KY
Sbjct  1    MAPNRWLRPEVYPLFAATGVAVGICGLSLFRHITINPEVRVSKENRAAGILENFDEGEKY  60

Query  204  AEHSLRKFVRNKSPEIMPSLNRFFSDPQRN  293
             EH LRKFVRNKSPEIMPS+N FF+DP RN
Sbjct  61   KEHFLRKFVRNKSPEIMPSVNGFFTDPSRN  90



>ref|XP_011042649.1| PREDICTED: uncharacterized protein LOC105138299 [Populus euphratica]
Length=90

 Score =   151 bits (381),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 68/90 (76%), Positives = 78/90 (87%), Gaps = 0/90 (0%)
 Frame = +3

Query  24   MASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKY  203
            M  SRW+RPEVYPLFAA+GVAVGICGFQL RNI  NPEVRV K+ RAAGVLEN+ EG+KY
Sbjct  1    MGGSRWLRPEVYPLFAAVGVAVGICGFQLARNICINPEVRVTKQNRAAGVLENFSEGEKY  60

Query  204  AEHSLRKFVRNKSPEIMPSLNRFFSDPQRN  293
            +EH LRK VRN+SPEIMPS+N FF+DP+ N
Sbjct  61   SEHGLRKLVRNRSPEIMPSINNFFTDPKLN  90



>ref|XP_009771458.1| PREDICTED: uncharacterized protein LOC104221988 [Nicotiana sylvestris]
Length=91

 Score =   151 bits (381),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = +3

Query  15   LSSMASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEG  194
            ++S   +RW+RPEVYPLFAA+GVAVGICG QL+RNI  NPEVRV KE RAAGVL+N+ EG
Sbjct  1    MASSTLNRWLRPEVYPLFAAVGVAVGICGMQLVRNICGNPEVRVTKENRAAGVLDNFSEG  60

Query  195  KKYAEHSLRKFVRNKSPEIMPSLNRFFSDPQ  287
            +KYAEH+LRKFVRNKSPEIMP++N FFSDP+
Sbjct  61   EKYAEHALRKFVRNKSPEIMPNINGFFSDPK  91



>gb|ACJ84101.1| unknown [Medicago truncatula]
 gb|AFK34497.1| unknown [Medicago truncatula]
 gb|KEH35090.1| NADH-ubiquinone reductase complex 1 MLRQ subunit [Medicago truncatula]
Length=90

 Score =   151 bits (381),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 68/90 (76%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = +3

Query  24   MASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKY  203
            MA++RWIRPEVYPLFAA+G AVGIC F L+RNI  NPEVRVNK+ RAAGVLEN+ EG+KY
Sbjct  1    MATNRWIRPEVYPLFAAVGAAVGICAFSLVRNICINPEVRVNKQSRAAGVLENFAEGEKY  60

Query  204  AEHSLRKFVRNKSPEIMPSLNRFFSDPQRN  293
             EH LRKF RN+SPEIMP LN FF+DP RN
Sbjct  61   TEHLLRKFSRNRSPEIMPGLNSFFTDPSRN  90



>gb|AFO59572.1| B12D like protein [Saccharum hybrid cultivar GT28]
 gb|AHB79077.1| B12D-like protein [Saccharum hybrid cultivar]
Length=87

 Score =   151 bits (381),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 66/86 (77%), Positives = 79/86 (92%), Gaps = 0/86 (0%)
 Frame = +3

Query  30   SSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAE  209
            +SRW+RPEVYPLFAAMGVAVGICGFQL RNIT NPEVRVNK GRAAGVLEN+EEG++YA 
Sbjct  2    ASRWVRPEVYPLFAAMGVAVGICGFQLFRNITGNPEVRVNKAGRAAGVLENHEEGRRYAM  61

Query  210  HSLRKFVRNKSPEIMPSLNRFFSDPQ  287
            H LR FV +K+PEIMP++N+FF++P+
Sbjct  62   HGLRSFVHDKTPEIMPAINKFFTEPK  87



>ref|XP_004232259.1| PREDICTED: uncharacterized protein LOC101265497 [Solanum lycopersicum]
Length=91

 Score =   151 bits (381),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = +3

Query  15   LSSMASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEG  194
            ++S   +RW+RPEVYPLFAA+GVAVGICG QL+RNI TNPEVRV KE RAAGVL+N+ EG
Sbjct  1    MASSTINRWLRPEVYPLFAAVGVAVGICGMQLVRNICTNPEVRVTKENRAAGVLDNFSEG  60

Query  195  KKYAEHSLRKFVRNKSPEIMPSLNRFFSDPQ  287
            +KY+EH+LRKFVRNKSPEIMPS+N FFS+P 
Sbjct  61   EKYSEHALRKFVRNKSPEIMPSINGFFSNPN  91



>ref|XP_011085792.1| PREDICTED: uncharacterized protein LOC105167687 [Sesamum indicum]
Length=93

 Score =   151 bits (381),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 68/90 (76%), Positives = 79/90 (88%), Gaps = 0/90 (0%)
 Frame = +3

Query  18   SSMASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGK  197
            SS    RW+RPEVYPLFAA+GVAVGICG QL+RNI  NPEVRV KE RAAGVLEN+ EG+
Sbjct  3    SSNTLKRWLRPEVYPLFAAVGVAVGICGMQLVRNICINPEVRVTKENRAAGVLENFAEGE  62

Query  198  KYAEHSLRKFVRNKSPEIMPSLNRFFSDPQ  287
            KYAEH+LRKFVRN++PEIMPS+N FF+DP+
Sbjct  63   KYAEHALRKFVRNRAPEIMPSINSFFTDPK  92



>ref|XP_011098540.1| PREDICTED: uncharacterized protein LOC105177185 [Sesamum indicum]
Length=93

 Score =   151 bits (381),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 67/90 (74%), Positives = 79/90 (88%), Gaps = 0/90 (0%)
 Frame = +3

Query  18   SSMASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGK  197
            SS    RW+RPEVYPLFAA+GVAVGICG QL+RNI  NPEVRV KE RAAGVL+N+ EG+
Sbjct  3    SSTTLKRWLRPEVYPLFAAVGVAVGICGMQLVRNICINPEVRVTKENRAAGVLDNFAEGE  62

Query  198  KYAEHSLRKFVRNKSPEIMPSLNRFFSDPQ  287
            KYAEH+LRKFVRN++PEIMPS+N FF+DP+
Sbjct  63   KYAEHALRKFVRNRAPEIMPSINSFFTDPK  92



>gb|AEC10990.1| b12d-like protein [Camellia sinensis]
Length=91

 Score =   150 bits (380),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +3

Query  15   LSSMASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEG  194
            ++S   +RW+RPEVYPLFAA+GVAVGICGFQL+RNI  NPEVRVNKE  AAGVL+N+ EG
Sbjct  1    MASSTVNRWLRPEVYPLFAAVGVAVGICGFQLVRNICINPEVRVNKEKGAAGVLDNHAEG  60

Query  195  KKYAEHSLRKFVRNKSPEIMPSLNRFFSDPQ  287
            +KYAEH +RKFVRNKSPEIMP++N+FF+DP+
Sbjct  61   EKYAEHFVRKFVRNKSPEIMPAVNKFFTDPK  91



>ref|XP_003551877.1| PREDICTED: uncharacterized protein LOC100500344 [Glycine max]
 gb|KHN24095.1| hypothetical protein glysoja_025268 [Glycine soja]
Length=89

 Score =   150 bits (380),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = +3

Query  24   MASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKY  203
            MA++RW++PEVYPLFAA+GVAVGICG QL+RNITTNPEVRV K+ RAAG+LEN+ EG+KY
Sbjct  1    MAANRWLKPEVYPLFAAVGVAVGICGMQLVRNITTNPEVRVTKQNRAAGILENFAEGEKY  60

Query  204  AEHSLRKFVRNKSPEIMPSLNRFFSDP  284
            ++HSLRK+VR K P+IMPS+N FFSDP
Sbjct  61   SQHSLRKYVRGKQPQIMPSVNNFFSDP  87



>ref|XP_010942172.1| PREDICTED: uncharacterized protein LOC105060250 isoform X1 [Elaeis 
guineensis]
Length=105

 Score =   151 bits (381),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 71/105 (68%), Positives = 85/105 (81%), Gaps = 14/105 (13%)
 Frame = +3

Query  15   LSSMASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVR--------------VNK  152
            ++S  ++RW+RPEVYPLFAA+GVAVGICGFQL+RNI  NPEVR              V+K
Sbjct  1    MASSTANRWLRPEVYPLFAAVGVAVGICGFQLVRNICINPEVRYGDVLFHTYGDFTRVSK  60

Query  153  EGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMPSLNRFFSDPQ  287
            EGRAAGVLENY EG+KYAEH LR+FVRNK+PEIMPS+NRFF+DP+
Sbjct  61   EGRAAGVLENYAEGQKYAEHGLRRFVRNKAPEIMPSINRFFADPK  105



>ref|XP_003523058.1| PREDICTED: uncharacterized protein LOC100500534 [Glycine max]
Length=89

 Score =   150 bits (380),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 67/88 (76%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +3

Query  30   SSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAE  209
            ++RW+RPEVYPLFAA+G AVGICGFQL+RNI  NPEVRVNKEGR AGVLEN+ EG+KYAE
Sbjct  2    ANRWLRPEVYPLFAAVGAAVGICGFQLVRNICINPEVRVNKEGRKAGVLENFAEGEKYAE  61

Query  210  HSLRKFVRNKSPEIMPSLNRFFSDPQRN  293
            H LRK+VRN++PEIMPS+N FF+D  RN
Sbjct  62   HFLRKYVRNRTPEIMPSINSFFADTSRN  89



>ref|NP_001152717.1| LOC100286358 [Zea mays]
 gb|ACG30827.1| B12D protein [Zea mays]
 gb|ACG49122.1| B12D protein [Zea mays]
 gb|AFW76867.1| b12D protein [Zea mays]
Length=87

 Score =   150 bits (379),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 66/86 (77%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = +3

Query  30   SSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAE  209
            +SRW+RPEVYPLFAA GVAVGICGFQL RNIT NPEVRVNK GRAAGVLEN+EEG++YA 
Sbjct  2    ASRWVRPEVYPLFAATGVAVGICGFQLFRNITGNPEVRVNKAGRAAGVLENHEEGRRYAM  61

Query  210  HSLRKFVRNKSPEIMPSLNRFFSDPQ  287
            H LR FV +K+PEIMP++N+FF+DP+
Sbjct  62   HGLRSFVHDKTPEIMPAVNKFFTDPK  87



>ref|XP_002438146.1| hypothetical protein SORBIDRAFT_10g008810 [Sorghum bicolor]
 gb|EER89513.1| hypothetical protein SORBIDRAFT_10g008810 [Sorghum bicolor]
Length=87

 Score =   150 bits (379),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 66/86 (77%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = +3

Query  30   SSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAE  209
            ++RW+RPEVYPLFAAMGVAVGICGFQL RNIT NPEVRVNK GRAAGVLEN+EEG++YA 
Sbjct  2    ANRWVRPEVYPLFAAMGVAVGICGFQLFRNITGNPEVRVNKAGRAAGVLENHEEGRRYAM  61

Query  210  HSLRKFVRNKSPEIMPSLNRFFSDPQ  287
            H LR FV  K+PEIMP++N+FF+DP+
Sbjct  62   HGLRSFVHEKTPEIMPAINKFFTDPK  87



>ref|XP_006845122.1| hypothetical protein AMTR_s00005p00190110 [Amborella trichopoda]
 gb|ERN06797.1| hypothetical protein AMTR_s00005p00190110 [Amborella trichopoda]
Length=91

 Score =   150 bits (380),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 65/91 (71%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = +3

Query  15   LSSMASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEG  194
            ++S   SRW+RPEVYP+FA +G AVGICG QL+RNI TNP+VRV KE R+AGVLEN+ EG
Sbjct  1    MASSTFSRWLRPEVYPIFAVVGTAVGICGLQLVRNIRTNPDVRVTKEKRSAGVLENFAEG  60

Query  195  KKYAEHSLRKFVRNKSPEIMPSLNRFFSDPQ  287
            ++YA+HSLRKFVRNKSPEIMPS+N+FF+DP+
Sbjct  61   ERYAQHSLRKFVRNKSPEIMPSINKFFTDPK  91



>ref|XP_006439727.1| hypothetical protein CICLE_v10023087mg [Citrus clementina]
 ref|XP_006476687.1| PREDICTED: uncharacterized protein LOC102617192 [Citrus sinensis]
 gb|ESR52967.1| hypothetical protein CICLE_v10023087mg [Citrus clementina]
 gb|KDO69809.1| hypothetical protein CISIN_1g034649mg [Citrus sinensis]
Length=88

 Score =   150 bits (378),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 67/88 (76%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = +3

Query  24   MASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKY  203
            MA +RWIRPEV+PLFAA+GVAVGICG QL+RNI  NPEVRV K+ RAAGVLENY EG+KY
Sbjct  1    MAGNRWIRPEVFPLFAAVGVAVGICGMQLVRNICINPEVRVTKQNRAAGVLENYAEGEKY  60

Query  204  AEHSLRKFVRNKSPEIMPSLNRFFSDPQ  287
            +EH LRK+VRNK+PEIMP +N FF+DPQ
Sbjct  61   SEHFLRKYVRNKTPEIMPKINSFFTDPQ  88



>gb|ACU15396.1| unknown [Glycine max]
Length=89

 Score =   150 bits (378),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 64/87 (74%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = +3

Query  24   MASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKY  203
            MA++RW++PEVYPLFAA+GVAVGICG QL+RNITTNPEVRV K+ RAAG+LEN+ EG+KY
Sbjct  1    MAANRWLKPEVYPLFAAVGVAVGICGMQLVRNITTNPEVRVTKQNRAAGILENFAEGEKY  60

Query  204  AEHSLRKFVRNKSPEIMPSLNRFFSDP  284
            ++HSLRK+VR K P++MPS+N FFSDP
Sbjct  61   SQHSLRKYVRGKQPQVMPSVNNFFSDP  87



>gb|AFK33307.1| unknown [Medicago truncatula]
Length=90

 Score =   150 bits (378),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 67/90 (74%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = +3

Query  24   MASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKY  203
            MA++RWIRPEVYPLFAA+G AVGIC F L+RNI  NPEVRVNK+ RAAGVLEN+ EG+KY
Sbjct  1    MATNRWIRPEVYPLFAAVGAAVGICAFSLVRNICINPEVRVNKQSRAAGVLENFAEGEKY  60

Query  204  AEHSLRKFVRNKSPEIMPSLNRFFSDPQRN  293
             EH LR+F RN+SPEIMP LN FF+DP RN
Sbjct  61   TEHLLRRFSRNRSPEIMPGLNSFFTDPSRN  90



>emb|CDP02170.1| unnamed protein product [Coffea canephora]
Length=92

 Score =   149 bits (377),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 80/91 (88%), Gaps = 0/91 (0%)
 Frame = +3

Query  15   LSSMASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEG  194
            ++S   +RW+RPEVYPLFAA+GVAVGICG QLIRNI  NPEVRV KE RAAGVLEN+ EG
Sbjct  1    MASSTVNRWLRPEVYPLFAAVGVAVGICGAQLIRNICINPEVRVTKENRAAGVLENHAEG  60

Query  195  KKYAEHSLRKFVRNKSPEIMPSLNRFFSDPQ  287
            +KYAEH+LRKFVRN++P+IMPS+N FFS PQ
Sbjct  61   EKYAEHALRKFVRNRAPQIMPSVNNFFSKPQ  91



>emb|CAK22419.1| B12D-like protein [Beta vulgaris]
Length=91

 Score =   149 bits (377),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 70/91 (77%), Positives = 81/91 (89%), Gaps = 1/91 (1%)
 Frame = +3

Query  24   MAS-SRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKK  200
            MAS +RW+RPEVYPLFAA+GVAVGICG QL+RNI  NPEVRV+KE RAAGVLEN+ EG+K
Sbjct  1    MASVNRWVRPEVYPLFAAVGVAVGICGVQLVRNICINPEVRVSKENRAAGVLENFSEGEK  60

Query  201  YAEHSLRKFVRNKSPEIMPSLNRFFSDPQRN  293
            YAEH LRK+VRNK+PEIMPS+N FF+D  RN
Sbjct  61   YAEHFLRKYVRNKTPEIMPSINSFFADSTRN  91



>ref|XP_002515002.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF47556.1| conserved hypothetical protein [Ricinus communis]
Length=93

 Score =   149 bits (377),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 67/88 (76%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +3

Query  24   MASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKY  203
            MA+SRWIRPEV+PLFA++GVAVGICG QL+RNI TNPEVRV KE RAAGVL+N+ EG++Y
Sbjct  1    MAASRWIRPEVFPLFASVGVAVGICGMQLVRNICTNPEVRVTKENRAAGVLDNFAEGERY  60

Query  204  AEHSLRKFVRNKSPEIMPSLNRFFSDPQ  287
             EH LRKFVRN+SP+IMPSLN FFS+P 
Sbjct  61   KEHGLRKFVRNRSPQIMPSLNGFFSEPD  88



>gb|KDP26755.1| hypothetical protein JCGZ_17913 [Jatropha curcas]
Length=93

 Score =   149 bits (376),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 67/88 (76%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = +3

Query  24   MASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKY  203
            MA+SRWIRPEV+PLFAA+GVAVGICG QL+RNI  NP+VRV KE RAAGVL+N+ EG+KY
Sbjct  1    MAASRWIRPEVFPLFAAVGVAVGICGMQLVRNICINPDVRVTKEKRAAGVLDNFAEGEKY  60

Query  204  AEHSLRKFVRNKSPEIMPSLNRFFSDPQ  287
            AEH LRKFVR K P+IMPS+N FFSDP 
Sbjct  61   AEHGLRKFVRKKQPQIMPSINGFFSDPD  88



>ref|XP_008239697.1| PREDICTED: uncharacterized protein LOC103338283 [Prunus mume]
Length=90

 Score =   149 bits (376),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 68/90 (76%), Positives = 78/90 (87%), Gaps = 0/90 (0%)
 Frame = +3

Query  24   MASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKY  203
            MA +RW+RPEVYPLFAA GVAV ICG  L R+IT NPEVRV+KE RAAG+LEN++EG+KY
Sbjct  1    MAPNRWLRPEVYPLFAATGVAVAICGLSLFRHITINPEVRVSKENRAAGILENFDEGEKY  60

Query  204  AEHSLRKFVRNKSPEIMPSLNRFFSDPQRN  293
             EH LRKFVRNKSPEIMPS+N FF+DP RN
Sbjct  61   KEHFLRKFVRNKSPEIMPSVNGFFTDPSRN  90



