BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002E21

Length=560
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP18577.1|  unnamed protein product                                244   2e-77   Coffea canephora [robusta coffee]
ref|XP_009787718.1|  PREDICTED: uncharacterized protein LOC104235612    241   2e-76   Nicotiana sylvestris
ref|XP_004228972.1|  PREDICTED: uncharacterized protein LOC101267925    231   1e-72   Solanum lycopersicum
ref|XP_010276434.1|  PREDICTED: uncharacterized protein LOC104611177    228   4e-71   Nelumbo nucifera [Indian lotus]
ref|XP_002285769.1|  PREDICTED: uncharacterized protein LOC100250...    221   1e-68   
ref|XP_010651409.1|  PREDICTED: uncharacterized protein LOC100250...    221   1e-68   
gb|EYU32819.1|  hypothetical protein MIMGU_mgv1a012602mg                214   3e-66   Erythranthe guttata [common monkey flower]
ref|XP_004144065.1|  PREDICTED: uncharacterized protein LOC101216...    213   6e-66   
ref|XP_004144064.1|  PREDICTED: uncharacterized protein LOC101216...    214   7e-66   Cucumis sativus [cucumbers]
ref|XP_011089758.1|  PREDICTED: uncharacterized protein LOC105170618    210   2e-64   Sesamum indicum [beniseed]
ref|XP_008450994.1|  PREDICTED: uncharacterized protein LOC103492410    209   3e-64   Cucumis melo [Oriental melon]
ref|XP_006348221.1|  PREDICTED: uncharacterized protein LOC102606203    206   8e-63   Solanum tuberosum [potatoes]
ref|XP_006445553.1|  hypothetical protein CICLE_v10016445mg             199   5e-60   Citrus clementina [clementine]
ref|XP_010536807.1|  PREDICTED: uncharacterized protein LOC104811711    199   6e-60   Tarenaya hassleriana [spider flower]
ref|XP_010032828.1|  PREDICTED: uncharacterized protein LOC104422263    198   7e-60   Eucalyptus grandis [rose gum]
gb|KDO54525.1|  hypothetical protein CISIN_1g025242mg                   198   1e-59   Citrus sinensis [apfelsine]
ref|XP_006488962.1|  PREDICTED: uncharacterized protein LOC102628779    197   2e-59   Citrus sinensis [apfelsine]
ref|XP_002869612.1|  hypothetical protein ARALYDRAFT_913923             196   1e-58   Arabidopsis lyrata subsp. lyrata
gb|KFK29159.1|  hypothetical protein AALP_AA7G096800                    192   1e-57   Arabis alpina [alpine rockcress]
ref|XP_002299091.1|  hypothetical protein POPTR_0001s03860g             192   2e-57   Populus trichocarpa [western balsam poplar]
ref|XP_007014648.1|  Uncharacterized protein TCM_039966                 192   2e-57   
ref|XP_011048149.1|  PREDICTED: uncharacterized protein LOC105142285    192   2e-57   Populus euphratica
ref|XP_002523392.1|  conserved hypothetical protein                     192   5e-57   Ricinus communis
gb|KJB83394.1|  hypothetical protein B456_013G245200                    188   2e-56   Gossypium raimondii
gb|KJB83391.1|  hypothetical protein B456_013G245200                    187   8e-56   Gossypium raimondii
gb|KJB83395.1|  hypothetical protein B456_013G245200                    187   8e-56   Gossypium raimondii
gb|KJB83392.1|  hypothetical protein B456_013G245200                    187   1e-55   Gossypium raimondii
gb|KJB83396.1|  hypothetical protein B456_013G245200                    187   2e-55   Gossypium raimondii
gb|KHG03556.1|  Chromosome-associated kinesin KIF4                      185   1e-54   Gossypium arboreum [tree cotton]
ref|XP_010448277.1|  PREDICTED: uncharacterized protein LOC104730768    185   2e-54   Camelina sativa [gold-of-pleasure]
gb|KEH30817.1|  hypothetical protein MTR_4g083250                       182   1e-53   Medicago truncatula
ref|NP_194371.2|  uncharacterized protein                               182   2e-53   Arabidopsis thaliana [mouse-ear cress]
gb|KDP30630.1|  hypothetical protein JCGZ_16195                         181   2e-53   Jatropha curcas
ref|XP_003607819.1|  hypothetical protein MTR_4g083250                  182   2e-53   Medicago truncatula
ref|XP_010438763.1|  PREDICTED: uncharacterized protein LOC104722317    182   4e-53   Camelina sativa [gold-of-pleasure]
ref|XP_010433511.1|  PREDICTED: uncharacterized protein LOC104717609    181   5e-53   Camelina sativa [gold-of-pleasure]
ref|XP_006284348.1|  hypothetical protein CARUB_v10005520mg             181   6e-53   Capsella rubella
ref|XP_010673453.1|  PREDICTED: uncharacterized protein LOC104889828    181   6e-53   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009137593.1|  PREDICTED: uncharacterized protein LOC103861626    179   5e-52   Brassica rapa
emb|CDY42739.1|  BnaA03g48000D                                          177   1e-51   Brassica napus [oilseed rape]
gb|EPS63583.1|  hypothetical protein M569_11194                         177   1e-51   Genlisea aurea
ref|XP_004505352.1|  PREDICTED: uncharacterized protein LOC101513717    174   9e-51   Cicer arietinum [garbanzo]
ref|XP_006413188.1|  hypothetical protein EUTSA_v10026011mg             174   2e-50   Eutrema salsugineum [saltwater cress]
ref|XP_003556589.1|  PREDICTED: uncharacterized protein LOC100780119    172   1e-49   Glycine max [soybeans]
gb|KHN20511.1|  hypothetical protein glysoja_029524                     172   1e-49   Glycine soja [wild soybean]
emb|CDX89342.1|  BnaA01g15510D                                          172   1e-49   
gb|ACU19454.1|  unknown                                                 172   1e-49   Glycine max [soybeans]
ref|XP_009142234.1|  PREDICTED: uncharacterized protein LOC103866109    172   1e-49   Brassica rapa
ref|XP_006829819.1|  hypothetical protein AMTR_s00119p00084860          172   3e-49   Amborella trichopoda
ref|XP_007157828.1|  hypothetical protein PHAVU_002G101500g             169   2e-48   Phaseolus vulgaris [French bean]
emb|CDX94341.1|  BnaC01g18430D                                          168   8e-48   
ref|XP_003529452.1|  PREDICTED: uncharacterized protein LOC100808143    164   2e-46   Glycine max [soybeans]
gb|KHN42956.1|  hypothetical protein glysoja_007486                     164   3e-46   Glycine soja [wild soybean]
emb|CDX92771.1|  BnaC07g40290D                                          162   2e-45   
ref|XP_003607823.1|  hypothetical protein MTR_4g083290                  162   1e-44   
ref|XP_010105296.1|  hypothetical protein L484_002346                   157   4e-44   
ref|XP_006413187.1|  hypothetical protein EUTSA_v10026011mg             154   1e-42   
gb|KDO54526.1|  hypothetical protein CISIN_1g025242mg                   153   4e-42   Citrus sinensis [apfelsine]
ref|XP_004294933.1|  PREDICTED: uncharacterized protein LOC101308945    151   2e-41   Fragaria vesca subsp. vesca
ref|XP_008220369.1|  PREDICTED: uncharacterized protein LOC103320436    150   8e-41   Prunus mume [ume]
ref|XP_007205735.1|  hypothetical protein PRUPE_ppa010110mg             148   3e-40   Prunus persica
ref|XP_009589516.1|  PREDICTED: uncharacterized protein LOC104086877    141   6e-38   
ref|XP_008384350.1|  PREDICTED: uncharacterized protein LOC103446960    141   1e-37   
ref|XP_009339217.1|  PREDICTED: uncharacterized protein LOC103931455    140   4e-37   Pyrus x bretschneideri [bai li]
emb|CAA18229.1|  putative protein                                       138   2e-36   Arabidopsis thaliana [mouse-ear cress]
gb|KJB83393.1|  hypothetical protein B456_013G245200                    128   2e-33   Gossypium raimondii
ref|XP_010921336.1|  PREDICTED: uncharacterized protein LOC105044929    129   4e-33   Elaeis guineensis
ref|XP_008781206.1|  PREDICTED: uncharacterized protein LOC103701046    126   7e-32   Phoenix dactylifera
ref|XP_002511643.1|  conserved hypothetical protein                     124   4e-31   Ricinus communis
gb|KDP28809.1|  hypothetical protein JCGZ_14580                         120   9e-30   Jatropha curcas
ref|XP_010258900.1|  PREDICTED: uncharacterized protein LOC104598502    119   5e-29   Nelumbo nucifera [Indian lotus]
ref|XP_008232561.1|  PREDICTED: uncharacterized protein LOC103331692    115   1e-27   Prunus mume [ume]
ref|XP_004984525.1|  PREDICTED: uncharacterized protein LOC101782...    112   5e-27   Setaria italica
ref|XP_007052189.1|  Uncharacterized protein isoform 2                  113   1e-26   
ref|XP_007052190.1|  Uncharacterized protein isoform 3                  113   1e-26   
ref|XP_007052188.1|  Uncharacterized protein isoform 1                  113   1e-26   
ref|XP_006838189.1|  hypothetical protein AMTR_s00106p00135890          111   4e-26   Amborella trichopoda
ref|XP_002465337.1|  hypothetical protein SORBIDRAFT_01g036710          109   6e-26   Sorghum bicolor [broomcorn]
ref|XP_010436412.1|  PREDICTED: uncharacterized protein LOC104720153    108   6e-26   Camelina sativa [gold-of-pleasure]
ref|XP_009393907.1|  PREDICTED: uncharacterized protein LOC103979471    109   7e-26   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010456590.1|  PREDICTED: uncharacterized protein LOC104738049    107   1e-25   Camelina sativa [gold-of-pleasure]
ref|XP_010053946.1|  PREDICTED: uncharacterized protein LOC104442278    109   2e-25   Eucalyptus grandis [rose gum]
ref|NP_001049981.1|  Os03g0324800                                       108   3e-25   
gb|KCW78323.1|  hypothetical protein EUGRSUZ_D02501                     108   4e-25   Eucalyptus grandis [rose gum]
ref|XP_008670078.1|  PREDICTED: uncharacterized protein LOC100276...    107   5e-25   
gb|KDO85660.1|  hypothetical protein CISIN_1g024845mg                   107   7e-25   Citrus sinensis [apfelsine]
ref|XP_011017444.1|  PREDICTED: uncharacterized protein LOC105120771    107   8e-25   Populus euphratica
ref|XP_001760783.1|  predicted protein                                  109   8e-25   
ref|XP_004984524.1|  PREDICTED: uncharacterized protein LOC101782...    106   8e-25   Setaria italica
ref|XP_002302514.1|  hypothetical protein POPTR_0002s14390g             107   9e-25   Populus trichocarpa [western balsam poplar]
dbj|BAK05826.1|  predicted protein                                      106   9e-25   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KDO85659.1|  hypothetical protein CISIN_1g024845mg                   107   1e-24   Citrus sinensis [apfelsine]
ref|XP_006650015.1|  PREDICTED: uncharacterized protein LOC102714271    105   2e-24   Oryza brachyantha
ref|XP_006445337.1|  hypothetical protein CICLE_v10021755mg             106   2e-24   Citrus clementina [clementine]
ref|XP_004306965.1|  PREDICTED: uncharacterized protein LOC101308610    107   2e-24   Fragaria vesca subsp. vesca
ref|XP_009617840.1|  PREDICTED: uncharacterized protein LOC104110119    103   2e-24   
gb|EEC75161.1|  hypothetical protein OsI_11375                          104   4e-24   Oryza sativa Indica Group [Indian rice]
ref|XP_003558009.1|  PREDICTED: uncharacterized protein LOC100838509    103   2e-23   Brachypodium distachyon [annual false brome]
ref|XP_010524407.1|  PREDICTED: uncharacterized protein LOC104802474    103   2e-23   Tarenaya hassleriana [spider flower]
gb|KEH22362.1|  hypothetical protein MTR_7g445370                       102   5e-23   Medicago truncatula
ref|XP_002277999.1|  PREDICTED: uncharacterized protein LOC100266783    102   6e-23   Vitis vinifera
gb|AFK35211.1|  unknown                                                 102   6e-23   Medicago truncatula
ref|XP_006294795.1|  hypothetical protein CARUB_v10023846mg             101   8e-23   
ref|XP_007052191.1|  Uncharacterized protein isoform 4                  102   1e-22   
ref|XP_002881994.1|  hypothetical protein ARALYDRAFT_903941             100   3e-22   Arabidopsis lyrata subsp. lyrata
ref|NP_566034.1|  uncharacterized protein                               100   3e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006294796.1|  hypothetical protein CARUB_v10023846mg             100   4e-22   Capsella rubella
ref|XP_003538068.1|  PREDICTED: uncharacterized protein LOC100804339    100   4e-22   Glycine max [soybeans]
ref|XP_010508215.1|  PREDICTED: uncharacterized protein LOC104784826    100   5e-22   Camelina sativa [gold-of-pleasure]
ref|XP_004229779.1|  PREDICTED: uncharacterized protein LOC101267648    100   6e-22   Solanum lycopersicum
gb|KEH22363.1|  hypothetical protein MTR_7g445370                       100   6e-22   Medicago truncatula
gb|AFK39373.1|  unknown                                               99.4    1e-21   Lotus japonicus
gb|AFK47092.1|  unknown                                               99.4    1e-21   Lotus japonicus
gb|KJB09928.1|  hypothetical protein B456_001G175600                  99.4    1e-21   Gossypium raimondii
ref|XP_009385849.1|  PREDICTED: uncharacterized protein LOC103973101  99.4    1e-21   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX83410.1|  BnaA03g20960D                                        98.2    2e-21   
ref|XP_010518116.1|  PREDICTED: uncharacterized protein LOC104793462  98.2    3e-21   Camelina sativa [gold-of-pleasure]
ref|XP_010692135.1|  PREDICTED: uncharacterized protein LOC104905332  97.8    3e-21   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB09931.1|  hypothetical protein B456_001G175600                  98.2    3e-21   Gossypium raimondii
ref|XP_006397686.1|  hypothetical protein EUTSA_v10001582mg           97.8    4e-21   Eutrema salsugineum [saltwater cress]
ref|XP_009776946.1|  PREDICTED: uncharacterized protein LOC104226615  97.8    4e-21   Nicotiana sylvestris
ref|XP_010506443.1|  PREDICTED: uncharacterized protein LOC104783...  97.4    6e-21   Camelina sativa [gold-of-pleasure]
ref|XP_006375267.1|  hypothetical protein POPTR_0014s05780g           97.1    7e-21   
ref|XP_009142315.1|  PREDICTED: uncharacterized protein LOC103866188  97.1    8e-21   Brassica rapa
emb|CDY37025.1|  BnaA04g26030D                                        97.1    9e-21   Brassica napus [oilseed rape]
ref|XP_009133693.1|  PREDICTED: uncharacterized protein LOC103858149  95.9    2e-20   Brassica rapa
ref|XP_006347915.1|  PREDICTED: uncharacterized protein LOC102584275  95.9    2e-20   Solanum tuberosum [potatoes]
ref|XP_011033296.1|  PREDICTED: uncharacterized protein LOC105131821  94.7    3e-20   Populus euphratica
gb|KHG03984.1|  Alanine--tRNA ligase                                  95.1    4e-20   Gossypium arboreum [tree cotton]
gb|KFK37300.1|  hypothetical protein AALP_AA4G239300                  95.1    4e-20   Arabis alpina [alpine rockcress]
ref|XP_010445295.1|  PREDICTED: pentatricopeptide repeat-containi...  95.5    4e-20   
ref|XP_008459726.1|  PREDICTED: uncharacterized protein LOC103498769  94.7    4e-20   Cucumis melo [Oriental melon]
ref|XP_008796934.1|  PREDICTED: uncharacterized protein LOC103712...  94.0    8e-20   Phoenix dactylifera
emb|CDX95625.1|  BnaC03g25060D                                        94.4    1e-19   
ref|XP_004514234.1|  PREDICTED: uncharacterized protein LOC101491840  92.4    3e-19   Cicer arietinum [garbanzo]
ref|XP_011093293.1|  PREDICTED: uncharacterized protein LOC105173298  91.7    5e-19   Sesamum indicum [beniseed]
ref|XP_007140975.1|  hypothetical protein PHAVU_008G156600g           90.1    7e-19   Phaseolus vulgaris [French bean]
ref|XP_008796933.1|  PREDICTED: uncharacterized protein LOC103712...  90.5    1e-18   
emb|CDY48625.1|  BnaC09g20600D                                        86.7    3e-18   Brassica napus [oilseed rape]
ref|XP_009631125.1|  PREDICTED: uncharacterized protein LOC104120950  87.8    5e-18   Nicotiana tomentosiformis
emb|CDY27396.1|  BnaC04g50090D                                        88.6    7e-18   Brassica napus [oilseed rape]
ref|XP_010934947.1|  PREDICTED: uncharacterized protein LOC105054...  87.8    1e-17   Elaeis guineensis
ref|XP_009337245.1|  PREDICTED: uncharacterized protein LOC103929743  87.8    1e-17   Pyrus x bretschneideri [bai li]
ref|XP_010934948.1|  PREDICTED: uncharacterized protein LOC105054...  87.4    1e-17   Elaeis guineensis
ref|XP_010506444.1|  PREDICTED: uncharacterized protein LOC104783...  87.4    2e-17   
gb|EYU42370.1|  hypothetical protein MIMGU_mgv1a023111mg              86.7    3e-17   Erythranthe guttata [common monkey flower]
ref|XP_008375716.1|  PREDICTED: uncharacterized protein LOC103438950  86.3    4e-17   
ref|XP_009339857.1|  PREDICTED: uncharacterized protein LOC103932041  85.5    9e-17   Pyrus x bretschneideri [bai li]
ref|XP_006375268.1|  hypothetical protein POPTR_0014s05780g           84.3    1e-16   
ref|XP_006423787.1|  hypothetical protein CICLE_v10029731mg           80.9    2e-16   
gb|KGN46560.1|  hypothetical protein Csa_6G108580                     82.8    4e-16   Cucumis sativus [cucumbers]
ref|XP_007220768.1|  hypothetical protein PRUPE_ppa024369mg           81.3    1e-15   
ref|XP_004171485.1|  PREDICTED: uncharacterized LOC101214960          80.9    2e-15   
ref|XP_004140609.1|  PREDICTED: uncharacterized protein LOC101214960  80.9    4e-15   
ref|XP_001771369.1|  predicted protein                                81.3    5e-15   
emb|CDP09483.1|  unnamed protein product                              78.6    2e-14   Coffea canephora [robusta coffee]
ref|XP_002983323.1|  hypothetical protein SELMODRAFT_445444           76.3    5e-13   Selaginella moellendorffii
ref|XP_002987624.1|  hypothetical protein SELMODRAFT_447060           75.5    9e-13   Selaginella moellendorffii
gb|EPS62058.1|  hypothetical protein M569_12732                       73.2    1e-12   Genlisea aurea
ref|XP_011396980.1|  hypothetical protein F751_1359                   73.2    1e-12   Auxenochlorella protothecoides
ref|XP_006659070.1|  PREDICTED: uncharacterized protein LOC102721384  68.2    1e-10   Oryza brachyantha
ref|NP_001144763.1|  uncharacterized protein LOC100277822             67.4    2e-10   Zea mays [maize]
gb|AFW66822.1|  hypothetical protein ZEAMMB73_141697                  67.0    2e-10   
dbj|BAJ98005.1|  predicted protein                                    66.2    5e-10   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_005846915.1|  hypothetical protein CHLNCDRAFT_134807           65.9    7e-10   Chlorella variabilis
gb|EEE56139.1|  hypothetical protein OsJ_05019                        65.1    1e-09   Oryza sativa Japonica Group [Japonica rice]
gb|EMT05527.1|  hypothetical protein F775_07413                       64.3    1e-09   
ref|NP_001045615.1|  Os02g0104800                                     65.1    1e-09   
gb|EEC75159.1|  hypothetical protein OsI_11373                        63.9    1e-09   Oryza sativa Indica Group [Indian rice]
ref|XP_004951200.1|  PREDICTED: uncharacterized protein LOC101766807  65.1    1e-09   Setaria italica
ref|XP_006375269.1|  hypothetical protein POPTR_0014s05780g           63.5    2e-09   
ref|XP_003570319.1|  PREDICTED: uncharacterized protein LOC100834616  64.3    3e-09   Brachypodium distachyon [annual false brome]
gb|AEJ54427.1|  hypothetical protein                                  60.1    4e-09   Fagopyrum esculentum subsp. ancestrale
ref|XP_003078117.1|  unnamed protein product                          62.8    4e-09   
gb|EEC72302.1|  hypothetical protein OsI_05485                        63.9    4e-09   Oryza sativa Indica Group [Indian rice]
emb|CEF97085.1|  unnamed product                                      63.2    5e-09   Ostreococcus tauri
emb|CAN64905.1|  hypothetical protein VITISV_042831                   63.9    1e-08   Vitis vinifera
gb|EMS57790.1|  hypothetical protein TRIUR3_22595                     60.1    1e-08   Triticum urartu
gb|EMT21115.1|  hypothetical protein F775_32566                       60.8    2e-08   
ref|XP_001416629.1|  predicted protein                                60.1    2e-08   Ostreococcus lucimarinus CCE9901
gb|KHN10117.1|  hypothetical protein glysoja_048900                   58.9    4e-08   Glycine soja [wild soybean]
gb|KDD75675.1|  hypothetical protein H632_c557p1                      60.1    6e-08   Helicosporidium sp. ATCC 50920
gb|KJB09930.1|  hypothetical protein B456_001G175600                  53.1    7e-06   Gossypium raimondii
gb|KJB09929.1|  hypothetical protein B456_001G175600                  49.3    1e-04   Gossypium raimondii



>emb|CDP18577.1| unnamed protein product [Coffea canephora]
Length=260

 Score =   244 bits (622),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 119/176 (68%), Positives = 139/176 (79%), Gaps = 2/176 (1%)
 Frame = +3

Query  33   VPSTEIDETSSPAPAATPQQRDKPWHAYISEDLPRTVQESTDSAIRSARLFQNTSSGHLR  212
            VP + I  TS+        + DK WH+YISEDLPRTVQ+STDSA+RSAR F ++SS H R
Sbjct  18   VPESSI--TSASPSKDKSDKADKTWHSYISEDLPRTVQQSTDSALRSARSFHHSSSTHFR  75

Query  213  SLQDFLPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRN  392
            +L+DF+PQL SQY+ YEDA F K+KDE+   RE+PAV GGIAVA GL+  RGPRRFLFR+
Sbjct  76   TLRDFMPQLGSQYRTYEDAFFLKIKDELTKVRENPAVTGGIAVAVGLLLFRGPRRFLFRH  135

Query  393  TLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMN  560
            TLGRF+SEEAQF +AEKNVKEL LSVDLMKKESGKL ERAALA  EMK G  +LMN
Sbjct  136  TLGRFQSEEAQFIRAEKNVKELNLSVDLMKKESGKLLERAALAEKEMKHGQIDLMN  191



>ref|XP_009787718.1| PREDICTED: uncharacterized protein LOC104235612 [Nicotiana sylvestris]
Length=249

 Score =   241 bits (614),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 117/175 (67%), Positives = 143/175 (82%), Gaps = 1/175 (1%)
 Frame = +3

Query  36   PSTEIDETSSPAPAATPQQRDKPWHAYISEDLPRTVQESTDSAIRSARLFQNTSSGHLRS  215
            P+ +ID +SS  P  + Q ++K WH+YISEDLPRTVQESTDSA+RSAR  Q TSS HLR+
Sbjct  7    PAVDIDPSSSSLPLPS-QNKEKAWHSYISEDLPRTVQESTDSALRSARSIQYTSSTHLRT  65

Query  216  LQDFLPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNT  395
            LQDF+P++ +QY  YE+  F+K+KDE+  AREHPA+ GGI +A GL+ MRGPRRFLFR T
Sbjct  66   LQDFMPKIKAQYTTYEEVFFRKIKDELVTAREHPAMAGGIGIAAGLLLMRGPRRFLFRQT  125

Query  396  LGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMN  560
            LGR +SEEA+F+KAEKNVKEL LSVDLMKKES KL ERAALA  +MKRG S+LM+
Sbjct  126  LGRLQSEEAKFSKAEKNVKELSLSVDLMKKESKKLLERAALAEKDMKRGLSDLMD  180



>ref|XP_004228972.1| PREDICTED: uncharacterized protein LOC101267925 [Solanum lycopersicum]
Length=233

 Score =   231 bits (588),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 107/155 (69%), Positives = 129/155 (83%), Gaps = 0/155 (0%)
 Frame = +3

Query  93   RDKPWHAYISEDLPRTVQESTDSAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDAL  272
            ++K WH+YISEDLPRTVQ+ST SAIRSAR  QNTSS HLR+LQDF+P++  QY+ YE+  
Sbjct  9    QNKVWHSYISEDLPRTVQQSTYSAIRSARSIQNTSSTHLRTLQDFMPKIKGQYRTYEEVF  68

Query  273  FQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVK  452
            F+K+KDE+  AREHPA+ GGI +A GL+  RGPRRFL+R TLGR +SEEA+F KAEKNVK
Sbjct  69   FRKIKDELVSAREHPALAGGIGIAAGLLLTRGPRRFLYRQTLGRLQSEEAKFIKAEKNVK  128

Query  453  ELRLSVDLMKKESGKLFERAALAHTEMKRGHSELM  557
            EL LSV LMKKES KL ERA+LA  +MKRGHS+LM
Sbjct  129  ELGLSVGLMKKESKKLLERASLAEKDMKRGHSDLM  163



>ref|XP_010276434.1| PREDICTED: uncharacterized protein LOC104611177 [Nelumbo nucifera]
Length=248

 Score =   228 bits (580),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 113/167 (68%), Positives = 129/167 (77%), Gaps = 3/167 (2%)
 Frame = +3

Query  60   SSPAPAATPQQRDKPWHAYISEDLPRTVQESTDSAIRSARLFQNTSSGHLRSLQDFLPQL  239
            SSP  A+   Q  KPWHAY +EDL +TV  +TDSA+RSAR  Q  SS H RSLQ F  QL
Sbjct  16   SSPREAS---QEQKPWHAYTAEDLKQTVFGTTDSALRSARSLQENSSTHFRSLQTFTAQL  72

Query  240  SSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEE  419
             SQYK YEDA+F+KVKDE+  A+EHPAV GGIAV  GL+ MRGPRRFLFR+TLGR +SEE
Sbjct  73   KSQYKTYEDAVFKKVKDELMSAQEHPAVAGGIAVTAGLLLMRGPRRFLFRHTLGRLQSEE  132

Query  420  AQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMN  560
            AQF +AEKNVKEL LSVDLMK ES KL ERA LA  +MKRG+ +LMN
Sbjct  133  AQFLRAEKNVKELTLSVDLMKNESKKLLERATLAEKDMKRGYDQLMN  179



>ref|XP_002285769.1| PREDICTED: uncharacterized protein LOC100250144 isoform X2 [Vitis 
vinifera]
 emb|CBI16570.3| unnamed protein product [Vitis vinifera]
Length=246

 Score =   221 bits (563),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 120/183 (66%), Positives = 138/183 (75%), Gaps = 9/183 (5%)
 Frame = +3

Query  21   MASDVPSTEIDETSSPAPA---ATPQQRDKPWHAYISEDLPRTVQESTDSAIRSARLFQN  191
            MA   PS      S+PAPA   +  QQ+ KPWH   +EDL RTV ES DSAIRSA   Q 
Sbjct  1    MAEATPS------SAPAPADGESISQQQQKPWHISFAEDLQRTVSESADSAIRSALSLQQ  54

Query  192  TSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGP  371
             SS HLRSLQ+F+PQ+ SQY+ YEDA F+KVKDE+  A+EHP VVG +AV  GLIF+RGP
Sbjct  55   NSSSHLRSLQEFIPQMESQYRTYEDAFFKKVKDELTSAKEHPVVVGAVAVTAGLIFLRGP  114

Query  372  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  551
            RRFLF +TLGRF+SEEAQF +AEKNVKEL LSVDLMK ES KL ERAALA  +MK GH+E
Sbjct  115  RRFLFHHTLGRFQSEEAQFVRAEKNVKELNLSVDLMKNESRKLLERAALAEKDMKCGHTE  174

Query  552  LMN  560
            LMN
Sbjct  175  LMN  177



>ref|XP_010651409.1| PREDICTED: uncharacterized protein LOC100250144 isoform X1 [Vitis 
vinifera]
Length=252

 Score =   221 bits (563),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 120/183 (66%), Positives = 138/183 (75%), Gaps = 9/183 (5%)
 Frame = +3

Query  21   MASDVPSTEIDETSSPAPA---ATPQQRDKPWHAYISEDLPRTVQESTDSAIRSARLFQN  191
            MA   PS      S+PAPA   +  QQ+ KPWH   +EDL RTV ES DSAIRSA   Q 
Sbjct  1    MAEATPS------SAPAPADGESISQQQQKPWHISFAEDLQRTVSESADSAIRSALSLQQ  54

Query  192  TSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGP  371
             SS HLRSLQ+F+PQ+ SQY+ YEDA F+KVKDE+  A+EHP VVG +AV  GLIF+RGP
Sbjct  55   NSSSHLRSLQEFIPQMESQYRTYEDAFFKKVKDELTSAKEHPVVVGAVAVTAGLIFLRGP  114

Query  372  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  551
            RRFLF +TLGRF+SEEAQF +AEKNVKEL LSVDLMK ES KL ERAALA  +MK GH+E
Sbjct  115  RRFLFHHTLGRFQSEEAQFVRAEKNVKELNLSVDLMKNESRKLLERAALAEKDMKCGHTE  174

Query  552  LMN  560
            LMN
Sbjct  175  LMN  177



>gb|EYU32819.1| hypothetical protein MIMGU_mgv1a012602mg [Erythranthe guttata]
Length=245

 Score =   214 bits (546),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 100/152 (66%), Positives = 120/152 (79%), Gaps = 0/152 (0%)
 Frame = +3

Query  105  WHAYISEDLPRTVQESTDSAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKV  284
            W +YISEDLPR+VQ+S DSAIRSAR  Q +SS HLRS+QDF+PQ+ ++Y+ YEDA   KV
Sbjct  25   WRSYISEDLPRSVQQSADSAIRSARSLQESSSTHLRSIQDFVPQIGTRYRYYEDAFIHKV  84

Query  285  KDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRL  464
            KDE+   +EHPA+ GG+AV    + M GPRRFLFR TLGR +SEEAQF KAE NVKEL L
Sbjct  85   KDELMTLKEHPALAGGVAVTAFFLLMPGPRRFLFRQTLGRLQSEEAQFVKAENNVKELTL  144

Query  465  SVDLMKKESGKLFERAALAHTEMKRGHSELMN  560
            SVD+MKKES KL ER+ LA  +MKRGHS+LM 
Sbjct  145  SVDIMKKESKKLLERSVLAEKDMKRGHSDLMG  176



>ref|XP_004144065.1| PREDICTED: uncharacterized protein LOC101216418 isoform 2 [Cucumis 
sativus]
 ref|XP_004159355.1| PREDICTED: uncharacterized LOC101216418 isoform 2 [Cucumis sativus]
Length=217

 Score =   213 bits (542),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 103/148 (70%), Positives = 121/148 (82%), Gaps = 0/148 (0%)
 Frame = +3

Query  117  ISEDLPRTVQESTDSAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEV  296
            I+EDL RTV +S DSAIRSAR FQ  SS H+RSLQDF+PQ +SQ+K YED  F+K+ DE+
Sbjct  25   IAEDLQRTVVQSKDSAIRSARSFQQASSSHIRSLQDFVPQATSQFKTYEDTFFRKLTDEL  84

Query  297  EIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDL  476
            +IAREHPA   G+AV  GL+ MRGPRRFLFR+TLGRF++EEA F KAEK+VKEL LSVDL
Sbjct  85   KIAREHPAATIGVAVTAGLLIMRGPRRFLFRHTLGRFQTEEASFLKAEKHVKELNLSVDL  144

Query  477  MKKESGKLFERAALAHTEMKRGHSELMN  560
            MK ES KL ERAALA  +MK GH+ELMN
Sbjct  145  MKNESKKLLERAALAEKDMKYGHNELMN  172



>ref|XP_004144064.1| PREDICTED: uncharacterized protein LOC101216418 isoform 1 [Cucumis 
sativus]
 ref|XP_004159354.1| PREDICTED: uncharacterized LOC101216418 isoform 1 [Cucumis sativus]
 gb|KGN66344.1| hypothetical protein Csa_1G599380 [Cucumis sativus]
Length=241

 Score =   214 bits (544),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 103/148 (70%), Positives = 121/148 (82%), Gaps = 0/148 (0%)
 Frame = +3

Query  117  ISEDLPRTVQESTDSAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEV  296
            I+EDL RTV +S DSAIRSAR FQ  SS H+RSLQDF+PQ +SQ+K YED  F+K+ DE+
Sbjct  25   IAEDLQRTVVQSKDSAIRSARSFQQASSSHIRSLQDFVPQATSQFKTYEDTFFRKLTDEL  84

Query  297  EIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDL  476
            +IAREHPA   G+AV  GL+ MRGPRRFLFR+TLGRF++EEA F KAEK+VKEL LSVDL
Sbjct  85   KIAREHPAATIGVAVTAGLLIMRGPRRFLFRHTLGRFQTEEASFLKAEKHVKELNLSVDL  144

Query  477  MKKESGKLFERAALAHTEMKRGHSELMN  560
            MK ES KL ERAALA  +MK GH+ELMN
Sbjct  145  MKNESKKLLERAALAEKDMKYGHNELMN  172



>ref|XP_011089758.1| PREDICTED: uncharacterized protein LOC105170618 [Sesamum indicum]
Length=234

 Score =   210 bits (534),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 112/170 (66%), Positives = 133/170 (78%), Gaps = 7/170 (4%)
 Frame = +3

Query  51   DETSSPAPAATPQQRDKPWHAYISEDLPRTVQESTDSAIRSARLFQNTSSGHLRSLQDFL  230
            +E ++PAP  TP      W  YISE+LPR+VQES DSAIRSAR  Q +SS HLRSLQ+F 
Sbjct  3    EEEATPAP--TP-----AWRTYISEELPRSVQESADSAIRSARSLQQSSSTHLRSLQEFF  55

Query  231  PQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFR  410
            PQL +QY+ YE+A   +VKDE+   RE+PA+ GG+AVA  L+ MRGPRRFLFR TLGR +
Sbjct  56   PQLGTQYRYYEEAFVNRVKDELVNVRENPALAGGVAVAACLLLMRGPRRFLFRQTLGRLQ  115

Query  411  SEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMN  560
            SEEAQF +AEKNVKEL LSVDLMKKES KL ER+ALA  +MKRGHS+LMN
Sbjct  116  SEEAQFVRAEKNVKELNLSVDLMKKESKKLLERSALAEKDMKRGHSDLMN  165



>ref|XP_008450994.1| PREDICTED: uncharacterized protein LOC103492410 [Cucumis melo]
Length=241

 Score =   209 bits (533),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 120/148 (81%), Gaps = 0/148 (0%)
 Frame = +3

Query  117  ISEDLPRTVQESTDSAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEV  296
            I+EDL RTV +S DSAIRSAR  Q  SS H+RS QDF+P+ +SQ+K YEDA F+K+ DE+
Sbjct  25   IAEDLQRTVVQSKDSAIRSARSLQEASSSHIRSFQDFVPRATSQFKTYEDAFFRKLTDEL  84

Query  297  EIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDL  476
            +IAREHPA   G+AV  GL+ MRGPRRFLFR+TLGRF++EEA F KAEK+VKEL LSVDL
Sbjct  85   KIAREHPAATIGVAVTAGLLIMRGPRRFLFRHTLGRFQTEEASFLKAEKHVKELNLSVDL  144

Query  477  MKKESGKLFERAALAHTEMKRGHSELMN  560
            MK ES KL ERAALA  +MK GH+ELMN
Sbjct  145  MKNESKKLLERAALAEKDMKYGHNELMN  172



>ref|XP_006348221.1| PREDICTED: uncharacterized protein LOC102606203 [Solanum tuberosum]
Length=233

 Score =   206 bits (523),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 106/155 (68%), Positives = 129/155 (83%), Gaps = 0/155 (0%)
 Frame = +3

Query  93   RDKPWHAYISEDLPRTVQESTDSAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDAL  272
            ++K WH+YISE+LPRTVQ STDSAIRSAR  QNTSS HLR+LQDF+P++  QY+  E+  
Sbjct  9    QNKAWHSYISENLPRTVQASTDSAIRSARSIQNTSSTHLRTLQDFIPKIKGQYRTCEEVF  68

Query  273  FQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVK  452
            F+K+KDE+  AREHPA+ GGI +A GL+ MRGPRRFL+R TLGR +SEEA+F KAEKNVK
Sbjct  69   FRKIKDELVSAREHPAIAGGIGIAAGLLLMRGPRRFLYRQTLGRLQSEEAKFIKAEKNVK  128

Query  453  ELRLSVDLMKKESGKLFERAALAHTEMKRGHSELM  557
            EL LSV LMKKES KL ERA+LA  +M+RGHS+LM
Sbjct  129  ELGLSVGLMKKESKKLLERASLAEKDMQRGHSDLM  163



>ref|XP_006445553.1| hypothetical protein CICLE_v10016445mg [Citrus clementina]
 gb|ESR58793.1| hypothetical protein CICLE_v10016445mg [Citrus clementina]
 gb|KDO54524.1| hypothetical protein CISIN_1g025242mg [Citrus sinensis]
Length=243

 Score =   199 bits (505),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 104/169 (62%), Positives = 123/169 (73%), Gaps = 5/169 (3%)
 Frame = +3

Query  57   TSSPAPAATPQQRD-KPWHAYISEDLPRTVQESTDSAIRSARLFQNTSSGHLRSLQDFLP  233
            T + APA T + +D K W     EDL R+V +S DSAIRSAR FQ+ SS +L++LQDF+ 
Sbjct  10   TVAAAPAITTRTKDAKEW----VEDLQRSVIQSKDSAIRSARSFQHNSSTYLQTLQDFVL  65

Query  234  QLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRS  413
               SQY+ YEDA F KVKDE+  AREHPA   G+A+  GL+FMRGPRRFLFR+T GR RS
Sbjct  66   HGVSQYQTYEDAFFSKVKDELVSAREHPAAATGVALTAGLLFMRGPRRFLFRHTFGRLRS  125

Query  414  EEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMN  560
            EEA F +AEKNV EL LS +LMKKES KL ERAALA  EM RG +EL N
Sbjct  126  EEAMFVRAEKNVNELNLSGELMKKESKKLLERAALAEKEMIRGETELKN  174



>ref|XP_010536807.1| PREDICTED: uncharacterized protein LOC104811711 [Tarenaya hassleriana]
Length=255

 Score =   199 bits (506),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 101/177 (57%), Positives = 124/177 (70%), Gaps = 8/177 (5%)
 Frame = +3

Query  30   DVPSTEIDETSSPAPAATPQQRDKPWHAYISEDLPRTVQESTDSAIRSARLFQNTSSGHL  209
            D P  E+ E ++       ++    W     ED  RTV+ESTDSAIRSAR  +N SS H 
Sbjct  18   DKPEVEVIEATAETAVGGAER----W----VEDFQRTVKESTDSAIRSARSLRNNSSSHF  69

Query  210  RSLQDFLPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFR  389
            RSLQDF+P    QYK YE+A F KV +E+  A++HPA   G+ VA GL+ MRGPRRFLFR
Sbjct  70   RSLQDFIPHALVQYKTYENAFFSKVTEELTNAKDHPAATVGLGVAAGLLLMRGPRRFLFR  129

Query  390  NTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMN  560
             TLGRF+SEEA++ K EKNV+EL ++VDLMKKES KL ERAALA  +MKRG SELM+
Sbjct  130  QTLGRFQSEEARYLKVEKNVQELNMTVDLMKKESRKLLERAALAEKDMKRGLSELMS  186



>ref|XP_010032828.1| PREDICTED: uncharacterized protein LOC104422263 [Eucalyptus grandis]
 gb|KCW52324.1| hypothetical protein EUGRSUZ_J01745 [Eucalyptus grandis]
Length=242

 Score =   198 bits (504),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 103/171 (60%), Positives = 123/171 (72%), Gaps = 5/171 (3%)
 Frame = +3

Query  60   SSPAPAA----TPQQRDKPWHAYISEDLPRTVQESTDSAIRSARLFQNTSSGHLRSLQDF  227
            +SP+P A     P+Q  K   A I+ED+ RTV ES DSAI++AR  Q  SS HLRSLQ+ 
Sbjct  4    ASPSPPAAEPAVPRQNGKSI-ADIAEDVQRTVLESRDSAIQTARSLQQNSSTHLRSLQEL  62

Query  228  LPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRF  407
            L ++ SQY AYED    KVKDEV  AREHP    G++VA  L+ +RGPRRFL R T GR 
Sbjct  63   LTKMRSQYHAYEDTFVNKVKDEVRSAREHPGTTVGVSVAAALLLLRGPRRFLIRQTFGRL  122

Query  408  RSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMN  560
            +SEEAQF +AEKNVK+L LSVDLMKKES KL ERAALA T+MKRG ++L N
Sbjct  123  QSEEAQFVRAEKNVKDLNLSVDLMKKESKKLIERAALAETDMKRGLTDLKN  173



>gb|KDO54525.1| hypothetical protein CISIN_1g025242mg [Citrus sinensis]
Length=255

 Score =   198 bits (504),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 104/169 (62%), Positives = 123/169 (73%), Gaps = 5/169 (3%)
 Frame = +3

Query  57   TSSPAPAATPQQRD-KPWHAYISEDLPRTVQESTDSAIRSARLFQNTSSGHLRSLQDFLP  233
            T + APA T + +D K W     EDL R+V +S DSAIRSAR FQ+ SS +L++LQDF+ 
Sbjct  10   TVAAAPAITTRTKDAKEW----VEDLQRSVIQSKDSAIRSARSFQHNSSTYLQTLQDFVL  65

Query  234  QLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRS  413
               SQY+ YEDA F KVKDE+  AREHPA   G+A+  GL+FMRGPRRFLFR+T GR RS
Sbjct  66   HGVSQYQTYEDAFFSKVKDELVSAREHPAAATGVALTAGLLFMRGPRRFLFRHTFGRLRS  125

Query  414  EEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMN  560
            EEA F +AEKNV EL LS +LMKKES KL ERAALA  EM RG +EL N
Sbjct  126  EEAMFVRAEKNVNELNLSGELMKKESKKLLERAALAEKEMIRGETELKN  174



>ref|XP_006488962.1| PREDICTED: uncharacterized protein LOC102628779 [Citrus sinensis]
Length=243

 Score =   197 bits (501),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 103/169 (61%), Positives = 123/169 (73%), Gaps = 5/169 (3%)
 Frame = +3

Query  57   TSSPAPAATPQQRD-KPWHAYISEDLPRTVQESTDSAIRSARLFQNTSSGHLRSLQDFLP  233
            T + APA T + +D K W     EDL R+V +S DSAIRSAR FQ+ SS +L++LQDF+ 
Sbjct  10   TVAAAPAITTRTKDAKEW----VEDLQRSVIQSKDSAIRSARSFQHNSSTYLQTLQDFVL  65

Query  234  QLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRS  413
               SQY+ YEDA F KVKDE+  AREHPA   G+A+  GL+FMRGPRRFLFR+T GR RS
Sbjct  66   HGVSQYQTYEDAFFSKVKDELVSAREHPAAATGVALTAGLLFMRGPRRFLFRHTFGRLRS  125

Query  414  EEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMN  560
            EEA F +AEKNV EL LS +LMKKES KL ERAALA  +M RG +EL N
Sbjct  126  EEAMFVRAEKNVNELNLSGELMKKESKKLLERAALAEKDMIRGETELKN  174



>ref|XP_002869612.1| hypothetical protein ARALYDRAFT_913923 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45871.1| hypothetical protein ARALYDRAFT_913923 [Arabidopsis lyrata subsp. 
lyrata]
Length=263

 Score =   196 bits (498),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/146 (65%), Positives = 114/146 (78%), Gaps = 0/146 (0%)
 Frame = +3

Query  123  EDLPRTVQESTDSAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEI  302
            +D  RTV+ESTDSA+RSAR  +  S+   RS+QDF+P   +QYK YE+A F KV +E+  
Sbjct  49   DDFQRTVKESTDSAMRSARSLRENSTSQFRSIQDFIPHALTQYKTYENAFFSKVTEELIY  108

Query  303  AREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMK  482
            A+EHPA   GI VA GL+ MRGPRRFLFR+TLGRF+SEEAQF KAEK+V+EL +SVDLMK
Sbjct  109  AKEHPAATVGIGVAAGLVLMRGPRRFLFRHTLGRFQSEEAQFLKAEKHVQELNMSVDLMK  168

Query  483  KESGKLFERAALAHTEMKRGHSELMN  560
            KES KL ER ALA  +MKRG SELMN
Sbjct  169  KESRKLLERTALAEKDMKRGLSELMN  194



>gb|KFK29159.1| hypothetical protein AALP_AA7G096800 [Arabis alpina]
Length=229

 Score =   192 bits (488),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 113/146 (77%), Gaps = 0/146 (0%)
 Frame = +3

Query  123  EDLPRTVQESTDSAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEI  302
            +D  RTV+ESTDSAIRSAR  +  S+   RS+QDF+P   +QYK YE+A F KV +E+  
Sbjct  15   DDFSRTVKESTDSAIRSARSLRENSTSQFRSIQDFIPHALTQYKTYENAFFSKVTEELVN  74

Query  303  AREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMK  482
            A+EHPA   GI +   L+ MRGPRRFLFRNTLGRF+SEEAQF +AEK+V+EL +SVDLMK
Sbjct  75   AKEHPAAAAGIGLTAALVLMRGPRRFLFRNTLGRFQSEEAQFLRAEKHVQELNMSVDLMK  134

Query  483  KESGKLFERAALAHTEMKRGHSELMN  560
            KES KL ERAALA  +MKRG SELM+
Sbjct  135  KESRKLLERAALAEKDMKRGLSELMD  160



>ref|XP_002299091.1| hypothetical protein POPTR_0001s03860g [Populus trichocarpa]
 gb|EEE83896.1| hypothetical protein POPTR_0001s03860g [Populus trichocarpa]
Length=239

 Score =   192 bits (488),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/152 (62%), Positives = 115/152 (76%), Gaps = 2/152 (1%)
 Frame = +3

Query  105  WHAYISEDLPRTVQESTDSAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKV  284
            W   + EDL RTV+ES DSAIRSA  FQ +SS HLRS QD +P+  S++ +YE+  F KV
Sbjct  21   WE--VMEDLQRTVKESKDSAIRSALSFQQSSSSHLRSFQDHVPEAISKFNSYENTFFSKV  78

Query  285  KDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRL  464
            K+E+  A++HPA   G+ +  GL  MRGPRRFLFRNTLGRF+SEEAQF +AEKNVKE   
Sbjct  79   KEELLTAKDHPAAAIGLTLTAGLFLMRGPRRFLFRNTLGRFQSEEAQFLRAEKNVKEFSF  138

Query  465  SVDLMKKESGKLFERAALAHTEMKRGHSELMN  560
            SVDLMKKES KL ERA+LA  EMK GH+EL++
Sbjct  139  SVDLMKKESRKLLERASLAEKEMKNGHTELLD  170



>ref|XP_007014648.1| Uncharacterized protein TCM_039966 [Theobroma cacao]
 gb|EOY32267.1| Uncharacterized protein TCM_039966 [Theobroma cacao]
Length=238

 Score =   192 bits (488),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/146 (65%), Positives = 113/146 (77%), Gaps = 0/146 (0%)
 Frame = +3

Query  123  EDLPRTVQESTDSAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEI  302
            E+L R++Q+S +SAI+SAR   + SS HLRSLQDF+P   S+YK+YEDA   K+K+E+  
Sbjct  24   EELQRSLQDSKESAIQSARSLHHNSSTHLRSLQDFVPHAFSRYKSYEDAFVNKLKEELMS  83

Query  303  AREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMK  482
            A+EHPA   GI V   L  M GPRR LFRNTLGRF+SEEAQF +AEKNVKEL LSVD+MK
Sbjct  84   AKEHPAAAIGITVTAALFLMPGPRRLLFRNTLGRFQSEEAQFLRAEKNVKELNLSVDMMK  143

Query  483  KESGKLFERAALAHTEMKRGHSELMN  560
            KES KL ERAALA  +MKRGH ELMN
Sbjct  144  KESSKLLERAALAEKDMKRGHKELMN  169



>ref|XP_011048149.1| PREDICTED: uncharacterized protein LOC105142285 [Populus euphratica]
Length=236

 Score =   192 bits (487),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/152 (62%), Positives = 115/152 (76%), Gaps = 2/152 (1%)
 Frame = +3

Query  105  WHAYISEDLPRTVQESTDSAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKV  284
            W   + EDL RTV+ES DSAIRSA  FQ +SS HLRS QD +P+  S++ +YE+  F KV
Sbjct  18   WE--VMEDLQRTVKESKDSAIRSAVSFQQSSSSHLRSFQDHVPEAISKFNSYENTFFSKV  75

Query  285  KDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRL  464
            K+E+  A++HPA   G+ +  GL  MRGPRRFLFRNTLGRF+SEEAQF +AEKNVKE   
Sbjct  76   KEELLTAKDHPAAAIGLTLTAGLFLMRGPRRFLFRNTLGRFQSEEAQFLRAEKNVKEYSF  135

Query  465  SVDLMKKESGKLFERAALAHTEMKRGHSELMN  560
            SVDLMKKES KL ERA+LA  EMK GH+EL++
Sbjct  136  SVDLMKKESRKLLERASLAEKEMKNGHTELLD  167



>ref|XP_002523392.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF38971.1| conserved hypothetical protein [Ricinus communis]
Length=265

 Score =   192 bits (487),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 95/146 (65%), Positives = 111/146 (76%), Gaps = 0/146 (0%)
 Frame = +3

Query  123  EDLPRTVQESTDSAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEI  302
            EDL RTV ES DSAIRSAR     SS  LRSLQD +PQ  S ++ YED+ F K+K+E+ I
Sbjct  51   EDLQRTVIESKDSAIRSARSLHQNSSSRLRSLQDHVPQALSLFRTYEDSFFNKIKEELMI  110