>ref|XP_002318014.1| senescence-associated family protein [Populus trichocarpa]
 gb|ABK94203.1| unknown [Populus trichocarpa]
 gb|EEE96234.1| senescence-associated family protein [Populus trichocarpa]
Length=90

 Score =   149 bits (376),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 78/90 (87%), Gaps = 0/90 (0%)
 Frame = +3

Query  24   MASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKY  203
            M  SRW+RPEVYPLFAA+GVAVGICGFQL RNI  NPEVRV K+ RAAGVL+N+ EG+KY
Sbjct  1    MGGSRWLRPEVYPLFAAVGVAVGICGFQLARNICINPEVRVTKQNRAAGVLDNFSEGEKY  60

Query  204  AEHSLRKFVRNKSPEIMPSLNRFFSDPQRN  293
            +EH LRK VRN+SP+IMPS+N FF+DP+ N
Sbjct  61   SEHGLRKLVRNRSPQIMPSINNFFTDPKLN  90



>gb|KHG12689.1| Uncharacterized protein F383_19724 [Gossypium arboreum]
Length=89

 Score =   149 bits (376),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 80/89 (90%), Gaps = 1/89 (1%)
 Frame = +3

Query  24   MASS-RWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKK  200
            MAS+ RW++PEVYPLFA++GVAVGIC  QL+RNITTNPEVRV KE RAAGVL N+EEG+K
Sbjct  1    MASANRWLKPEVYPLFASVGVAVGICAMQLVRNITTNPEVRVTKENRAAGVLNNFEEGEK  60

Query  201  YAEHSLRKFVRNKSPEIMPSLNRFFSDPQ  287
            YAEH LRKFVRN+ P+IMPS+N FFSDP+
Sbjct  61   YAEHGLRKFVRNRQPQIMPSVNNFFSDPK  89



>ref|XP_006391239.1| hypothetical protein EUTSA_v10019446mg [Eutrema salsugineum]
 gb|ESQ28525.1| hypothetical protein EUTSA_v10019446mg [Eutrema salsugineum]
Length=89

 Score =   149 bits (376),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 67/88 (76%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +3

Query  24   MASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKY  203
            MA SRWIRPEVYPLFA++GVAVGIC  QL+RNI+TNPEVRV K+ R AGVL+N+ EG+KY
Sbjct  1    MAPSRWIRPEVYPLFASVGVAVGICVMQLVRNISTNPEVRVTKQNRIAGVLDNFAEGEKY  60

Query  204  AEHSLRKFVRNKSPEIMPSLNRFFSDPQ  287
            AEH LRKFVRNK+P+IMPS+N FFSDP+
Sbjct  61   AEHGLRKFVRNKTPQIMPSINGFFSDPK  88



>ref|XP_010907762.1| PREDICTED: uncharacterized protein LOC105034337 [Elaeis guineensis]
Length=91

 Score =   149 bits (376),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 65/90 (72%), Positives = 80/90 (89%), Gaps = 0/90 (0%)
 Frame = +3

Query  15   LSSMASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEG  194
            ++S   SRW++PEVYPL AA+GVAVG+CG QL+RNITTNPEVRV K+ RAAGVL+N+ EG
Sbjct  1    MASSTMSRWLKPEVYPLLAAVGVAVGMCGMQLVRNITTNPEVRVTKQNRAAGVLDNFAEG  60

Query  195  KKYAEHSLRKFVRNKSPEIMPSLNRFFSDP  284
            +KYAEH LRKF+RNK+PEIMPS+N+FFS P
Sbjct  61   EKYAEHGLRKFLRNKAPEIMPSVNKFFSSP  90



>gb|ACU15648.1| unknown [Glycine max]
Length=89

 Score =   149 bits (375),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +3

Query  30   SSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAE  209
            ++RW+RPEVYPLFAA+G AVGICGFQL+R+I  NPEVRVNKEGR AGVLEN+ EG+KYAE
Sbjct  2    ANRWLRPEVYPLFAAVGAAVGICGFQLVRSICINPEVRVNKEGRKAGVLENFAEGEKYAE  61

Query  210  HSLRKFVRNKSPEIMPSLNRFFSDPQRN  293
            H LRK+VRN++PEIMPS+N FF+D  RN
Sbjct  62   HFLRKYVRNRTPEIMPSINSFFADTSRN  89



>ref|XP_010546014.1| PREDICTED: uncharacterized protein LOC104818223 [Tarenaya hassleriana]
Length=88

 Score =   149 bits (375),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 79/86 (92%), Gaps = 0/86 (0%)
 Frame = +3

Query  30   SSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAE  209
            +SRW+RPEVYPLFAA+G AVGICGFQL+RNI  NPEVRV+KE RAAGVLEN+ EG++YAE
Sbjct  2    ASRWLRPEVYPLFAAVGAAVGICGFQLVRNICINPEVRVSKENRAAGVLENFAEGERYAE  61

Query  210  HSLRKFVRNKSPEIMPSLNRFFSDPQ  287
            H +R+FVRNK PEIMPS+N+FF+DP+
Sbjct  62   HFVRRFVRNKDPEIMPSINKFFTDPK  87



>ref|XP_009588369.1| PREDICTED: uncharacterized protein LOC104085953 [Nicotiana tomentosiformis]
Length=92

 Score =   149 bits (375),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 80/90 (89%), Gaps = 0/90 (0%)
 Frame = +3

Query  18   SSMASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGK  197
            +S + +RW+RPEVYPLF A+GVA GICGFQL+RNI  NPEVRV KE RAAGVL+N+ EG+
Sbjct  3    ASSSINRWLRPEVYPLFVAVGVAFGICGFQLVRNICINPEVRVTKENRAAGVLDNFTEGE  62

Query  198  KYAEHSLRKFVRNKSPEIMPSLNRFFSDPQ  287
            KYAEH+LRKFVRN++PEIMPS+N FFSDP+
Sbjct  63   KYAEHALRKFVRNRAPEIMPSINGFFSDPK  92



>emb|CDP14927.1| unnamed protein product [Coffea canephora]
Length=93

 Score =   149 bits (375),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = +3

Query  15   LSSMASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEG  194
            ++S + +RW+RPEVYPLFAA+GVA+GICGF L+RNI  NPEVRV K+ RAAGVLEN+ EG
Sbjct  1    MASSSVNRWLRPEVYPLFAAVGVAIGICGFSLVRNICINPEVRVAKQDRAAGVLENFAEG  60

Query  195  KKYAEHSLRKFVRNKSPEIMPSLNRFFSDPQRN  293
            +KYAEH+LRK+VRN+ PEIMPS+N FF++P++N
Sbjct  61   EKYAEHALRKYVRNRKPEIMPSINSFFTEPEKN  93



>ref|XP_004965125.1| PREDICTED: uncharacterized protein LOC101762161 [Setaria italica]
Length=87

 Score =   148 bits (374),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = +3

Query  30   SSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAE  209
            +SRW+RPEVYPLFAA GVAVGICGFQL RNIT NPEVRVNK GRAAGVLEN+EEG++YA 
Sbjct  2    ASRWVRPEVYPLFAATGVAVGICGFQLFRNITGNPEVRVNKAGRAAGVLENHEEGRRYAM  61

Query  210  HSLRKFVRNKSPEIMPSLNRFFSDPQ  287
            H LR FV +K+PEIMP++N+FF++P+
Sbjct  62   HGLRSFVHDKTPEIMPAINKFFTEPK  87



>gb|KHG26447.1| Uncharacterized protein F383_04740 [Gossypium arboreum]
 gb|KJB07848.1| hypothetical protein B456_001G047700 [Gossypium raimondii]
Length=87

 Score =   148 bits (374),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 79/86 (92%), Gaps = 0/86 (0%)
 Frame = +3

Query  30   SSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAE  209
            ++RW+RPEVYPLFAA+GVAVGICGFQL+RNI  NPEVRV KE RAAGVL+N+ EG+KY+E
Sbjct  2    ANRWLRPEVYPLFAAVGVAVGICGFQLVRNICINPEVRVTKENRAAGVLDNFAEGEKYSE  61

Query  210  HSLRKFVRNKSPEIMPSLNRFFSDPQ  287
            H LRK+VRNK+PEIMPS+N FF+DP+
Sbjct  62   HFLRKYVRNKTPEIMPSINSFFTDPK  87



>ref|XP_004502329.1| PREDICTED: uncharacterized protein LOC101491577 [Cicer arietinum]
Length=88

 Score =   148 bits (374),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 64/88 (73%), Positives = 81/88 (92%), Gaps = 0/88 (0%)
 Frame = +3

Query  24   MASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKY  203
            MA++RWIRPEV+PLFA++GVAVGICG QL+RNIT NP+VRV K+ RAAGVL+N+ EG+KY
Sbjct  1    MAANRWIRPEVFPLFASVGVAVGICGMQLVRNITGNPDVRVTKQNRAAGVLDNFSEGEKY  60

Query  204  AEHSLRKFVRNKSPEIMPSLNRFFSDPQ  287
            ++H+LRKFVRNKS +IMPS+N FFSDP+
Sbjct  61   SQHTLRKFVRNKSSQIMPSVNNFFSDPK  88



>gb|KJB30971.1| hypothetical protein B456_005G172200 [Gossypium raimondii]
Length=89

 Score =   148 bits (373),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 80/89 (90%), Gaps = 1/89 (1%)
 Frame = +3

Query  24   MASS-RWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKK  200
            MAS+ RW++PEVYPLFA++GVAVGIC  QL+RNITTNP+VRV KE RAAGVL N+EEG+K
Sbjct  1    MASANRWLKPEVYPLFASVGVAVGICAMQLVRNITTNPDVRVTKENRAAGVLNNFEEGEK  60

Query  201  YAEHSLRKFVRNKSPEIMPSLNRFFSDPQ  287
            YAEH LRKFVRN+ P+IMPS+N FFSDP+
Sbjct  61   YAEHGLRKFVRNRQPQIMPSVNNFFSDPK  89



>ref|XP_003538567.1| PREDICTED: uncharacterized protein LOC100527541 [Glycine max]
Length=89

 Score =   148 bits (373),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = +3

Query  24   MASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKY  203
            MA++RW++PEVYPLFA++GVAVGICG QL+RNITTNPEVRV K+ R AG+LEN+ EG+KY
Sbjct  1    MAANRWLKPEVYPLFASVGVAVGICGMQLVRNITTNPEVRVTKQNRTAGILENFAEGEKY  60

Query  204  AEHSLRKFVRNKSPEIMPSLNRFFSDP  284
            ++HSLRK+VR K P+IMPS+N FFSDP
Sbjct  61   SQHSLRKYVRGKQPQIMPSVNNFFSDP  87



>ref|XP_010255359.1| PREDICTED: uncharacterized protein LOC104596051 [Nelumbo nucifera]
Length=90

 Score =   147 bits (372),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 68/88 (77%), Positives = 80/88 (91%), Gaps = 2/88 (2%)
 Frame = +3

Query  24   MASS--RWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGK  197
            MASS  RW+RPEVYPLFAA+GVAVGICGFQL+RNI  NPEVRV+KE R AGVLEN+ EG+
Sbjct  1    MASSVNRWLRPEVYPLFAAVGVAVGICGFQLVRNICINPEVRVSKETRTAGVLENFAEGE  60

Query  198  KYAEHSLRKFVRNKSPEIMPSLNRFFSD  281
            KYAEH+LRKFVRN++PEIMPS+N FF++
Sbjct  61   KYAEHTLRKFVRNRTPEIMPSINNFFTN  88



>ref|XP_008374479.1| PREDICTED: uncharacterized protein LOC103437758 [Malus domestica]
Length=90

 Score =   147 bits (371),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = +3

Query  24   MASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKY  203
            MA++RW+RPEVYPLFAA GVAVGICG  L R+IT NPEVRV KE RAAGVL+N+ EG+KY
Sbjct  1    MAANRWLRPEVYPLFAATGVAVGICGLSLFRHITINPEVRVTKENRAAGVLDNHAEGEKY  60

Query  204  AEHSLRKFVRNKSPEIMPSLNRFFSDPQRN  293
             EH LRKFVRNK+PEIMP +N FF+DP +N
Sbjct  61   KEHFLRKFVRNKAPEIMPGINAFFTDPSKN  90



>gb|KHN44408.1| hypothetical protein glysoja_014449 [Glycine soja]
Length=89

 Score =   147 bits (370),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = +3

Query  24   MASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKY  203
            MA++RW++PEVYPLFA++GVAVGICG QL+RNITTNPEVRV K  R AG+LEN+ EG+KY
Sbjct  1    MAANRWLKPEVYPLFASVGVAVGICGMQLVRNITTNPEVRVTKRNRTAGILENFAEGEKY  60

Query  204  AEHSLRKFVRNKSPEIMPSLNRFFSDP  284
            ++HSLRK+VR K P+IMPS+N FFSDP
Sbjct  61   SQHSLRKYVRGKQPQIMPSVNNFFSDP  87



>gb|ACU16637.1| unknown [Glycine max]
Length=89

 Score =   146 bits (368),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = +3

Query  24   MASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKY  203
            MA++RW++PEVYPL A++GVAVGICG QL+RNITTNPEVRV K+ R AG+LEN+ EG+KY
Sbjct  1    MAANRWLKPEVYPLIASVGVAVGICGMQLVRNITTNPEVRVTKQNRTAGILENFAEGEKY  60

Query  204  AEHSLRKFVRNKSPEIMPSLNRFFSDP  284
            ++HSLRK+VR K P+IMPS+N FFSDP
Sbjct  61   SQHSLRKYVRGKQPQIMPSVNNFFSDP  87



>ref|XP_010550670.1| PREDICTED: uncharacterized protein LOC104821467 [Tarenaya hassleriana]
Length=86

 Score =   145 bits (366),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = +3

Query  30   SSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAE  209
            ++RW+RPEVYPLFAA+G AVGICGFQL+RNI  NPEVRVNKE RAAGVL+N+ EG++YAE
Sbjct  2    ANRWLRPEVYPLFAAVGAAVGICGFQLVRNICINPEVRVNKENRAAGVLDNFAEGERYAE  61

Query  210  HSLRKFVRNKSPEIMPSLNRFFSD  281
            H LRKFVRNK PEIMPS+N+FF++
Sbjct  62   HFLRKFVRNKGPEIMPSINKFFTE  85



>ref|XP_007036078.1| B12D protein [Theobroma cacao]
 gb|EOY20579.1| B12D protein [Theobroma cacao]
Length=87

 Score =   145 bits (365),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = +3

Query  30   SSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAE  209
            ++RW+RPEVYPLFAA+ VAVGICG QL+RNI  NPEVRVNKE RAAGVL+N+ EG+KYAE
Sbjct  2    ANRWLRPEVYPLFAAVSVAVGICGLQLVRNICINPEVRVNKENRAAGVLDNFAEGEKYAE  61

Query  210  HSLRKFVRNKSPEIMPSLNRFFSDPQ  287
            H +RK+VRN++PEIMPS+N FF+DP+
Sbjct  62   HFVRKYVRNRAPEIMPSINSFFTDPK  87



>ref|XP_006404294.1| hypothetical protein EUTSA_v10010862mg [Eutrema salsugineum]
 gb|ESQ45747.1| hypothetical protein EUTSA_v10010862mg [Eutrema salsugineum]
Length=88

 Score =   145 bits (365),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 66/86 (77%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = +3

Query  30   SSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAE  209
            SSRW+RPEVYPLFAA GVAVGICGF LIRNIT NPEVRV KE RAAGVL+N+ EG+KY E
Sbjct  2    SSRWLRPEVYPLFAATGVAVGICGFSLIRNITGNPEVRVTKENRAAGVLDNHAEGEKYKE  61

Query  210  HSLRKFVRNKSPEIMPSLNRFFSDPQ  287
            + LRK+VRNK PEIMP +N+FF+DP+
Sbjct  62   NFLRKYVRNKHPEIMPGINKFFTDPK  87



>gb|AFK36649.1| unknown [Lotus japonicus]
Length=88

 Score =   145 bits (365),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 61/87 (70%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = +3

Query  24   MASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKY  203
            MA++RWIRPEV+PLFA +G+AVGICG QL+RNI+TNPEVRV K+ RAAG+L+N+EEG+KY
Sbjct  1    MAANRWIRPEVFPLFATVGIAVGICGMQLVRNISTNPEVRVTKQNRAAGILDNFEEGEKY  60

Query  204  AEHSLRKFVRNKSPEIMPSLNRFFSDP  284
            ++H +RKFVR K  +IMPS+N+FFSDP
Sbjct  61   SQHFVRKFVRGKDTQIMPSINKFFSDP  87



>ref|XP_004142944.1| PREDICTED: uncharacterized protein LOC101222643 [Cucumis sativus]
 ref|XP_004159555.1| PREDICTED: uncharacterized protein LOC101224466 [Cucumis sativus]
 gb|KGN62359.1| hypothetical protein Csa_2G350420 [Cucumis sativus]
Length=89

 Score =   144 bits (364),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = +3

Query  27   ASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYA  206
             ++RW++PEVYPLFA++GVAVGIC  QL+RNITTNPEVRV KE RAAGVL+N+EEG+KYA
Sbjct  3    TANRWLKPEVYPLFASVGVAVGICAMQLVRNITTNPEVRVIKERRAAGVLDNFEEGEKYA  62

Query  207  EHSLRKFVRNKSPEIMPSLNRFFSDP  284
            EH LRKF+R + P+IMPS+N+FFSDP
Sbjct  63   EHGLRKFLRTRPPQIMPSINKFFSDP  88



>ref|XP_008351806.1| PREDICTED: uncharacterized protein LOC103415246 [Malus domestica]
Length=90

 Score =   144 bits (363),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 79/90 (88%), Gaps = 0/90 (0%)
 Frame = +3

Query  24   MASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKY  203
            MA++RW+RPEVYPLFAA GVA+GICG  L R+IT NPEVRVNKE RAAGVL+N+ EG+KY
Sbjct  1    MAANRWLRPEVYPLFAATGVAIGICGLSLFRHITINPEVRVNKENRAAGVLDNHAEGEKY  60

Query  204  AEHSLRKFVRNKSPEIMPSLNRFFSDPQRN  293
             E+ LRKFVRN++PEIMP++N FF+DP+ N
Sbjct  61   KENFLRKFVRNRAPEIMPAINGFFTDPKNN  90



>gb|AFK42697.1| unknown [Lotus japonicus]
Length=89

 Score =   144 bits (362),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 64/88 (73%), Positives = 75/88 (85%), Gaps = 0/88 (0%)
 Frame = +3

Query  30   SSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAE  209
            +SRW+RPEVYPLFAA+GVAVGICG QL+RNI  NPEVRVNK+ RAAGVL+N+ EG+KY E
Sbjct  2    ASRWLRPEVYPLFAAVGVAVGICGMQLVRNICINPEVRVNKQNRAAGVLDNFSEGEKYTE  61

Query  210  HSLRKFVRNKSPEIMPSLNRFFSDPQRN  293
            H +RKF R  S EIMPS+N FF+DP RN
Sbjct  62   HFIRKFARTSSREIMPSINSFFADPSRN  89



>gb|KCW61991.1| hypothetical protein EUGRSUZ_H04674, partial [Eucalyptus grandis]
Length=135

 Score =   145 bits (366),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 63/91 (69%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = +3

Query  15   LSSMASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEG  194
            ++S  ++RWIRPEV+PLFAA+GVAVGICG QLIRNI TNPEVRV KE RAAGVL+N+ EG
Sbjct  45   MASSTANRWIRPEVFPLFAAVGVAVGICGMQLIRNICTNPEVRVTKEKRAAGVLDNFAEG  104

Query  195  KKYAEHSLRKFVRNKSPEIMPSLNRFFSDPQ  287
            +KY++H +R+FVRN+ P++MPS+N FFSDP+
Sbjct  105  EKYSQHVVRRFVRNRPPQVMPSINNFFSDPK  135



>gb|EMT09386.1| hypothetical protein F775_07588 [Aegilops tauschii]
Length=87

 Score =   143 bits (361),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = +3

Query  30   SSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAE  209
            +S+W+RPEVYPLFAA GVA+GIC F L+RNIT NPEVRVNK GRAAGVLEN+EEG++YAE
Sbjct  2    ASKWVRPEVYPLFAATGVAIGICAFSLLRNITGNPEVRVNKMGRAAGVLENHEEGRRYAE  61

Query  210  HSLRKFVRNKSPEIMPSLNRFFSDPQ  287
            H LR +V++K+PEIMP +N+FF+ P+
Sbjct  62   HGLRAYVQDKTPEIMPGINKFFTSPK  87



>ref|XP_010692143.1| PREDICTED: uncharacterized protein LOC104905334 [Beta vulgaris 
subsp. vulgaris]
Length=89

 Score =   143 bits (361),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +3

Query  36   RWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHS  215
            RW+RPEVYPLF A+G AVGICGFQL+RNI  NPEVRVNKE RAAGVL+N++EG+KYAEH 
Sbjct  6    RWVRPEVYPLFVAVGAAVGICGFQLVRNICINPEVRVNKENRAAGVLDNHKEGEKYAEHF  65

Query  216  LRKFVRNKSPEIMPSLNRFFSDPQ  287
            +RKF R +S EIMP LN+FFSDPQ
Sbjct  66   IRKFSRTQSAEIMPGLNKFFSDPQ  89



>ref|XP_004504481.1| PREDICTED: uncharacterized protein LOC101503540 [Cicer arietinum]
Length=90

 Score =   143 bits (360),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 64/88 (73%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = +3

Query  24   MASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKY  203
            MA SRWI+PEVYPLFAA+G  VGIC  QL+RNI+TNPEVRVNKE R AGVL+N+ EG+ Y
Sbjct  1    MAGSRWIKPEVYPLFAAVGAVVGICAMQLVRNISTNPEVRVNKENRLAGVLDNHAEGEAY  60

Query  204  AEHSLRKFVRNKSPEIMPSLNRFFSDPQ  287
            AEH  RKFVRNK  ++MPS+N FFSDPQ
Sbjct  61   AEHRFRKFVRNKPRQVMPSVNNFFSDPQ  88



>gb|KFK34105.1| b12d protein [Arabis alpina]
Length=90

 Score =   142 bits (358),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 67/88 (76%), Positives = 77/88 (88%), Gaps = 1/88 (1%)
 Frame = +3

Query  21   SMASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKK  200
            SMAS RW+RPEVYPLFAA GVAVGIC F LIRNIT NPEVRV+KE RAAG+L+N+ EG+K
Sbjct  2    SMAS-RWLRPEVYPLFAATGVAVGICAFSLIRNITGNPEVRVSKENRAAGILDNHAEGEK  60

Query  201  YAEHSLRKFVRNKSPEIMPSLNRFFSDP  284
            Y E+ LRKFVRNK PEIMP +N+FF+DP
Sbjct  61   YKENFLRKFVRNKHPEIMPGINKFFTDP  88



>ref|XP_010515125.1| PREDICTED: uncharacterized protein LOC104791023 [Camelina sativa]
 ref|XP_010426282.1| PREDICTED: uncharacterized protein LOC104711289 [Camelina sativa]
Length=88

 Score =   142 bits (358),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = +3

Query  30   SSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAE  209
            SSRW+RPEVYPLFAA GVAVGIC F LIRNIT NPEVR  KE RAAG+L+N+ EG+KY E
Sbjct  2    SSRWLRPEVYPLFAATGVAVGICAFSLIRNITGNPEVRCTKENRAAGILDNFAEGEKYKE  61

Query  210  HSLRKFVRNKSPEIMPSLNRFFSDPQ  287
            + LRKFVRNK PEIMP +N+FF+DP+
Sbjct  62   NFLRKFVRNKHPEIMPGINKFFTDPK  87



>ref|XP_004310038.1| PREDICTED: uncharacterized protein LOC101295883 [Fragaria vesca 
subsp. vesca]
Length=87

 Score =   142 bits (357),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = +3

Query  30   SSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAE  209
            +SRWIRPEVYPLFAA GVAVGIC  QL+RNIT NPEVRV KE RAAG+L+N+EEG+KY E
Sbjct  2    ASRWIRPEVYPLFAATGVAVGICAMQLVRNITGNPEVRVTKENRAAGILDNFEEGEKYRE  61

Query  210  HSLRKFVRNKSPEIMPSLNRFFSDPQ  287
            +++R+FVRNK P+IMPS+N FFS+P 
Sbjct  62   NAVRRFVRNKKPQIMPSINNFFSEPN  87



>emb|CAA54065.1| HvB12D [Hordeum vulgare subsp. vulgare]
 emb|CAA70936.1| B12Dg1 [Hordeum vulgare subsp. vulgare]
Length=87

 Score =   142 bits (357),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = +3

Query  30   SSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAE  209
            +S+W+RPEVYPLFAA GVA+GIC F L+RNIT NPEVRV+K GRAAGVLEN+EEG++YAE
Sbjct  2    ASKWVRPEVYPLFAATGVAIGICAFSLLRNITGNPEVRVSKMGRAAGVLENHEEGRRYAE  61

Query  210  HSLRKFVRNKSPEIMPSLNRFFSDPQ  287
            H LR +V++K+PEIMP +N+FF+ P+
Sbjct  62   HGLRAYVQDKTPEIMPGINKFFTSPK  87



>ref|XP_002875880.1| hypothetical protein ARALYDRAFT_485174 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52139.1| hypothetical protein ARALYDRAFT_485174 [Arabidopsis lyrata subsp. 
lyrata]
Length=88

 Score =   141 bits (356),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 64/85 (75%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = +3

Query  30   SSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAE  209
            +SRW+RPEVYPLFAA GVAVGIC F LIRNIT NPEVR  KE RAAG+L+N+ EG+KY E
Sbjct  2    TSRWLRPEVYPLFAATGVAVGICAFSLIRNITGNPEVRCTKENRAAGILDNHAEGEKYKE  61

Query  210  HSLRKFVRNKSPEIMPSLNRFFSDP  284
            + LRKFVRNK PEIMP LN+FF+DP
Sbjct  62   NFLRKFVRNKKPEIMPGLNKFFTDP  86



>ref|NP_190397.1| B12D protein [Arabidopsis thaliana]
 pir||T13003 hypothetical protein T24C20.20 - Arabidopsis thaliana
 emb|CAB51061.1| B12D-like protein [Arabidopsis thaliana]
 gb|AAL91215.1| B12D-like protein [Arabidopsis thaliana]
 gb|AAN65070.1| B12D-like protein [Arabidopsis thaliana]
 dbj|BAH19734.1| AT3G48140 [Arabidopsis thaliana]
 gb|AEE78372.1| B12D protein [Arabidopsis thaliana]
Length=88

 Score =   141 bits (355),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 64/85 (75%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = +3

Query  30   SSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAE  209
            +SRW+RPEVYPLFAA GVAVGIC F LIRNIT NPEVR  KE RAAG+L+N+ EG+KY E
Sbjct  2    ASRWLRPEVYPLFAATGVAVGICAFSLIRNITGNPEVRCTKENRAAGILDNHAEGEKYKE  61

Query  210  HSLRKFVRNKSPEIMPSLNRFFSDP  284
            + LRKFVRNK PEIMP LN+FF+DP
Sbjct  62   NFLRKFVRNKKPEIMPGLNKFFTDP  86



>emb|CDY44977.1| BnaCnng12070D [Brassica napus]
Length=88

 Score =   141 bits (355),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = +3

Query  30   SSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAE  209
            SSRW+RPEVYPLFAA GVAVGIC F LIRNIT NPEVR  KE RAAGVL+N+ EG+KY E
Sbjct  2    SSRWLRPEVYPLFAATGVAVGICAFSLIRNITGNPEVRCTKENRAAGVLDNHAEGEKYKE  61

Query  210  HSLRKFVRNKSPEIMPSLNRFFSDPQ  287
            + LRK+VRNK PEIMP +N+FF+DP+
Sbjct  62   NFLRKYVRNKHPEIMPGINKFFTDPK  87



>ref|XP_006290288.1| hypothetical protein CARUB_v10018322mg [Capsella rubella]
 gb|EOA23186.1| hypothetical protein CARUB_v10018322mg [Capsella rubella]
Length=88

 Score =   140 bits (354),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = +3

Query  30   SSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAE  209
            SSRW+RPEVYPLFAA GVAVGIC F LIRNIT NPEVR  KE RAAG+L+N+ EG+KY E
Sbjct  2    SSRWLRPEVYPLFAATGVAVGICAFSLIRNITGNPEVRCTKENRAAGILDNFAEGEKYKE  61

Query  210  HSLRKFVRNKSPEIMPSLNRFFSDPQ  287
            + LRKFVR+K PEIMP +N+FF+DP+
Sbjct  62   NFLRKFVRDKHPEIMPGINKFFTDPK  87



>ref|XP_009149843.1| PREDICTED: uncharacterized protein LOC103873171 [Brassica rapa]
 emb|CDY36902.1| BnaA06g16870D [Brassica napus]
Length=88

 Score =   140 bits (354),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = +3

Query  30   SSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAE  209
            SSRW+RPEVYPLFAA GVAVGIC F LIRNIT NPEVR  KE RAAG+L+N+ EG+KY E
Sbjct  2    SSRWLRPEVYPLFAATGVAVGICAFSLIRNITGNPEVRCTKENRAAGILDNHAEGEKYKE  61

Query  210  HSLRKFVRNKSPEIMPSLNRFFSDPQ  287
            + LRK+VRNK PEIMP +N+FF+DP+
Sbjct  62   NFLRKYVRNKHPEIMPGINKFFTDPK  87



>ref|XP_003601829.1| B12D protein [Medicago truncatula]
 gb|AES72080.1| NADH-ubiquinone reductase complex 1 MLRQ subunit [Medicago truncatula]
 gb|AFK33923.1| unknown [Medicago truncatula]
Length=88

 Score =   140 bits (354),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 62/88 (70%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = +3

Query  24   MASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKY  203
            MA++RWIRPEVYPLF  +G AVGIC  QL+RNITTNPEVRV K+ RAAG+L+N++EG+KY
Sbjct  1    MAANRWIRPEVYPLFVPVGAAVGICVMQLVRNITTNPEVRVTKQNRAAGILDNHDEGEKY  60

Query  204  AEHSLRKFVRNKSPEIMPSLNRFFSDPQ  287
            ++H +R+FVR KS EIMPSLN FFSDP+
Sbjct  61   SQHFIRRFVRGKSTEIMPSLNGFFSDPK  88



>gb|EMS61978.1| hypothetical protein TRIUR3_19930 [Triticum urartu]
 gb|EMT04073.1| hypothetical protein F775_11885 [Aegilops tauschii]
Length=97

 Score =   139 bits (349),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  18   SSMASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGK  197
            SS A  RW+RPEVYP+FAA GVAV IC  QLIRNITTNPEVRV KE RAAG+ EN++EGK
Sbjct  6    SSAAWKRWLRPEVYPIFAATGVAVSICAMQLIRNITTNPEVRVTKENRAAGIQENFDEGK  65

Query  198  KYAEHSLRKFVRNKSPEIMPSLNRFFSDPQR  290
            +Y++H  RKF+  + PEIMP++N FFSDP +
Sbjct  66   RYSQHGFRKFIDRQRPEIMPAINNFFSDPPK  96



>gb|ACG48656.1| B12D protein [Zea mays]
Length=98

 Score =   139 bits (349),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 73/88 (83%), Gaps = 0/88 (0%)
 Frame = +3

Query  30   SSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAE  209
            S RWIRPEVYPLF  M VA+GIC +QL+RNIT NPEVRV KE RAAGVL+N++EG++YA 
Sbjct  10   SKRWIRPEVYPLFVPMAVALGICSYQLVRNITGNPEVRVTKEKRAAGVLDNHDEGERYAM  69

Query  210  HSLRKFVRNKSPEIMPSLNRFFSDPQRN  293
            H LRKFVR K PEIM S+N FF+DP ++
Sbjct  70   HGLRKFVRGKKPEIMASINSFFADPXKD  97



>gb|KEH20547.1| NADH-ubiquinone reductase complex 1 MLRQ subunit [Medicago truncatula]
Length=91

 Score =   138 bits (347),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 74/87 (85%), Gaps = 0/87 (0%)
 Frame = +3

Query  24   MASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKY  203
            MA  +WI+PEVYPLFAA+G  VGIC  QL+RNI TNPEVRVNK+ R AGVLEN+ EG+ Y
Sbjct  1    MAGFKWIKPEVYPLFAAVGTVVGICAMQLVRNICTNPEVRVNKQNRIAGVLENHAEGEAY  60

Query  204  AEHSLRKFVRNKSPEIMPSLNRFFSDP  284
            AEH +RKF+RNK P++MPS+N+FFS+P
Sbjct  61   AEHRVRKFLRNKPPQVMPSVNKFFSEP  87



>ref|XP_007044988.1| B12D protein [Theobroma cacao]
 gb|EOY00820.1| B12D protein [Theobroma cacao]
Length=89

 Score =   137 bits (346),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = +3

Query  27   ASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYA  206
            +++RW++PEVYPLFAA+G AVGIC  QL+RNI+TNPEVRV KE R+AG+LEN+EEG++YA
Sbjct  3    STNRWLKPEVYPLFAAVGFAVGICAMQLVRNISTNPEVRVTKENRSAGILENFEEGERYA  62

Query  207  EHSLRKFVRNKSPEIMPSLNRFFSDPQ  287
            EH LR FVR +  +IMPS+N FFSDP 
Sbjct  63   EHGLRNFVRKRPSQIMPSINNFFSDPN  89



>ref|XP_009150210.1| PREDICTED: uncharacterized protein LOC103873555 [Brassica rapa]
 emb|CDY21808.1| BnaA06g20770D [Brassica napus]
Length=88

 Score =   137 bits (346),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 62/85 (73%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +3

Query  30   SSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAE  209
            SSRW+RPEVYPLFAA G AVGIC F LIRNIT NPEVR  KE RAAG+L+N+ EG+KY E
Sbjct  2    SSRWLRPEVYPLFAATGAAVGICAFSLIRNITGNPEVRCTKENRAAGILDNHAEGEKYKE  61

Query  210  HSLRKFVRNKSPEIMPSLNRFFSDP  284
            + LRK+VR+K PEIMP LN+FF+DP
Sbjct  62   NFLRKYVRDKRPEIMPGLNKFFTDP  86



>ref|XP_008651557.1| PREDICTED: B12D protein isoform X1 [Zea mays]
 gb|ACG31473.1| B12D protein [Zea mays]
 tpg|DAA60235.1| TPA: hypothetical protein ZEAMMB73_939997 [Zea mays]
Length=98

 Score =   138 bits (347),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 73/88 (83%), Gaps = 0/88 (0%)
 Frame = +3

Query  30   SSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAE  209
            S RWIRPEVYPLF  M VA+GIC +QL+RNIT NPEVRV KE RAAGVL+N++EG++YA 
Sbjct  10   SKRWIRPEVYPLFVPMAVALGICSYQLVRNITGNPEVRVTKEKRAAGVLDNHDEGERYAM  69

Query  210  HSLRKFVRNKSPEIMPSLNRFFSDPQRN  293
            H LRKFVR K PEIM S+N FF+DP ++
Sbjct  70   HGLRKFVRGKKPEIMASINSFFADPPKD  97



>ref|XP_002459694.1| hypothetical protein SORBIDRAFT_02g008930 [Sorghum bicolor]
 gb|EER96215.1| hypothetical protein SORBIDRAFT_02g008930 [Sorghum bicolor]
Length=97

 Score =   137 bits (346),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 72/88 (82%), Gaps = 0/88 (0%)
 Frame = +3

Query  30   SSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAE  209
            S RWIRPEVYPLF  M  A+GIC +QL+RNIT NPEVRV KE RAAGVL+N++EG+KYA 
Sbjct  9    SKRWIRPEVYPLFVPMAAALGICSYQLVRNITGNPEVRVTKEKRAAGVLDNHDEGEKYAM  68

Query  210  HSLRKFVRNKSPEIMPSLNRFFSDPQRN  293
            H LRKFVR K PEIM S+N FF+DP ++
Sbjct  69   HGLRKFVRGKKPEIMASINSFFADPPKD  96



>ref|XP_004299593.1| PREDICTED: uncharacterized protein LOC101301782 [Fragaria vesca 
subsp. vesca]
Length=88

 Score =   137 bits (344),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 74/87 (85%), Gaps = 0/87 (0%)
 Frame = +3

Query  30   SSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAE  209
            +SRW+RPEVYPLF A+G AVGICGF ++R++  NPEVRV+K  RAAGVL+N+ EG+KY E
Sbjct  2    ASRWLRPEVYPLFLAVGAAVGICGFSMVRHMCINPEVRVSKVNRAAGVLDNFAEGEKYQE  61

Query  210  HSLRKFVRNKSPEIMPSLNRFFSDPQR  290
            H LRKFVRN+SPEIMP +N FF+DP +
Sbjct  62   HMLRKFVRNRSPEIMPGINSFFADPAK  88



>gb|ABK24106.1| unknown [Picea sitchensis]
Length=92

 Score =   137 bits (344),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = +3

Query  18   SSMASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGK  197
            S+ A  RW+RPE YP+FAA G+AV +C FQL RN+ TNPEVR+ KE RAAG+L+N+EEG+
Sbjct  3    STSAFKRWLRPEAYPIFAATGIAVTMCCFQLSRNLFTNPEVRLLKENRAAGILDNFEEGE  62