Query  303  AREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMK  482
            AREHP  V G+AV  G + MRGPRRFLFR+T GRF+SEEA+F K EKNVKEL LSVDLMK
Sbjct  111  AREHPVEVVGVAVTAGFLLMRGPRRFLFRHTFGRFQSEEARFLKTEKNVKELNLSVDLMK  170

Query  483  KESGKLFERAALAHTEMKRGHSELMN  560
             ES KL ERA+LA  +MK GH+ELM+
Sbjct  171  NESRKLLERASLAEKDMKHGHTELMD  196



>gb|KJB83394.1| hypothetical protein B456_013G245200 [Gossypium raimondii]
Length=193

 Score =   188 bits (477),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 100/169 (59%), Positives = 119/169 (70%), Gaps = 8/169 (5%)
 Frame = +3

Query  60   SSPAPAATPQQRDKPWHAYISEDLP--RTVQESTDSAIRSARLFQNTSSGHLRSLQDFLP  233
            ++  PAA      KPW     E+LP   ++ +S D AIRSA+   + SS HLRS QD LP
Sbjct  11   TATVPAANSST--KPW----VEELPTIESLIDSKDLAIRSAQSLFHNSSTHLRSFQDSLP  64

Query  234  QLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRS  413
            Q SS YK+YEDA F K+K+ V IA+E+P    GI +   L  MRGPRRFLFRNTLGRF+S
Sbjct  65   QASSHYKSYEDAFFSKLKEGVMIAKENPGAAVGITLTAALCLMRGPRRFLFRNTLGRFQS  124

Query  414  EEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMN  560
            EEA+F++AEKNVK L LSVDLMKKES KL ERAALA  +MKRG  ELMN
Sbjct  125  EEAKFSRAEKNVKVLNLSVDLMKKESSKLLERAALAEKDMKRGQKELMN  173



>gb|KJB83391.1| hypothetical protein B456_013G245200 [Gossypium raimondii]
Length=229

 Score =   187 bits (476),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 122/170 (72%), Gaps = 10/170 (6%)
 Frame = +3

Query  60   SSPAPAATPQQRDKPWHAYISEDLP--RTVQESTDSAIRSAR-LFQNTSSGHLRSLQDFL  230
            ++  PAA      KPW     E+LP   ++ +S D AIRSA+ LF N+S+ HLRS QD L
Sbjct  11   TATVPAANSST--KPW----VEELPTIESLIDSKDLAIRSAQSLFHNSST-HLRSFQDSL  63

Query  231  PQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFR  410
            PQ SS YK+YEDA F K+K+ V IA+E+P    GI +   L  MRGPRRFLFRNTLGRF+
Sbjct  64   PQASSHYKSYEDAFFSKLKEGVMIAKENPGAAVGITLTAALCLMRGPRRFLFRNTLGRFQ  123

Query  411  SEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMN  560
            SEEA+F++AEKNVK L LSVDLMKKES KL ERAALA  +MKRG  ELMN
Sbjct  124  SEEAKFSRAEKNVKVLNLSVDLMKKESSKLLERAALAEKDMKRGQKELMN  173



>gb|KJB83395.1| hypothetical protein B456_013G245200 [Gossypium raimondii]
Length=237

 Score =   187 bits (476),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 122/170 (72%), Gaps = 10/170 (6%)
 Frame = +3

Query  60   SSPAPAATPQQRDKPWHAYISEDLP--RTVQESTDSAIRSAR-LFQNTSSGHLRSLQDFL  230
            ++  PAA      KPW     E+LP   ++ +S D AIRSA+ LF N+S+ HLRS QD L
Sbjct  11   TATVPAANSST--KPW----VEELPTIESLIDSKDLAIRSAQSLFHNSST-HLRSFQDSL  63

Query  231  PQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFR  410
            PQ SS YK+YEDA F K+K+ V IA+E+P    GI +   L  MRGPRRFLFRNTLGRF+
Sbjct  64   PQASSHYKSYEDAFFSKLKEGVMIAKENPGAAVGITLTAALCLMRGPRRFLFRNTLGRFQ  123

Query  411  SEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMN  560
            SEEA+F++AEKNVK L LSVDLMKKES KL ERAALA  +MKRG  ELMN
Sbjct  124  SEEAKFSRAEKNVKVLNLSVDLMKKESSKLLERAALAEKDMKRGQKELMN  173



>gb|KJB83392.1| hypothetical protein B456_013G245200 [Gossypium raimondii]
Length=242

 Score =   187 bits (476),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 100/169 (59%), Positives = 119/169 (70%), Gaps = 8/169 (5%)
 Frame = +3

Query  60   SSPAPAATPQQRDKPWHAYISEDLP--RTVQESTDSAIRSARLFQNTSSGHLRSLQDFLP  233
            ++  PAA      KPW     E+LP   ++ +S D AIRSA+   + SS HLRS QD LP
Sbjct  11   TATVPAANSST--KPW----VEELPTIESLIDSKDLAIRSAQSLFHNSSTHLRSFQDSLP  64

Query  234  QLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRS  413
            Q SS YK+YEDA F K+K+ V IA+E+P    GI +   L  MRGPRRFLFRNTLGRF+S
Sbjct  65   QASSHYKSYEDAFFSKLKEGVMIAKENPGAAVGITLTAALCLMRGPRRFLFRNTLGRFQS  124

Query  414  EEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMN  560
            EEA+F++AEKNVK L LSVDLMKKES KL ERAALA  +MKRG  ELMN
Sbjct  125  EEAKFSRAEKNVKVLNLSVDLMKKESSKLLERAALAEKDMKRGQKELMN  173



>gb|KJB83396.1| hypothetical protein B456_013G245200 [Gossypium raimondii]
Length=239

 Score =   187 bits (474),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 100/169 (59%), Positives = 119/169 (70%), Gaps = 8/169 (5%)
 Frame = +3

Query  60   SSPAPAATPQQRDKPWHAYISEDLP--RTVQESTDSAIRSARLFQNTSSGHLRSLQDFLP  233
            ++  PAA      KPW     E+LP   ++ +S D AIRSA+   + SS HLRS QD LP
Sbjct  11   TATVPAANSST--KPW----VEELPTIESLIDSKDLAIRSAQSLFHNSSTHLRSFQDSLP  64

Query  234  QLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRS  413
            Q SS YK+YEDA F K+K+ V IA+E+P    GI +   L  MRGPRRFLFRNTLGRF+S
Sbjct  65   QASSHYKSYEDAFFSKLKEGVMIAKENPGAAVGITLTAALCLMRGPRRFLFRNTLGRFQS  124

Query  414  EEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMN  560
            EEA+F++AEKNVK L LSVDLMKKES KL ERAALA  +MKRG  ELMN
Sbjct  125  EEAKFSRAEKNVKVLNLSVDLMKKESSKLLERAALAEKDMKRGQKELMN  173



>gb|KHG03556.1| Chromosome-associated kinesin KIF4 [Gossypium arboreum]
Length=243

 Score =   185 bits (469),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 99/165 (60%), Positives = 116/165 (70%), Gaps = 8/165 (5%)
 Frame = +3

Query  72   PAATPQQRDKPWHAYISEDLP--RTVQESTDSAIRSARLFQNTSSGHLRSLQDFLPQLSS  245
            PAA      KPW     E+LP    + +S D AIRSA+   + SS HLR+ QD LPQ SS
Sbjct  16   PAANSST--KPW----VEELPTIENLIDSKDLAIRSAQSLFHNSSTHLRTFQDSLPQASS  69

Query  246  QYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQ  425
             YK+YEDA F K+K+ V IA+E+P    GI +   L  MRGPRRFLFRNTLGRF+SEEA+
Sbjct  70   YYKSYEDAFFSKLKEGVMIAKENPGAAVGITLTASLCLMRGPRRFLFRNTLGRFQSEEAK  129

Query  426  FNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMN  560
            F++AEKNVK L LSVDLMKKES KL ERAALA  +MKRG  ELMN
Sbjct  130  FSRAEKNVKVLSLSVDLMKKESSKLLERAALAEKDMKRGQKELMN  174



>ref|XP_010448277.1| PREDICTED: uncharacterized protein LOC104730768 [Camelina sativa]
Length=263

 Score =   185 bits (470),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 95/145 (66%), Positives = 113/145 (78%), Gaps = 0/145 (0%)
 Frame = +3

Query  126  DLPRTVQESTDSAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIA  305
            DL +TV+ESTDSA+RSAR F+  S+   RS+QDF+P   +QYK YE+A F KV +E+  A
Sbjct  50   DLQQTVKESTDSAMRSARSFRENSTSQFRSIQDFIPHALTQYKNYENAFFSKVTEELTYA  109

Query  306  REHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKK  485
            +EHPA   GI VA  L+ MRGPRRFLFR TLGRF+SEEAQF +AEK V+EL +SVDLMKK
Sbjct  110  KEHPAAAVGIGVAASLVLMRGPRRFLFRQTLGRFQSEEAQFLRAEKQVQELNMSVDLMKK  169

Query  486  ESGKLFERAALAHTEMKRGHSELMN  560
            ES KL ERA LA  +MKRGHSELMN
Sbjct  170  ESKKLLERATLAEKDMKRGHSELMN  194



>gb|KEH30817.1| hypothetical protein MTR_4g083250 [Medicago truncatula]
Length=240

 Score =   182 bits (462),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/134 (66%), Positives = 106/134 (79%), Gaps = 0/134 (0%)
 Frame = +3

Query  159  SAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIA  338
            SAI SAR  Q+ S+ H R+ Q+FLP   SQY+ YEDA F KVKD V +ARE+PA+  G+A
Sbjct  64   SAIESARTVQHNSTTHFRTFQNFLPGAVSQYRTYEDAFFNKVKDGVMVARENPAIGVGLA  123

Query  339  VATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAAL  518
            V+T L+ MRGPRRFLFR+TLGRF+SEEA++  AEKNVK+L LSVDL+KKES KL +R AL
Sbjct  124  VSTALLVMRGPRRFLFRHTLGRFQSEEARYASAEKNVKDLNLSVDLLKKESIKLLQRTAL  183

Query  519  AHTEMKRGHSELMN  560
            A  EMK GHSELMN
Sbjct  184  AEKEMKYGHSELMN  197



>ref|NP_194371.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AAO22774.1| unknown protein [Arabidopsis thaliana]
 gb|AAO42434.1| unknown protein [Arabidopsis thaliana]
 gb|AEE85195.1| uncharacterized protein AT4G26410 [Arabidopsis thaliana]
Length=263

 Score =   182 bits (463),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 95/145 (66%), Positives = 112/145 (77%), Gaps = 0/145 (0%)
 Frame = +3

Query  126  DLPRTVQESTDSAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIA  305
            DL RTV+ES D+A+RSAR  +  S+   RS+QDF+P   +QYK YE+A F KV DE+  A
Sbjct  50   DLQRTVKESKDTAMRSARSLRENSTSQFRSIQDFIPHALTQYKTYENAFFSKVTDELIYA  109

Query  306  REHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKK  485
            +EHPA   GI VA  L+ MRGPRRFLFRNTLGRF+SEEAQF KAEK+V+EL +SVDLMKK
Sbjct  110  KEHPAAAIGIGVAASLVLMRGPRRFLFRNTLGRFQSEEAQFLKAEKHVQELNMSVDLMKK  169

Query  486  ESGKLFERAALAHTEMKRGHSELMN  560
            ES KL ER ALA  +MKRG SELMN
Sbjct  170  ESRKLLERTALAEKDMKRGLSELMN  194



>gb|KDP30630.1| hypothetical protein JCGZ_16195 [Jatropha curcas]
Length=226

 Score =   181 bits (459),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 108/146 (74%), Gaps = 0/146 (0%)
 Frame = +3

Query  123  EDLPRTVQESTDSAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEI  302
            EDL RTV +S DSAIRSA  FQ  SS HLRSLQD LP+  SQ+K YEDA   K+K+E+  
Sbjct  12   EDLQRTVIQSKDSAIRSACSFQQNSSFHLRSLQDHLPRAVSQFKTYEDAFVNKIKEELMS  71

Query  303  AREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMK  482
            AREHP    G+AV  GL+ MRGPRR LFR T GR +SEEA+F KAEKN+KEL LSVDLMK
Sbjct  72   AREHPVETVGVAVTAGLLLMRGPRRLLFRQTFGRLQSEEAKFLKAEKNLKELTLSVDLMK  131

Query  483  KESGKLFERAALAHTEMKRGHSELMN  560
             ES KL ERA+ A  +MK G +EL++
Sbjct  132  NESRKLLERASYAEKDMKHGLTELLD  157



>ref|XP_003607819.1| hypothetical protein MTR_4g083250 [Medicago truncatula]
 gb|AES90016.1| hypothetical protein MTR_4g083250 [Medicago truncatula]
 gb|AFK36915.1| unknown [Medicago truncatula]
Length=266

 Score =   182 bits (462),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/134 (66%), Positives = 106/134 (79%), Gaps = 0/134 (0%)
 Frame = +3

Query  159  SAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIA  338
            SAI SAR  Q+ S+ H R+ Q+FLP   SQY+ YEDA F KVKD V +ARE+PA+  G+A
Sbjct  64   SAIESARTVQHNSTTHFRTFQNFLPGAVSQYRTYEDAFFNKVKDGVMVARENPAIGVGLA  123

Query  339  VATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAAL  518
            V+T L+ MRGPRRFLFR+TLGRF+SEEA++  AEKNVK+L LSVDL+KKES KL +R AL
Sbjct  124  VSTALLVMRGPRRFLFRHTLGRFQSEEARYASAEKNVKDLNLSVDLLKKESIKLLQRTAL  183

Query  519  AHTEMKRGHSELMN  560
            A  EMK GHSELMN
Sbjct  184  AEKEMKYGHSELMN  197



>ref|XP_010438763.1| PREDICTED: uncharacterized protein LOC104722317 [Camelina sativa]
Length=263

 Score =   182 bits (461),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 113/145 (78%), Gaps = 0/145 (0%)
 Frame = +3

Query  126  DLPRTVQESTDSAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIA  305
            DL +TV+ESTDSA+RSAR F+  S+   RS+QDF+P   +QYK YE+A F KV +E+  A
Sbjct  50   DLQQTVKESTDSAMRSARSFRENSTSQFRSIQDFIPHALTQYKTYENAFFSKVTEELTYA  109

Query  306  REHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKK  485
            +EHPA   GI VA  L+ MRGPRRFLFR TLGRF+SEEAQF +AEK+V+EL +SVDLMKK
Sbjct  110  KEHPAAAVGIGVAASLVLMRGPRRFLFRQTLGRFQSEEAQFLRAEKHVQELNMSVDLMKK  169

Query  486  ESGKLFERAALAHTEMKRGHSELMN  560
            ES KL ERA LA  +MKRG SELMN
Sbjct  170  ESKKLLERATLAEKDMKRGLSELMN  194



>ref|XP_010433511.1| PREDICTED: uncharacterized protein LOC104717609 [Camelina sativa]
Length=263

 Score =   181 bits (460),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 113/145 (78%), Gaps = 0/145 (0%)
 Frame = +3

Query  126  DLPRTVQESTDSAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIA  305
            DL +TV+ESTDSA+RSAR F+  S+   RS+QDF+P   +QYK YE+A F KV +E+  A
Sbjct  50   DLQQTVKESTDSAMRSARSFRENSTSQFRSIQDFIPHALTQYKTYENAFFSKVTEELTYA  109

Query  306  REHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKK  485
            +EHPA   GI VA  L+ MRGPRRFLFR TLGRF+SEEAQF +AEK+V+EL +SVDLMKK
Sbjct  110  KEHPAAAVGIGVAASLVLMRGPRRFLFRQTLGRFQSEEAQFLRAEKHVQELNMSVDLMKK  169

Query  486  ESGKLFERAALAHTEMKRGHSELMN  560
            ES KL ERA LA  +MKRG SELMN
Sbjct  170  ESKKLLERATLAEKDMKRGLSELMN  194



>ref|XP_006284348.1| hypothetical protein CARUB_v10005520mg [Capsella rubella]
 gb|EOA17246.1| hypothetical protein CARUB_v10005520mg [Capsella rubella]
Length=263

 Score =   181 bits (460),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 94/146 (64%), Positives = 115/146 (79%), Gaps = 0/146 (0%)
 Frame = +3

Query  123  EDLPRTVQESTDSAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEI  302
            +DL RTV+++TDSA+RSAR  +  S+ H RS+QDF+P   +QYK YE+A F KV +E+  
Sbjct  49   DDLQRTVKDTTDSAMRSARSLRENSTSHFRSIQDFIPHALTQYKTYENAFFSKVTEELIY  108

Query  303  AREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMK  482
            A+EHPA   GI VA GL+ MRGPRRFLFR TLGRF+SEEAQF +AEK+V+EL +SVDLMK
Sbjct  109  AKEHPAAAVGIGVAAGLVLMRGPRRFLFRQTLGRFQSEEAQFLRAEKHVQELNMSVDLMK  168

Query  483  KESGKLFERAALAHTEMKRGHSELMN  560
            KES KL ER ALA  +MKRG SELMN
Sbjct  169  KESKKLLERTALAEKDMKRGLSELMN  194



>ref|XP_010673453.1| PREDICTED: uncharacterized protein LOC104889828 [Beta vulgaris 
subsp. vulgaris]
Length=248

 Score =   181 bits (458),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 89/169 (53%), Positives = 116/169 (69%), Gaps = 3/169 (2%)
 Frame = +3

Query  54   ETSSPAPAATPQQRDKPWHAYISEDLPRTVQESTDSAIRSARLFQNTSSGHLRSLQDFLP  233
            ET    P   P    KPWH+YIS+DLPR+  ES D+AIRSAR   + SS  LR +QD +P
Sbjct  14   ETKREDPTRQP---SKPWHSYISDDLPRSFMESADAAIRSARSLHHDSSTRLRFMQDLIP  70

Query  234  QLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRS  413
            ++  ++  YE+A  +K KD +    +HP +  GI +AT  + MRGPRRFLF++T+GR +S
Sbjct  71   EVKFKFSNYEEACIKKFKDGLATGLQHPTMTVGITLATVFLLMRGPRRFLFQHTVGRLQS  130

Query  414  EEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMN  560
            EE QF +AEK+VK L LSVDLMKKES KL ERA+LA  EM  G ++LMN
Sbjct  131  EEVQFVRAEKSVKMLELSVDLMKKESRKLLERASLAEKEMINGQTDLMN  179



>ref|XP_009137593.1| PREDICTED: uncharacterized protein LOC103861626 [Brassica rapa]
Length=254

 Score =   179 bits (453),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 89/142 (63%), Positives = 108/142 (76%), Gaps = 3/142 (2%)
 Frame = +3

Query  135  RTVQESTDSAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIAREH  314
            RTV+ESTDSAIRS R     S+   RS+QD +P   + YK YE+A F KV +E+  A+EH
Sbjct  47   RTVKESTDSAIRSLR---ENSTSQFRSIQDLIPHALTHYKTYENAFFSKVTEELVNAKEH  103

Query  315  PAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESG  494
            PA   GI +A GL+ MRGPRRFLFR TLGRF+SEEAQF +AEK+V+EL +SVDLMKKES 
Sbjct  104  PAASAGIGLAAGLVLMRGPRRFLFRRTLGRFQSEEAQFLRAEKHVQELNMSVDLMKKESS  163

Query  495  KLFERAALAHTEMKRGHSELMN  560
            KL ER+ALA  +MKRG SELM+
Sbjct  164  KLLERSALAEKDMKRGLSELMD  185



>emb|CDY42739.1| BnaA03g48000D [Brassica napus]
Length=254

 Score =   177 bits (450),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 89/142 (63%), Positives = 108/142 (76%), Gaps = 3/142 (2%)
 Frame = +3

Query  135  RTVQESTDSAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIAREH  314
            RTV+ESTDSAIRS R     S+   RS+QD +P   + YK YE+A F KV +E+  A+EH
Sbjct  47   RTVKESTDSAIRSLR---ENSTSQFRSIQDLIPHALTHYKTYENAFFSKVTEELVNAKEH  103

Query  315  PAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESG  494
            PA   GI +A GL+ MRGPRRFLFR TLGRF+SEEAQF +AEK+V+EL +SVDLMKKES 
Sbjct  104  PAASAGIGLAAGLVLMRGPRRFLFRRTLGRFQSEEAQFLRAEKHVQELNMSVDLMKKESM  163

Query  495  KLFERAALAHTEMKRGHSELMN  560
            KL ER+ALA  +MKRG SELM+
Sbjct  164  KLLERSALAEKDMKRGLSELMD  185



>gb|EPS63583.1| hypothetical protein M569_11194 [Genlisea aurea]
Length=236

 Score =   177 bits (448),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 88/155 (57%), Positives = 113/155 (73%), Gaps = 2/155 (1%)
 Frame = +3

Query  99   KPWHAYISEDLPRTVQESTDSAIRSARLFQNTSSGHLRSL-QDFLPQLSSQYKAYEDALF  275
            K WH+YISED+PR  ++S D+AIRSAR  Q ++S   R+L Q+F+PQ+   Y+ YE+A F
Sbjct  14   KAWHSYISEDIPRNFKDSADAAIRSARSIQESTSSIGRNLFQEFIPQIGPTYRYYEEAFF  73

Query  276  QKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKE  455
             K KDEV   R++P +  G+AVA  L  MRGPRRFL R TL R +SEEA+F +AEKNV E
Sbjct  74   NKAKDEVVYLRDNPPLAAGLAVAC-LFLMRGPRRFLLRQTLHRLQSEEARFVRAEKNVNE  132

Query  456  LRLSVDLMKKESGKLFERAALAHTEMKRGHSELMN  560
            L LSV+LMKKE  KLF+R+ LA  +MK G+S LMN
Sbjct  133  LNLSVELMKKEGVKLFQRSMLAEKDMKHGYSSLMN  167



>ref|XP_004505352.1| PREDICTED: uncharacterized protein LOC101513717 [Cicer arietinum]
Length=233

 Score =   174 bits (442),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 84/134 (63%), Positives = 103/134 (77%), Gaps = 0/134 (0%)
 Frame = +3

Query  159  SAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIA  338
            SAI SAR  Q+ SS H R+ Q+FLP+  SQY  YEDA F KVKD + + RE+PA+  G+A
Sbjct  31   SAIESARSMQHNSSTHFRTFQNFLPEAVSQYITYEDAFFNKVKDGLMVGRENPALGVGLA  90

Query  339  VATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAAL  518
            ++  L+ MR PRRFLFRNTLGRF+SEEA++  AEKNVK+L LSVDL+KKES KL +R AL
Sbjct  91   ISAALLVMRAPRRFLFRNTLGRFQSEEARYASAEKNVKDLNLSVDLLKKESIKLLQRTAL  150

Query  519  AHTEMKRGHSELMN  560
            A  EMK GH+ELMN
Sbjct  151  AEKEMKYGHNELMN  164



>ref|XP_006413188.1| hypothetical protein EUTSA_v10026011mg [Eutrema salsugineum]
 gb|ESQ54641.1| hypothetical protein EUTSA_v10026011mg [Eutrema salsugineum]
Length=261

 Score =   174 bits (442),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 114/146 (78%), Gaps = 0/146 (0%)
 Frame = +3

Query  123  EDLPRTVQESTDSAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEI  302
            +D  RTV+ES DSAIRSAR  +  S+   RS+QDF+P   +QYK YE+A F KV +E+  
Sbjct  47   DDFQRTVKESKDSAIRSARSLRENSTSQFRSIQDFIPHALTQYKTYENAFFSKVTEELIY  106

Query  303  AREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMK  482
            A+EHPA   GI +A GL+ MRGPRRFLFR+TLGRF+SEEAQF KAEK+V+EL +SVDLMK
Sbjct  107  AKEHPAAAAGIGLAAGLVLMRGPRRFLFRHTLGRFQSEEAQFLKAEKHVQELNMSVDLMK  166

Query  483  KESGKLFERAALAHTEMKRGHSELMN  560
            KES KL ER+ALA  +MKRG SELM+
Sbjct  167  KESRKLLERSALAEKDMKRGLSELMD  192



>ref|XP_003556589.1| PREDICTED: uncharacterized protein LOC100780119 [Glycine max]
Length=230

 Score =   172 bits (435),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/150 (56%), Positives = 112/150 (75%), Gaps = 7/150 (5%)
 Frame = +3

Query  111  AYISEDLPRTVQESTDSAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKD  290
            A I+E+L R       SAI+SAR  Q++SS H R+ Q+FLP+  SQY+ YEDA   KVKD
Sbjct  19   ASIAENLQR-------SAIQSARTVQHSSSTHFRAFQNFLPEAVSQYRTYEDAFVNKVKD  71

Query  291  EVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSV  470
             + IA+E+PAV  G+A++  L+ MR PRRFLFR+TLGRF+SEEA++ + EKNVK+L LSV
Sbjct  72   GLMIAKENPAVSAGVAISAALLAMRAPRRFLFRHTLGRFQSEEARYARIEKNVKDLNLSV  131

Query  471  DLMKKESGKLFERAALAHTEMKRGHSELMN  560
            DL+KKE+ KL +R  LA  EMK GH+EL++
Sbjct  132  DLLKKENAKLLQRTTLAEKEMKYGHTELVS  161



>gb|KHN20511.1| hypothetical protein glysoja_029524 [Glycine soja]
Length=237

 Score =   172 bits (436),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/150 (56%), Positives = 112/150 (75%), Gaps = 7/150 (5%)
 Frame = +3

Query  111  AYISEDLPRTVQESTDSAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKD  290
            A I+E+L R       SAI+SAR  Q++SS H R+ Q+FLP+  SQY+ YEDA   KVKD
Sbjct  19   ASIAENLQR-------SAIQSARTVQHSSSTHFRAFQNFLPEAVSQYRTYEDAFVNKVKD  71

Query  291  EVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSV  470
             + IA+E+PAV  G+A++  L+ MR PRRFLFR+TLGRF+SEEA++ + EKNVK+L LSV
Sbjct  72   GLMIAKENPAVSAGVAISAALLAMRAPRRFLFRHTLGRFQSEEARYARIEKNVKDLNLSV  131

Query  471  DLMKKESGKLFERAALAHTEMKRGHSELMN  560
            DL+KKE+ KL +R  LA  EMK GH+EL++
Sbjct  132  DLLKKENAKLLQRTTLAEKEMKYGHTELVS  161



>emb|CDX89342.1| BnaA01g15510D [Brassica napus]
Length=261

 Score =   172 bits (437),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 100/194 (52%), Positives = 129/194 (66%), Gaps = 19/194 (10%)
 Frame = +3

Query  27   SDVPSTEIDETSSPAPAATPQQRDKPWHAYIS----------------EDLPRTVQESTD  158
            SD  +  + + S+PA A +    D   H  I                 +DL RTV+ESTD
Sbjct  2    SDTEANGVTDDSAPANAVSA---DATEHKAIGVIESVEEAVGGAEKWVDDLQRTVKESTD  58

Query  159  SAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIA  338
            SA+RSAR  +  S+   RS+QDF+P   +QYK YE+  F KV +E+  A+E+PA   GI 
Sbjct  59   SAMRSARSLRENSTSQFRSIQDFIPHALNQYKTYENVFFSKVTEELRNAKENPAAAAGIG  118

Query  339  VATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAAL  518
            +A GL+ MRGPRRFLFR+TLGRF+SEEAQF +AEK+V+EL +SVDLMKKES KL ER+AL
Sbjct  119  LAAGLVLMRGPRRFLFRHTLGRFQSEEAQFLRAEKHVQELNMSVDLMKKESMKLLERSAL  178

Query  519  AHTEMKRGHSELMN  560
            A  +MKRG SELM+
Sbjct  179  AEKDMKRGLSELMD  192



>gb|ACU19454.1| unknown [Glycine max]
Length=230

 Score =   172 bits (435),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/150 (56%), Positives = 112/150 (75%), Gaps = 7/150 (5%)
 Frame = +3

Query  111  AYISEDLPRTVQESTDSAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKD  290
            A I+E+L R       SAI+SAR  Q++SS H R+ Q+FLP+  SQY+ YEDA   KVKD
Sbjct  19   ASIAENLQR-------SAIQSARTVQHSSSTHFRAFQNFLPEAVSQYRTYEDAFVNKVKD  71

Query  291  EVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSV  470
             + IA+E+PAV  G+A++  L+ MR PRRFLFR+TLGRF+SEEA++ + EKNVK+L LSV
Sbjct  72   GLMIAKENPAVSAGVAISVALLAMRAPRRFLFRHTLGRFQSEEARYARIEKNVKDLNLSV  131

Query  471  DLMKKESGKLFERAALAHTEMKRGHSELMN  560
            DL+KKE+ KL +R  LA  EMK GH+EL++
Sbjct  132  DLLKKENAKLLQRTTLAEKEMKYGHTELVS  161



>ref|XP_009142234.1| PREDICTED: uncharacterized protein LOC103866109 [Brassica rapa]
Length=261

 Score =   172 bits (437),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 100/194 (52%), Positives = 129/194 (66%), Gaps = 19/194 (10%)
 Frame = +3

Query  27   SDVPSTEIDETSSPAPAATPQQRDKPWHAYIS----------------EDLPRTVQESTD  158
            SD  +  + + S+PA A +    D   H  I                 +DL RTV+ESTD
Sbjct  2    SDTEANGVTDDSAPANAVSA---DATEHKAIGVIESVEEAVGGAEKWVDDLQRTVKESTD  58

Query  159  SAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIA  338
            SA+RSAR  +  S+   RS+QDF+P   +QYK YE+  F KV +E+  A+E+PA   GI 
Sbjct  59   SAMRSARSLRENSTSQFRSIQDFIPHALNQYKTYENVFFSKVTEELRNAKENPAAAAGIG  118

Query  339  VATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAAL  518
            +A GL+ MRGPRRFLFR+TLGRF+SEEAQF +AEK+V+EL +SVDLMKKES KL ER+AL
Sbjct  119  LAAGLVLMRGPRRFLFRHTLGRFQSEEAQFLRAEKHVQELNMSVDLMKKESVKLLERSAL  178

Query  519  AHTEMKRGHSELMN  560
            A  +MKRG SELM+
Sbjct  179  AEKDMKRGLSELMD  192



>ref|XP_006829819.1| hypothetical protein AMTR_s00119p00084860 [Amborella trichopoda]
 gb|ERM97235.1| hypothetical protein AMTR_s00119p00084860 [Amborella trichopoda]
Length=292

 Score =   172 bits (437),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 91/183 (50%), Positives = 122/183 (67%), Gaps = 9/183 (5%)
 Frame = +3

Query  27   SDVPSTEIDETSSPAPAATPQQR--DKPWHAYISED---LPRTVQESTDSAIRSARLFQN  191
            ++  S+E   +S+   A T + +  +KPWH Y +E    L R+V ES     +SA   Q 
Sbjct  45   AETTSSEALSSSTETGALTHELKPLNKPWHVYTTEQAEGLRRSVVES----FQSAPSLQQ  100

Query  192  TSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGP  371
                H  +LQDF+PQL S+Y  YEDA F+K K+E+ ++REHP    GIAVATGL+ +RGP
Sbjct  101  YFPLHFSTLQDFIPQLKSKYHVYEDAFFKKAKEELMVSREHPIETIGIAVATGLLLLRGP  160

Query  372  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  551
            RRFLFR+T GR +SEEAQ+ + EK + EL LS+DLMKKES KL +RA  A  EM+RGH++
Sbjct  161  RRFLFRHTFGRLQSEEAQYVRTEKRLTELGLSLDLMKKESKKLLQRATFAEDEMRRGHAK  220

Query  552  LMN  560
            L N
Sbjct  221  LKN  223



>ref|XP_007157828.1| hypothetical protein PHAVU_002G101500g [Phaseolus vulgaris]
 gb|ESW29822.1| hypothetical protein PHAVU_002G101500g [Phaseolus vulgaris]
Length=241

 Score =   169 bits (427),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/153 (54%), Positives = 111/153 (73%), Gaps = 7/153 (5%)
 Frame = +3

Query  102  PWHAYISEDLPRTVQESTDSAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQK  281
            P  A I+E+L R       SAI+SAR  Q++SS    + Q+ LP+ +SQY+ YEDA F K
Sbjct  20   PSLATIAENLQR-------SAIQSARTVQHSSSTQFHAFQNSLPEAASQYRTYEDAFFNK  72

Query  282  VKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELR  461
            VKD + I +E+PA+  G+A++  L+ MR PRRFLFR TLGRF+SEEA++ + EK+VK+  
Sbjct  73   VKDGLMIVKENPALGAGVAISAALLVMRAPRRFLFRQTLGRFQSEEARYARTEKSVKDFN  132

Query  462  LSVDLMKKESGKLFERAALAHTEMKRGHSELMN  560
            LSVDL+KKESGKL +R ALA  EMK GHSEL++
Sbjct  133  LSVDLLKKESGKLLQRTALAEKEMKYGHSELLS  165



>emb|CDX94341.1| BnaC01g18430D [Brassica napus]
Length=261

 Score =   168 bits (425),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 115/146 (79%), Gaps = 0/146 (0%)
 Frame = +3

Query  123  EDLPRTVQESTDSAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEI  302
            +DL RTV+ES DSA+RSAR  +  S+   RS+QDF+P   +QYK YE+A F KV +E+  
Sbjct  47   DDLQRTVKESKDSAMRSARSLRENSTSQFRSIQDFIPHALTQYKTYENAFFSKVTEELRN  106

Query  303  AREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMK  482
            A+E+PA   GI +A GL+ MRGPRRFLFR+TLGRF+SEEAQF +AEK+V+EL +SVDLMK
Sbjct  107  AKENPAAAAGIGLAAGLLLMRGPRRFLFRHTLGRFQSEEAQFLRAEKHVQELNMSVDLMK  166

Query  483  KESGKLFERAALAHTEMKRGHSELMN  560
            KES KL ER+ALA  +MKRG SELM+
Sbjct  167  KESMKLLERSALAEKDMKRGLSELMD  192



>ref|XP_003529452.1| PREDICTED: uncharacterized protein LOC100808143 [Glycine max]
Length=231

 Score =   164 bits (414),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 82/150 (55%), Positives = 110/150 (73%), Gaps = 7/150 (5%)
 Frame = +3

Query  111  AYISEDLPRTVQESTDSAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKD  290
            A I+E+L R       SAI+SAR  Q+++  H R+ Q+FLP+   QY+ YEDA   KVKD
Sbjct  20   ASIAENLQR-------SAIQSARTVQHSTINHFRAFQNFLPEAVPQYRTYEDAFVNKVKD  72

Query  291  EVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSV  470
             + IA+E+PA+  G+AV+  L+ MR PRRFLFR+TLGRF+SEE ++ + EKNVK+L LSV
Sbjct  73   GLMIAKENPALSAGLAVSGALLAMRAPRRFLFRHTLGRFQSEEVRYARTEKNVKDLGLSV  132

Query  471  DLMKKESGKLFERAALAHTEMKRGHSELMN  560
            DL+KKES KL +R ALA  EMK GH+EL++
Sbjct  133  DLLKKESVKLLQRTALAEKEMKYGHTELVS  162



>gb|KHN42956.1| hypothetical protein glysoja_007486 [Glycine soja]
Length=264

 Score =   164 bits (414),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 82/150 (55%), Positives = 110/150 (73%), Gaps = 7/150 (5%)
 Frame = +3

Query  111  AYISEDLPRTVQESTDSAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKD  290
            A I+E+L R       SAI+SAR  Q+++  H R+ Q+FLP+   QY+ YEDA   KVKD
Sbjct  58   ASIAENLQR-------SAIQSARTVQHSTINHFRAFQNFLPEAVPQYRTYEDAFVNKVKD  110

Query  291  EVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSV  470
             + IA+E+PA+  G+AV+  L+ MR PRRFLFR+TLGRF+SEE ++ + EKNVK+L LSV
Sbjct  111  GLMIAKENPALSAGLAVSGALLAMRAPRRFLFRHTLGRFQSEEVRYARTEKNVKDLGLSV  170

Query  471  DLMKKESGKLFERAALAHTEMKRGHSELMN  560
            DL+KKES KL +R ALA  EMK GH+EL++
Sbjct  171  DLLKKESVKLLQRTALAEKEMKYGHTELVS  200



>emb|CDX92771.1| BnaC07g40290D [Brassica napus]
Length=263

 Score =   162 bits (409),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 92/156 (59%), Positives = 111/156 (71%), Gaps = 14/156 (9%)
 Frame = +3

Query  135  RTVQESTDSAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIAREH  314
            RTV+ESTDSAIRSAR  +  S+   RS+QD +P   +QYK YE+A F KV +E+  A+EH
Sbjct  39   RTVKESTDSAIRSARSLRENSTSQFRSVQDLIPHALTQYKTYENAFFSKVTEELINAKEH  98

Query  315  PAVVGGIAVATGLIFMRG--------------PRRFLFRNTLGRFRSEEAQFNKAEKNVK  452
            PA   GI +A GL+ MRG              PRRFLFR TLGRF+SEEAQF +AEK+V+
Sbjct  99   PAAAAGIGLAAGLVLMRGITTSSLIYFLNLFCPRRFLFRRTLGRFQSEEAQFLRAEKHVQ  158

Query  453  ELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMN  560
            EL +SVDLMKKES KL ER+ALA  +MKRG SELMN
Sbjct  159  ELNMSVDLMKKESSKLLERSALAEKDMKRGLSELMN  194



>ref|XP_003607823.1| hypothetical protein MTR_4g083290 [Medicago truncatula]
Length=353

 Score =   162 bits (410),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 94/117 (80%), Gaps = 0/117 (0%)
 Frame = +3

Query  210  RSLQDFLPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFR  389
            R  ++FLP   SQY+ YEDA F KVKD V +ARE+PA+  G+AV+T L+ MRGPRRFLFR
Sbjct  168  RKEENFLPGAVSQYRTYEDAFFNKVKDGVMVARENPAIGVGLAVSTALLVMRGPRRFLFR  227

Query  390  NTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMN  560
            +TLGRF+SEEA++  AEKNVK+L LSVDL+KKES KL +R ALA  EMK GHSELMN
Sbjct  228  HTLGRFQSEEARYASAEKNVKDLNLSVDLLKKESIKLLQRTALAEKEMKYGHSELMN  284



>ref|XP_010105296.1| hypothetical protein L484_002346 [Morus notabilis]
 gb|EXC04261.1| hypothetical protein L484_002346 [Morus notabilis]
Length=226

 Score =   157 bits (397),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 92/183 (50%), Positives = 111/183 (61%), Gaps = 28/183 (15%)
 Frame = +3

Query  12   LKEMASDVPSTEIDETSSPAPAATPQQRD-KPWHAYISEDLPRTVQESTDSAIRSARLFQ  188
            + E A++  S E D + SPA  +  ++R+ +   A ++EDL R V  STDSAIRSAR   
Sbjct  1    MAETATESSSGE-DLSVSPASESKKKERNERQTLASMAEDLQRNVISSTDSAIRSARSLH  59

Query  189  NTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRG  368
            + SS H R+LQ+F+    S YK YED  F  VK                          G
Sbjct  60   HNSSAHFRNLQEFVANAKSHYKTYEDTFFNTVK--------------------------G  93

Query  369  PRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHS  548
            PRRFLFR+TLGR RSEEAQF KAEKNVKEL LSVD+MK ES KL ERAALA  +MK GH+
Sbjct  94   PRRFLFRHTLGRLRSEEAQFVKAEKNVKELSLSVDVMKNESRKLLERAALAEKDMKYGHT  153

Query  549  ELM  557
            ELM
Sbjct  154  ELM  156



>ref|XP_006413187.1| hypothetical protein EUTSA_v10026011mg [Eutrema salsugineum]
 gb|ESQ54640.1| hypothetical protein EUTSA_v10026011mg [Eutrema salsugineum]
Length=245

 Score =   154 bits (389),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 82/129 (64%), Positives = 100/129 (78%), Gaps = 0/129 (0%)
 Frame = +3

Query  123  EDLPRTVQESTDSAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEI  302
            +D  RTV+ES DSAIRSAR  +  S+   RS+QDF+P   +QYK YE+A F KV +E+  
Sbjct  47   DDFQRTVKESKDSAIRSARSLRENSTSQFRSIQDFIPHALTQYKTYENAFFSKVTEELIY  106

Query  303  AREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMK  482
            A+EHPA   GI +A GL+ MRGPRRFLFR+TLGRF+SEEAQF KAEK+V+EL +SVDLMK
Sbjct  107  AKEHPAAAAGIGLAAGLVLMRGPRRFLFRHTLGRFQSEEAQFLKAEKHVQELNMSVDLMK  166

Query  483  KESGKLFER  509
            KES KL ER
Sbjct  167  KESRKLLER  175



>gb|KDO54526.1| hypothetical protein CISIN_1g025242mg [Citrus sinensis]
Length=250

 Score =   153 bits (386),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 86/114 (75%), Gaps = 0/114 (0%)
 Frame = +3

Query  219  QDFLPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTL  398
            QDF+    SQY+ YEDA F KVKDE+  AREHPA   G+A+  GL+FMRGPRRFLFR+T 
Sbjct  68   QDFVLHGVSQYQTYEDAFFSKVKDELVSAREHPAAATGVALTAGLLFMRGPRRFLFRHTF  127

Query  399  GRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMN  560
            GR RSEEA F +AEKNV EL LS +LMKKES KL ERAALA  EM RG +EL N
Sbjct  128  GRLRSEEAMFVRAEKNVNELNLSGELMKKESKKLLERAALAEKEMIRGETELKN  181



>ref|XP_004294933.1| PREDICTED: uncharacterized protein LOC101308945 [Fragaria vesca 
subsp. vesca]
Length=249

 Score =   151 bits (381),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 76/145 (52%), Positives = 101/145 (70%), Gaps = 7/145 (5%)
 Frame = +3

Query  126  DLPRTVQESTDSAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIA  305
            DL R+V +S DSA+RSAR+ Q+   G       ++ + +S+Y+ YE A F K+K+ V+ A
Sbjct  43   DLQRSVMQSRDSAMRSARILQHNMPG-------YIDKAASKYRTYEHAFFHKIKEGVKRA  95

Query  306  REHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKK  485
             E+PA   GI +    IF+RGPRRFLFRNTLGRF+S EA++ KAEKNV +L LSVDLMK+
Sbjct  96   AENPASTIGIGLTAAFIFLRGPRRFLFRNTLGRFQSLEAKYAKAEKNVNQLNLSVDLMKQ  155

Query  486  ESGKLFERAALAHTEMKRGHSELMN  560
            ES KL ERA  A   MK G ++LM+
Sbjct  156  ESKKLLERAGYAEKHMKVGQTDLMD  180



>ref|XP_008220369.1| PREDICTED: uncharacterized protein LOC103320436 [Prunus mume]
Length=263

 Score =   150 bits (378),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 82/150 (55%), Positives = 97/150 (65%), Gaps = 15/150 (10%)
 Frame = +3

Query  123  EDLPRTVQESTDSAIRSARLFQNTSSGHLRSLQDFLPQLS----SQYKAYEDALFQKVKD  290
            EDL RTV +STDSAIRSAR           SLQ  LPQ      S Y+ YE+A F K+K+
Sbjct  56   EDLQRTVMQSTDSAIRSAR-----------SLQHHLPQYVEKAVSDYRTYENAFFTKIKE  104

Query  291  EVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSV  470
             +  AREHPA   GI +    + + GPRRF  R T  R +SEEAQF +AEKNVKEL LSV
Sbjct  105  GLMSAREHPASTLGIGLTAAFLLLPGPRRFFIRQTFSRLQSEEAQFVRAEKNVKELNLSV  164

Query  471  DLMKKESGKLFERAALAHTEMKRGHSELMN  560
            DLMKKES KL ERA LA  +MK G ++LM+
Sbjct  165  DLMKKESKKLLERALLAEKDMKYGQTDLMD  194



>ref|XP_007205735.1| hypothetical protein PRUPE_ppa010110mg [Prunus persica]
 gb|EMJ06934.1| hypothetical protein PRUPE_ppa010110mg [Prunus persica]
Length=263

 Score =   148 bits (374),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 81/150 (54%), Positives = 96/150 (64%), Gaps = 15/150 (10%)
 Frame = +3

Query  123  EDLPRTVQESTDSAIRSARLFQNTSSGHLRSLQDFLPQLS----SQYKAYEDALFQKVKD  290
            EDL RTV +STDSAIRSAR           SLQ  LPQ      S Y+ YE+A F K+K+
Sbjct  56   EDLQRTVMQSTDSAIRSAR-----------SLQHHLPQYVEKAVSDYRTYENAFFTKIKE  104

Query  291  EVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSV  470
             +  AREHP    GI +    + + GPRRF  R T  R +SEEAQF +AEKNVKEL LSV
Sbjct  105  GLMSAREHPTSTLGIGLTAAFLLLPGPRRFFIRQTFSRLQSEEAQFVRAEKNVKELNLSV  164

Query  471  DLMKKESGKLFERAALAHTEMKRGHSELMN  560
            DLMKKES KL ERA LA  +MK G ++LM+
Sbjct  165  DLMKKESKKLLERALLAEKDMKYGQTDLMD  194



>ref|XP_009589516.1| PREDICTED: uncharacterized protein LOC104086877 [Nicotiana tomentosiformis]
Length=234

 Score =   141 bits (356),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 67/115 (58%), Positives = 84/115 (73%), Gaps = 5/115 (4%)
 Frame = +3

Query  87   QQRDKPWHAYISEDLPRTVQESTDSAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYED  266
            Q +DK WH+YISEDLPRTVQESTDSA+RSAR  Q TSS HLR+LQDF+P++ +QY  YE+
Sbjct  23   QNKDKAWHSYISEDLPRTVQESTDSALRSARSIQYTSSTHLRTLQDFMPKIKAQYTTYEE  82

Query  267  ALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFN  431
              F+K+KDE+  AREHPA+ GGI +A  L+ MRG      R+T GR  S    F+
Sbjct  83   VFFKKIKDELVTAREHPAMAGGIGIAASLLLMRGN-----RSTPGREISHRKSFS  132



>ref|XP_008384350.1| PREDICTED: uncharacterized protein LOC103446960 [Malus domestica]
Length=259

 Score =   141 bits (356),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 76/150 (51%), Positives = 97/150 (65%), Gaps = 7/150 (5%)
 Frame = +3

Query  111  AYISEDLPRTVQESTDSAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKD  290
            A ++EDL RTV ESTDSA+RSAR  Q+        L  ++ +    Y+ YE A F K+K+
Sbjct  48   ATMAEDLQRTVMESTDSAVRSARYIQH-------HLPQYIGKAVDNYRIYEHAFFTKIKE  100

Query  291  EVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSV  470
             +  A E+PA   GI +    + + GPRRFLFR T  R +SEEAQF  AEK+VKEL LSV
Sbjct  101  GLTSAIENPAPTLGIGLTAAFLVLPGPRRFLFRQTFRRLQSEEAQFLSAEKSVKELNLSV  160

Query  471  DLMKKESGKLFERAALAHTEMKRGHSELMN  560
            DLM KES KL ERA LA  +M  GH++LM+
Sbjct  161  DLMXKESKKLLERALLAEKDMTYGHTDLMD  190



>ref|XP_009339217.1| PREDICTED: uncharacterized protein LOC103931455 [Pyrus x bretschneideri]
Length=259

 Score =   140 bits (353),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 76/150 (51%), Positives = 97/150 (65%), Gaps = 7/150 (5%)
 Frame = +3

Query  111  AYISEDLPRTVQESTDSAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKD  290
            A ++EDL RT  ESTDSA+RSAR  Q+        L  ++ +    Y+ YE A F K+K+
Sbjct  48   ATMAEDLQRTGMESTDSAVRSARYIQH-------HLPQYIGKAVDNYRIYEHAFFTKIKE  100

Query  291  EVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSV  470
             +  A E+PA   GI +    + + GPRRFLFR T  R +SEEAQF  AEK+VKEL LSV
Sbjct  101  GLTSAIENPAPTLGIGLTAAFLVLPGPRRFLFRQTFRRLQSEEAQFLSAEKSVKELNLSV  160

Query  471  DLMKKESGKLFERAALAHTEMKRGHSELMN  560
            DLMKKES KL ERA LA  +M  GH++LM+
Sbjct  161  DLMKKESKKLLERALLAEKDMTYGHNDLMD  190



>emb|CAA18229.1| putative protein [Arabidopsis thaliana]
 emb|CAB79496.1| putative protein [Arabidopsis thaliana]
Length=266

 Score =   138 bits (348),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 81/149 (54%), Positives = 101/149 (68%), Gaps = 5/149 (3%)
 Frame = +3

Query  126  DLPRTVQESTDSAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIA  305
            DL RTV+ES D+A+RSAR  +  S+   RS+QDF+P   +QYK YE+A F KV DE+  A
Sbjct  50   DLQRTVKESKDTAMRSARSLRENSTSQFRSIQDFIPHALTQYKTYENAFFSKVTDELIYA  109

Query  306  REHPAVVGGIAVATGLIFMRGPR----RFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVD  473
            +EHPA   GI VA  L+ MR         +F +T  +  S +AQF KAEK+V+EL +SVD
Sbjct  110  KEHPAAAIGIGVAASLVLMRVALVCVPSLIFTST-SKSSSLQAQFLKAEKHVQELNMSVD  168

Query  474  LMKKESGKLFERAALAHTEMKRGHSELMN  560
            LMKKES KL ER ALA  +MKRG SELMN
Sbjct  169  LMKKESRKLLERTALAEKDMKRGLSELMN  197



>gb|KJB83393.1| hypothetical protein B456_013G245200 [Gossypium raimondii]
Length=169

 Score =   128 bits (321),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/97 (66%), Positives = 72/97 (74%), Gaps = 0/97 (0%)
 Frame = +3

Query  270  LFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNV  449
            LF      V IA+E+P    GI +   L  MRGPRRFLFRNTLGRF+SEEA+F++AEKNV
Sbjct  4    LFSANLKGVMIAKENPGAAVGITLTAALCLMRGPRRFLFRNTLGRFQSEEAKFSRAEKNV  63

Query  450  KELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMN  560
            K L LSVDLMKKES KL ERAALA  +MKRG  ELMN
Sbjct  64   KVLNLSVDLMKKESSKLLERAALAEKDMKRGQKELMN  100



>ref|XP_010921336.1| PREDICTED: uncharacterized protein LOC105044929 [Elaeis guineensis]
Length=250

 Score =   129 bits (325),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 65/135 (48%), Positives = 91/135 (67%), Gaps = 0/135 (0%)
 Frame = +3

Query  150  STDSAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVG  329
            S  S +R A   Q  SS  LRSLQD++ ++ +QYK +EDA  QKVKD++ IAREHP    
Sbjct  45   SNGSVLRFAPSPQENSSWSLRSLQDYMTRVQAQYKVHEDAFVQKVKDQLMIAREHPTETF  104