Query  198  KYAEHSLRKFVRNKSPEIMPSLNRFFSDPQ  287
            KYAEH LRK+VRNKSPEIMPS+N++F++ +
Sbjct  63   KYAEHKLRKYVRNKSPEIMPSINKYFTESK  92



>gb|AFW76868.1| hypothetical protein ZEAMMB73_758599, partial [Zea mays]
Length=141

 Score =   137 bits (346),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = +3

Query  45   RPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRK  224
            R +VYPLFAA GVAVGICGFQL RNIT NPEVRVNK GRAAGVLEN+EEG++YA H LR 
Sbjct  61   RAQVYPLFAATGVAVGICGFQLFRNITGNPEVRVNKAGRAAGVLENHEEGRRYAMHGLRS  120

Query  225  FVRNKSPEIMPSLNRFFSDPQ  287
            FV +K+PEIMP++N+FF+DP+
Sbjct  121  FVHDKTPEIMPAVNKFFTDPK  141



>gb|EMT27875.1| hypothetical protein F775_28789 [Aegilops tauschii]
Length=98

 Score =   134 bits (337),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 58/87 (67%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = +3

Query  33   SRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEH  212
            +RW+RPE YP+FAA GVAVGIC  QL+RNITTNPEVRV KE RAAGVL+N++EG++YA H
Sbjct  12   ARWLRPEAYPIFAATGVAVGICVMQLVRNITTNPEVRVTKENRAAGVLDNHDEGRRYARH  71

Query  213  SLRKFVRNKSPEIMPSLNRFFSDPQRN  293
              R+F+  KS EIMP +N FF+DP +N
Sbjct  72   PFRRFIDGKSAEIMPGINSFFTDPPKN  98



>ref|XP_006376832.1| hypothetical protein POPTR_0012s07660g [Populus trichocarpa]
 gb|ERP54629.1| hypothetical protein POPTR_0012s07660g [Populus trichocarpa]
Length=82

 Score =   133 bits (334),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = +3

Query  51   EVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFV  230
            +VYPLFAA+GVAVGICGFQL RNI  NPEVRV K+ RAAGVL+N+ EG+KY+EH LRK V
Sbjct  2    QVYPLFAAVGVAVGICGFQLARNICINPEVRVTKQNRAAGVLDNFSEGEKYSEHGLRKLV  61

Query  231  RNKSPEIMPSLNRFFSDPQRN  293
            RN+SP+IMPS+N FF+DP+ N
Sbjct  62   RNRSPQIMPSINNFFTDPKLN  82



>ref|XP_011086732.1| PREDICTED: uncharacterized protein LOC105168371 [Sesamum indicum]
Length=86

 Score =   132 bits (333),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = +3

Query  33   SRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEH  212
             RW++PE+YPL   +G AVGICG QLIRNI TNPEVRV KE RAAGVL+NYEEG+KYA+H
Sbjct  2    GRWMKPEIYPLLVPVGFAVGICGMQLIRNICTNPEVRVTKENRAAGVLQNYEEGEKYADH  61

Query  213  SLRKFVRNKSPEIMPSLNRFFSDPQ  287
            + RK++R + P+IMP +NR+FS P+
Sbjct  62   AFRKYLRGQHPQIMPGINRYFSKPE  86



>dbj|BAK01100.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=97

 Score =   133 bits (334),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 71/93 (76%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    ATQLSSMASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENY  185
            A   SS A  RW+RPE YP+F   GVAV IC  QLIRNITTNPEVRV KE RAAGV EN+
Sbjct  2    AAGASSAAWKRWLRPEAYPIFLTTGVAVSICAMQLIRNITTNPEVRVTKENRAAGVQENF  61

Query  186  EEGKKYAEHSLRKFVRNKSPEIMPSLNRFFSDP  284
            +EGK+Y++H  RKF+  + P+IMP++N FFSDP
Sbjct  62   DEGKRYSQHGFRKFIDRQRPQIMPAINNFFSDP  94



>ref|XP_004955942.1| PREDICTED: uncharacterized protein LOC101785845 [Setaria italica]
Length=95

 Score =   132 bits (331),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = +3

Query  18   SSMASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGK  197
            S+  S RWIRPEVYPLF A G AVGIC  QLIRNIT NPEVRV KE RAAGVLEN+EEG+
Sbjct  5    SASWSKRWIRPEVYPLFLATGAAVGICAMQLIRNITGNPEVRVLKEKRAAGVLENHEEGR  64

Query  198  KYAEHSLRKFVRNKSPEIMPSLNRFFSDPQ  287
            +Y++H  RK++  K PEIM SLN + +DP+
Sbjct  65   RYSQHGFRKYIDGKKPEIMQSLNSWMADPK  94



>gb|EPS70497.1| hypothetical protein M569_04271, partial [Genlisea aurea]
Length=79

 Score =   131 bits (330),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 59/77 (77%), Positives = 70/77 (91%), Gaps = 0/77 (0%)
 Frame = +3

Query  54   VYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVR  233
            V+PLFAA+GVAVG+CG QLIRNIT NPEVRVNK  R AGVL+N+EEG+KYA+HS+RKFVR
Sbjct  1    VFPLFAAVGVAVGLCGMQLIRNITINPEVRVNKMNRGAGVLDNFEEGEKYAQHSVRKFVR  60

Query  234  NKSPEIMPSLNRFFSDP  284
             +SPEIMPS+N FFS+P
Sbjct  61   KRSPEIMPSINHFFSEP  77



>ref|XP_010249439.1| PREDICTED: uncharacterized protein LOC104591985 [Nelumbo nucifera]
Length=94

 Score =   131 bits (330),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = +3

Query  27   ASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYA  206
            A +RW RPEVYPL  A+G  VG+C FQL+RNI +NP+VRVNK+ R+ GV +N+EEGK Y 
Sbjct  4    AYNRWSRPEVYPLMVALGGVVGLCAFQLVRNICSNPDVRVNKQKRSEGVFDNFEEGKNYK  63

Query  207  EHSLRKFVRNKSPEIMPSLNRFFSDPQ  287
            EHS+RKF+RN+ PE+MPS+N+FFS+P+
Sbjct  64   EHSIRKFLRNRPPEVMPSVNKFFSEPK  90



>gb|EMS45331.1| hypothetical protein TRIUR3_29962 [Triticum urartu]
Length=98

 Score =   131 bits (329),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 57/87 (66%), Positives = 71/87 (82%), Gaps = 0/87 (0%)
 Frame = +3

Query  33   SRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEH  212
            +RW+RPE YP+FAA GVAVGIC  QL+RNITTNPEVRV KE RAAGVL+N++EG++YA H
Sbjct  12   ARWLRPEAYPIFAATGVAVGICVMQLVRNITTNPEVRVTKENRAAGVLDNHDEGRRYARH  71

Query  213  SLRKFVRNKSPEIMPSLNRFFSDPQRN  293
              R+F+  KS EIMP +N FF+ P +N
Sbjct  72   PFRRFIDGKSAEIMPGINSFFTAPPKN  98



>ref|XP_003557311.1| PREDICTED: uncharacterized protein LOC100833199 [Brachypodium 
distachyon]
Length=97

 Score =   131 bits (329),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 73/95 (77%), Gaps = 0/95 (0%)
 Frame = +3

Query  6    ATQLSSMASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENY  185
            AT  S+    RW+RPE YP+FA  GVAVGIC  QL+RNITTNPEVRV KE RAAGVL+N+
Sbjct  2    ATGASANMWRRWLRPEAYPIFATTGVAVGICVMQLVRNITTNPEVRVTKENRAAGVLDNH  61

Query  186  EEGKKYAEHSLRKFVRNKSPEIMPSLNRFFSDPQR  290
             EG++Y+ H  RKF+  +S EIMP+LN FF+DP +
Sbjct  62   AEGERYSRHGFRKFIDGRSREIMPALNSFFTDPPK  96



>dbj|BAK01669.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ85036.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=98

 Score =   130 bits (328),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 57/87 (66%), Positives = 71/87 (82%), Gaps = 0/87 (0%)
 Frame = +3

Query  33   SRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEH  212
            +RW+RPE YP+FAA GVAVGIC  QL+RNITTNPEVRV KE RAAGVL+N++EG++YA H
Sbjct  12   ARWLRPEAYPIFAATGVAVGICVMQLVRNITTNPEVRVTKENRAAGVLDNHDEGRRYARH  71

Query  213  SLRKFVRNKSPEIMPSLNRFFSDPQRN  293
              R+F+  KS EIMP +N FF+ P +N
Sbjct  72   PFRRFIDGKSAEIMPGINNFFTAPPKN  98



>dbj|BAC84633.1| putative B12D protein [Oryza sativa Japonica Group]
 dbj|BAD31625.1| putative B12D protein [Oryza sativa Japonica Group]
 gb|EAZ03481.1| hypothetical protein OsI_25619 [Oryza sativa Indica Group]
 gb|EAZ39393.1| hypothetical protein OsJ_23824 [Oryza sativa Japonica Group]
 dbj|BAH01595.1| unnamed protein product [Oryza sativa Japonica Group]
Length=98

 Score =   130 bits (327),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 60/85 (71%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = +3

Query  36   RWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHS  215
            RWIRPEVYPLF A GVAV IC  QL+RNIT NPEVRV KE RAAGVLEN++EGK+Y++H 
Sbjct  13   RWIRPEVYPLFLATGVAVSICVGQLVRNITGNPEVRVLKEKRAAGVLENFDEGKRYSQHG  72

Query  216  LRKFVRNKSPEIMPSLNRFFSDPQR  290
             RKF+  K PEIMP +N FFSDP +
Sbjct  73   FRKFIDGKRPEIMPGINSFFSDPPK  97



>emb|CDP13299.1| unnamed protein product [Coffea canephora]
Length=89

 Score =   129 bits (324),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = +3

Query  33   SRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEH  212
            SRWI+PEVYPL A +   VG+C  QL+RNI TNPEVRV KE RAAGVL N+EEG+ YA+H
Sbjct  5    SRWIKPEVYPLLAPVAAVVGLCTMQLVRNICTNPEVRVTKENRAAGVLNNFEEGEYYAQH  64

Query  213  SLRKFVRNKSPEIMPSLNRFFSDP  284
             LR+F+R + PE+MPS+N+FFSDP
Sbjct  65   RLRQFLRGRRPEVMPSVNKFFSDP  88



>ref|XP_006658464.1| PREDICTED: uncharacterized protein LOC102702396 [Oryza brachyantha]
Length=100

 Score =   128 bits (322),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = +3

Query  36   RWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHS  215
            RWIRPEVYPLF A GVAV IC  QL+RNIT NPEVRV KE RAAGVLEN++EG++Y++H 
Sbjct  15   RWIRPEVYPLFLATGVAVSICVGQLVRNITGNPEVRVLKEKRAAGVLENFDEGRRYSQHG  74

Query  216  LRKFVRNKSPEIMPSLNRFFSDPQR  290
             RKF+  + PEIMPS+N FF+DP +
Sbjct  75   FRKFIDGRRPEIMPSINSFFADPPK  99



>ref|XP_006338343.1| PREDICTED: uncharacterized protein LOC102603988 [Solanum tuberosum]
Length=88

 Score =   125 bits (314),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 67/86 (78%), Gaps = 0/86 (0%)
 Frame = +3

Query  36   RWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHS  215
            RWIRPEVYPL AAM    G+C FQL RN+  NP+VR+NK  R+ GVLEN EEG+KYA+HS
Sbjct  3    RWIRPEVYPLMAAMTFVTGMCVFQLTRNVLLNPDVRINKAHRSMGVLENEEEGEKYAKHS  62

Query  216  LRKFVRNKSPEIMPSLNRFFSDPQRN  293
            LR F+R + P++MPS+NRFFSD   N
Sbjct  63   LRNFLRTRPPQVMPSINRFFSDHDNN  88



>ref|XP_006438116.1| hypothetical protein CICLE_v10033501mg [Citrus clementina]
 gb|ESR51356.1| hypothetical protein CICLE_v10033501mg [Citrus clementina]
 gb|KDO82025.1| hypothetical protein CISIN_1g047755mg [Citrus sinensis]
Length=90

 Score =   124 bits (312),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = +3

Query  27   ASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYA  206
            +S +W+RPEVYPLF A+G AVGIC  QL+RN  TNPEVR+ K  R AGVLEN++EG +Y 
Sbjct  4    SSFKWVRPEVYPLFGALGAAVGICAMQLVRNAWTNPEVRLTKANRTAGVLENFDEGYRYK  63

Query  207  EHSLRKFVRNKSPEIMPSLNRFFS  278
            E++LR+FVR+K P+IMPS+N FFS
Sbjct  64   ENALRRFVRDKPPQIMPSVNEFFS  87



>ref|XP_009596991.1| PREDICTED: uncharacterized protein LOC104092997 [Nicotiana tomentosiformis]
Length=88

 Score =   124 bits (311),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = +3

Query  36   RWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHS  215
            RW+RPEVYPL AAM    G+C FQL RN+  NP+VR++K  R+  VLEN EEG+KYA+HS
Sbjct  3    RWMRPEVYPLMAAMTFVTGMCVFQLTRNVLLNPDVRISKVHRSMAVLENEEEGEKYAQHS  62

Query  216  LRKFVRNKSPEIMPSLNRFFSDPQRN  293
            LRKF+R + P++MPS+NRFFSD  +N
Sbjct  63   LRKFLRTRPPQVMPSINRFFSDHDKN  88



>ref|XP_006484337.1| PREDICTED: uncharacterized protein LOC102622685 [Citrus sinensis]
Length=90

 Score =   124 bits (310),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = +3

Query  27   ASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYA  206
            +S +W+RPEVYPLF A+G AVGIC  QL+RN  TNPEVR+ K  R AGVLEN++EG +Y 
Sbjct  4    SSFKWVRPEVYPLFGALGAAVGICAVQLVRNAWTNPEVRLTKANRTAGVLENFDEGYRYK  63

Query  207  EHSLRKFVRNKSPEIMPSLNRFFS  278
            E++LR+FVR+K P+IMPS+N FFS
Sbjct  64   ENALRRFVRDKPPQIMPSVNEFFS  87



>ref|XP_010694063.1| PREDICTED: uncharacterized protein LOC104906928 [Beta vulgaris 
subsp. vulgaris]
Length=88

 Score =   123 bits (309),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = +3

Query  36   RWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHS  215
            RWI+P+VYPL AAM    G+C FQL RN+  NP+VR+NK  RA  VLEN+EEG+KYAEH 
Sbjct  3    RWIKPDVYPLIAAMSFVTGMCIFQLTRNVLLNPDVRINKAHRATAVLENHEEGEKYAEHG  62

Query  216  LRKFVRNKSPEIMPSLNRFFSDPQRN  293
             RK++R +SPE+MPS+N FFS+ +++
Sbjct  63   FRKYLRTRSPEVMPSINSFFSETKKD  88



>ref|XP_004232140.1| PREDICTED: uncharacterized protein LOC101252543 [Solanum lycopersicum]
Length=88

 Score =   123 bits (309),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 67/86 (78%), Gaps = 0/86 (0%)
 Frame = +3

Query  36   RWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHS  215
            RWIRPEVYPL AAM    G+C FQL RN+  NP+VR+NK  R+ GVLEN EEG+KYA+HS
Sbjct  3    RWIRPEVYPLMAAMTFVTGMCVFQLTRNVLLNPDVRINKAHRSMGVLENEEEGEKYAKHS  62

Query  216  LRKFVRNKSPEIMPSLNRFFSDPQRN  293
            LR F+R + P++MPS+NRFFS+   N
Sbjct  63   LRNFLRTRPPQVMPSINRFFSNHDNN  88



>ref|NP_001151846.1| B12D protein [Zea mays]
 gb|ACG44577.1| B12D protein [Zea mays]
Length=84

 Score =   122 bits (307),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = +3

Query  51   EVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFV  230
            +VYPLF  M VA+GIC +QL+RNIT NPEVRV KE RAAGVL+N++EG++YA H LRKFV
Sbjct  3    QVYPLFVPMAVALGICSYQLVRNITGNPEVRVTKEKRAAGVLDNHDEGERYAMHGLRKFV  62

Query  231  RNKSPEIMPSLNRFFSDPQRN  293
            R K PEIM S+N FF+DP ++
Sbjct  63   RGKKPEIMASINSFFADPPKD  83



>ref|XP_011099034.1| PREDICTED: uncharacterized protein LOC105177540 [Sesamum indicum]
Length=86

 Score =   122 bits (307),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = +3

Query  36   RWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHS  215
            RW++P+VYPL AAM    G+C FQL RN   NP+VR+NK  R   VLEN EEG+KYAEHS
Sbjct  3    RWMKPDVYPLVAAMSFVTGMCLFQLTRNALLNPDVRINKAHRRRAVLENQEEGEKYAEHS  62

Query  216  LRKFVRNKSPEIMPSLNRFFSD  281
            LRKF+R + PE+MPSLNRFFSD
Sbjct  63   LRKFLRTRPPEVMPSLNRFFSD  84



>gb|AAL17696.1| B12D-like protein [Castanea sativa]
Length=134

 Score =   124 bits (310),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 69/86 (80%), Gaps = 1/86 (1%)
 Frame = +3

Query  33   SRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAA-GVLENYEEGKKYAE  209
            + W+RPEVYPLFA +GVAVGIC  QL+RNI TNPEVRV KE  +    L N+EEG+KY++
Sbjct  30   TEWLRPEVYPLFATVGVAVGICAMQLVRNICTNPEVRVTKENNSCRKCLHNFEEGEKYSQ  89

Query  210  HSLRKFVRNKSPEIMPSLNRFFSDPQ  287
            H++RKFV N+SP IMPSL  FFS+P+
Sbjct  90   HAVRKFVLNRSPHIMPSLKSFFSEPK  115



>ref|XP_009792586.1| PREDICTED: uncharacterized protein LOC104239607 [Nicotiana sylvestris]
Length=87

 Score =   122 bits (306),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 65/82 (79%), Gaps = 0/82 (0%)
 Frame = +3

Query  36   RWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHS  215
            RW+RPEVYPL AAM    G+C FQL RN+  NP+VR+ K  R+  +LEN EEG+KYA+HS
Sbjct  3    RWMRPEVYPLMAAMTFVTGMCVFQLTRNVLLNPDVRIKKAHRSMAILENEEEGEKYAQHS  62

Query  216  LRKFVRNKSPEIMPSLNRFFSD  281
            LRKF+R + P++MPS+NRFFSD
Sbjct  63   LRKFLRTRPPQVMPSINRFFSD  84



>ref|XP_001779363.1| predicted protein [Physcomitrella patens]
 gb|EDQ55870.1| predicted protein [Physcomitrella patens]
Length=93

 Score =   122 bits (305),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 67/83 (81%), Gaps = 0/83 (0%)
 Frame = +3