Query  330  GIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFER  509
            GI VA GL+ M+GPRRFL RNT GR  SE+ +  KAE  +KEL  SV+ +KK+S  +  +
Sbjct  105  GIVVAAGLVLMQGPRRFLLRNTFGRLVSEQDRSAKAELCLKELSQSVEKLKKDSKNMLLK  164

Query  510  AALAHTEMKRGHSEL  554
            A+    +++RGH+++
Sbjct  165  ASWGEQDLQRGHAKI  179



>ref|XP_008781206.1| PREDICTED: uncharacterized protein LOC103701046 [Phoenix dactylifera]
Length=248

 Score =   126 bits (316),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 61/132 (46%), Positives = 89/132 (67%), Gaps = 0/132 (0%)
 Frame = +3

Query  159  SAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIA  338
            SA+R A   Q  SS  L+ LQD++P + + YK YEDA  +KVKD++ IAR+HP    G+ 
Sbjct  46   SALRFAPSPQENSSWSLQRLQDYMPSVQAWYKDYEDAFVKKVKDQLMIARDHPTETFGVV  105

Query  339  VATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAAL  518
            VA G + M+GPRRFL RNT+GR  SE+ +  KAE  +KEL  SVD +KK+S  +  +A+ 
Sbjct  106  VAAGFVLMQGPRRFLVRNTIGRLLSEQDRSAKAELCLKELSQSVDKLKKDSKNMLLKASW  165

Query  519  AHTEMKRGHSEL  554
               +++RGH+++
Sbjct  166  GEQDLQRGHTKI  177



>ref|XP_002511643.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF50312.1| conserved hypothetical protein [Ricinus communis]
Length=267

 Score =   124 bits (312),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 73/181 (40%), Positives = 104/181 (57%), Gaps = 16/181 (9%)
 Frame = +3

Query  60   SSPAPAATPQ---------QRDKPWHAY-ISEDLP--RTVQESTDSAIRSARL----FQN  191
            S PAP+  P+         +   PW  Y I + L   +T++E+ D A ++ R      ++
Sbjct  16   SPPAPSHFPEAEMIKYKTLEEVTPWIDYAIQQALTYQKTIEEAVDDATKALRSRFSEIRS  75

Query  192  TSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGP  371
            TSS H     D L  + S+  AYED LF KVKD V +A  HP + GG+AV  G +  + P
Sbjct  76   TSSAHFNQTMDSLQDVKSELGAYEDTLFGKVKDGVNVAASHPLITGGVAVGLGFVLFKRP  135

Query  372  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  551
            RRFL+ NTL  F SEEA  +KA+  VKEL+ S+ L++ ES KL +RA+ A  E+ RG ++
Sbjct  136  RRFLYYNTLRLFVSEEALLSKADAKVKELQQSISLLRAESEKLEKRASSAEGELIRGRTK  195

Query  552  L  554
            L
Sbjct  196  L  196



>gb|KDP28809.1| hypothetical protein JCGZ_14580 [Jatropha curcas]
Length=264

 Score =   120 bits (302),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 69/173 (40%), Positives = 97/173 (56%), Gaps = 30/173 (17%)
 Frame = +3

Query  126  DLPRTVQEST--------DSAIRSARLFQ----------------------NTSSGHLRS  215
            D P T++  T        DSA++ A ++Q                      +TSS H   
Sbjct  21   DFPSTIKSKTLEEVTPWIDSAVQQALIYQKNMEETLEGATSVFRSRFSEIRSTSSAHFHQ  80

Query  216  LQDFLPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNT  395
              D L    S++ AYED LF KVK+ V+IA  HP + GG+AV  GL  ++ PRRFL+ NT
Sbjct  81   TIDSLQDFKSEFDAYEDMLFGKVKEGVKIAVSHPIITGGVAVGLGLALLKRPRRFLYYNT  140

Query  396  LGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSEL  554
            L  F SEE+  ++A+  VKELR S+ L+K ES K+ +RA+LA TE+ RG ++L
Sbjct  141  LRLFVSEESLLSQADAKVKELRQSISLLKAESEKIEKRASLAETELIRGRTKL  193



>ref|XP_010258900.1| PREDICTED: uncharacterized protein LOC104598502 [Nelumbo nucifera]
Length=250

 Score =   119 bits (297),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 69/173 (40%), Positives = 99/173 (57%), Gaps = 8/173 (5%)
 Frame = +3

Query  60   SSPAPAATPQQRDK-PWHAYISED---LPRTVQESTDSAIRSA--RL--FQNTSSGHLRS  215
            S   P  +P +  + PW  Y  +    + +T+QE+ DS I  A  RL   ++TSS HL  
Sbjct  7    SEEKPELSPMENQQTPWIEYAVQQAQLVQKTIQETVDSTIEVAGSRLSEIRSTSSAHLHQ  66

Query  216  LQDFLPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNT  395
              D L  + S++  YED  F K+KD + +A  HP +  G+A   GL+ ++ PR FL+ +T
Sbjct  67   TLDNLQDIKSEFNTYEDVFFGKIKDGLTLAALHPMITCGVAAGVGLVALKRPRLFLYHST  126

Query  396  LGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSEL  554
            L  F SEE+   +A+  VK LR S+ LMK ES KL +RA  A  EMKRG ++L
Sbjct  127  LRLFMSEESLLARADSKVKALRQSIALMKAESEKLEKRALQAEQEMKRGRTKL  179



>ref|XP_008232561.1| PREDICTED: uncharacterized protein LOC103331692 [Prunus mume]
Length=264

 Score =   115 bits (288),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 64/165 (39%), Positives = 96/165 (58%), Gaps = 7/165 (4%)
 Frame = +3

Query  81   TPQQRDKPWHAYISED---LPRTVQESTDSAIRSARL----FQNTSSGHLRSLQDFLPQL  239
            T +Q   PW  Y  E      +T++E+ +SAI ++R      ++TS+ H     + L  +
Sbjct  29   TLEQSATPWIDYAVEQARVYQKTIEETFESAIEASRSRLSEIRSTSAAHFSQTINSLEDI  88

Query  240  SSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEE  419
             S Y  YED  F K+K+ V IA  HP + GG+A   GL+ ++ PRR L+  TL  F SEE
Sbjct  89   KSDYGTYEDMFFGKIKEGVLIAASHPMITGGVAAGLGLLVLKRPRRMLYHKTLRLFVSEE  148

Query  420  AQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSEL  554
            +  ++A+  VKELR S+DL+K E  KL +RA+ A  E+ RG ++L
Sbjct  149  SLLSRADAKVKELRHSIDLLKAEGEKLEKRASHAEEELIRGRTKL  193



>ref|XP_004984525.1| PREDICTED: uncharacterized protein LOC101782823 isoform X2 [Setaria 
italica]
Length=210

 Score =   112 bits (280),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 52/122 (43%), Positives = 78/122 (64%), Gaps = 0/122 (0%)
 Frame = +3

Query  189  NTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRG  368
            +TS   LR LQ F P L SQYK YE+A+ +  KD + + +EH A   G A   G I  RG
Sbjct  18   STSPWPLRKLQSFTPGLWSQYKVYENAVVESTKDALVLVKEHQAEAIGCATVAGFILFRG  77

Query  369  PRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHS  548
            PRRFL+RNT GRF++E+   N AE+++ E + S+  +KKES    ++ A+  ++++RG +
Sbjct  78   PRRFLYRNTFGRFKTEKDLLNDAEESMMEYKTSIANLKKESKYTLDKVAIGESDLQRGQT  137

Query  549  EL  554
            +L
Sbjct  138  DL  139



>ref|XP_007052189.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOX96346.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=285

 Score =   113 bits (282),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 61/158 (39%), Positives = 94/158 (59%), Gaps = 7/158 (4%)
 Frame = +3

Query  102  PWHAYISED---LPRTVQESTDSAIRSARL----FQNTSSGHLRSLQDFLPQLSSQYKAY  260
            PW  Y  E      + ++++ ++ I ++R     F +TS+ H     D L  + SQ   Y
Sbjct  56   PWIDYAVEQALLYQKIIEQNINATIEASRSRLSEFGSTSAAHFNQTIDSLEDVKSQLAVY  115

Query  261  EDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAE  440
            E+ +F KVK+ ++IA  HP + GGIAV  G++ ++ PRRFL+ NTL  F SEE+  +KA+
Sbjct  116  ENMMFGKVKEGIKIAASHPMITGGIAVGLGVLVLKRPRRFLYYNTLRLFVSEESWLSKAD  175

Query  441  KNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSEL  554
              VKELR S+D +K ES KL   A++A  ++ RG  +L
Sbjct  176  IRVKELRQSIDRLKTESVKLERSASVAEEDLIRGRKKL  213



>ref|XP_007052190.1| Uncharacterized protein isoform 3 [Theobroma cacao]
 gb|EOX96347.1| Uncharacterized protein isoform 3 [Theobroma cacao]
Length=290

 Score =   113 bits (282),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 61/158 (39%), Positives = 94/158 (59%), Gaps = 7/158 (4%)
 Frame = +3

Query  102  PWHAYISED---LPRTVQESTDSAIRSARL----FQNTSSGHLRSLQDFLPQLSSQYKAY  260
            PW  Y  E      + ++++ ++ I ++R     F +TS+ H     D L  + SQ   Y
Sbjct  56   PWIDYAVEQALLYQKIIEQNINATIEASRSRLSEFGSTSAAHFNQTIDSLEDVKSQLAVY  115

Query  261  EDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAE  440
            E+ +F KVK+ ++IA  HP + GGIAV  G++ ++ PRRFL+ NTL  F SEE+  +KA+
Sbjct  116  ENMMFGKVKEGIKIAASHPMITGGIAVGLGVLVLKRPRRFLYYNTLRLFVSEESWLSKAD  175

Query  441  KNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSEL  554
              VKELR S+D +K ES KL   A++A  ++ RG  +L
Sbjct  176  IRVKELRQSIDRLKTESVKLERSASVAEEDLIRGRKKL  213



>ref|XP_007052188.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOX96345.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=284

 Score =   113 bits (282),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 61/158 (39%), Positives = 94/158 (59%), Gaps = 7/158 (4%)
 Frame = +3

Query  102  PWHAYISED---LPRTVQESTDSAIRSARL----FQNTSSGHLRSLQDFLPQLSSQYKAY  260
            PW  Y  E      + ++++ ++ I ++R     F +TS+ H     D L  + SQ   Y
Sbjct  56   PWIDYAVEQALLYQKIIEQNINATIEASRSRLSEFGSTSAAHFNQTIDSLEDVKSQLAVY  115

Query  261  EDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAE  440
            E+ +F KVK+ ++IA  HP + GGIAV  G++ ++ PRRFL+ NTL  F SEE+  +KA+
Sbjct  116  ENMMFGKVKEGIKIAASHPMITGGIAVGLGVLVLKRPRRFLYYNTLRLFVSEESWLSKAD  175

Query  441  KNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSEL  554
              VKELR S+D +K ES KL   A++A  ++ RG  +L
Sbjct  176  IRVKELRQSIDRLKTESVKLERSASVAEEDLIRGRKKL  213



>ref|XP_006838189.1| hypothetical protein AMTR_s00106p00135890 [Amborella trichopoda]
 gb|ERN00758.1| hypothetical protein AMTR_s00106p00135890 [Amborella trichopoda]
Length=263

 Score =   111 bits (277),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 68/158 (43%), Positives = 101/158 (64%), Gaps = 7/158 (4%)
 Frame = +3

Query  102  PWHAYI---SEDLPRTVQESTDSAIRS--ARLF--QNTSSGHLRSLQDFLPQLSSQYKAY  260
            PW  Y    +E + +T+ E+TDSA+ +  +RLF    TSS H    ++ L  + ++Y  Y
Sbjct  35   PWIEYAVQEAESIKKTLMEATDSALEATRSRLFDIHATSSAHFYQAKEALLDVKTKYSEY  94

Query  261  EDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAE  440
            ED++F KVK+ + IA  HP++  G+AV +G++ M+ PRR+LF +    F SEE+    AE
Sbjct  95   EDSMFGKVKEGLLIAASHPSLACGVAVGSGVLIMKRPRRYLFNSVQRLFVSEESMLASAE  154

Query  441  KNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSEL  554
              VKELR S++L+K ES KL ERA LA  EM+RG ++L
Sbjct  155  AKVKELRQSIELVKNESKKLEERARLAEEEMRRGQTKL  192



>ref|XP_002465337.1| hypothetical protein SORBIDRAFT_01g036710 [Sorghum bicolor]
 gb|EER92335.1| hypothetical protein SORBIDRAFT_01g036710 [Sorghum bicolor]
Length=214

 Score =   109 bits (273),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 78/126 (62%), Gaps = 4/126 (3%)
 Frame = +3

Query  189  NTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVK----DEVEIAREHPAVVGGIAVATGLI  356
            +TS   LR LQ F P L SQYKAYEDA+ +  K    D + + REH     G A   G I
Sbjct  18   STSPWPLRKLQSFTPGLWSQYKAYEDAVVEGTKGTIADALVLVREHQTEAIGCATVAGFI  77

Query  357  FMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMK  536
              RGPRRFL+RNT GRF++E+   N AE+++ E + S+  +KKES    ++ A+  ++++
Sbjct  78   LFRGPRRFLYRNTFGRFKTEKDLLNDAEQSMMEYKTSIQNLKKESKYTLDKVAVGESDLQ  137

Query  537  RGHSEL  554
            RG ++L
Sbjct  138  RGRTDL  143



>ref|XP_010436412.1| PREDICTED: uncharacterized protein LOC104720153 [Camelina sativa]
Length=153

 Score =   108 bits (269),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 66/91 (73%), Gaps = 0/91 (0%)
 Frame = +3

Query  126  DLPRTVQESTDSAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIA  305
            DL  TV+ESTDSA+RSAR F+  S+ H RS+QDF+P   +QYK YE+A F KV +E+  A
Sbjct  50   DLQHTVKESTDSAMRSARSFRENSNSHFRSIQDFIPHALTQYKTYENAFFSKVTEELTYA  109

Query  306  REHPAVVGGIAVATGLIFMRGPRRFLFRNTL  398
            +EHPA   GI VA  L+ MRGPRRF FR TL
Sbjct  110  KEHPAAAVGIGVAASLVLMRGPRRFFFRQTL  140



>ref|XP_009393907.1| PREDICTED: uncharacterized protein LOC103979471 [Musa acuminata 
subsp. malaccensis]
Length=212

 Score =   109 bits (273),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 53/136 (39%), Positives = 83/136 (61%), Gaps = 0/136 (0%)
 Frame = +3

Query  147  ESTDSAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIAREHPAVV  326
            +ST  A+ SA+  Q  S   L   QD + ++ S ++AYEDAL    KDE+ +A +HP   
Sbjct  6    DSTGPAVGSAQSSQQRSPRPLEKFQDLMLRVRSHWQAYEDALVHNAKDELLVAYDHPLEA  65

Query  327  GGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFE  506
             G+ V  G++ +RGPRRFL+R TLGRF++EE +   AE  ++E+  SV  +KKES  L  
Sbjct  66   CGVVVVAGILLLRGPRRFLYRKTLGRFKTEEERLTDAESFLREINESVTKLKKESKNLLT  125

Query  507  RAALAHTEMKRGHSEL  554
            + +    ++ RG +++
Sbjct  126  KVSYGEEDLHRGRTKI  141



>ref|XP_010456590.1| PREDICTED: uncharacterized protein LOC104738049 [Camelina sativa]
Length=153

 Score =   107 bits (267),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 67/91 (74%), Gaps = 0/91 (0%)
 Frame = +3

Query  126  DLPRTVQESTDSAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIA  305
            DL  TV+ESTDSA+RSAR F+  S+ H RS+QDF+P   +QYK YE+A F KV +E+  A
Sbjct  50   DLQHTVKESTDSAMRSARSFRENSTSHFRSIQDFIPHALTQYKTYENAFFSKVTEELTYA  109

Query  306  REHPAVVGGIAVATGLIFMRGPRRFLFRNTL  398
            +EHPA   GI VA GL+ MRGPRRF FR TL
Sbjct  110  KEHPAAAVGIGVAAGLLLMRGPRRFFFRQTL  140



>ref|XP_010053946.1| PREDICTED: uncharacterized protein LOC104442278 [Eucalyptus grandis]
 gb|KCW78322.1| hypothetical protein EUGRSUZ_D02501 [Eucalyptus grandis]
Length=268

 Score =   109 bits (273),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 64/163 (39%), Positives = 95/163 (58%), Gaps = 13/163 (8%)
 Frame = +3

Query  102  PWHAYISEDLPRTVQESTDSAIRS------ARLFQ--NTSSGH----LRSLQDFLPQLSS  245
            PW  Y + D  R +++  +  + S      +RL Q  +T++ H    +  +QD   ++ S
Sbjct  36   PWVDY-AVDQARLLRKGVEDDVGSFAEASRSRLAQIRSTAAAHTMMTVAMIQDTFQEVKS  94

Query  246  QYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQ  425
            +Y AYED  F KVK  +EIA  +P +  G+   +G I ++ PRRFL+ NTL    SEE+ 
Sbjct  95   KYDAYEDIFFGKVKGGIEIAASNPMLTAGVVTGSGFIVLKRPRRFLYYNTLRLLMSEESM  154

Query  426  FNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSEL  554
             ++A+  VKELR S+DL+K ES KL  RA LA  EM RG ++L
Sbjct  155  LSRADAKVKELRKSIDLLKAESEKLERRAQLAEEEMLRGRTKL  197



>ref|NP_001049981.1| Os03g0324800 [Oryza sativa Japonica Group]
 gb|ABF95704.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF11895.1| Os03g0324800 [Oryza sativa Japonica Group]
 dbj|BAG92495.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87177.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE58974.1| hypothetical protein OsJ_10675 [Oryza sativa Japonica Group]
Length=214

 Score =   108 bits (269),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/126 (41%), Positives = 78/126 (62%), Gaps = 4/126 (3%)
 Frame = +3

Query  189  NTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVK----DEVEIAREHPAVVGGIAVATGLI  356
            +TS   LR LQ F P L SQYKAYE+A     K    D + +  EH     G A   G I
Sbjct  18   STSPWPLRKLQSFTPGLCSQYKAYENAFVDMAKGTISDAMVLVNEHQTEAIGCATVAGFI  77

Query  357  FMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMK  536
             +RGPRRFL+RNTLGRF++E+   N AE+++ E + S++ +KK+S    ++ A+  ++++
Sbjct  78   LLRGPRRFLYRNTLGRFKTEKDLLNDAEQSMMEYKTSIEQLKKDSKYTLDKIAVGESDLQ  137

Query  537  RGHSEL  554
            RG ++L
Sbjct  138  RGQTDL  143



>gb|KCW78323.1| hypothetical protein EUGRSUZ_D02501 [Eucalyptus grandis]
Length=270

 Score =   108 bits (270),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 64/163 (39%), Positives = 95/163 (58%), Gaps = 13/163 (8%)
 Frame = +3

Query  102  PWHAYISEDLPRTVQESTDSAIRS------ARLFQ--NTSSGH----LRSLQDFLPQLSS  245
            PW  Y + D  R +++  +  + S      +RL Q  +T++ H    +  +QD   ++ S
Sbjct  36   PWVDY-AVDQARLLRKGVEDDVGSFAEASRSRLAQIRSTAAAHTMMTVAMIQDTFQEVKS  94

Query  246  QYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQ  425
            +Y AYED  F KVK  +EIA  +P +  G+   +G I ++ PRRFL+ NTL    SEE+ 
Sbjct  95   KYDAYEDIFFGKVKGGIEIAASNPMLTAGVVTGSGFIVLKRPRRFLYYNTLRLLMSEESM  154

Query  426  FNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSEL  554
             ++A+  VKELR S+DL+K ES KL  RA LA  EM RG ++L
Sbjct  155  LSRADAKVKELRKSIDLLKAESEKLERRAQLAEEEMLRGRTKL  197



>ref|XP_008670078.1| PREDICTED: uncharacterized protein LOC100276044 isoform X1 [Zea 
mays]
 gb|ACF85910.1| unknown [Zea mays]
 gb|ACG28462.1| hypothetical protein [Zea mays]
 gb|ACG32171.1| hypothetical protein [Zea mays]
 tpg|DAA45114.1| TPA: hypothetical protein ZEAMMB73_628651 [Zea mays]
Length=214

 Score =   107 bits (266),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 51/119 (43%), Positives = 75/119 (63%), Gaps = 4/119 (3%)
 Frame = +3

Query  210  RSLQDFLPQLSSQYKAYEDALFQKVK----DEVEIAREHPAVVGGIAVATGLIFMRGPRR  377
            R LQ F P L SQYKAYEDA+ + +K    D + + REH A   G A   G I  RGPRR
Sbjct  25   RKLQSFTPGLWSQYKAYEDAVVENIKGTIADALVLVREHQAEAIGCATVAGFILFRGPRR  84

Query  378  FLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSEL  554
            FL+RNT GR ++E+   N AE+++ E + S+  +KKES    ++ A+  ++++RG ++L
Sbjct  85   FLYRNTFGRLKTEKDLLNDAEQSMMEYQTSIQNLKKESKYTLDKVAIGESDVQRGRTDL  143



>gb|KDO85660.1| hypothetical protein CISIN_1g024845mg [Citrus sinensis]
Length=217

 Score =   107 bits (266),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 60/144 (42%), Positives = 89/144 (62%), Gaps = 4/144 (3%)
 Frame = +3

Query  135  RTVQESTDSAIRSAR--LFQN--TSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEI  302
            + V+ES DSAI ++R  L Q   T+S H +   D+L  + S+Y AYEDA   KVK+ + +
Sbjct  47   KIVEESIDSAIEASRSRLSQTRLTASVHFQQTLDYLQDVKSEYAAYEDAAVGKVKEGIHV  106

Query  303  AREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMK  482
            A  HP +  G A+  G   ++ PR FL+ NTL  F SEE+  ++A+  VK+LR S+D +K
Sbjct  107  AASHPFITAGGAIGLGSFLLKRPRHFLYYNTLRLFASEESLLSRADTKVKQLRQSIDRLK  166

Query  483  KESGKLFERAALAHTEMKRGHSEL  554
             ES KL + A +A  E+ RG ++L
Sbjct  167  AESEKLEKVALVAEDELIRGRTKL  190



>ref|XP_011017444.1| PREDICTED: uncharacterized protein LOC105120771 [Populus euphratica]
Length=270

 Score =   107 bits (268),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 67/180 (37%), Positives = 97/180 (54%), Gaps = 9/180 (5%)
 Frame = +3

Query  36   PSTEIDETSSPAPAATPQQRDKPW-HAYISEDL--PRTVQESTDSAIRSARL----FQNT  194
            P+ E D TS     A   +   PW  + + + L   +T+Q+S D AI S++        T
Sbjct  22   PTAETDLTSILKSKAV--EETAPWIDSALQQALVYQKTIQDSLDIAIESSKSRFSEIITT  79

Query  195  SSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPR  374
            S  H     D L  + S+   YED LF K K+ + +A  HP +   +AV  G + ++ PR
Sbjct  80   SQAHFSQTIDSLQDVKSEIGVYEDKLFGKAKEGINVAASHPLITSAVAVGLGFVVLKRPR  139

Query  375  RFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSEL  554
            R L+  TL  F SEEA  ++A+  VKELR S+ L+K ES KL  RA+LA  E+ RG ++L
Sbjct  140  RILYYKTLRLFTSEEALLSQADAKVKELRQSISLLKAESEKLERRASLAEEELIRGRTKL  199



>ref|XP_001760783.1| predicted protein [Physcomitrella patens]
 gb|EDQ74522.1| predicted protein [Physcomitrella patens]
Length=387

 Score =   109 bits (272),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 63/161 (39%), Positives = 91/161 (57%), Gaps = 6/161 (4%)
 Frame = +3

Query  96   DKPWHAYISE--DLPRTVQESTDSAIRSARL----FQNTSSGHLRSLQDFLPQLSSQYKA  257
            D  W  Y ++   +      STD A+R+AR+     Q+ SS    + Q    +   +Y  
Sbjct  77   DDSWSFYTAQAQSMGHRALNSTDEALRTARVQIDQLQDASSQQFAAAQKLADRAKQEYTH  136

Query  258  YEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKA  437
            YE  +F+K+K+ V IA ++P    GI   T L+ +R PRR L+R T+G+FRSEEA   +A
Sbjct  137  YEGLVFKKLKEGVNIAVQNPNATFGILGVTTLLALRTPRRLLYRYTIGQFRSEEAMLTRA  196

Query  438  EKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMN  560
            E  VKE+  +VD +K E+ KL ERA LA  E  RG ++L N
Sbjct  197  ETKVKEMHQTVDSLKNETKKLEERAKLAEEEFLRGMTKLKN  237



>ref|XP_004984524.1| PREDICTED: uncharacterized protein LOC101782823 isoform X1 [Setaria 
italica]
Length=214

 Score =   106 bits (265),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 52/126 (41%), Positives = 78/126 (62%), Gaps = 4/126 (3%)
 Frame = +3

Query  189  NTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVK----DEVEIAREHPAVVGGIAVATGLI  356
            +TS   LR LQ F P L SQYK YE+A+ +  K    D + + +EH A   G A   G I
Sbjct  18   STSPWPLRKLQSFTPGLWSQYKVYENAVVESTKGTIADALVLVKEHQAEAIGCATVAGFI  77