Query  30   SSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAE  209
            S RWI+PE+YPLFAA+G A+GICG+ + RN+  NP+VR+ KE RAAGVLENY+EG+ Y  
Sbjct  8    SKRWIKPEIYPLFAAIGAALGICGYSMARNLAINPDVRITKEDRAAGVLENYKEGEAYKM  67

Query  210  HSLRKFVRNKSPEIMPSLNRFFS  278
            H LRK+++ + P+IMP +N +FS
Sbjct  68   HGLRKYLQQQEPQIMPGINNYFS  90



>gb|EYU29787.1| hypothetical protein MIMGU_mgv1a021169mg [Erythranthe guttata]
Length=80

 Score =   121 bits (304),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 68/89 (76%), Gaps = 11/89 (12%)
 Frame = +3

Query  27   ASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYA  206
            A++RWIRPEVYPLFAA G+AVGICGFQL+RNI  NPEVR           +N++EG KY 
Sbjct  3    AANRWIRPEVYPLFAATGLAVGICGFQLVRNICGNPEVR-----------DNFDEGHKYK  51

Query  207  EHSLRKFVRNKSPEIMPSLNRFFSDPQRN  293
            E +LRK+VRN+  EIMPSLN FF+DPQ N
Sbjct  52   ERALRKYVRNRKLEIMPSLNSFFTDPQNN  80



>ref|XP_008464582.1| PREDICTED: uncharacterized protein LOC103502424 [Cucumis melo]
Length=86

 Score =   121 bits (304),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 65/81 (80%), Gaps = 0/81 (0%)
 Frame = +3

Query  36   RWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHS  215
            RW++PEVYPL AAMG    +C FQL RNI  NP+VRVNK  R  GVLEN EEG+KY+EHS
Sbjct  3    RWMKPEVYPLLAAMGFVTSMCVFQLTRNILINPDVRVNKAHRRMGVLENEEEGEKYSEHS  62

Query  216  LRKFVRNKSPEIMPSLNRFFS  278
            LR+F+R + PEIMP++NR+FS
Sbjct  63   LRRFLRTRPPEIMPTINRYFS  83



>ref|XP_010257978.1| PREDICTED: uncharacterized protein LOC104597899 [Nelumbo nucifera]
Length=87

 Score =   121 bits (303),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 62/81 (77%), Gaps = 0/81 (0%)
 Frame = +3

Query  36   RWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHS  215
            RWI+PEVYPL AAM     +C FQL RN   NP+VRVNK+ R   VLENYEEG+KYAEH 
Sbjct  3    RWIKPEVYPLMAAMTFVTSMCVFQLTRNAFLNPDVRVNKDHRKTAVLENYEEGEKYAEHG  62

Query  216  LRKFVRNKSPEIMPSLNRFFS  278
            LRKF+R + PEIMP++N FFS
Sbjct  63   LRKFLRTRPPEIMPTINHFFS  83



>emb|CDP19974.1| unnamed protein product [Coffea canephora]
Length=92

 Score =   120 bits (300),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 64/81 (79%), Gaps = 0/81 (0%)
 Frame = +3

Query  36   RWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHS  215
            RWI+PEVYPL AAM    G+C FQL RN+  NP+VRV+K  R   VLEN EEG+KYA+HS
Sbjct  3    RWIKPEVYPLMAAMSFVTGMCIFQLTRNVLLNPDVRVDKAHRKTAVLENQEEGEKYAQHS  62

Query  216  LRKFVRNKSPEIMPSLNRFFS  278
            LR+F+R + PEIMPS+NRFF+
Sbjct  63   LRRFLRTRPPEIMPSINRFFA  83



>dbj|BAG94722.1| unnamed protein product [Oryza sativa Japonica Group]
Length=90

 Score =   120 bits (300),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = +3

Query  30   SSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAE  209
            +SRWIRPEVYPLFA  GVAVGIC  QL+RNITTNPEVRV KE RAAGVLEN++EGK+Y++
Sbjct  2    ASRWIRPEVYPLFATTGVAVGICAMQLVRNITTNPEVRVTKENRAAGVLENFDEGKRYSQ  61

Query  210  HSLRKFVRNKSPEIMPSLN  266
            H +R+F  +K  + M +L+
Sbjct  62   HGVRRFWLSKRRDYMQALD  80



>ref|NP_001059359.1| Os07g0274400 [Oryza sativa Japonica Group]
 dbj|BAC84630.1| putative B12D protein [Oryza sativa Japonica Group]
 dbj|BAD31622.1| putative B12D protein [Oryza sativa Japonica Group]
 dbj|BAF21273.1| Os07g0274400 [Oryza sativa Japonica Group]
 gb|EAZ39392.1| hypothetical protein OsJ_23823 [Oryza sativa Japonica Group]
Length=89

 Score =   120 bits (300),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = +3

Query  30   SSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAE  209
            +SRWIRPEVYPLFA  GVAVGIC  QL+RNITTNPEVRV KE RAAGVLEN++EGK+Y++
Sbjct  2    ASRWIRPEVYPLFATTGVAVGICAMQLVRNITTNPEVRVTKENRAAGVLENFDEGKRYSQ  61

Query  210  HSLRKFVRNKSPEIMPSLN  266
            H +R+F  +K  + M +L+
Sbjct  62   HGVRRFWLSKRRDYMQALD  80



>gb|EYU20492.1| hypothetical protein MIMGU_mgv1a026736mg [Erythranthe guttata]
Length=86

 Score =   119 bits (299),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = +3

Query  36   RWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHS  215
            RW++PEVYPL AAM    G+C FQL RN+  NP+VR+NK  R   VLEN EEG  Y EH+
Sbjct  3    RWVKPEVYPLMAAMSFVTGMCLFQLTRNVILNPDVRINKAHRTTAVLENEEEGLTYREHN  62

Query  216  LRKFVRNKSPEIMPSLNRFFSD  281
            LRKF+R + PE+MPS+NRFFSD
Sbjct  63   LRKFLRTRPPEVMPSVNRFFSD  84



>ref|XP_007215204.1| hypothetical protein PRUPE_ppa014104mg [Prunus persica]
 gb|EMJ16403.1| hypothetical protein PRUPE_ppa014104mg [Prunus persica]
Length=86

 Score =   119 bits (299),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 51/81 (63%), Positives = 63/81 (78%), Gaps = 0/81 (0%)
 Frame = +3

Query  36   RWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHS  215
            RW+RPEVYPL AAM     +C FQL RN+  NP+VR++K  R  GVLEN EEG+KYAEH 
Sbjct  3    RWVRPEVYPLMAAMTFVTSLCAFQLTRNVFLNPDVRIDKAKRGMGVLENKEEGEKYAEHG  62

Query  216  LRKFVRNKSPEIMPSLNRFFS  278
            LRKF+R + PEIMP++N+FFS
Sbjct  63   LRKFLRTRPPEIMPTINQFFS  83



>gb|EYU25265.1| hypothetical protein MIMGU_mgv1a024239mg [Erythranthe guttata]
Length=86

 Score =   119 bits (299),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 52/82 (63%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = +3

Query  36   RWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHS  215
            RWI+PEVYPL AAM    G+C FQL RN+  NP+VR+NK  R   VLEN EEG KY EH+
Sbjct  3    RWIKPEVYPLMAAMSFVTGMCLFQLTRNVILNPDVRINKAHRTTAVLENEEEGWKYREHN  62

Query  216  LRKFVRNKSPEIMPSLNRFFSD  281
            LRKF+R + PE+MPS+NRFFS+
Sbjct  63   LRKFLRTRPPEVMPSVNRFFSE  84



>ref|XP_008230281.1| PREDICTED: uncharacterized protein LOC103329570 [Prunus mume]
Length=86

 Score =   119 bits (298),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 51/81 (63%), Positives = 63/81 (78%), Gaps = 0/81 (0%)
 Frame = +3

Query  36   RWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHS  215
            RW++PEVYPL AAM     +C FQL RN+  NP+VR++K  R  GVLEN EEG+KYAEH 
Sbjct  3    RWVKPEVYPLMAAMTFVTSLCAFQLTRNVFLNPDVRIDKARRGMGVLENKEEGEKYAEHG  62

Query  216  LRKFVRNKSPEIMPSLNRFFS  278
            LRKF+R + PEIMP++NRFFS
Sbjct  63   LRKFLRTRPPEIMPTINRFFS  83



>ref|XP_010099316.1| hypothetical protein L484_018178 [Morus notabilis]
 gb|EXB77662.1| hypothetical protein L484_018178 [Morus notabilis]
Length=87

 Score =   119 bits (298),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 63/81 (78%), Gaps = 0/81 (0%)
 Frame = +3

Query  36   RWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHS  215
            RWI+PEVYPL AAM     +C FQL RN+  NP+VR+NK  R+ GVLEN EEG+KYAEH 
Sbjct  3    RWIKPEVYPLMAAMTFVTSMCVFQLTRNMFLNPDVRINKAHRSMGVLENKEEGEKYAEHC  62

Query  216  LRKFVRNKSPEIMPSLNRFFS  278
            LRKF+R + PE+MPS+N FFS
Sbjct  63   LRKFLRTRPPEVMPSVNHFFS  83



>ref|XP_010260574.1| PREDICTED: uncharacterized protein LOC104599651 [Nelumbo nucifera]
Length=88

 Score =   119 bits (297),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = +3

Query  33   SRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEH  212
            +RW++PEVYPL AAM     +C FQL RN+  NP+VRVNKE R   VLEN EEG+KYAEH
Sbjct  2    ARWVKPEVYPLMAAMTFVASMCVFQLTRNVFMNPDVRVNKEHRQKAVLENAEEGEKYAEH  61

Query  213  SLRKFVRNKSPEIMPSLNRFFS  278
             LRKF+R + PE+MP++N FFS
Sbjct  62   GLRKFLRTRPPEVMPAINSFFS  83



>ref|XP_001776158.1| predicted protein [Physcomitrella patens]
 gb|EDQ59069.1| predicted protein [Physcomitrella patens]
Length=93

 Score =   119 bits (297),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 64/83 (77%), Gaps = 0/83 (0%)
 Frame = +3

Query  30   SSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAE  209
            S RWI+PE+YPLF A+G A+GICG+ + RN+  NP+VR+ KE RAAGVLENY+EG+ Y  
Sbjct  8    SKRWIKPEIYPLFFAIGAALGICGYAMARNLAINPDVRITKEDRAAGVLENYKEGEAYKM  67

Query  210  HSLRKFVRNKSPEIMPSLNRFFS  278
            H LR +VR + P+IMP  N +FS
Sbjct  68   HGLRAYVRQQEPQIMPGFNNYFS  90



>ref|XP_006856407.1| hypothetical protein AMTR_s00047p00213990 [Amborella trichopoda]
 gb|ERN17874.1| hypothetical protein AMTR_s00047p00213990 [Amborella trichopoda]
Length=87

 Score =   118 bits (296),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = +3

Query  36   RWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHS  215
            RWI+PEVYPL AAMG    +C FQL RN+  NP+VR+NK  R + VL+N EEG+KYAEHS
Sbjct  3    RWIKPEVYPLMAAMGFVTSLCIFQLTRNLLLNPDVRINKAHRTSAVLDNEEEGQKYAEHS  62

Query  216  LRKFVRNKSPEIMPSLNRFFSD  281
            LR F+R + PEIMP++N+ FS+
Sbjct  63   LRNFLRTRPPEIMPAINKIFSE  84



>ref|XP_003531875.1| PREDICTED: uncharacterized protein LOC100527287 [Glycine max]
 gb|ACU16358.1| unknown [Glycine max]
 gb|KHN30319.1| hypothetical protein glysoja_037830 [Glycine soja]
Length=86

 Score =   118 bits (296),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = +3

Query  36   RWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHS  215
            RW++PEVYPL AAM    G+C FQL RN+  NP+VR+NK  R+  VLEN EEG+KYAEH 
Sbjct  3    RWMKPEVYPLLAAMTFVTGMCVFQLTRNVLGNPDVRINKTRRSMAVLENREEGEKYAEHG  62

Query  216  LRKFVRNKSPEIMPSLNRFFSD  281
            LRKF+R + PEIMP++N FFS+
Sbjct  63   LRKFLRTRPPEIMPTINHFFSE  84



>ref|XP_008362218.1| PREDICTED: uncharacterized protein LOC103425898 [Malus domestica]
 ref|XP_009373788.1| PREDICTED: uncharacterized protein LOC103962745 [Pyrus x bretschneideri]
Length=86

 Score =   118 bits (296),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 52/82 (63%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = +3

Query  36   RWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHS  215
            RW+RPEVYPL AAM     +C FQL RN+  NPEVR+NK  R   VLEN EEG+KYAEH 
Sbjct  3    RWVRPEVYPLMAAMTFVTSLCAFQLTRNMFLNPEVRINKAHRRMAVLENEEEGEKYAEHG  62

Query  216  LRKFVRNKSPEIMPSLNRFFSD  281
            LRKF+R + PEIMP++N FFS 
Sbjct  63   LRKFLRTRPPEIMPTINHFFSQ  84



>ref|XP_011021065.1| PREDICTED: uncharacterized protein LOC105123251 [Populus euphratica]
Length=86

 Score =   118 bits (296),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = +3

Query  36   RWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHS  215
            RW++PEVYPL AAM     +C FQL RN+  NP+VR+NK  R  GVLEN EEG+KYAEH 
Sbjct  3    RWMKPEVYPLLAAMTCVTSLCIFQLTRNVFMNPDVRINKANRGMGVLENKEEGEKYAEHG  62

Query  216  LRKFVRNKSPEIMPSLNRFFSD  281
            LRKF+R + PEIMP++N FFS+
Sbjct  63   LRKFLRTRPPEIMPTVNHFFSE  84



>ref|XP_008664404.1| PREDICTED: uncharacterized protein LOC100383000 [Zea mays]
 gb|ACN31786.1| unknown [Zea mays]
Length=88

 Score =   118 bits (296),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 51/87 (59%), Positives = 70/87 (80%), Gaps = 0/87 (0%)
 Frame = +3

Query  30   SSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAE  209
            SSRW+R EVYPLFA  GVAVGIC  QL+RNITTNPEVRV KE RAAGVL+N++EG++Y++
Sbjct  2    SSRWVRAEVYPLFATTGVAVGICVMQLVRNITTNPEVRVTKEKRAAGVLDNHDEGRRYSQ  61

Query  210  HSLRKFVRNKSPEIMPSLNRFFSDPQR  290
            H +R+F  +K  + M ++++  +DP +
Sbjct  62   HGVRRFWLSKRRDYMQAMDKVPTDPNK  88



>dbj|BAK03592.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=89

 Score =   118 bits (296),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = +3

Query  33   SRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEH  212
            SRWIRPEVYPLFA  GVAVGIC  QL+RNI TNPEVRV KE RAAGVLEN++EGK+Y++H
Sbjct  3    SRWIRPEVYPLFATTGVAVGICVMQLVRNIMTNPEVRVTKENRAAGVLENHDEGKRYSQH  62

Query  213  SLRKFVRNKSPEIMPSLNRFFSDP  284
             +R+F  +K  + M +L+   +DP
Sbjct  63   GVRRFWLSKRRDYMQALDNVPTDP  86



>ref|XP_006373388.1| germination family protein [Populus trichocarpa]
 gb|ERP51185.1| germination family protein [Populus trichocarpa]
Length=86

 Score =   117 bits (294),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = +3

Query  36   RWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHS  215
            RW++PEVYPL AAM     +C FQL RN+  NP+VRVNK  R  GVLEN EEG++YAEH 
Sbjct  3    RWMKPEVYPLLAAMTCVTSLCIFQLTRNVFMNPDVRVNKANRGMGVLENKEEGERYAEHG  62

Query  216  LRKFVRNKSPEIMPSLNRFFSD  281
            LRKF+R + PEIMP++N FFS+
Sbjct  63   LRKFLRTRPPEIMPTVNHFFSE  84



>ref|XP_010029400.1| PREDICTED: uncharacterized protein LOC104419438 isoform X2 [Eucalyptus 
grandis]
Length=86

 Score =   117 bits (294),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 65/83 (78%), Gaps = 0/83 (0%)
 Frame = +3

Query  33   SRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEH  212
            +RW++PEVYPL AAM    G+C FQL RN+  NP+VR+NK  R  GVL+N EEG+KY++H
Sbjct  2    ARWVKPEVYPLMAAMTFVTGMCVFQLTRNVALNPDVRINKLNRRTGVLDNGEEGEKYSQH  61

Query  213  SLRKFVRNKSPEIMPSLNRFFSD  281
             LRKF+R + PEIMP++N FFS+
Sbjct  62   GLRKFLRTRPPEIMPAINHFFSE  84



>ref|XP_008379445.1| PREDICTED: uncharacterized protein LOC103442440 [Malus domestica]
 ref|XP_008348095.1| PREDICTED: uncharacterized protein LOC103411226 [Malus domestica]
Length=86

 Score =   117 bits (293),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 52/82 (63%), Positives = 60/82 (73%), Gaps = 0/82 (0%)
 Frame = +3

Query  36   RWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHS  215
            RW+RPEVYPL AAM     +C FQL RN+  NPEVR+NK  R   VLEN EEG+KYAEH 
Sbjct  3    RWVRPEVYPLMAAMTFVTSLCAFQLTRNMFLNPEVRINKAHRRMAVLENEEEGEKYAEHG  62

Query  216  LRKFVRNKSPEIMPSLNRFFSD  281
            LRKF+R + PEIMP+ N FFS 
Sbjct  63   LRKFLRTRPPEIMPTXNHFFSQ  84



>ref|NP_001059360.2| Os07g0274700 [Oryza sativa Japonica Group]
 dbj|BAF21274.2| Os07g0274700, partial [Oryza sativa Japonica Group]
Length=130

 Score =   118 bits (296),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = +3

Query  51   EVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFV  230
            EVYPLF A GVAV IC  QL+RNIT NPEVRV KE RAAGVLEN++EGK+Y++H  RKF+
Sbjct  50   EVYPLFLATGVAVSICVGQLVRNITGNPEVRVLKEKRAAGVLENFDEGKRYSQHGFRKFI  109

Query  231  RNKSPEIMPSLNRFFSDPQR  290
              K PEIMP +N FFSDP +
Sbjct  110  DGKRPEIMPGINSFFSDPPK  129



>ref|XP_002281305.1| PREDICTED: uncharacterized protein LOC100258293 [Vitis vinifera]
Length=89

 Score =   117 bits (293),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 67/87 (77%), Gaps = 0/87 (0%)
 Frame = +3

Query  33   SRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEH  212
             RW+ PEVYPL  AM +  G+  F L R++T NP+VR++KEGR   VL+N +EG++YAEH
Sbjct  2    GRWVIPEVYPLLGAMAIVGGMVVFSLGRHVTMNPDVRISKEGRKQAVLDNADEGERYAEH  61

Query  213  SLRKFVRNKSPEIMPSLNRFFSDPQRN  293
             LRKF+R ++PEI P LNRFFSDP+++
Sbjct  62   GLRKFLRTRTPEIFPKLNRFFSDPEKS  88



>ref|XP_010260461.1| PREDICTED: uncharacterized protein LOC104599559 [Nelumbo nucifera]
Length=89

 Score =   117 bits (292),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 64/88 (73%), Gaps = 0/88 (0%)
 Frame = +3

Query  24   MASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKY  203
            M    WI+P+VYPL AAM     +C FQL RN+  NP+VR+NK+ R   VLEN EEG+KY
Sbjct  1    MPRWSWIKPDVYPLVAAMTFVTSMCVFQLTRNVFLNPDVRINKDRRKMAVLENQEEGEKY  60

Query  204  AEHSLRKFVRNKSPEIMPSLNRFFSDPQ  287
            AEH LRKF+R + PEIMP++N FFS P+
Sbjct  61   AEHGLRKFLRTRPPEIMPTINHFFSKPE  88



>ref|XP_006658463.1| PREDICTED: uncharacterized protein LOC102702117 [Oryza brachyantha]
Length=86

 Score =   117 bits (292),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 67/85 (79%), Gaps = 3/85 (4%)
 Frame = +3

Query  30   SSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAE  209
            +SRWIRPEVYPLF   GVAVGIC  QL+RNITTNPEVRV KE RAAGVLEN++EGK+Y++
Sbjct  2    ASRWIRPEVYPLFVTTGVAVGICAMQLVRNITTNPEVRVTKEKRAAGVLENFDEGKRYSQ  61

Query  210  HSLRKFVRNKSPEIMPSLNRFFSDP  284
            H +R+F  +K  + M  L+   +DP
Sbjct  62   HGVRRFWLSKRRDYMHVLD---NDP  83



>dbj|BAJ88884.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=150

 Score =   118 bits (296),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 65/81 (80%), Gaps = 0/81 (0%)
 Frame = +3

Query  51   EVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFV  230
            + YP+FAA GVAVGIC  QL+RNITTNPEVRV KE RAAGVL+N++EG++YA H  R+F+
Sbjct  70   QAYPIFAATGVAVGICVMQLVRNITTNPEVRVTKENRAAGVLDNHDEGRRYARHPFRRFI  129

Query  231  RNKSPEIMPSLNRFFSDPQRN  293
              KS EIMP +N FF+ P +N
Sbjct  130  DGKSAEIMPGINNFFTAPPKN  150



>ref|XP_006340507.1| PREDICTED: uncharacterized protein LOC102592850 [Solanum tuberosum]
Length=125

 Score =   117 bits (294),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 65/83 (78%), Gaps = 10/83 (12%)
 Frame = +3

Query  36   RWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHS  215
            RW+RPEVYPLFAA+GVAVGICG Q +             E RAAGVL+N+ EG+KYAEH+
Sbjct  52   RWLRPEVYPLFAAVGVAVGICGMQYMHQ----------PENRAAGVLDNFSEGEKYAEHA  101

Query  216  LRKFVRNKSPEIMPSLNRFFSDP  284
            LRKFVRNKSPEIMPS+N FFSDP
Sbjct  102  LRKFVRNKSPEIMPSINGFFSDP  124



>ref|XP_004137261.1| PREDICTED: uncharacterized protein LOC101217963 [Cucumis sativus]
 ref|XP_004154766.1| PREDICTED: uncharacterized LOC101217963 [Cucumis sativus]
Length=87

 Score =   116 bits (291),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 64/85 (75%), Gaps = 0/85 (0%)
 Frame = +3

Query  36   RWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHS  215
            RW++PEVYPL AAMG    +C FQL RNI  NP+VRV K  R  GVL+N EEG+KY+EHS
Sbjct  3    RWMKPEVYPLLAAMGFVTTMCIFQLTRNILINPDVRVKKSHRRMGVLDNEEEGEKYSEHS  62

Query  216  LRKFVRNKSPEIMPSLNRFFSDPQR  290
            LR+F+R + PEIMP++N +FS   +
Sbjct  63   LRRFLRTRPPEIMPTINHYFSQDHK  87



>ref|XP_004304209.1| PREDICTED: uncharacterized protein LOC101313329 [Fragaria vesca 
subsp. vesca]
Length=89

 Score =   116 bits (291),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 63/86 (73%), Gaps = 0/86 (0%)
 Frame = +3

Query  36   RWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHS  215
            RWIRPEVYPL AAM     +C FQL RN+  NP+VRVNK  R   VL+N EEG++YAEH 
Sbjct  3    RWIRPEVYPLMAAMTFVTSLCVFQLTRNVILNPDVRVNKAHRRMAVLDNEEEGERYAEHG  62

Query  216  LRKFVRNKSPEIMPSLNRFFSDPQRN  293
            LRK++R + PE+MP++N FFS  Q +
Sbjct  63   LRKYLRTRRPEVMPTINHFFSHSQED  88



>gb|KJB22813.1| hypothetical protein B456_004G066900 [Gossypium raimondii]
Length=86

 Score =   116 bits (291),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 49/82 (60%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = +3

Query  36   RWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHS  215
            RW++PEVYPL  AM     +C FQL RN+  NP VR+NK  R+  VLENYEEG+KYAEH 
Sbjct  3    RWMKPEVYPLVGAMAFVTSMCIFQLTRNVFLNPAVRINKSDRSQAVLENYEEGEKYAEHG  62

Query  216  LRKFVRNKSPEIMPSLNRFFSD  281
            LRKF+R + PE+MP++N FFS+
Sbjct  63   LRKFLRTRPPEVMPAINHFFSE  84



>ref|XP_002459693.1| hypothetical protein SORBIDRAFT_02g008920 [Sorghum bicolor]
 gb|EER96214.1| hypothetical protein SORBIDRAFT_02g008920 [Sorghum bicolor]
Length=96

 Score =   117 bits (292),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = +3

Query  24   MASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKY  203
            M+SSRW+RPEVYPLFA  GVAVGIC  QL+RNIT NPEVRV KE RAAGVL+N++EG++Y
Sbjct  1    MSSSRWVRPEVYPLFATTGVAVGICVMQLVRNITGNPEVRVTKENRAAGVLDNHDEGRRY  60

Query  204  AEHSLRKFVRNKSPEIMPSLNRFFSD  281
            ++H +R+F  ++  + M +++   +D
Sbjct  61   SQHGVRRFWLSQRRDYMQAMDNVPTD  86



>ref|XP_007032847.1| B12D protein [Theobroma cacao]
 gb|EOY03773.1| B12D protein [Theobroma cacao]
Length=86

 Score =   116 bits (290),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 49/82 (60%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = +3

Query  36   RWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHS  215
            RW++PEVYPL  AM     +C FQL RN+  NP VR+NK  R+  VLENYEEG+KYAEH 
Sbjct  3    RWMKPEVYPLLGAMTFVTSMCIFQLTRNVFLNPAVRINKADRSKAVLENYEEGEKYAEHG  62

Query  216  LRKFVRNKSPEIMPSLNRFFSD  281
            LRKF+R + PE+MP++N FFS+
Sbjct  63   LRKFLRTRPPEVMPAINHFFSE  84



>ref|XP_006482419.1| PREDICTED: uncharacterized protein LOC102612079 [Citrus sinensis]
 gb|KDO72280.1| hypothetical protein CISIN_1g048115mg [Citrus sinensis]
Length=94

 Score =   116 bits (290),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 64/81 (79%), Gaps = 0/81 (0%)
 Frame = +3

Query  36   RWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHS  215
            RW+RPEVYPL AAM     +C FQL RN+  NP+VR+NK  R+ GVLEN EEG+KYAEH 
Sbjct  3    RWMRPEVYPLMAAMTFVASMCVFQLTRNVLLNPDVRINKGRRSMGVLENEEEGEKYAEHG  62

Query  216  LRKFVRNKSPEIMPSLNRFFS  278
            LR+F+R + P++MP++NRFF+
Sbjct  63   LRRFLRTRPPQVMPAINRFFT  83



>ref|XP_004955938.1| PREDICTED: uncharacterized protein LOC101784102 [Setaria italica]
Length=91

 Score =   115 bits (289),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 49/85 (58%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = +3

Query  30   SSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAE  209
            SSRW++ EVYPLFA  GVAVGIC  QL+RNITTNPEVRV K+ RAAGVL+N++EG++Y++
Sbjct  2    SSRWLKAEVYPLFATTGVAVGICVMQLVRNITTNPEVRVTKQNRAAGVLDNHDEGRRYSQ  61

Query  210  HSLRKFVRNKSPEIMPSLNRFFSDP  284
            H +R+F  +K  + M ++++  +DP
Sbjct  62   HGVRRFWLSKRRDYMQAMDKVPTDP  86



>ref|XP_002531002.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF31390.1| conserved hypothetical protein [Ricinus communis]
Length=86

 Score =   115 bits (289),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 50/83 (60%), Positives = 62/83 (75%), Gaps = 0/83 (0%)
 Frame = +3

Query  33   SRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEH  212
            +RWI+PEVYPL AAM     +C FQL RN+  NP+VR+NK  R   VLEN  EG++YAEH
Sbjct  2    ARWIKPEVYPLMAAMTFVTSLCAFQLTRNMFLNPDVRINKAHRRTAVLENEVEGEQYAEH  61

Query  213  SLRKFVRNKSPEIMPSLNRFFSD  281
             LRKF+R + PEIMPS+N FFS+
Sbjct  62   GLRKFLRTRPPEIMPSINHFFSE  84



>gb|KCW56312.1| hypothetical protein EUGRSUZ_I02053 [Eucalyptus grandis]
Length=234

 Score =   120 bits (300),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 67/87 (77%), Gaps = 0/87 (0%)
 Frame = +3

Query  21   SMASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKK  200
            + A +RW++PEVYPL AAM    G+C FQL RN+  NP+VR+NK  R  GVL+N EEG+K
Sbjct  146  TFAMARWVKPEVYPLMAAMTFVTGMCVFQLTRNVALNPDVRINKLNRRTGVLDNGEEGEK  205

Query  201  YAEHSLRKFVRNKSPEIMPSLNRFFSD  281
            Y++H LRKF+R + PEIMP++N FFS+
Sbjct  206  YSQHGLRKFLRTRPPEIMPAINHFFSE  232



>ref|XP_010034410.1| PREDICTED: uncharacterized protein LOC104423644 [Eucalyptus grandis]
 gb|KCW51947.1| hypothetical protein EUGRSUZ_J01394 [Eucalyptus grandis]
Length=88

 Score =   115 bits (288),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 61/81 (75%), Gaps = 0/81 (0%)
 Frame = +3

Query  36   RWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHS  215
            RW++P+VYPL AAM     +C FQL RN+  NP+VR+NK  R   VL+N EEG+KYAEH 
Sbjct  3    RWVKPDVYPLMAAMTFVTSLCIFQLTRNVLLNPDVRINKAHRGMAVLDNAEEGRKYAEHG  62

Query  216  LRKFVRNKSPEIMPSLNRFFS  278
            LRKF+R + PE+MP++N FFS
Sbjct  63   LRKFLRTRPPEVMPTINHFFS  83



>ref|XP_007139429.1| hypothetical protein PHAVU_008G028700g [Phaseolus vulgaris]
 gb|ESW11423.1| hypothetical protein PHAVU_008G028700g [Phaseolus vulgaris]
Length=115

 Score =   116 bits (290),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 50/81 (62%), Positives = 62/81 (77%), Gaps = 0/81 (0%)
 Frame = +3

Query  36   RWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHS  215
            RW++PEVYPL AAM     +C FQL RN+  NP+VRVNK  R+  VL+N EEG+KYAEH 
Sbjct  32   RWMKPEVYPLLAAMTFVTSMCVFQLTRNLLGNPDVRVNKTRRSMAVLDNREEGEKYAEHG  91

Query  216  LRKFVRNKSPEIMPSLNRFFS  278
            LRKF+R + PEIMP++N FFS
Sbjct  92   LRKFLRTRPPEIMPTINHFFS  112



>ref|XP_004491894.1| PREDICTED: uncharacterized protein LOC101510215 [Cicer arietinum]
Length=86

 Score =   115 bits (287),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = +3

Query  36   RWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHS  215
            RW++PEVYPL AAM     +C FQL RNI  NP+VR++K  R  GV +N EEG+KYAEH 
Sbjct  3    RWMKPEVYPLLAAMTFVTSMCIFQLTRNILGNPDVRISKSRRTKGVFDNKEEGEKYAEHG  62

Query  216  LRKFVRNKSPEIMPSLNRFFSD  281
            LRKF+R + PEIMPS+N FFS+
Sbjct  63   LRKFLRTRPPEIMPSINHFFSE  84



>ref|XP_003561264.1| PREDICTED: uncharacterized protein LOC100824762 [Brachypodium 
distachyon]
Length=87

 Score =   114 bits (286),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 67/84 (80%), Gaps = 3/84 (4%)
 Frame = +3

Query  33   SRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEH  212
            SRWIRPEVYPLF   GVAVGIC  QL+RNITTNPEVRV K+ RAAGVLEN++EGK+Y++H
Sbjct  3    SRWIRPEVYPLFVTTGVAVGICAMQLVRNITTNPEVRVTKQNRAAGVLENHDEGKRYSQH  62

Query  213  SLRKFVRNKSPEIMPSLNRFFSDP  284
             +R+F  ++  + M +L+   +DP
Sbjct  63   GVRRFWLSQRRDYMQALD---NDP  83



>ref|XP_009419068.1| PREDICTED: uncharacterized protein LOC103999135 [Musa acuminata 
subsp. malaccensis]
Length=87

 Score =   114 bits (285),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 62/81 (77%), Gaps = 0/81 (0%)
 Frame = +3

Query  36   RWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHS  215
            RW+RPEV+PL AAM     +C FQL RN+  NP+VR+NK  R   VLEN EEG+KY++HS
Sbjct  3    RWVRPEVFPLMAAMTFVTSMCVFQLTRNMLMNPDVRINKTNRTTAVLENAEEGEKYSQHS  62

Query  216  LRKFVRNKSPEIMPSLNRFFS  278
            LR+F+ ++ PE+ P+LNRFFS
Sbjct  63   LRRFLSHRPPEVFPALNRFFS  83



>ref|XP_010514670.1| PREDICTED: uncharacterized protein LOC104790592 [Camelina sativa]
Length=87

 Score =   114 bits (284),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = +3

Query  36   RWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHS  215
            RW+RPEVYPL  AMG    +  FQL RN   NP+ R+NK  R  G+LEN +EG+KYA+H+
Sbjct  3    RWVRPEVYPLLGAMGFVTSMVVFQLTRNALFNPDCRINKAHRKMGILENEDEGEKYAQHN  62

Query  216  LRKFVRNKSPEIMPSLNRFFSD  281
            LRK++R + P++MPSLNRFFSD
Sbjct  63   LRKYLRTRPPQVMPSLNRFFSD  84



>ref|NP_001060222.2| Os07g0604600 [Oryza sativa Japonica Group]
 dbj|BAF22136.2| Os07g0604600, partial [Oryza sativa Japonica Group]
Length=127

 Score =   114 bits (286),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 65/89 (73%), Gaps = 0/89 (0%)
 Frame = +3

Query  18   SSMASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGK  197
            +S+   RW++P+VYPL AAM    G+C FQL RN+  NP+VRVNK  R + VLEN EEG+
Sbjct  29   ASIDMGRWLKPDVYPLIAAMTFVTGLCTFQLTRNVFMNPDVRVNKNNRKSAVLENAEEGE  88

Query  198  KYAEHSLRKFVRNKSPEIMPSLNRFFSDP  284
            KY +H+ R+F+  + PE+ P+LNRFF+ P
Sbjct  89   KYHQHAFRRFLATQRPEVFPALNRFFAGP  117



>ref|XP_003552604.1| PREDICTED: uncharacterized protein LOC100785946 [Glycine max]
 gb|KHN37934.1| hypothetical protein glysoja_042363 [Glycine soja]
Length=86

 Score =   113 bits (282),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 49/82 (60%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = +3

Query  36   RWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHS  215
            RW++PEVYPL AAM     +C FQL RN+  NP+VR+NK  R+  VL+N EEG+KYAEH 
Sbjct  3    RWMKPEVYPLLAAMTFVSSMCVFQLTRNMLGNPDVRINKTRRSMPVLDNREEGEKYAEHG  62

Query  216  LRKFVRNKSPEIMPSLNRFFSD  281
            LRKF+R + PEIMP++N FFS+
Sbjct  63   LRKFLRTRPPEIMPTINHFFSE  84



>ref|XP_009151762.1| PREDICTED: uncharacterized protein LOC103875065 [Brassica rapa]
 emb|CDX86357.1| BnaA06g30740D [Brassica napus]
Length=87

 Score =   113 bits (282),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 47/82 (57%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = +3

Query  36   RWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHS  215
            RW+RPEVYPL  AMG    +  FQL RN   NP+ R++KE R  G+LEN +EG+KYA+H+
Sbjct  3    RWVRPEVYPLLGAMGFVTSMVVFQLTRNALLNPDCRISKENRKMGILENEDEGEKYAQHN  62

Query  216  LRKFVRNKSPEIMPSLNRFFSD  281
            LRK++R + P++MPSLNRFFS+
Sbjct  63   LRKYLRTRPPQVMPSLNRFFSE  84



>gb|KDP24288.1| hypothetical protein JCGZ_25584 [Jatropha curcas]
Length=86

 Score =   113 bits (282),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 61/81 (75%), Gaps = 0/81 (0%)
 Frame = +3

Query  36   RWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHS  215
            RW++PEVYPL AAM     +C FQL RN+  NP+VR+NK  R   VLEN +EG+KYAEH 
Sbjct  3    RWMKPEVYPLLAAMTFVTSMCVFQLTRNVFLNPDVRINKAHRRMAVLENEDEGEKYAEHG  62

Query  216  LRKFVRNKSPEIMPSLNRFFS  278
            LRKF+R + PE+MP++N FFS
Sbjct  63   LRKFLRTRPPEVMPAINHFFS  83



>gb|AFK43764.1| unknown [Medicago truncatula]
 gb|KEH21758.1| NADH-ubiquinone reductase complex 1 MLRQ subunit [Medicago truncatula]
Length=86

 Score =   113 bits (282),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = +3

Query  36   RWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHS  215
            RW++PEVYPL AAM     +C FQL RN+  NP+VR++K GR  GV +N EEG+KYA+H 
Sbjct  3    RWMKPEVYPLLAAMTFVTSMCVFQLTRNLLQNPDVRISKNGRTKGVFDNKEEGEKYAKHG  62