Query  357  FMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMK  536
              RGPRRFL+RNT GRF++E+   N AE+++ E + S+  +KKES    ++ A+  ++++
Sbjct  78   LFRGPRRFLYRNTFGRFKTEKDLLNDAEESMMEYKTSIANLKKESKYTLDKVAIGESDLQ  137

Query  537  RGHSEL  554
            RG ++L
Sbjct  138  RGQTDL  143



>ref|XP_002302514.1| hypothetical protein POPTR_0002s14390g [Populus trichocarpa]
 gb|EEE81787.1| hypothetical protein POPTR_0002s14390g [Populus trichocarpa]
Length=270

 Score =   107 bits (268),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 68/183 (37%), Positives = 96/183 (52%), Gaps = 15/183 (8%)
 Frame = +3

Query  36   PSTEIDETSSPAPAATPQQRDKPW------HAYISEDLPRTVQESTDSAIRSARL----F  185
            P+ E D TS     A   +   PW       A I +   +T+Q+S D AI S++      
Sbjct  22   PTAETDLTSILKSKAL--EETAPWIDNALQQALIYQ---KTIQDSLDIAIESSKSRFSEI  76

Query  186  QNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMR  365
              TS  H     D L   +S+   YED LF K K+ + +A  HP +   +AV  G + ++
Sbjct  77   ITTSQAHFSQTIDSLQYFTSEIGVYEDKLFGKAKEGINVAASHPLITSAVAVGLGFVVLK  136

Query  366  GPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGH  545
             PRR L+  TL  F SEEA  ++A+  VKELR S+ L+K ES KL  RA+LA  E+ RG 
Sbjct  137  RPRRILYYKTLRLFTSEEALLSQADAKVKELRQSISLLKAESEKLERRASLAEEELIRGR  196

Query  546  SEL  554
            ++L
Sbjct  197  TKL  199



>dbj|BAK05826.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=214

 Score =   106 bits (265),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 51/126 (40%), Positives = 77/126 (61%), Gaps = 4/126 (3%)
 Frame = +3

Query  189  NTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVK----DEVEIAREHPAVVGGIAVATGLI  356
            + SS  LR LQ F P L SQYKAYED   ++ K    D V +A EH     G A   G I
Sbjct  18   SASSWPLRKLQSFTPGLWSQYKAYEDVFVERAKVTISDAVVLASEHQVEAIGCATVAGFI  77

Query  357  FMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMK  536
              RGPRRFL+RNTLGRF++E+   N  E+++ E + S++ ++K+S    ++  +  ++++
Sbjct  78   LFRGPRRFLYRNTLGRFKTEKDLLNDVEQSMIEYKTSIESLRKDSKYTLDKVVIGESDLQ  137

Query  537  RGHSEL  554
            RG ++L
Sbjct  138  RGRTDL  143



>gb|KDO85659.1| hypothetical protein CISIN_1g024845mg [Citrus sinensis]
Length=237

 Score =   107 bits (266),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 60/144 (42%), Positives = 89/144 (62%), Gaps = 4/144 (3%)
 Frame = +3

Query  135  RTVQESTDSAIRSAR--LFQN--TSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEI  302
            + V+ES DSAI ++R  L Q   T+S H +   D+L  + S+Y AYEDA   KVK+ + +
Sbjct  47   KIVEESIDSAIEASRSRLSQTRLTASVHFQQTLDYLQDVKSEYAAYEDAAVGKVKEGIHV  106

Query  303  AREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMK  482
            A  HP +  G A+  G   ++ PR FL+ NTL  F SEE+  ++A+  VK+LR S+D +K
Sbjct  107  AASHPFITAGGAIGLGSFLLKRPRHFLYYNTLRLFASEESLLSRADTKVKQLRQSIDRLK  166

Query  483  KESGKLFERAALAHTEMKRGHSEL  554
             ES KL + A +A  E+ RG ++L
Sbjct  167  AESEKLEKVALVAEDELIRGRTKL  190



>ref|XP_006650015.1| PREDICTED: uncharacterized protein LOC102714271 [Oryza brachyantha]
Length=214

 Score =   105 bits (263),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/126 (41%), Positives = 76/126 (60%), Gaps = 4/126 (3%)
 Frame = +3

Query  189  NTSSGHLRSLQDFLPQLSSQYKAYEDALFQ----KVKDEVEIAREHPAVVGGIAVATGLI  356
            +TS   LR LQ   P L SQYKAYEDA        V D + +  EH A   G A   G I
Sbjct  18   STSPWPLRKLQSLTPGLWSQYKAYEDAFVHMAKGTVSDALVLVNEHQAEAIGCATVAGFI  77

Query  357  FMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMK  536
             +RGPRRFL+RNTLGRF++E+   N AE+++ E + S+  +KK+S    ++ A+  ++++
Sbjct  78   LLRGPRRFLYRNTLGRFKTEKDLLNDAEQSMMEYKTSIKQLKKDSKYTLDKIAIGESDLQ  137

Query  537  RGHSEL  554
            RG ++ 
Sbjct  138  RGQTDF  143



>ref|XP_006445337.1| hypothetical protein CICLE_v10021755mg [Citrus clementina]
 ref|XP_006490844.1| PREDICTED: uncharacterized protein LOC102630500 [Citrus sinensis]
 gb|ESR58577.1| hypothetical protein CICLE_v10021755mg [Citrus clementina]
 gb|KDO85658.1| hypothetical protein CISIN_1g024845mg [Citrus sinensis]
Length=261

 Score =   106 bits (265),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 60/144 (42%), Positives = 89/144 (62%), Gaps = 4/144 (3%)
 Frame = +3

Query  135  RTVQESTDSAIRSAR--LFQN--TSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEI  302
            + V+ES DSAI ++R  L Q   T+S H +   D+L  + S+Y AYEDA   KVK+ + +
Sbjct  47   KIVEESIDSAIEASRSRLSQTRLTASVHFQQTLDYLQDVKSEYAAYEDAAVGKVKEGIHV  106

Query  303  AREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMK  482
            A  HP +  G A+  G   ++ PR FL+ NTL  F SEE+  ++A+  VK+LR S+D +K
Sbjct  107  AASHPFITAGGAIGLGSFLLKRPRHFLYYNTLRLFASEESLLSRADTKVKQLRQSIDRLK  166

Query  483  KESGKLFERAALAHTEMKRGHSEL  554
             ES KL + A +A  E+ RG ++L
Sbjct  167  AESEKLEKVALVAEDELIRGRTKL  190



>ref|XP_004306965.1| PREDICTED: uncharacterized protein LOC101308610 [Fragaria vesca 
subsp. vesca]
Length=274

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 58/165 (35%), Positives = 91/165 (55%), Gaps = 7/165 (4%)
 Frame = +3

Query  81   TPQQRDKPWHAYI---SEDLPRTVQESTDSAIRSAR----LFQNTSSGHLRSLQDFLPQL  239
            T  Q   PW  Y    +    + ++E+ +SA+ ++R     F+ T S HL    D +  +
Sbjct  39   TLDQPPTPWIDYAIAQARVYQKNIEETLNSALEASRSRLSQFRATGSAHLSQTIDLVEDV  98

Query  240  SSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEE  419
             + Y  YE+    K+++   +A  HP + GG+A A GL+ ++GPRRFL+  +L    SEE
Sbjct  99   KTNYADYENTFLAKIREGASVAASHPLITGGVATALGLVVLKGPRRFLYYKSLRLLMSEE  158

Query  420  AQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSEL  554
            +  N+A   VKELR ++D++K ES KL  RAA A  E  +G  +L
Sbjct  159  SLLNRAHIEVKELRHAIDVLKAESQKLEIRAANAENEFIQGRKKL  203



>ref|XP_009617840.1| PREDICTED: uncharacterized protein LOC104110119, partial [Nicotiana 
tomentosiformis]
Length=133

 Score =   103 bits (257),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/64 (80%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +3

Query  369  PRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHS  548
            PRRFLFR TLGR +SEEA+F+KAEKNVKEL LSVDLMKKES KL ERAALA  +MKRG S
Sbjct  1    PRRFLFRQTLGRLQSEEAKFSKAEKNVKELSLSVDLMKKESKKLLERAALAEKDMKRGLS  60

Query  549  ELMN  560
            ELM+
Sbjct  61   ELMD  64



>gb|EEC75161.1| hypothetical protein OsI_11375 [Oryza sativa Indica Group]
Length=192

 Score =   104 bits (259),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 51/126 (40%), Positives = 77/126 (61%), Gaps = 4/126 (3%)
 Frame = +3

Query  189  NTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVK----DEVEIAREHPAVVGGIAVATGLI  356
            +TS   LR LQ F   L SQYKAYE+A     K    D + +  EH     G A   G I
Sbjct  18   STSPWPLRKLQSFTSGLCSQYKAYENAFVDMAKGTISDAMVLVNEHQTEAIGCATVAGFI  77

Query  357  FMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMK  536
             +RGPRRFL+RNTLGRF++E+   N AE+++ E + S++ +KK+S    ++ A+  ++++
Sbjct  78   LLRGPRRFLYRNTLGRFKTEKDLLNDAEQSMMEYKTSIEQLKKDSKYTLDKIAVGESDLQ  137

Query  537  RGHSEL  554
            RG ++L
Sbjct  138  RGQTDL  143



>ref|XP_003558009.1| PREDICTED: uncharacterized protein LOC100838509 [Brachypodium 
distachyon]
Length=214

 Score =   103 bits (256),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 75/120 (63%), Gaps = 4/120 (3%)
 Frame = +3

Query  207  LRSLQDFLPQLSSQYKAYEDALFQKVK----DEVEIAREHPAVVGGIAVATGLIFMRGPR  374
            LR LQ F P L S YKAYED   ++ K    D + +A  H A   G A   G I +RGPR
Sbjct  24   LRKLQSFSPGLWSHYKAYEDVFVERAKVTISDALVLASGHQAEAIGCATVAGFILLRGPR  83

Query  375  RFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSEL  554
            RFL+RNTLGRF++E+   N AE+++ E + S++ ++KES    ++  +  ++++RG ++L
Sbjct  84   RFLYRNTLGRFKTEKDLLNDAEQSMIEYKTSIENLRKESKYTLDKVVIGESDLQRGRTDL  143



>ref|XP_010524407.1| PREDICTED: uncharacterized protein LOC104802474 [Tarenaya hassleriana]
Length=269

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 58/143 (41%), Positives = 85/143 (59%), Gaps = 4/143 (3%)
 Frame = +3

Query  138  TVQESTDSAIRSAR----LFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIA  305
            TV E+ +S I+++R      + TSS H     D L  ++S+Y  YE  LF KVK+ V +A
Sbjct  56   TVTETVESTIQASRSRLSQIRETSSAHFNQTLDSLRDIASEYTVYEHMLFGKVKEGVNVA  115

Query  306  REHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKK  485
              +P + GG+A   G+  ++  RRFL+ +TL  F SEEA  ++A+  VKELR S+D +K 
Sbjct  116  ASYPLISGGVAFGVGIFSLKRTRRFLYYSTLRIFSSEEALLSQADLKVKELRQSIDRLKA  175

Query  486  ESGKLFERAALAHTEMKRGHSEL  554
            ES KL  R  +A  E+ RG  +L
Sbjct  176  ESEKLERRTTVAEQELIRGRMKL  198



>gb|KEH22362.1| hypothetical protein MTR_7g445370 [Medicago truncatula]
Length=264

 Score =   102 bits (255),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 66/179 (37%), Positives = 97/179 (54%), Gaps = 14/179 (8%)
 Frame = +3

Query  60   SSPAPAAT------PQQRD-KPWHAYISEDL---PRTVQESTDSAI--RSARLFQ--NTS  197
            S+PAP         PQ  D KP+  Y    +    +T  ++ DSAI   ++R  Q  +TS
Sbjct  15   STPAPTVNQSTTTNPQTLDVKPFIDYAVGHVLYYQKTFNDAVDSAIDASTSRFSQIRSTS  74

Query  198  SGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRR  377
            S H     D+L    SQY AYE+ LF K+K+ V +A  HP +  G   + GL+ ++ PRR
Sbjct  75   SAHFHQSLDYLDDFKSQYNAYEELLFGKIKEGVLVAASHPVITSGATASMGLLVLKRPRR  134

Query  378  FLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSEL  554
            FL+ N    F SEE+  +KA + VKELR S+DL+K E  ++ + A  A  +   G ++L
Sbjct  135  FLYYNMQRLFVSEESLVSKASEEVKELRQSIDLLKSEVERMEKSALHAEEQFLHGRTKL  193



>ref|XP_002277999.1| PREDICTED: uncharacterized protein LOC100266783 [Vitis vinifera]
 emb|CBI16597.3| unnamed protein product [Vitis vinifera]
Length=260

 Score =   102 bits (254),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 68/194 (35%), Positives = 104/194 (54%), Gaps = 21/194 (11%)
 Frame = +3

Query  21   MASDVPSTEIDETSSPAPAATPQQRDKP---------WHAY---ISEDLPRTVQESTDSA  164
            MA+ V   E    S P+P   P   +KP         W  Y    ++ L +T+ ++ +S 
Sbjct  1    MATTVAECE----SKPSPGDYPPD-EKPKSLEEAASSWIEYGVNQAQLLHKTLDDTVNSF  55

Query  165  IRSA--RLFQ--NTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGG  332
            I ++  R  Q  +TSS HL+   + L  + S+Y  YED    K+K+ + +A  +P +  G
Sbjct  56   IEASGSRFSQILSTSSAHLQQTIESLKDVKSEYDVYEDLAVGKIKEGILVAASNPLITSG  115

Query  333  IAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERA  512
            + V  G + ++ PR FL+ NTL    SEE+   +A+  V ELR S+DL+K ES KL +RA
Sbjct  116  VCVGLGCLLLKRPRHFLYYNTLRLLVSEESMVARADAKVNELRKSIDLLKAESEKLEKRA  175

Query  513  ALAHTEMKRGHSEL  554
              A  EMKRG ++L
Sbjct  176  LQAEDEMKRGRTKL  189



>gb|AFK35211.1| unknown [Medicago truncatula]
Length=264

 Score =   102 bits (255),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 66/179 (37%), Positives = 97/179 (54%), Gaps = 14/179 (8%)
 Frame = +3

Query  60   SSPAPAAT------PQQRD-KPWHAYISEDL---PRTVQESTDSAI--RSARLFQ--NTS  197
            S+PAP         PQ  D KP+  Y    +    +T  ++ DSAI   ++R  Q  +TS
Sbjct  15   STPAPTVNQSTTTNPQTLDVKPFIDYAVGHVLYYQKTFNDAVDSAIDASTSRFSQIRSTS  74

Query  198  SGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRR  377
            S H     D+L    SQY AYE+ LF K+K+ V +A  HP +  G   + GL+ ++ PRR
Sbjct  75   SAHFHQSLDYLDDFKSQYNAYEELLFGKIKEGVLVAASHPVITSGATASMGLLVLKRPRR  134

Query  378  FLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSEL  554
            FL+ N    F SEE+  +KA + VKELR S+DL+K E  ++ + A  A  +   G ++L
Sbjct  135  FLYYNMQRLFVSEESLVSKASEEVKELRQSIDLLKSEVERMEKSALHAEEQFLHGKTKL  193



>ref|XP_006294795.1| hypothetical protein CARUB_v10023846mg [Capsella rubella]
 gb|EOA27693.1| hypothetical protein CARUB_v10023846mg [Capsella rubella]
Length=207

 Score =   101 bits (251),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 57/144 (40%), Positives = 85/144 (59%), Gaps = 4/144 (3%)
 Frame = +3

Query  135  RTVQESTDSAIRS--ARLFQ--NTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEI  302
            +T+ E+ DS I +  ARL Q  +TS  H     D L +++S+Y  YE  +F K+KD V +
Sbjct  57   KTITETVDSTIDASKARLSQIRDTSVAHTSQTIDSLREIASEYNVYEQMVFGKIKDGVNV  116

Query  303  AREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMK  482
            A  HP + G +A   G+  ++  RRF++ NT+  F SEEA  ++A+  VKELR S+D + 
Sbjct  117  AASHPLISGTLAFGVGIFALKKTRRFVYYNTVRMFLSEEALLSRADLKVKELRQSMDRLT  176

Query  483  KESGKLFERAALAHTEMKRGHSEL  554
             ES KL   A +A  E+ RG  +L
Sbjct  177  AESEKLQRVATVAEEELIRGRMKL  200



>ref|XP_007052191.1| Uncharacterized protein isoform 4 [Theobroma cacao]
 gb|EOX96348.1| Uncharacterized protein isoform 4 [Theobroma cacao]
Length=278

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 59/158 (37%), Positives = 89/158 (56%), Gaps = 13/158 (8%)
 Frame = +3

Query  102  PWHAYISED---LPRTVQESTDSAIRSARL----FQNTSSGHLRSLQDFLPQLSSQYKAY  260
            PW  Y  E      + ++++ ++ I ++R     F +TS+ H     D L  + SQ   Y
Sbjct  56   PWIDYAVEQALLYQKIIEQNINATIEASRSRLSEFGSTSAAHFNQTIDSLEDVKSQLAVY  115

Query  261  EDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAE  440
            E+ +F KVK        HP + GGIAV  G++ ++ PRRFL+ NTL  F SEE+  +KA+
Sbjct  116  ENMMFGKVKAS------HPMITGGIAVGLGVLVLKRPRRFLYYNTLRLFVSEESWLSKAD  169

Query  441  KNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSEL  554
              VKELR S+D +K ES KL   A++A  ++ RG  +L
Sbjct  170  IRVKELRQSIDRLKTESVKLERSASVAEEDLIRGRKKL  207



>ref|XP_002881994.1| hypothetical protein ARALYDRAFT_903941 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58253.1| hypothetical protein ARALYDRAFT_903941 [Arabidopsis lyrata subsp. 
lyrata]
Length=272

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 57/144 (40%), Positives = 85/144 (59%), Gaps = 4/144 (3%)
 Frame = +3

Query  135  RTVQESTDSAIRS--ARLFQ--NTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEI  302
            +T+ E+ DS I +  ARL Q  +TS  H     D L  ++S+Y  YE  +F K+KD V +
Sbjct  58   KTISETVDSTIDASKARLSQIRDTSVAHTSQTIDSLRDIASEYNVYEQMVFGKIKDGVNV  117

Query  303  AREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMK  482
            A  HP + G +A   G+  ++  R+F++ NT+  F SEEA  ++A+  VKELR S+D +K
Sbjct  118  AASHPLISGTLAFGVGIFALKKTRKFVYYNTVRMFVSEEALLSRADLKVKELRQSMDRLK  177

Query  483  KESGKLFERAALAHTEMKRGHSEL  554
             ES KL   A +A  E+ RG  +L
Sbjct  178  AESEKLERVATVAEEELIRGRMKL  201



>ref|NP_566034.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAK73943.1| At2g45060/T14P1.13 [Arabidopsis thaliana]
 gb|AAM62665.1| unknown [Arabidopsis thaliana]
 gb|AAN28847.1| At2g45060/T14P1.13 [Arabidopsis thaliana]
 gb|AEC10501.1| uncharacterized protein AT2G45060 [Arabidopsis thaliana]
Length=272

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 58/144 (40%), Positives = 84/144 (58%), Gaps = 4/144 (3%)
 Frame = +3

Query  135  RTVQESTDSAIRS--ARLFQ--NTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEI  302
            +T+ E+ DS I +  ARL Q  +TS  H     D L  ++S+Y  YE  +F K+KD V +
Sbjct  58   KTITETVDSTIDASKARLSQIRDTSVAHTSQTIDSLRDIASEYNVYEQMVFGKIKDGVNV  117

Query  303  AREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMK  482
            A  HP + G +A   G+  ++  RRF++ NT+  F SEEA  ++A+  VKELR S+D +K
Sbjct  118  AASHPLISGTLAFGVGIFALKKTRRFVYYNTVRMFVSEEALLSRADLKVKELRQSMDRLK  177

Query  483  KESGKLFERAALAHTEMKRGHSEL  554
             ES KL   A +A  E  RG  +L
Sbjct  178  AESEKLERVATVAEEEFIRGRMKL  201



>ref|XP_006294796.1| hypothetical protein CARUB_v10023846mg [Capsella rubella]
 gb|EOA27694.1| hypothetical protein CARUB_v10023846mg [Capsella rubella]
Length=271

 Score =   100 bits (249),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 57/144 (40%), Positives = 85/144 (59%), Gaps = 4/144 (3%)
 Frame = +3

Query  135  RTVQESTDSAIRS--ARLFQ--NTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEI  302
            +T+ E+ DS I +  ARL Q  +TS  H     D L +++S+Y  YE  +F K+KD V +
Sbjct  57   KTITETVDSTIDASKARLSQIRDTSVAHTSQTIDSLREIASEYNVYEQMVFGKIKDGVNV  116

Query  303  AREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMK  482
            A  HP + G +A   G+  ++  RRF++ NT+  F SEEA  ++A+  VKELR S+D + 
Sbjct  117  AASHPLISGTLAFGVGIFALKKTRRFVYYNTVRMFLSEEALLSRADLKVKELRQSMDRLT  176

Query  483  KESGKLFERAALAHTEMKRGHSEL  554
             ES KL   A +A  E+ RG  +L
Sbjct  177  AESEKLQRVATVAEEELIRGRMKL  200



>ref|XP_003538068.1| PREDICTED: uncharacterized protein LOC100804339 [Glycine max]
Length=258

 Score =   100 bits (249),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 62/185 (34%), Positives = 95/185 (51%), Gaps = 7/185 (4%)
 Frame = +3

Query  21   MASDVPSTEIDETSSPAPAATPQQRDKPWHAYI---SEDLPRTVQESTDSAIRSAR----  179
            M ++ P ++ D  SS            P+  Y    ++   +   ++ DS I +A+    
Sbjct  3    MVAESPESDSDNNSSKTNNPQTLNETAPFLDYALAQAQLYHKAFNDAVDSTIDTAKSRFS  62

Query  180  LFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIF  359
              ++TSS H     D L  L SQY AYE  LF K+K+ V +A  HP +  G   + GL+ 
Sbjct  63   QIRSTSSAHFHQTLDSLDDLKSQYTAYEGLLFGKIKEGVVVAASHPVITCGATASLGLLV  122

Query  360  MRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKR  539
            ++ PRR L+ NTL  F SEE+  ++A   VKELR S++L+K E  KL + A  A  +   
Sbjct  123  LKRPRRVLYYNTLRLFVSEESMISRAHAEVKELRQSIELLKAEGEKLEKSALHAEEQFLH  182

Query  540  GHSEL  554
            G ++L
Sbjct  183  GRTKL  187



>ref|XP_010508215.1| PREDICTED: uncharacterized protein LOC104784826 [Camelina sativa]
Length=271

 Score =   100 bits (248),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 56/144 (39%), Positives = 86/144 (60%), Gaps = 4/144 (3%)
 Frame = +3

Query  135  RTVQESTDSAIRS--ARLFQ--NTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEI  302
            +T+ E+ DS I +  ARL Q  +TS+ H     D L +++S+Y  YE  +F K+KD V +
Sbjct  57   KTITETVDSTIDASKARLSQIRDTSAAHTSQTIDSLREIASEYNVYEQMVFGKIKDGVNV  116

Query  303  AREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMK  482
            A  HP + G +A   G+  ++  RRF++ NT+  F SEEA  ++A+  VKELR S+D + 
Sbjct  117  AASHPVISGTLAFGVGVFALKKTRRFVYFNTVRMFVSEEALLSRADLKVKELRQSMDRLT  176

Query  483  KESGKLFERAALAHTEMKRGHSEL  554
             +S KL   A +A  E+ RG  +L
Sbjct  177  AQSEKLERVATMAEEELIRGRMKL  200



>ref|XP_004229779.1| PREDICTED: uncharacterized protein LOC101267648 [Solanum lycopersicum]
Length=266

 Score =   100 bits (248),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 70/197 (36%), Positives = 104/197 (53%), Gaps = 21/197 (11%)
 Frame = +3

Query  21   MASDVPSTEIDETSSPAPAATPQQ---RDK--------PW--HAYISEDLPRTVQEST-D  158
            MA+   S+E +  +SP+P+  P++    DK        PW  +A     L R   E T +
Sbjct  1    MAAIAESSEAN-VNSPSPSLPPERVNHEDKSNTWGEAVPWIDNALQQAQLARKTAEDTFE  59

Query  159  SAI-----RSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIAREHPAV  323
            +AI     R  R+   TSS H     D L  L S+Y  YED  F K+K+ + +A  HP  
Sbjct  60   NAIVVTKSRLNRIL-TTSSAHFNQTLDTLQDLKSEYSVYEDLAFGKIKEGLLLAASHPLA  118

Query  324  VGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLF  503
              G  +  G++ ++ PRRFL+ + +  F  EEA  ++A+  VKEL+ S+DL+K ES KL 
Sbjct  119  TTGAVLGVGVLVLKRPRRFLYYSAMRLFVREEALLSRADAKVKELQKSIDLLKAESAKLE  178

Query  504  ERAALAHTEMKRGHSEL  554
             +A  A  EM RG ++L
Sbjct  179  NQAIQAEGEMIRGRTKL  195



>gb|KEH22363.1| hypothetical protein MTR_7g445370 [Medicago truncatula]
Length=276

 Score =   100 bits (248),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 62/157 (39%), Positives = 87/157 (55%), Gaps = 14/157 (9%)
 Frame = +3