Query  216  LRKFVRNKSPEIMPSLNRFFSD  281
            LR F+R + PE+MP++N FFS+
Sbjct  63   LRNFLRTRPPEVMPTINHFFSE  84



>ref|NP_189632.1| B12D protein [Arabidopsis thaliana]
 dbj|BAB02998.1| unnamed protein product [Arabidopsis thaliana]
 gb|AEE77618.1| B12D protein [Arabidopsis thaliana]
Length=87

 Score =   113 bits (282),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 61/81 (75%), Gaps = 0/81 (0%)
 Frame = +3

Query  36   RWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHS  215
            RW+RPEVYPL  AMG    +  FQL RN   NP+ R+NKE R  G+LEN +EG+KYA+H+
Sbjct  3    RWVRPEVYPLLGAMGFVTSMVVFQLTRNAFLNPDCRINKEHRKMGILENKDEGEKYAQHN  62

Query  216  LRKFVRNKSPEIMPSLNRFFS  278
             RK++R + P++MPSLNRFFS
Sbjct  63   FRKYLRTRQPQVMPSLNRFFS  83



>ref|XP_002875526.1| hypothetical protein ARALYDRAFT_323026 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51785.1| hypothetical protein ARALYDRAFT_323026 [Arabidopsis lyrata subsp. 
lyrata]
Length=87

 Score =   112 bits (281),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 61/81 (75%), Gaps = 0/81 (0%)
 Frame = +3

Query  36   RWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHS  215
            RW+RPEVYPL  AMG    +  FQL RN   NP+ R+NKE R  G+LEN +EG+KYA+H+
Sbjct  3    RWVRPEVYPLLGAMGFVTTMVVFQLTRNALLNPDCRINKEHRKMGILENEDEGEKYAQHN  62

Query  216  LRKFVRNKSPEIMPSLNRFFS  278
             RK++R + P++MPSLNRFFS
Sbjct  63   FRKYLRTRQPQVMPSLNRFFS  83



>ref|XP_010502994.1| PREDICTED: uncharacterized protein LOC104780196 [Camelina sativa]
Length=87

 Score =   112 bits (281),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = +3

Query  36   RWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHS  215
            RW+RPEVYPL  AMG    +  FQL RN   NP+ R+NK  R  G+LEN EEG+KYA+H+
Sbjct  3    RWVRPEVYPLLGAMGFVTSMVVFQLTRNALFNPDCRINKAHRKMGILENEEEGEKYAQHN  62

Query  216  LRKFVRNKSPEIMPSLNRFFSD  281
            LRK++R + P++MPSLNRFFS+
Sbjct  63   LRKYLRTRPPQVMPSLNRFFSE  84



>ref|XP_010553961.1| PREDICTED: uncharacterized protein LOC104823885 [Tarenaya hassleriana]
Length=87

 Score =   112 bits (281),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 62/81 (77%), Gaps = 0/81 (0%)
 Frame = +3

Query  36   RWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHS  215
            RWIRPEVYPL  AMG    +  FQL RN   NP+ R+NK  R +GVLEN EEG+KYA+HS
Sbjct  3    RWIRPEVYPLLGAMGFVTSMVVFQLTRNAMLNPDCRINKGNRKSGVLENEEEGEKYAQHS  62

Query  216  LRKFVRNKSPEIMPSLNRFFS  278
            LR+F+R ++P++MP++N FFS
Sbjct  63   LRRFLRTRAPQVMPAINNFFS  83



>ref|XP_002305391.1| germination family protein [Populus trichocarpa]
 gb|EEE85902.1| germination family protein [Populus trichocarpa]
Length=86

 Score =   112 bits (280),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 47/82 (57%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = +3

Query  36   RWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHS  215
            RW++PEVYPL AAM     +C FQL RN+  NP+VR+NK  R+ GVL N EEG++YAEH 
Sbjct  3    RWMKPEVYPLLAAMTCVTSLCIFQLTRNVFLNPDVRINKAKRSMGVLGNNEEGERYAEHG  62

Query  216  LRKFVRNKSPEIMPSLNRFFSD  281
            LR+F+R + PEIMP++N FF++
Sbjct  63   LRRFLRTRPPEIMPTINHFFTE  84



>dbj|BAC83875.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAG88459.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC82410.1| hypothetical protein OsI_26790 [Oryza sativa Indica Group]
 gb|EEE67550.1| hypothetical protein OsJ_25042 [Oryza sativa Japonica Group]
Length=95

 Score =   112 bits (281),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 46/83 (55%), Positives = 62/83 (75%), Gaps = 0/83 (0%)
 Frame = +3

Query  36   RWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHS  215
            RW++P+VYPL AAM    G+C FQL RN+  NP+VRVNK  R + VLEN EEG+KY +H+
Sbjct  3    RWLKPDVYPLIAAMTFVTGLCTFQLTRNVFMNPDVRVNKNNRKSAVLENAEEGEKYHQHA  62

Query  216  LRKFVRNKSPEIMPSLNRFFSDP  284
             R+F+  + PE+ P+LNRFF+ P
Sbjct  63   FRRFLATQRPEVFPALNRFFAGP  85



>ref|XP_010034411.1| PREDICTED: uncharacterized protein LOC104423646 [Eucalyptus grandis]
 gb|KCW51953.1| hypothetical protein EUGRSUZ_J01397 [Eucalyptus grandis]
Length=88

 Score =   112 bits (280),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 59/81 (73%), Gaps = 0/81 (0%)
 Frame = +3

Query  36   RWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHS  215
            RW++P+VYPL AAM     +C FQL RN   NP+VRVNK  R   VL+  EEG+KYAEH 
Sbjct  3    RWVKPDVYPLMAAMTFVTSLCIFQLTRNALLNPDVRVNKAHRGMAVLDTAEEGRKYAEHG  62

Query  216  LRKFVRNKSPEIMPSLNRFFS  278
            LRKF+R + PE+MP++N FFS
Sbjct  63   LRKFLRTRPPEVMPTINHFFS  83



>ref|XP_006395262.1| hypothetical protein EUTSA_v10005671mg [Eutrema salsugineum]
 gb|ESQ32548.1| hypothetical protein EUTSA_v10005671mg [Eutrema salsugineum]
Length=87

 Score =   112 bits (279),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 61/81 (75%), Gaps = 0/81 (0%)
 Frame = +3

Query  36   RWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHS  215
            RW+RPE+YPL  AMG    +  FQL RN   NP+ R+NK  R  G+LEN +EG+KYA+H+
Sbjct  3    RWVRPEMYPLLGAMGFVTSMVVFQLTRNALLNPDCRINKANRKMGILENEDEGEKYAQHN  62

Query  216  LRKFVRNKSPEIMPSLNRFFS  278
            LRK++R + P++MPSLNRFFS
Sbjct  63   LRKYLRTRQPQVMPSLNRFFS  83



>ref|XP_006430939.1| hypothetical protein CICLE_v10013823mg [Citrus clementina]
 gb|ESR44179.1| hypothetical protein CICLE_v10013823mg [Citrus clementina]
Length=94

 Score =   112 bits (280),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 63/81 (78%), Gaps = 0/81 (0%)
 Frame = +3

Query  36   RWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHS  215
            R +RPEVYPL AAM     +C FQL RN+  NP+VR+NK  R+ GVLEN EEG+KYAEH 
Sbjct  3    RGMRPEVYPLMAAMTFVASMCVFQLTRNVLLNPDVRINKGRRSMGVLENEEEGEKYAEHG  62

Query  216  LRKFVRNKSPEIMPSLNRFFS  278
            LR+F+R + P++MP++NRFFS
Sbjct  63   LRRFLRTRPPQVMPAINRFFS  83



>gb|AFK44347.1| unknown [Lotus japonicus]
Length=87

 Score =   112 bits (279),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 65/83 (78%), Gaps = 1/83 (1%)
 Frame = +3

Query  36   RWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVL-ENYEEGKKYAEH  212
            RW++PEVYPL AAM    G+C FQL RN+  NP+VR++K  R+ GVL +N EEG++YAEH
Sbjct  3    RWMKPEVYPLLAAMTFVTGMCVFQLTRNLLGNPDVRISKARRSMGVLFDNKEEGERYAEH  62

Query  213  SLRKFVRNKSPEIMPSLNRFFSD  281
             LRKF+R + PEIMP++N FFS+
Sbjct  63   GLRKFLRTRQPEIMPTINHFFSE  85



>ref|XP_011008605.1| PREDICTED: uncharacterized protein LOC105113935 [Populus euphratica]
 ref|XP_011014073.1| PREDICTED: uncharacterized protein LOC105117942 [Populus euphratica]
Length=86

 Score =   111 bits (277),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = +3

Query  36   RWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHS  215
            RW++PEVYPL AAM     +C FQL RN+  NP+VR+NK  R+ GVL N EEG++YA+H 
Sbjct  3    RWMKPEVYPLLAAMTCVTSLCIFQLTRNVFLNPDVRINKAKRSMGVLGNNEEGERYADHG  62

Query  216  LRKFVRNKSPEIMPSLNRFFSD  281
            LR+F+R + PEIMP++N FF++
Sbjct  63   LRRFLRTRPPEIMPAINHFFTE  84



>ref|XP_003562728.1| PREDICTED: uncharacterized protein LOC100837236 [Brachypodium 
distachyon]
Length=88

 Score =   111 bits (277),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = +3

Query  36   RWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHS  215
            RW++P+VYPL  AM +  G+C FQL+RN+  NP+VR++K  R + VLEN EEG+KY++H+
Sbjct  3    RWLKPDVYPLIGAMSLVTGMCAFQLVRNVLLNPDVRISKSNRQSAVLENAEEGEKYSQHA  62

Query  216  LRKFVRNKSPEIMPSLNRFFSD  281
             R+FV    PE+ P++NRFFS+
Sbjct  63   FRRFVSAHRPEVFPAINRFFSE  84



>ref|XP_004958246.1| PREDICTED: uncharacterized protein LOC101775472 [Setaria italica]
Length=91

 Score =   109 bits (272),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = +3

Query  36   RWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHS  215
            RW++P+VYPL AAM    G+C FQL RN+  NP+VRV+K  R + VL+N +EG++Y++H+
Sbjct  3    RWLKPDVYPLIAAMSFVTGMCVFQLTRNVFMNPDVRVSKASRQSAVLDNADEGQRYSQHA  62

Query  216  LRKFVRNKSPEIMPSLNRFFSD  281
             R+F+  + PE+ P+LNRFFS+
Sbjct  63   FRRFLATQRPEVFPALNRFFSE  84



>ref|XP_006657932.1| PREDICTED: uncharacterized protein LOC102705450 [Oryza brachyantha]
Length=95

 Score =   108 bits (270),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 61/83 (73%), Gaps = 0/83 (0%)
 Frame = +3

Query  36   RWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHS  215
            RW++P+VYPL AAM    G+C FQL RN+  NP+VRVNK  R + VLEN  EG++Y++H+
Sbjct  3    RWLKPDVYPLIAAMSFVTGLCTFQLTRNVFMNPDVRVNKNNRQSAVLENATEGERYSQHA  62

Query  216  LRKFVRNKSPEIMPSLNRFFSDP  284
             R+F+  + PE+ P+ NRFF+ P
Sbjct  63   FRRFLATQRPEVFPAANRFFAGP  85



>ref|XP_008651396.1| PREDICTED: B12D protein isoform X1 [Zea mays]
 gb|ACG30695.1| B12D protein [Zea mays]
 tpg|DAA63527.1| TPA: b12D protein [Zea mays]
Length=94

 Score =   107 bits (268),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 44/90 (49%), Positives = 63/90 (70%), Gaps = 0/90 (0%)
 Frame = +3

Query  36   RWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHS  215
            RW++P+VYPL AAM    G+C FQL RN+  NP+VRV+K  R + VL+N  EG++Y++H+
Sbjct  3    RWLKPDVYPLIAAMSFVTGMCVFQLARNVLMNPDVRVSKTSRQSAVLDNAGEGQRYSQHA  62

Query  216  LRKFVRNKSPEIMPSLNRFFSDPQRN*LPG  305
             R+F+  + PE+ P+LN FFSD   N  P 
Sbjct  63   FRRFLATQRPEVFPALNSFFSDSNNNNTPA  92



>ref|XP_008810952.1| PREDICTED: uncharacterized protein LOC103722254 [Phoenix dactylifera]
Length=87

 Score =   106 bits (265),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 61/85 (72%), Gaps = 0/85 (0%)
 Frame = +3

Query  36   RWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHS  215
            RW+RPEVYPL AAM    G+C FQL RN+  NP+VR+NK  RA+ +L+N EEG+KY++HS
Sbjct  3    RWVRPEVYPLMAAMAFVTGMCAFQLTRNMILNPDVRINKARRASAILDNAEEGEKYSQHS  62

Query  216  LRKFVRNKSPEIMPSLNRFFSDPQR  290
             RKF+  +   +MP+L+   +D  +
Sbjct  63   FRKFLYRQRSAVMPALDGLSTDSDK  87



>ref|XP_009406306.1| PREDICTED: uncharacterized protein LOC103989230 [Musa acuminata 
subsp. malaccensis]
Length=89

 Score =   106 bits (265),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 62/86 (72%), Gaps = 0/86 (0%)
 Frame = +3

Query  36   RWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHS  215
            RW++PEVYPL AAM     +C FQL RN+  NP+VR+NK  R   VLEN +E ++Y++H 
Sbjct  3    RWVKPEVYPLMAAMTFVTSLCLFQLTRNMFLNPDVRINKSHRTTPVLENADEAQRYSQHG  62

Query  216  LRKFVRNKSPEIMPSLNRFFSDPQRN  293
            LR+F+  + PEIMP++N FFS  +R+
Sbjct  63   LRRFLSRRPPEIMPTINTFFSGIKRD  88



>ref|NP_001060223.1| Os07g0604700 [Oryza sativa Japonica Group]
 dbj|BAC83876.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAF22137.1| Os07g0604700 [Oryza sativa Japonica Group]
 gb|EAZ04641.1| hypothetical protein OsI_26791 [Oryza sativa Indica Group]
 gb|EAZ40584.1| hypothetical protein OsJ_25043 [Oryza sativa Japonica Group]
 dbj|BAH01133.1| unnamed protein product [Oryza sativa Japonica Group]
Length=95

 Score =   106 bits (264),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 61/83 (73%), Gaps = 0/83 (0%)
 Frame = +3

Query  36   RWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHS  215
            RW++P+VYPL  AM +  G+C FQL RN+  NP+VRVNK  R + VLEN +EG+KY  H+
Sbjct  3    RWVKPDVYPLIVAMSLVGGMCVFQLTRNVFMNPDVRVNKSHRQSAVLENADEGEKYHHHA  62

Query  216  LRKFVRNKSPEIMPSLNRFFSDP  284
             R+F+  + PE+ P++NRFF+ P
Sbjct  63   FRRFLGTQRPEVFPAINRFFAGP  85



>ref|XP_010029399.1| PREDICTED: uncharacterized protein LOC104419438 isoform X1 [Eucalyptus 
grandis]
Length=90

 Score =   105 bits (262),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 62/88 (70%), Gaps = 0/88 (0%)
 Frame = +3

Query  24   MASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKY  203
            + S   I   VYPL AAM    G+C FQL RN+  NP+VR+NK  R  GVL+N EEG+KY
Sbjct  3    LISFCLIEETVYPLMAAMTFVTGMCVFQLTRNVALNPDVRINKLNRRTGVLDNGEEGEKY  62

Query  204  AEHSLRKFVRNKSPEIMPSLNRFFSDPQ  287
            ++H LRKF+R + PEIMP++N FFS+ +
Sbjct  63   SQHGLRKFLRTRPPEIMPAINHFFSEDK  90



>gb|AAR13310.1| B12D-like protein [Phaseolus vulgaris]
Length=128

 Score =   106 bits (265),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/97 (52%), Positives = 63/97 (65%), Gaps = 13/97 (13%)
 Frame = +3

Query  36   RWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEV-------------RVNKEGRAAGVL  176
            RW++PEVYPL AAM     +C FQL RN+  NP+V             RVNK  R+  VL
Sbjct  32   RWMKPEVYPLLAAMTFVTSMCVFQLTRNLLGNPDVSILVINFWSENWYRVNKTRRSMAVL  91

Query  177  ENYEEGKKYAEHSLRKFVRNKSPEIMPSLNRFFSDPQ  287
            +N EEG+KYAEH LRKF+R + PEIMP++N FFS  +
Sbjct  92   DNREEGEKYAEHGLRKFLRTRPPEIMPTINHFFSQDK  128



>ref|XP_006658786.1| PREDICTED: uncharacterized protein LOC102700818 [Oryza brachyantha]
Length=100

 Score =   105 bits (261),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 62/83 (75%), Gaps = 0/83 (0%)
 Frame = +3

Query  36   RWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHS  215
            RW++P+VYPL AAM +  G+C F L RN+  NP+VRVNK  R + V EN EEG+KY++H+
Sbjct  3    RWVKPDVYPLIAAMSLVGGMCVFSLTRNVFMNPDVRVNKNNRQSAVPENAEEGEKYSQHA  62

Query  216  LRKFVRNKSPEIMPSLNRFFSDP  284
             R+F+  + PE+ P++NRFF+ P
Sbjct  63   FRRFLGTQRPEVFPAINRFFAGP  85



>ref|XP_002978639.1| hypothetical protein SELMODRAFT_152721 [Selaginella moellendorffii]
 ref|XP_002984577.1| hypothetical protein SELMODRAFT_181102 [Selaginella moellendorffii]
 gb|EFJ14222.1| hypothetical protein SELMODRAFT_181102 [Selaginella moellendorffii]
 gb|EFJ20086.1| hypothetical protein SELMODRAFT_152721 [Selaginella moellendorffii]
Length=95

 Score =   104 bits (260),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 62/83 (75%), Gaps = 0/83 (0%)
 Frame = +3

Query  30   SSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAE  209
             SRW++PEV PL   +G A+G+  F  +RN+  NPEVR+NKE R+AG+++NY+EG +Y E
Sbjct  10   GSRWLKPEVIPLIGFIGAAMGLASFMCVRNLMLNPEVRINKEDRSAGLVQNYKEGYEYHE  69

Query  210  HSLRKFVRNKSPEIMPSLNRFFS  278
            H LR ++RN+  EIMP +N +F+
Sbjct  70   HGLRHYMRNRKSEIMPRINEYFT  92



>gb|EPS63516.1| hypothetical protein M569_11268, partial [Genlisea aurea]
Length=86

 Score =   103 bits (256),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 59/81 (73%), Gaps = 0/81 (0%)
 Frame = +3

Query  36   RWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHS  215
            RW++PEVYPL AAM    G+   QL RN+  NP VR+ K  R + +++N E+G KY EH+
Sbjct  3    RWMKPEVYPLLAAMTCVCGMVVLQLTRNVMHNPAVRLKKSERGSAIVDNEEKGMKYTEHA  62