Query  60   SSPAPAAT------PQQRD-KPWHAYISEDL---PRTVQESTDSAI--RSARLFQ--NTS  197
            S+PAP         PQ  D KP+  Y    +    +T  ++ DSAI   ++R  Q  +TS
Sbjct  15   STPAPTVNQSTTTNPQTLDVKPFIDYAVGHVLYYQKTFNDAVDSAIDASTSRFSQIRSTS  74

Query  198  SGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRR  377
            S H     D+L    SQY AYE+ LF K+K+ V +A  HP +  G   + GL+ ++ PRR
Sbjct  75   SAHFHQSLDYLDDFKSQYNAYEELLFGKIKEGVLVAASHPVITSGATASMGLLVLKRPRR  134

Query  378  FLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKE  488
            FL+ N    F SEE+  +KA + VKELR S+DL+K E
Sbjct  135  FLYYNMQRLFVSEESLVSKASEEVKELRQSIDLLKSE  171



>gb|AFK39373.1| unknown [Lotus japonicus]
Length=262

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 70/184 (38%), Positives = 103/184 (56%), Gaps = 17/184 (9%)
 Frame = +3

Query  21   MASDVPSTEIDETSSPAPA--ATPQQR-----DKPWHAY-ISEDL--PRTVQESTDSAIR  170
            MA+ V S+E D T  PAP   +T   R       P+  Y + + L   +   ++ +SAI 
Sbjct  1    MATVVESSESD-TPPPAPGNHSTTSNRPTLDPTTPFIDYAVGQALLYQKAFNDAVESAID  59

Query  171  SAR----LFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIA  338
            +++      ++TSS H +     L    SQY AYED LF K+K+ V +A  HP +  G A
Sbjct  60   ASKSRFSQIRSTSSAHFQQTLYALDDFKSQYNAYEDLLFGKIKEGVLVASSHPVITCGAA  119

Query  339  VATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAAL  518
             ATGL+  + PRR L+ NT+  F +EE   ++A   VKELR S+DL+K E G+ +E++AL
Sbjct  120  AATGLMVFKRPRRILYYNTMRLFLNEETLISRASAEVKELRKSIDLLKAE-GEKWEKSAL  178

Query  519  AHTE  530
             H E
Sbjct  179  -HAE  181



>gb|AFK47092.1| unknown [Lotus japonicus]
Length=262

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 70/184 (38%), Positives = 103/184 (56%), Gaps = 17/184 (9%)
 Frame = +3

Query  21   MASDVPSTEIDETSSPAPA--ATPQQR-----DKPWHAY-ISEDL--PRTVQESTDSAIR  170
            MA+ V S+E D T  PAP   +T   R       P+  Y + + L   +   ++ +SAI 
Sbjct  1    MATVVESSESD-TPPPAPGNHSTTSNRPTLDPTTPFIDYAVGQALLYQKAFNDAVESAID  59

Query  171  SAR----LFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIA  338
            +++      ++TSS H +     L    SQY AYED LF K+K+ V +A  HP +  G A
Sbjct  60   ASKSRFSQIRSTSSAHFQQTLYALDDFKSQYNAYEDLLFGKIKEGVLVASSHPVITCGAA  119

Query  339  VATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAAL  518
             ATGL+  + PRR L+ NT+  F +EE   ++A   VKELR S+DL+K E G+ +E++AL
Sbjct  120  AATGLMVFKRPRRILYYNTMRLFLNEETLISRASAEVKELRKSIDLLKAE-GEKWEKSAL  178

Query  519  AHTE  530
             H E
Sbjct  179  -HAE  181



>gb|KJB09928.1| hypothetical protein B456_001G175600 [Gossypium raimondii]
Length=273

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 57/158 (36%), Positives = 89/158 (56%), Gaps = 7/158 (4%)
 Frame = +3

Query  102  PWHAYISED---LPRTVQESTDSAIRSARL----FQNTSSGHLRSLQDFLPQLSSQYKAY  260
            PW     E      + ++++ + AI+++R      ++TSS H     + L  + SQ   Y
Sbjct  45   PWMDSAVEQALLYQKIIEQNVNDAIKASRSRLSEIRSTSSAHFNLTIESLKDVKSQLDVY  104

Query  261  EDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAE  440
            ED  F KVK+ + IA  +P + GG AV  G + ++ PR  L+  TL  F+SEE+  +KA+
Sbjct  105  EDLAFGKVKEGINIAASNPLITGGAAVGLGFLVLKRPRHLLYYKTLRLFQSEESLISKAD  164

Query  441  KNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSEL  554
              VKELR S+D +K ES KL   A++A  E+ RG ++L
Sbjct  165  IRVKELRQSIDRLKAESEKLERSASVAEDELIRGRTKL  202



>ref|XP_009385849.1| PREDICTED: uncharacterized protein LOC103973101 [Musa acuminata 
subsp. malaccensis]
Length=281

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 60/151 (40%), Positives = 86/151 (57%), Gaps = 6/151 (4%)
 Frame = +3

Query  120  SEDLPRTVQESTDSAIRS-----ARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKV  284
            +EDL R+V  + DSA +S     +R+  ++S   L   +  +      Y A E+    K+
Sbjct  62   AEDLKRSVTAAADSAFQSVGSVLSRIVSDSSE-SLEEAKVKIAWAKDHYAAAEEVALAKI  120

Query  285  KDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRL  464
            KD +  A  HPA+  GIA   GL+ ++GPRRFL RNT   F SEE+  + A+  VKEL+ 
Sbjct  121  KDGIVDAALHPALSCGIAAGLGLVLLKGPRRFLIRNTRRIFVSEESMLSSAQVKVKELQQ  180

Query  465  SVDLMKKESGKLFERAALAHTEMKRGHSELM  557
            SV+L+  ES KL +RA  A  +MKRG   L+
Sbjct  181  SVNLVTNESKKLEDRATRAVEDMKRGQKRLI  211



>emb|CDX83410.1| BnaA03g20960D [Brassica napus]
Length=223

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 84/143 (59%), Gaps = 4/143 (3%)
 Frame = +3

Query  138  TVQESTDSAIRSARL----FQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIA  305
            T+ E+ DS I ++R      ++TS  H     D L +++S+Y  YE+ +F K+K+ V +A
Sbjct  10   TIVETLDSTINASRTRLSQLRDTSKAHTSQTIDSLREIASEYSVYENMVFAKIKEGVNVA  69

Query  306  REHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKK  485
              HP + G +A   G+  ++  RRF++ NTL  F SEEA  ++A+  VKELR S+D +  
Sbjct  70   ASHPLISGSLAFGVGIFALKKTRRFVYYNTLRMFSSEEALLSRADLRVKELRQSMDRLTA  129

Query  486  ESGKLFERAALAHTEMKRGHSEL  554
            ES KL   + +A  E+ RG  +L
Sbjct  130  ESEKLERISTVAEDELIRGRMKL  152



>ref|XP_010518116.1| PREDICTED: uncharacterized protein LOC104793462 [Camelina sativa]
Length=271

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 55/144 (38%), Positives = 83/144 (58%), Gaps = 4/144 (3%)
 Frame = +3

Query  135  RTVQESTDSAIRS--ARLFQ--NTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEI  302
            +T+ E+ DS I +  ARL Q  +TS  H     D L +++ +Y  YE  +F K+KD V +
Sbjct  57   KTITETVDSTIDASKARLSQIRDTSVAHTSQTIDSLREIACEYNVYEQMVFGKIKDGVNV  116

Query  303  AREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMK  482
            A  HP + G +A   G+  +R  RR ++ NT+  F SEEA  ++A+  VKELR S+D + 
Sbjct  117  AASHPVISGTLAFGVGIFALRKTRRLVYYNTVRMFVSEEALLSRADLKVKELRQSMDRLT  176

Query  483  KESGKLFERAALAHTEMKRGHSEL  554
             +S KL   A +A  E+ RG  +L
Sbjct  177  AQSEKLERVATMAEEELIRGRMKL  200



>ref|XP_010692135.1| PREDICTED: uncharacterized protein LOC104905332 [Beta vulgaris 
subsp. vulgaris]
Length=266

 Score = 97.8 bits (242),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 62/183 (34%), Positives = 99/183 (54%), Gaps = 14/183 (8%)
 Frame = +3

Query  36   PSTEIDETSSPAPAATPQQRDKPW------HAYISEDLPRTVQESTDSAIRSAR----LF  185
            P T+ D  S      + +Q + PW       A I++   +TV+++ DS I +A      F
Sbjct  17   PLTKSDNYSVEKALKSLEQTN-PWIQQAIQQAVIAQ---KTVEQTFDSTISAAHSRFSRF  72

Query  186  QNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMR  365
            ++T S H +   + +  + +++  YE   F KVK+   +A  HP +  G A   G + ++
Sbjct  73   RSTGSAHFQQTIESVKDVKAEFDVYEAKFFAKVKEGAFMAASHPFIATGAATGLGFLALK  132

Query  366  GPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGH  545
            GPRRFL+  TL  F +EEA   +A+  VKEL+ S    K E+ KL +RA++A  EMKRG 
Sbjct  133  GPRRFLYYRTLRLFSTEEALLARADAKVKELKQSFQSFKAETEKLEKRASMAEEEMKRGR  192

Query  546  SEL  554
            ++L
Sbjct  193  TKL  195



>gb|KJB09931.1| hypothetical protein B456_001G175600 [Gossypium raimondii]
Length=275

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 58/160 (36%), Positives = 90/160 (56%), Gaps = 9/160 (6%)
 Frame = +3

Query  102  PWHAYISED---LPRTVQESTDSAIRSARL----FQNTSSGHLRSLQDFLPQLSSQYKAY  260
            PW     E      + ++++ + AI+++R      ++TSS H     + L  + SQ   Y
Sbjct  45   PWMDSAVEQALLYQKIIEQNVNDAIKASRSRLSEIRSTSSAHFNLTIESLKDVKSQLDVY  104

Query  261  EDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMR--GPRRFLFRNTLGRFRSEEAQFNK  434
            ED  F KVK+ + IA  +P + GG AV  G + ++  GPR  L+  TL  F+SEE+  +K
Sbjct  105  EDLAFGKVKEGINIAASNPLITGGAAVGLGFLLLQCPGPRHLLYYKTLRLFQSEESLISK  164

Query  435  AEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSEL  554
            A+  VKELR S+D +K ES KL   A++A  E+ RG ++L
Sbjct  165  ADIRVKELRQSIDRLKAESEKLERSASVAEDELIRGRTKL  204



>ref|XP_006397686.1| hypothetical protein EUTSA_v10001582mg [Eutrema salsugineum]
 gb|ESQ39139.1| hypothetical protein EUTSA_v10001582mg [Eutrema salsugineum]
Length=275

 Score = 97.8 bits (242),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 60/182 (33%), Positives = 97/182 (53%), Gaps = 9/182 (5%)
 Frame = +3

Query  21   MASDVPSTEIDETSSPAPAATPQQRDKPWHAYISEDLPRTVQESTDSAIRSAR----LFQ  188
            + S +PS++I  T+    A+      +    Y      +T+ E+ DS I ++R      +
Sbjct  28   LTSSIPSSKIAATTVENAASWIDDTMRQALVY-----QKTIVETLDSTIDASRSRLSQIR  82

Query  189  NTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRG  368
            +TS  H     D L  ++S+Y  YE  +F K+K+ V +A  HP + G +A   G+  ++ 
Sbjct  83   DTSLAHTSQTIDSLKDIASEYNVYEHMVFGKIKEGVNVAASHPLISGTLAFGVGIFALKK  142

Query  369  PRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHS  548
             RRF++ NT+  F SEEA  ++A+  VKELR S+D +  ES KL   A +A  E+ RG  
Sbjct  143  TRRFVYYNTIRMFLSEEALLSRADLRVKELRQSMDRLTAESEKLERVATVAEDELIRGRM  202

Query  549  EL  554
            +L
Sbjct  203  KL  204



>ref|XP_009776946.1| PREDICTED: uncharacterized protein LOC104226615 [Nicotiana sylvestris]
Length=274

 Score = 97.8 bits (242),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 56/145 (39%), Positives = 84/145 (58%), Gaps = 6/145 (4%)
 Frame = +3

Query  135  RTVQESTDSAI-----RSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVE  299
            +TV+ + ++AI     R  RL   TSS H     D L  L S+Y  YED +F K+++ + 
Sbjct  60   KTVENTLENAIVVTKSRLDRLL-TTSSVHFNQTLDSLQDLKSEYSVYEDLVFGKIREGLL  118

Query  300  IAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLM  479
            +A  HP    G  +  G++ ++ PRRFL+ + +  F SEEA  ++A+  VKEL+ S+D +
Sbjct  119  LAASHPLTTTGAVLGVGVLGLKRPRRFLYYSAMRLFVSEEALLSRADAKVKELQKSIDFL  178

Query  480  KKESGKLFERAALAHTEMKRGHSEL  554
            K ES KL  RA  A  EM RG ++L
Sbjct  179  KAESAKLENRAVQAEGEMIRGRTKL  203



>ref|XP_010506443.1| PREDICTED: uncharacterized protein LOC104783057 isoform X1 [Camelina 
sativa]
Length=271

 Score = 97.4 bits (241),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 55/144 (38%), Positives = 84/144 (58%), Gaps = 4/144 (3%)
 Frame = +3

Query  135  RTVQESTDSAIRS--ARLFQ--NTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEI  302
            +T+ E+ DS I +  ARL Q  +TS  H     D L +++S+Y  YE  +F K+KD V +
Sbjct  57   KTITETLDSTIDASKARLSQIRDTSVAHTSQTLDSLREIASEYNVYEQMVFGKIKDGVNV  116

Query  303  AREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMK  482
            A  HP + G +A   G+  ++  RR ++ NT+  F SEEA  ++A+  VKELR S+D + 
Sbjct  117  AASHPVISGTLAFGVGIFALKKTRRLVYYNTVRMFVSEEALLSRADLKVKELRQSMDRLT  176

Query  483  KESGKLFERAALAHTEMKRGHSEL  554
             +S KL   A +A  E+ RG  +L
Sbjct  177  AQSEKLERVATMAEEELIRGRMKL  200



>ref|XP_006375267.1| hypothetical protein POPTR_0014s05780g [Populus trichocarpa]
 gb|ERP53064.1| hypothetical protein POPTR_0014s05780g [Populus trichocarpa]
Length=259

 Score = 97.1 bits (240),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 60/165 (36%), Positives = 90/165 (55%), Gaps = 16/165 (10%)
 Frame = +3

Query  84   PQQRDKPW------HAYISEDLPRTVQESTDSAIRSA--RLFQNTSSGHLRSLQDFLPQL  239
            P +   PW       A I +   + +Q S D+AI ++  R  + TS+      Q    Q 
Sbjct  38   PVEETAPWIDNAMQQALIYQ---KNIQYSLDTAIEASKSRFSEITSTS-----QAHFSQT  89

Query  240  SSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEE  419
             S+   YE  LF KVK+E+ +A  HP +   +AV  GL+ ++ PR+ L+  TL  F SEE
Sbjct  90   ISEIGVYEGKLFGKVKEEINVAASHPLITSAVAVGLGLVALKRPRQILYYKTLRLFTSEE  149

Query  420  AQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSEL  554
            A  ++A+  VKEL+ S+ L+K ES  L  RA+LA  E+ RG ++L
Sbjct  150  ALLSQADAKVKELQQSISLLKAESENLKRRASLAEEELIRGRTKL  194



>ref|XP_009142315.1| PREDICTED: uncharacterized protein LOC103866188 [Brassica rapa]
Length=279

 Score = 97.1 bits (240),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 62/182 (34%), Positives = 97/182 (53%), Gaps = 9/182 (5%)
 Frame = +3

Query  21   MASDVPSTEIDETSSPAPAATPQQRDKPWHAYISEDLPRTVQESTDSAIRSA--RLFQ--  188
            + S +PS +I  T+    A+   +  +    Y       T+ E+ DS I ++  RL Q  
Sbjct  32   LLSSIPSAKIATTTVENAASWIDETMRQALVY-----QNTIVETLDSKIDASKSRLAQIR  86

Query  189  NTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRG  368
            +TS  H     D + ++ S+Y  YE  +F K+KD V +A  HP V GG+A   G+  ++ 
Sbjct  87   DTSIAHTSQTIDSIREIVSEYNVYEHMVFAKIKDGVNVAASHPLVSGGLAFGVGIFALKK  146

Query  369  PRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHS  548
             RRF++ N +  F +EEA  ++A+  VKELR S+D +  ES KL   A +A  E+ RG  
Sbjct  147  TRRFVYYNAVRMFSTEEALLSRADLRVKELRQSLDRLTAESEKLERVATVAEDELIRGRM  206

Query  549  EL  554
            +L
Sbjct  207  KL  208



>emb|CDY37025.1| BnaA04g26030D [Brassica napus]
Length=279

 Score = 97.1 bits (240),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 62/182 (34%), Positives = 97/182 (53%), Gaps = 9/182 (5%)
 Frame = +3

Query  21   MASDVPSTEIDETSSPAPAATPQQRDKPWHAYISEDLPRTVQESTDSAIRSA--RLFQ--  188
            + S +PS +I  T+    A+   +  +    Y       T+ E+ DS I ++  RL Q  
Sbjct  32   LLSSIPSAKIATTTVENAASWIDETMRQALVY-----QNTIVETLDSKIDASKSRLAQIR  86

Query  189  NTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRG  368
            +TS  H     D + ++ S+Y  YE  +F K+KD V +A  HP V GG+A   G+  ++ 
Sbjct  87   DTSIAHTSQTIDSIREIVSEYNVYEHLVFAKIKDGVNVAASHPLVSGGLAFGVGIFALKK  146

Query  369  PRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHS  548
             RRF++ N +  F +EEA  ++A+  VKELR S+D +  ES KL   A +A  E+ RG  
Sbjct  147  TRRFVYYNAVRMFSTEEALLSRADLRVKELRQSLDRLTAESEKLERVATVAEDELIRGRM  206

Query  549  EL  554
            +L
Sbjct  207  KL  208



>ref|XP_009133693.1| PREDICTED: uncharacterized protein LOC103858149 [Brassica rapa]
Length=275

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 67/205 (33%), Positives = 104/205 (51%), Gaps = 31/205 (15%)
 Frame = +3

Query  24   ASDVPSTEIDETSSPA-PAATPQQRDKPWHAYI-SEDLPRTVQES----TDSAIRSARLF  185
            AS   S+E+++  SP  P ++P Q   P  + I S ++  T  E+     D A+R A ++
Sbjct  3    ASAESSSEMEDAHSPTIPQSSPSQ---PLLSTIPSANIAATTVENAASWIDDAMRQALVY  59

Query  186  QNT----------------------SSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVE  299
            QNT                      S  H     D L +++S+Y  YE  +F K+K+ V 
Sbjct  60   QNTIVETLNSTIDASRTRLSQIRDTSIAHTSQTIDSLREIASEYSVYEHMVFTKIKEGVN  119

Query  300  IAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLM  479
            +A  HP + G +A   G+  ++  RRF++ NTL  F SEEA  ++A+  VKELR S+D +
Sbjct  120  VAASHPLISGSLAFGVGIFALKKTRRFVYYNTLRMFSSEEALLSRADLRVKELRQSMDRL  179

Query  480  KKESGKLFERAALAHTEMKRGHSEL  554
              ES KL   + +A  E+ RG  +L
Sbjct  180  TAESEKLERISTVAEDELIRGRMKL  204



>ref|XP_006347915.1| PREDICTED: uncharacterized protein LOC102584275 [Solanum tuberosum]
Length=266

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 60/159 (38%), Positives = 86/159 (54%), Gaps = 9/159 (6%)
 Frame = +3

Query  102  PW--HAYISEDLPRTVQEST-DSAI-----RSARLFQNTSSGHLRSLQDFLPQLSSQYKA  257
            PW  +A     L R   E T ++AI     R  R+   TSS H     D L  L S+Y  
Sbjct  38   PWIDNAVQQAQLARKTAEDTFENAIVVTKSRLNRIL-TTSSAHFNQTLDTLQDLKSEYSV  96

Query  258  YEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKA  437
            YED  F K+K+ + +A  HP    G  +  G++ ++ PRRFL+ + +  F  EEA  ++A
Sbjct  97   YEDLAFGKIKEGLLLAASHPLATTGAVLGVGVLGLKRPRRFLYYSAMRLFVREEALLSRA  156

Query  438  EKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSEL  554
            +  VKEL+ S+DL+K ES KL  +A  A  EM RG ++L
Sbjct  157  DAKVKELQKSIDLLKAESAKLENQAIQAEGEMIRGRTKL  195



>ref|XP_011033296.1| PREDICTED: uncharacterized protein LOC105131821, partial [Populus 
euphratica]
Length=217

 Score = 94.7 bits (234),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 56/147 (38%), Positives = 84/147 (57%), Gaps = 7/147 (5%)
 Frame = +3

Query  120  SEDLPRTVQESTDSAIRSA--RLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDE  293
            S  LP+ +Q+S D+AI ++  R  + TS+      Q    Q  S+   YE  LF KVK+E
Sbjct  5    SSYLPKNIQDSLDTAIEASKSRFSEITSTS-----QAHFSQTISEIGVYEGKLFGKVKEE  59

Query  294  VEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVD  473
            + +A  HP +   +AV  GL+  + PR+ L+  TL    SEEA  ++A+  VKEL+ S+ 
Sbjct  60   INVAASHPLITSAVAVGLGLVAHKRPRQILYYKTLRLLTSEEALLSQADAKVKELQQSIS  119

Query  474  LMKKESGKLFERAALAHTEMKRGHSEL  554
            L+K ES     RA+LA  E+ RG ++L
Sbjct  120  LLKAESENSKRRASLAEEELIRGRTKL  146



>gb|KHG03984.1| Alanine--tRNA ligase [Gossypium arboreum]
Length=266

 Score = 95.1 bits (235),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 53/144 (37%), Positives = 85/144 (59%), Gaps = 4/144 (3%)
 Frame = +3

Query  135  RTVQESTDSAIRSARL----FQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEI  302
            + ++++ + AI+++R      ++TSS H     + L  + SQ   YED  F KVK+ + I
Sbjct  52   KIIEQNVNDAIKASRSRLSEIRSTSSAHFNLTIESLKDVKSQLDVYEDLAFGKVKEGINI  111

Query  303  AREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMK  482
            A  +P +  G AV  G + ++ PR  L+  TL  F+SEE+  +KA+  VKELR S+D +K
Sbjct  112  AASNPLITVGAAVGLGFLVLKRPRHLLYYKTLRLFQSEESLISKADIRVKELRQSIDRLK  171

Query  483  KESGKLFERAALAHTEMKRGHSEL  554
             ES KL   A++A  E+ RG ++L
Sbjct  172  AESEKLERSASVAEDELIRGRTKL  195



>gb|KFK37300.1| hypothetical protein AALP_AA4G239300 [Arabis alpina]
Length=272

 Score = 95.1 bits (235),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 55/144 (38%), Positives = 84/144 (58%), Gaps = 4/144 (3%)
 Frame = +3

Query  135  RTVQESTDSAIRSA--RLFQ--NTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEI  302
            +T+ ++ DS I ++  RL Q  +TS  H     D L +++S+Y  YE  +F K+KD V +
Sbjct  58   KTISDTLDSTIDASKSRLTQIRDTSIAHTSQTIDSLREIASEYSVYEHMVFGKIKDGVNV  117

Query  303  AREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMK  482
            A  +P + G +A   G+  ++  RRF++ NTL    SEEA F++A+  VKELR S+D + 
Sbjct  118  AASYPVLSGALAFGVGIFALKKTRRFVYHNTLRMVMSEEALFSRADLKVKELRQSMDRLI  177

Query  483  KESGKLFERAALAHTEMKRGHSEL  554
             ES KL   A +A  E  RG  +L
Sbjct  178  AESDKLERVATVAEEEFIRGRLKL  201



>ref|XP_010445295.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like 
[Camelina sativa]
Length=318

 Score = 95.5 bits (236),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 61/145 (42%), Positives = 73/145 (50%), Gaps = 50/145 (34%)
 Frame = +3

Query  126  DLPRTVQESTDSAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIA  305
            DL + V+ESTDSA+RSAR F+  S+ H RS+Q                            
Sbjct  50   DLNQAVKESTDSAMRSARSFRENSTSHFRSIQT---------------------------  82

Query  306  REHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKK  485
                                   R   R TLGRF+SEEAQF +AEK+V+EL +S DLMKK
Sbjct  83   -----------------------RIDIRQTLGRFQSEEAQFLRAEKHVQELNMSADLMKK  119

Query  486  ESGKLFERAALAHTEMKRGHSELMN  560
            ES KL ERA LA  +MK G SELMN
Sbjct  120  ESKKLLERATLAEKDMKCGLSELMN  144



>ref|XP_008459726.1| PREDICTED: uncharacterized protein LOC103498769 [Cucumis melo]
Length=265

 Score = 94.7 bits (234),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 60/174 (34%), Positives = 96/174 (55%), Gaps = 8/174 (5%)
 Frame = +3

Query  54   ETSSPAPAATPQQRDKPWHAYISED---LPRTVQESTDSAIRSA--RLFQ--NTSSGHLR  212
            E+SS  P +  +   KPW  Y ++      R +  S +SAI ++  RL Q  +TS  H +
Sbjct  22   ESSSSKPQSL-EDLAKPWAEYAAQQALLYQRAIDHSLESAIEASKSRLSQIRSTSYPHFQ  80