Query  216  LRKFVRNKSPEIMPSLNRFFS  278
            LRKF+R + PEIMP++NRFF+
Sbjct  63   LRKFLRTRPPEIMPAVNRFFA  83



>ref|XP_001757013.1| predicted protein [Physcomitrella patens]
 gb|EDQ78244.1| predicted protein [Physcomitrella patens]
Length=94

 Score =   101 bits (251),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 59/81 (73%), Gaps = 0/81 (0%)
 Frame = +3

Query  36   RWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHS  215
            +WI+PE+YPLF A+  A+ + GF + R+I  NP+VR++K+ R AGVLENY+EG+ Y  H 
Sbjct  10   QWIKPEIYPLFLAVATALSMGGFVMARSIAVNPDVRISKQDREAGVLENYKEGEVYKNHR  69

Query  216  LRKFVRNKSPEIMPSLNRFFS  278
            LR +     P+IMPSLN +FS
Sbjct  70   LRHYALKHGPQIMPSLNNYFS  90



>ref|XP_010937886.1| PREDICTED: uncharacterized protein LOC105057112 [Elaeis guineensis]
Length=87

 Score =   100 bits (250),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 59/85 (69%), Gaps = 0/85 (0%)
 Frame = +3

Query  36   RWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHS  215
            RW++PEVYPL AAM +  G+C FQL RN+  NP+VR+NK  R+  +L+N EEG+ Y++HS
Sbjct  3    RWVKPEVYPLMAAMTLVTGMCVFQLTRNMILNPDVRINKTRRSTAILDNAEEGEMYSQHS  62

Query  216  LRKFVRNKSPEIMPSLNRFFSDPQR  290
             RKF+    P ++PS +   +D  +
Sbjct  63   FRKFLYRLRPSVLPSFDGLSTDSDK  87



>gb|KEH35272.1| NADH-ubiquinone reductase complex 1 MLRQ subunit [Medicago truncatula]
Length=62

 Score = 99.0 bits (245),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +3

Query  105  QLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMPSLNRFFSDP  284
            QL+RNITTNPEVRV K+ RAAG+L+N++EG+KY++H +R+FVR KS EIMPSLN FFSDP
Sbjct  2    QLVRNITTNPEVRVTKQNRAAGILDNHDEGEKYSQHFIRRFVRGKSTEIMPSLNGFFSDP  61

Query  285  Q  287
            +
Sbjct  62   K  62



>ref|NP_001147337.1| B12D protein [Zea mays]
 gb|ACG26928.1| B12D protein [Zea mays]
Length=88

 Score = 97.8 bits (242),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 58/85 (68%), Gaps = 0/85 (0%)
 Frame = +3

Query  51   EVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFV  230
            +VYPL AAM    G+C FQL RN+  NP+VRV+K  R + VL+N  EG++Y++H+ R+F+
Sbjct  2    QVYPLIAAMSFVTGMCVFQLARNVLMNPDVRVSKTSRQSAVLDNAGEGQRYSQHAFRRFL  61

Query  231  RNKSPEIMPSLNRFFSDPQRN*LPG  305
              + PE+ P+LN FFSD   N  P 
Sbjct  62   ATQRPEVFPALNSFFSDSNNNNTPA  86



>tpg|DAA63528.1| TPA: b12D protein [Zea mays]
Length=125

 Score = 97.8 bits (242),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 58/85 (68%), Gaps = 0/85 (0%)
 Frame = +3

Query  51   EVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFV  230
            +VYPL AAM    G+C FQL RN+  NP+VRV+K  R + VL+N  EG++Y++H+ R+F+
Sbjct  39   QVYPLIAAMSFVTGMCVFQLARNVLMNPDVRVSKTSRQSAVLDNAGEGQRYSQHAFRRFL  98

Query  231  RNKSPEIMPSLNRFFSDPQRN*LPG  305
              + PE+ P+LN FFSD   N  P 
Sbjct  99   ATQRPEVFPALNSFFSDSNNNNTPA  123



>ref|XP_002961492.1| hypothetical protein SELMODRAFT_76981 [Selaginella moellendorffii]
 gb|EFJ36752.1| hypothetical protein SELMODRAFT_76981 [Selaginella moellendorffii]
Length=95

 Score = 93.2 bits (230),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 41/90 (46%), Positives = 59/90 (66%), Gaps = 0/90 (0%)
 Frame = +3

Query  15   LSSMASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEG  194
            + +    RW++PEVYPL   +  AVG+  +   R + T+PEVRVNK+ R  G L+N+ EG
Sbjct  1    MDATFRKRWLKPEVYPLGVFVIGAVGLAAYLSARKLITDPEVRVNKDDRKHGRLDNHSEG  60

Query  195  KKYAEHSLRKFVRNKSPEIMPSLNRFFSDP  284
            + Y  H LR+F+R+K  +IMP LN +FS P
Sbjct  61   EVYHNHPLRRFLRDKKTQIMPGLNEYFSKP  90



>gb|KGN53786.1| hypothetical protein Csa_4G129030 [Cucumis sativus]
Length=72

 Score = 92.4 bits (228),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 52/72 (72%), Gaps = 0/72 (0%)
 Frame = +3

Query  75   MGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIM  254
            MG    +C FQL RNI  NP+VRV K  R  GVL+N EEG+KY+EHSLR+F+R + PEIM
Sbjct  1    MGFVTTMCIFQLTRNILINPDVRVKKSHRRMGVLDNEEEGEKYSEHSLRRFLRTRPPEIM  60

Query  255  PSLNRFFSDPQR  290
            P++N +FS   +
Sbjct  61   PTINHYFSQDHK  72



>ref|XP_009351238.1| PREDICTED: uncharacterized protein LOC103942755, partial [Pyrus 
x bretschneideri]
Length=66

 Score = 91.3 bits (225),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +3

Query  54   VYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRK  224
            VYPLFAA GVA+GICG  L R+IT NPEVRV+KEGRAAGVL+N+ EG+KY E+ LRK
Sbjct  1    VYPLFAATGVAIGICGLSLFRHITINPEVRVSKEGRAAGVLDNHAEGEKYKENFLRK  57



>gb|EYU29509.1| hypothetical protein MIMGU_mgv1a024878mg [Erythranthe guttata]
Length=90

 Score = 91.7 bits (226),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +3

Query  135  EVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMPSLNRFFSDPQRN  293
            EVRVNKE RAAG+L+N++EG KY EH+LRK+VRN+ PEIMPSLN FF+DPQ N
Sbjct  38   EVRVNKENRAAGILDNFDEGHKYKEHALRKYVRNRKPEIMPSLNSFFTDPQNN  90



>ref|NP_001050622.2| Os03g0601500 [Oryza sativa Japonica Group]
 gb|EEC75707.1| hypothetical protein OsI_12530 [Oryza sativa Indica Group]
 dbj|BAF12536.2| Os03g0601500 [Oryza sativa Japonica Group]
Length=96

 Score = 90.5 bits (223),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 60/85 (71%), Gaps = 0/85 (0%)
 Frame = +3

Query  36   RWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHS  215
            RW+RPEVYPL AAM +A G+  FQL RN+ TNPEV+++K  R   V ++  E ++Y+ H 
Sbjct  3    RWVRPEVYPLMAAMMLASGMVVFQLGRNVCTNPEVKISKRNRRNAVPDSAAEAERYSMHG  62

Query  216  LRKFVRNKSPEIMPSLNRFFSDPQR  290
             R+F   + PE+MPS+NRFFS+  R
Sbjct  63   FRRFFGRRRPEVMPSINRFFSNSDR  87



>emb|CDX85280.1| BnaC07g25910D [Brassica napus]
Length=72

 Score = 88.6 bits (218),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 52/69 (75%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIM  254
            MG    +  FQL RN   NP+ R++KE R  G+LEN +EG+KYA+H+LRK++R + P++M
Sbjct  1    MGFVTSMVVFQLTRNALLNPDCRISKENRKMGILENEDEGEKYAQHNLRKYLRTRPPQVM  60

Query  255  PSLNRFFSD  281
            PSLNRFFS+
Sbjct  61   PSLNRFFSE  69



>gb|EMS53792.1| hypothetical protein TRIUR3_24112 [Triticum urartu]
Length=131

 Score = 90.1 bits (222),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 53/75 (71%), Gaps = 0/75 (0%)
 Frame = +3

Query  36   RWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHS  215
            RW++P+VYPL  AM +  G+C FQL RN+  NP+VRV+K  R + V EN EEG++Y++H+
Sbjct  3    RWLKPDVYPLIGAMSLVTGMCVFQLTRNVFLNPDVRVSKSNRQSAVPENEEEGERYSQHA  62

Query  216  LRKFVRNKSPEIMPS  260
             R+FV    PE  P+
Sbjct  63   FRRFVSAHRPEGFPA  77



>ref|XP_001772578.1| predicted protein [Physcomitrella patens]
 gb|EDQ62620.1| predicted protein, partial [Physcomitrella patens]
Length=72

 Score = 87.8 bits (216),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 51/71 (72%), Gaps = 0/71 (0%)
 Frame = +3

Query  30   SSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAE  209
            + RWI PEVYP+   +G AVG+CG  ++RN + NP+VR+NKE RAAG LEN+ EGK Y +
Sbjct  1    AQRWIIPEVYPIVLVIGTAVGLCGTAIVRNASINPDVRINKEDRAAGYLENFTEGKAYKD  60

Query  210  HSLRKFVRNKS  242
             + R+F   +S
Sbjct  61   SAHRRFFAKQS  71



>ref|XP_003601294.1| B12D-like protein [Medicago truncatula]
Length=96

 Score = 87.8 bits (216),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 53/83 (64%), Gaps = 1/83 (1%)
 Frame = +3

Query  48   PEVYPLFAAM-GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRK  224
            P  YP    M G +        I ++ +    RVNK+ RAAGVLEN+ EG+KY EH LRK
Sbjct  14   PWKYPFAGEMEGGSTHTYALTSIMDVCSFDGFRVNKQSRAAGVLENFAEGEKYTEHLLRK  73

Query  225  FVRNKSPEIMPSLNRFFSDPQRN  293
            F RN+SPEIMP LN FF+DP RN
Sbjct  74   FSRNRSPEIMPGLNSFFTDPSRN  96



>ref|XP_001416807.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO95100.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=101

 Score = 87.4 bits (215),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 61/100 (61%), Gaps = 9/100 (9%)
 Frame = +3

Query  15   LSSMASSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLE---NY  185
            +S+  + RW+RPEVYP+FAA+G AVG+CGF   R +  +P     K  R AG+LE   ++
Sbjct  1    MSTTFAQRWLRPEVYPIFAAIGGAVGLCGFFCTRQLVASPGFTAAKSRRMAGILETKADF  60

Query  186  EEGKKYAEHSLRKFVRN------KSPEIMPSLNRFFSDPQ  287
            +EGK + +H +R+F+R+        P+I P LN  F   Q
Sbjct  61   DEGKNWRDHRVRRFLRSMYGGKGHGPQIFPGLNESFGGGQ  100



>ref|XP_002460987.1| hypothetical protein SORBIDRAFT_02g038760 [Sorghum bicolor]
 gb|EER97508.1| hypothetical protein SORBIDRAFT_02g038760 [Sorghum bicolor]
Length=76

 Score = 86.3 bits (212),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 51/69 (74%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIM  254
            M    G+C FQL RN+  NP+VRV+K  R + VL+N +EG++Y++H+ R+F+  + PE+ 
Sbjct  1    MSFVTGMCVFQLTRNVLMNPDVRVSKSHRQSAVLDNADEGQRYSQHAFRRFLSTQRPEVF  60

Query  255  PSLNRFFSD  281
            P+LNRFFS+
Sbjct  61   PALNRFFSN  69



>gb|EMS56733.1| Microspherule protein 1 [Triticum urartu]
Length=892

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 40/54 (74%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +3

Query  51   EVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEH  212
            +VYPLFA  GVAVGIC  QL+RNITTNPEVRV K+ RAAGVLEN++EGK+Y++H
Sbjct  22   QVYPLFATTGVAVGICVMQLVRNITTNPEVRVTKQNRAAGVLENHDEGKRYSQH  75



>ref|XP_007511902.1| predicted protein [Bathycoccus prasinos]
 emb|CCO65990.1| predicted protein [Bathycoccus prasinos]
Length=96

 Score = 86.7 bits (213),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 54/82 (66%), Gaps = 3/82 (4%)
 Frame = +3

Query  30   SSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLE---NYEEGKK  200
            S RW+RPEVYP+FAA+G AVG+C F   R +TT+P    +K  RA  + E   +++EG+K
Sbjct  8    SQRWLRPEVYPIFAALGSAVGLCAFFCTRQLTTSPGFTASKAKRATAIPETAQDFKEGEK  67

Query  201  YAEHSLRKFVRNKSPEIMPSLN  266
            +  H +R+ V    PEIMP LN
Sbjct  68   FRNHFIRRSVLGMKPEIMPGLN  89



>ref|XP_002975136.1| hypothetical protein SELMODRAFT_102690, partial [Selaginella 
moellendorffii]
 ref|XP_002977540.1| hypothetical protein SELMODRAFT_107004, partial [Selaginella 
moellendorffii]
 gb|EFJ21544.1| hypothetical protein SELMODRAFT_107004, partial [Selaginella 
moellendorffii]
 gb|EFJ23921.1| hypothetical protein SELMODRAFT_102690, partial [Selaginella 
moellendorffii]
Length=81

 Score = 84.3 bits (207),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 55/76 (72%), Gaps = 1/76 (1%)
 Frame = +3

Query  51   EVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFV  230
            +VYPL A M  AVG+  F  +RN+T NPEVRVNK+ R AG+++N++EGK Y +H+LR+++
Sbjct  1    QVYPLIAFMAAAVGLASFVSMRNLTLNPEVRVNKDDRMAGLVQNFKEGKAYHDHALRRYL  60

Query  231  RN-KSPEIMPSLNRFF  275
               K  +I P +N +F
Sbjct  61   YTRKHFQITPGINEYF  76



>ref|XP_009394678.1| PREDICTED: uncharacterized protein LOC103980120 [Musa acuminata 
subsp. malaccensis]
Length=66

 Score = 84.0 bits (206),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = +3

Query  141  RVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMPSLNRFFSDPQ  287
            RV+KEGRAAGVL+N+ EG+KYAEHSLRKFVRNK+PEIMP++N FF+ P+
Sbjct  16   RVSKEGRAAGVLDNHAEGEKYAEHSLRKFVRNKNPEIMPAINNFFTRPE  64



>ref|XP_008346823.1| PREDICTED: putative cyclin-B3-1 [Malus domestica]
Length=132

 Score = 85.1 bits (209),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = +3

Query  93   ICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMPSLNRF  272
            +   + ++   +  ++RV KE RAAGVL+N+ EG+KY EH LRKFVRNK+PEIMP +N F
Sbjct  66   VFMLRFLKAAQSETKIRVTKENRAAGVLDNHAEGEKYKEHFLRKFVRNKAPEIMPGINAF  125

Query  273  FSDPQRN  293
            F+DP +N
Sbjct  126  FTDPSKN  132



>ref|XP_002887135.1| hypothetical protein ARALYDRAFT_894514 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63394.1| hypothetical protein ARALYDRAFT_894514 [Arabidopsis lyrata subsp. 
lyrata]
Length=109

 Score = 83.2 bits (204),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +3

Query  138  VRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMPSLNRFFSDPQ  287
            +RV KE R AG+LEN+ +G++YAEHSLRKFVRNK+P+IMPS+N FF+DP+
Sbjct  59   IRVTKENRTAGILENHTKGERYAEHSLRKFVRNKAPQIMPSINGFFTDPK  108



>gb|ACU13634.1| unknown [Glycine max]
Length=110

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = -3

Query  259  DGIISGLLLRTNFLRECSAYFFPSS*FSNtpaalpslltltSGLVVIFRIN*NPQIPTAT  80
            +GIISG+LLRT FLR+CSAYF PS+ FSNTPA LPSL TLTSGL+ I R N NPQIPTA 
Sbjct  2    EGIISGVLLRTYFLRKCSAYFSPSAKFSNTPAFLPSLFTLTSGLMQILRTNWNPQIPTAA  61

Query  79   PMAANSG*TSGLIQ  38
            P AA+SG TSGL Q
Sbjct  62   PTAASSGYTSGLSQ  75



>gb|EMS55237.1| hypothetical protein TRIUR3_19745 [Triticum urartu]
Length=64

 Score = 78.6 bits (192),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  144  VNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMPSLNRFFSDPQ  287
            VNK GRAAGVLEN+EEG++YAEH LR +V++K+PEIMP +N+FF+ P+
Sbjct  17   VNKMGRAAGVLENHEEGRRYAEHGLRAYVQDKTPEIMPGINKFFTSPK  64



>ref|XP_002507620.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO68878.1| predicted protein [Micromonas sp. RCC299]
Length=99

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 54/87 (62%), Gaps = 4/87 (5%)
 Frame = +3

Query  39   WIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRA-AGVLEN---YEEGKKYA  206
            WIRPEVYP+ AA+G AV +C F   R I+++P  RV K+GRA  G+ E     +EG  + 
Sbjct  13   WIRPEVYPIVAAIGGAVSLCTFFCARQISSSPGFRVWKDGRAHEGIPEEKFRVKEGVNWR  72

Query  207  EHSLRKFVRNKSPEIMPSLNRFFSDPQ  287
            EH +R+ +R+  P I P LN   + P+
Sbjct  73   EHFVRRAMRDTKPAIFPGLNDAMTSPK  99



>gb|EEC81850.1| hypothetical protein OsI_25618 [Oryza sativa Indica Group]
Length=173

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +3

Query  30   SSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVR  143
            +SRWIRPEVYPLFA  GVAVGIC  QL+RNITTNPEVR
Sbjct  2    ASRWIRPEVYPLFATTGVAVGICAMQLVRNITTNPEVR  39



>emb|CEF97372.1| NADH-ubiquinone reductase complex 1 MLRQ subunit [Ostreococcus 
tauri]
Length=97

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 53/92 (58%), Gaps = 6/92 (7%)
 Frame = +3

Query  30   SSRWIRPEVYPLFAAMGVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLEN---YEEGKK  200
            S RW+RPEVYP+F A+G AV +CGF   R + T+P     K  RAAG+ E     +EG  
Sbjct  5    SKRWLRPEVYPIFVAIGGAVSLCGFFCARQLLTSPGFTAAKSKRAAGLNEGDAWVKEGTN  64

Query  201  YAEHSLRKFVRN---KSPEIMPSLNRFFSDPQ  287
            + EH +R+ +R+    +P+I   +N  +   Q
Sbjct  65   WREHRVRRALRSMYGGNPQIFTGMNATYGGGQ  96



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 579015689490