Query  213  SLQDFLPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRN  392
               D   +  S+  AYE+ +F K++D + +A  HP +  G+A   G +  + PR FL+  
Sbjct  81   KAIDSFWEAKSELAAYENLVFGKIRDGILVAASHPLISCGVATGMGFLVFKKPRSFLYYK  140

Query  393  TLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSEL  554
            T+  F +EE+  +KA+  VKELR S+D +K ES +L +R   A  E+ RG ++L
Sbjct  141  TVRLFMNEESLLSKADAKVKELRQSIDRIKVESERLEKRTLQAEEELIRGRTKL  194



>ref|XP_008796934.1| PREDICTED: uncharacterized protein LOC103712238 isoform X2 [Phoenix 
dactylifera]
Length=244

 Score = 94.0 bits (232),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 56/148 (38%), Positives = 85/148 (57%), Gaps = 4/148 (3%)
 Frame = +3

Query  126  DLPRTVQESTDSAIRSA--RLFQNTSSGH--LRSLQDFLPQLSSQYKAYEDALFQKVKDE  293
            D+ +T+ ++TD+ +R+A  RL    S+    L+  +  +  +  QY   E+ +F K+K+ 
Sbjct  51   DVKKTLGDATDATLRAAESRLVHAVSASKSSLQEARGMMEWVQGQYAVGEELVFGKIKEG  110

Query  294  VEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVD  473
            V +A  HP +  GIA   GL+  + PRRFL  N    F S E+  + A+ NV ELR SV+
Sbjct  111  VIVASSHPNLSLGIAGTAGLVLFKRPRRFLIWNVRRIFVSNESLLSDAQANVNELRQSVN  170

Query  474  LMKKESGKLFERAALAHTEMKRGHSELM  557
            L+K ES KL ERA  A  EM+ G  +L+
Sbjct  171  LVKNESKKLEERALKAEQEMREGRMKLI  198



>emb|CDX95625.1| BnaC03g25060D [Brassica napus]
Length=371

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 60/182 (33%), Positives = 98/182 (54%), Gaps = 9/182 (5%)
 Frame = +3

Query  21   MASDVPSTEIDETSSPAPAATPQQRDKPWHAYISEDLPRTVQESTDSAIRSARL----FQ  188
            + S +PS  I  T+    A+     D    A + ++   T+ E+ DS I ++R      +
Sbjct  123  LLSTIPSANIAATTVENAASWID--DAMRQALVYQN---TIVETLDSTIDASRTRLSQIR  177

Query  189  NTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRG  368
            +TS  H     D L +++S++  YE  +F K+K+ V +A  HP + G +A   G+  ++ 
Sbjct  178  DTSIAHTSQTIDSLREIASEFSVYEHMVFAKIKEGVNVAASHPLMSGSLAFGVGIFALKK  237

Query  369  PRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHS  548
             RRF++ NTL  F SEEA  ++A+  VKELR S+D +  ES KL   + +A  E+ RG  
Sbjct  238  TRRFVYYNTLRMFSSEEALLSRADLRVKELRQSMDRLTAESEKLERISTVAEDELIRGRM  297

Query  549  EL  554
            +L
Sbjct  298  KL  299



>ref|XP_004514234.1| PREDICTED: uncharacterized protein LOC101491840 [Cicer arietinum]
Length=262

 Score = 92.4 bits (228),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 48/124 (39%), Positives = 70/124 (56%), Gaps = 0/124 (0%)
 Frame = +3

Query  183  FQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFM  362
             ++TSS H      +L    SQY AYED LF K+K+ V +A  HP +  G   + GL+  
Sbjct  68   IRSTSSAHFHQTLHYLDDFKSQYDAYEDLLFGKIKEGVLVAASHPVITCGATASVGLLVF  127

Query  363  RGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRG  542
            + PRR L+ NT   F SEE+  ++A   VKELR S+D++K E  K+ + A  A  +   G
Sbjct  128  KRPRRMLYYNTKRLFVSEESLVSRASAEVKELRQSIDILKSEVEKMEKSALHAEEQFLHG  187

Query  543  HSEL  554
             ++L
Sbjct  188  RTKL  191



>ref|XP_011093293.1| PREDICTED: uncharacterized protein LOC105173298 [Sesamum indicum]
Length=261

 Score = 91.7 bits (226),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 51/144 (35%), Positives = 79/144 (55%), Gaps = 4/144 (3%)
 Frame = +3

Query  135  RTVQESTDSAIRSAR----LFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEI  302
            +TV+ + +SAI + R       NTSS H     D    L S Y  YED  F K+K+   +
Sbjct  47   KTVESTVESAIEATRSRIDRILNTSSAHFNQTIDSFQDLKSDYSQYEDIAFGKIKEGCLL  106

Query  303  AREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMK  482
            A  HP +  G  +  G + ++  R+F + NT+    SEE   ++A+  VK+LR S+DL+K
Sbjct  107  AASHPLITTGAVLGVGFLGLKRTRQFFYYNTMRLLFSEETLLSRADAKVKQLRQSIDLLK  166

Query  483  KESGKLFERAALAHTEMKRGHSEL  554
             ES KL ++A  A  ++ RG ++L
Sbjct  167  AESEKLEKKAMQAEEDVVRGRTKL  190



>ref|XP_007140975.1| hypothetical protein PHAVU_008G156600g [Phaseolus vulgaris]
 gb|ESW12969.1| hypothetical protein PHAVU_008G156600g [Phaseolus vulgaris]
Length=180

 Score = 90.1 bits (222),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 51/122 (42%), Positives = 68/122 (56%), Gaps = 4/122 (3%)
 Frame = +3

Query  147  ESTDSAIRSAR----LFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIAREH  314
            +  DS I +A+      ++TS  H     D L  L SQY AYED LF K+K+ V +A   
Sbjct  51   DGVDSTIDAAKSRFAQIRSTSYAHFNQTLDSLDDLKSQYNAYEDLLFGKIKEGVLVAASR  110

Query  315  PAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESG  494
            P +  G A A GL  ++ PRR L+ NTL  F  EE+  ++A   VKELR S+ L+K E  
Sbjct  111  PLITCGAAAALGLTVLKRPRRDLYYNTLRLFLKEESMISRAHAEVKELRQSIQLLKAEGE  170

Query  495  KL  500
            KL
Sbjct  171  KL  172



>ref|XP_008796933.1| PREDICTED: uncharacterized protein LOC103712238 isoform X1 [Phoenix 
dactylifera]
Length=245

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 56/149 (38%), Positives = 85/149 (57%), Gaps = 5/149 (3%)
 Frame = +3

Query  126  DLPRTVQESTDSAIRSA--RLFQNTSSGH--LRSLQDFLPQLSSQYKAYEDALFQKVKDE  293
            D+ +T+ ++TD+ +R+A  RL    S+    L+  +  +  +  QY   E+ +F K+K+ 
Sbjct  51   DVKKTLGDATDATLRAAESRLVHAVSASKSSLQEARGMMEWVQGQYAVGEELVFGKIKEG  110

Query  294  VEIAREHPAVVGGIAVATGLIFMRG-PRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSV  470
            V +A  HP +  GIA   GL+  +  PRRFL  N    F S E+  + A+ NV ELR SV
Sbjct  111  VIVASSHPNLSLGIAGTAGLVLFKSRPRRFLIWNVRRIFVSNESLLSDAQANVNELRQSV  170

Query  471  DLMKKESGKLFERAALAHTEMKRGHSELM  557
            +L+K ES KL ERA  A  EM+ G  +L+
Sbjct  171  NLVKNESKKLEERALKAEQEMREGRMKLI  199



>emb|CDY48625.1| BnaC09g20600D [Brassica napus]
Length=105

 Score = 86.7 bits (213),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 54/84 (64%), Gaps = 0/84 (0%)
 Frame = +3

Query  123  EDLPRTVQESTDSAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEI  302
            +DL RTV++STDS  RSAR  +  S+   RS+QDF+P   +QYK YE   F KV + +  
Sbjct  19   DDLQRTVKKSTDSIRRSARSLRENSTSQFRSIQDFIPHALNQYKTYETVFFSKVTEVLRN  78

Query  303  AREHPAVVGGIAVATGLIFMRGPR  374
            A+EHPA   GI +  GL+ +RG +
Sbjct  79   AKEHPAAAAGIGLTAGLVLLRGCK  102



>ref|XP_009631125.1| PREDICTED: uncharacterized protein LOC104120950 [Nicotiana tomentosiformis]
Length=191

 Score = 87.8 bits (216),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 77/132 (58%), Gaps = 4/132 (3%)
 Frame = +3

Query  135  RTVQESTDSAI--RSARL--FQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEI  302
            +TV+ + ++AI    +RL     TSS H     D L  L S+Y  YED +F K+++ + +
Sbjct  56   KTVESTLENAIVVTKSRLDRILTTSSAHFNQTLDSLQDLKSEYSVYEDLVFGKIREGLLL  115

Query  303  AREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMK  482
            A  HP    G  +  G++ ++ PRRFL+ + +  F SEEA  ++A+  VKEL+ S+D +K
Sbjct  116  AASHPLTTTGAVLGVGVLGLKRPRRFLYYSAMRLFVSEEALLSRADAKVKELQKSIDFLK  175

Query  483  KESGKLFERAAL  518
             ES KL  R+ L
Sbjct  176  AESAKLEVRSFL  187



>emb|CDY27396.1| BnaC04g50090D [Brassica napus]
Length=237

 Score = 88.6 bits (218),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 56/164 (34%), Positives = 88/164 (54%), Gaps = 9/164 (5%)
 Frame = +3

Query  21   MASDVPSTEIDETSSPAPAATPQQRDKPWHAYISEDLPRTVQESTDSAIRSA--RLFQ--  188
            + S +PS +I  T+    A+   +  +    Y S     T+ E+ DS I ++  RL Q  
Sbjct  32   LLSSIPSAKIATTTVENAASWINETMRQALVYQS-----TIVETLDSKIDASKSRLAQIR  86

Query  189  NTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRG  368
            +TS  H     D + ++ S+Y  YE  +F K+KD V +A  HP V GG+A   G+  ++ 
Sbjct  87   DTSIAHTSQTIDSIREIVSEYNVYEHMVFAKIKDGVNVAASHPLVSGGLAFGVGIFALKK  146

Query  369  PRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKL  500
             RR ++ N +  F +EEA  ++A+  VKELR S+D +  ES KL
Sbjct  147  TRRLVYYNAVRMFSTEEALLSRADLRVKELRQSLDRLTAESEKL  190



>ref|XP_010934947.1| PREDICTED: uncharacterized protein LOC105054975 isoform X1 [Elaeis 
guineensis]
Length=261

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 56/158 (35%), Positives = 86/158 (54%), Gaps = 7/158 (4%)
 Frame = +3

Query  105  WHAYISE---DLPRTVQESTDSAIRSAR--LFQNTSSGH--LRSLQDFLPQLSSQYKAYE  263
            W  Y  +   DL +T+ ++TD+A  +A   L    S+    L+  +  +  +  QY   E
Sbjct  34   WVEYAVQQALDLKKTLGDATDAAFGAAESSLVHAVSASKSSLQEARGMMEWVKGQYTVGE  93

Query  264  DALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEK  443
            + +F K+K+ V +A  HP++  GIA   GL+  + PRRF+  N    F S E+  + A+ 
Sbjct  94   ELVFGKIKEGVIVAASHPSLSLGIAGTAGLVLFKRPRRFVIWNVRRIFVSNESLLSDAQA  153

Query  444  NVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELM  557
             V ELR SV+L+K ES KL ERA  A  EM+ G  +L+
Sbjct  154  KVNELRQSVNLVKNESKKLEERALKAEEEMREGRMKLI  191



>ref|XP_009337245.1| PREDICTED: uncharacterized protein LOC103929743 [Pyrus x bretschneideri]
 ref|XP_009337246.1| PREDICTED: uncharacterized protein LOC103929743 [Pyrus x bretschneideri]
 ref|XP_009337247.1| PREDICTED: uncharacterized protein LOC103929743 [Pyrus x bretschneideri]
Length=262

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 61/168 (36%), Positives = 94/168 (56%), Gaps = 10/168 (6%)
 Frame = +3

Query  81   TPQQRDK---PWHAYISED---LPRTVQESTDSAIRSARL----FQNTSSGHLRSLQDFL  230
            +PQ  D+   PW  Y  E      + V+E+ +SAI ++R      + TS+ H     + L
Sbjct  24   SPQTLDQLGTPWVDYAVEQARIYQKNVEETFESAIAASRSHLSEIRATSAAHFSQTINSL  83

Query  231  PQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFR  410
              + S   AYE+ LF K+K+ V +A  +P +  G+A   G + ++ PRR L+   L  F 
Sbjct  84   EDIKSNCGAYEELLFGKIKEGVHVAASNPMITAGVATGLGFLLLKRPRRLLYHKALRLFV  143

Query  411  SEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSEL  554
            SEE+  ++A+  VKELR S+DL+K ES KL +RA  A  E+ RG ++L
Sbjct  144  SEESLLSRADAKVKELRHSIDLLKAESEKLEKRALHAEEELTRGRTKL  191



>ref|XP_010934948.1| PREDICTED: uncharacterized protein LOC105054975 isoform X2 [Elaeis 
guineensis]
Length=246

 Score = 87.4 bits (215),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 56/158 (35%), Positives = 86/158 (54%), Gaps = 7/158 (4%)
 Frame = +3

Query  105  WHAYISE---DLPRTVQESTDSAIRSAR--LFQNTSSGH--LRSLQDFLPQLSSQYKAYE  263
            W  Y  +   DL +T+ ++TD+A  +A   L    S+    L+  +  +  +  QY   E
Sbjct  34   WVEYAVQQALDLKKTLGDATDAAFGAAESSLVHAVSASKSSLQEARGMMEWVKGQYTVGE  93

Query  264  DALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEK  443
            + +F K+K+ V +A  HP++  GIA   GL+  + PRRF+  N    F S E+  + A+ 
Sbjct  94   ELVFGKIKEGVIVAASHPSLSLGIAGTAGLVLFKRPRRFVIWNVRRIFVSNESLLSDAQA  153

Query  444  NVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELM  557
             V ELR SV+L+K ES KL ERA  A  EM+ G  +L+
Sbjct  154  KVNELRQSVNLVKNESKKLEERALKAEEEMREGRMKLI  191



>ref|XP_010506444.1| PREDICTED: uncharacterized protein LOC104783057 isoform X2 [Camelina 
sativa]
Length=267

 Score = 87.4 bits (215),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 52/144 (36%), Positives = 81/144 (56%), Gaps = 8/144 (6%)
 Frame = +3

Query  135  RTVQESTDSAIRS--ARLFQ--NTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEI  302
            +T+ E+ DS I +  ARL Q  +TS  H     D L +++S+Y  YE  +F K+KD V +
Sbjct  57   KTITETLDSTIDASKARLSQIRDTSVAHTSQTLDSLREIASEYNVYEQMVFGKIKDGVNV  116

Query  303  AREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMK  482
            A  HP + G +A   G+  ++  RR ++ NT+  F    A  ++A+  VKELR S+D + 
Sbjct  117  AASHPVISGTLAFGVGIFALKKTRRLVYYNTVRMF----ALLSRADLKVKELRQSMDRLT  172

Query  483  KESGKLFERAALAHTEMKRGHSEL  554
             +S KL   A +A  E+ RG  +L
Sbjct  173  AQSEKLERVATMAEEELIRGRMKL  196



>gb|EYU42370.1| hypothetical protein MIMGU_mgv1a023111mg [Erythranthe guttata]
Length=240

 Score = 86.7 bits (213),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 51/144 (35%), Positives = 81/144 (56%), Gaps = 4/144 (3%)
 Frame = +3

Query  135  RTVQESTDSAIRSAR----LFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEI  302
            +T++ + ++AI + R        TSS HL    D L +L S+   YED +F K+K+   +
Sbjct  26   KTIEITVENAIEATRSRVDRLLTTSSAHLNQTIDSLQELKSECSTYEDIVFGKMKEGFLL  85

Query  303  AREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMK  482
            A   P V  G+ +  G++ ++  R+FL  +T+  F SEE   ++    VKELR S+DL+K
Sbjct  86   ASSRPFVATGVVLGVGVLSLKRTRQFLSHSTMRLFLSEEIMLSRTNAKVKELRQSIDLLK  145

Query  483  KESGKLFERAALAHTEMKRGHSEL  554
             ES KL +RA  A   + RG ++L
Sbjct  146  VESEKLEKRALQAEENLVRGRTKL  169



>ref|XP_008375716.1| PREDICTED: uncharacterized protein LOC103438950 [Malus domestica]
Length=262

 Score = 86.3 bits (212),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 65/188 (35%), Positives = 102/188 (54%), Gaps = 14/188 (7%)
 Frame = +3

Query  33   VPSTEIDE----TSSPAPAATPQQRDK---PWHAYISED---LPRTVQESTDSAIRSARL  182
            VP T  +E    + S + + +PQ  D+   PW  Y  E      + V+E+ +SA+ ++R 
Sbjct  4    VPETSSEENPTLSHSNSISHSPQPLDQLATPWVDYAVEQARIYQKNVEETFESAVAASRS  63

Query  183  ----FQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATG  350
                 + TS+ H     + L  + S   AYE+ LF K+K+ V +A  +P +  G+A   G
Sbjct  64   RLSEIRATSAAHFSQTINSLEDIKSNCXAYEELLFGKIKEGVHVAASNPMITAGVATGLG  123

Query  351  LIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTE  530
             + ++ PRR L+   L  F SEE+  ++A+  VKELR S+DL+K ES KL +RA  A  E
Sbjct  124  FLLLKRPRRLLYHKALRLFVSEESLLSRADAKVKELRHSIDLLKAESEKLEKRALHAEEE  183

Query  531  MKRGHSEL  554
              RG ++L
Sbjct  184  XTRGRTKL  191



>ref|XP_009339857.1| PREDICTED: uncharacterized protein LOC103932041 [Pyrus x bretschneideri]
 ref|XP_009339858.1| PREDICTED: uncharacterized protein LOC103932041 [Pyrus x bretschneideri]
 ref|XP_009339859.1| PREDICTED: uncharacterized protein LOC103932041 [Pyrus x bretschneideri]
 ref|XP_009339860.1| PREDICTED: uncharacterized protein LOC103932041 [Pyrus x bretschneideri]
Length=262

 Score = 85.5 bits (210),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 61/168 (36%), Positives = 93/168 (55%), Gaps = 10/168 (6%)
 Frame = +3

Query  81   TPQQRDK---PWHAYISED---LPRTVQESTDSAIRSARL----FQNTSSGHLRSLQDFL  230
            +PQ  D+   PW  Y  E      + V+E+ +SAI ++R      + TS+ H     + L
Sbjct  24   SPQTLDQLATPWVDYAVEQARIYQKNVEETFESAIAASRSRLSEIRATSAAHFSQTINSL  83

Query  231  PQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFR  410
              + S   AYE+ LF K+K+ V +A  +P    G+A   G + ++ PRR L+   L  F 
Sbjct  84   EDIKSNCGAYEELLFGKIKEGVHVAASNPMKTAGVATGLGFLLLKRPRRLLYHKALRLFV  143

Query  411  SEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSEL  554
            SEE+  ++A+  VKELR S+DL+K ES KL +RA  A  E+ RG ++L
Sbjct  144  SEESLLSRADAKVKELRHSIDLLKAESEKLEKRALHAEEELTRGRTKL  191



>ref|XP_006375268.1| hypothetical protein POPTR_0014s05780g [Populus trichocarpa]
 gb|ERP53065.1| hypothetical protein POPTR_0014s05780g [Populus trichocarpa]
Length=187

 Score = 84.3 bits (207),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 52/147 (35%), Positives = 78/147 (53%), Gaps = 16/147 (11%)
 Frame = +3

Query  84   PQQRDKPW------HAYISEDLPRTVQESTDSAIRSA--RLFQNTSSGHLRSLQDFLPQL  239
            P +   PW       A I +   + +Q S D+AI ++  R  + TS+      Q    Q 
Sbjct  38   PVEETAPWIDNAMQQALIYQ---KNIQYSLDTAIEASKSRFSEITSTS-----QAHFSQT  89

Query  240  SSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEE  419
             S+   YE  LF KVK+E+ +A  HP +   +AV  GL+ ++ PR+ L+  TL  F SEE
Sbjct  90   ISEIGVYEGKLFGKVKEEINVAASHPLITSAVAVGLGLVALKRPRQILYYKTLRLFTSEE  149

Query  420  AQFNKAEKNVKELRLSVDLMKKESGKL  500
            A  ++A+  VKEL+ S+ L+K ES  L
Sbjct  150  ALLSQADAKVKELQQSISLLKAESENL  176



>ref|XP_006423787.1| hypothetical protein CICLE_v10029731mg [Citrus clementina]
 gb|ESR37027.1| hypothetical protein CICLE_v10029731mg [Citrus clementina]
Length=77

 Score = 80.9 bits (198),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  GPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGH  545
            GPRRFLFR+T  R RSEEA F +AEKNV +L LS +LMKKES  L ERAALA  +M RG 
Sbjct  14   GPRRFLFRHTFDRLRSEEAMFVRAEKNVNKLNLSGELMKKESKTLLERAALAEKDMIRGE  73

Query  546  SEL  554
            +EL
Sbjct  74   TEL  76



>gb|KGN46560.1| hypothetical protein Csa_6G108580 [Cucumis sativus]
Length=209

 Score = 82.8 bits (203),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 42/113 (37%), Positives = 68/113 (60%), Gaps = 0/113 (0%)
 Frame = +3

Query  216  LQDFLPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNT  395
            L+D   +  S+  AYE+ +F K++D + +A  HP +  G+A   G +  + PR FL+  T
Sbjct  26   LKDSFWEAKSELAAYENLVFGKIRDGILVAASHPLISCGVATGMGFLVFKKPRNFLYYKT  85

Query  396  LGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSEL  554
            +  F +EE+  +KA+  VKELR S+D +K ES +L +R   A  E+ RG ++L
Sbjct  86   IRLFVNEESLLSKADAKVKELRQSIDRIKVESERLEKRTLQAEDELIRGRTKL  138



>ref|XP_007220768.1| hypothetical protein PRUPE_ppa024369mg [Prunus persica]
 gb|EMJ21967.1| hypothetical protein PRUPE_ppa024369mg [Prunus persica]
Length=175

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 66/122 (54%), Gaps = 7/122 (6%)
 Frame = +3

Query  87   QQRDKPWHAYISED---LPRTVQESTDSAIRSARL----FQNTSSGHLRSLQDFLPQLSS  245
            +Q   PW  Y  E      +T++E+ +SAI ++R      ++TS+ H     + L  + S
Sbjct  52   EQSATPWIDYAVEQARVYQKTIEETFESAIEASRSRLSEIRSTSAAHFSQTINSLEDIKS  111

Query  246  QYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQ  425
             Y  YED  F K+K+ V IA  HP + GG+A   GL+ ++ PRR L+  TL  F SEE +
Sbjct  112  DYGTYEDMFFGKIKEGVLIAASHPMITGGVAAGLGLLVLKRPRRLLYHKTLRLFVSEEVR  171

Query  426  FN  431
             +
Sbjct  172  MD  173



>ref|XP_004171485.1| PREDICTED: uncharacterized LOC101214960, partial [Cucumis sativus]
Length=186

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/111 (37%), Positives = 66/111 (59%), Gaps = 0/111 (0%)
 Frame = +3

Query  222  DFLPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLG  401
            D   +  S+  AYE+ +F K++D + +A  HP +  G+A   G +  + PR FL+  T+ 
Sbjct  5    DSFWEAKSELAAYENLVFGKIRDGILVAASHPLISCGVATGMGFLVFKKPRNFLYYKTIR  64

Query  402  RFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSEL  554
             F +EE+  +KA+  VKELR S+D +K ES +L +R   A  E+ RG ++L
Sbjct  65   LFVNEESLLSKADAKVKELRQSIDRIKVESERLEKRTLQAEDELIRGRTKL  115



>ref|XP_004140609.1| PREDICTED: uncharacterized protein LOC101214960 [Cucumis sativus]
Length=284

 Score = 80.9 bits (198),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 60/193 (31%), Positives = 94/193 (49%), Gaps = 27/193 (14%)
 Frame = +3

Query  54   ETSSPAPAATPQQRDKPWHAYISED---LPRTVQESTDSAIR--SARLFQ--NTSSGHLR  212
            ++SSP P +  +   KPW  Y ++      R +  S +SAI    +RL Q  +TS  H +
Sbjct  22   QSSSPKPQSL-EDLAKPWAEYAAQQALLYQRAIDHSLESAIEVSKSRLSQIRSTSFPHFQ  80

Query  213  SLQDFLPQLSSQYKAYEDALFQKVKDEVEI-------------------AREHPAVVGGI  335
               D   +  S+  AYE+ +F K++    I                   A  HP +  G+
Sbjct  81   KAVDSFWEAKSELAAYENLVFGKIRGLFLIYHCDGKLTLPSFVFSFSFVAASHPLISCGV  140

Query  336  AVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAA  515
            A   G +  + PR FL+  T+  F +EE+  +KA+  VKELR S+D +K ES +L +R  
Sbjct  141  ATGMGFLVFKKPRNFLYYKTIRLFVNEESLLSKADAKVKELRQSIDRIKVESERLEKRTL  200

Query  516  LAHTEMKRGHSEL  554
             A  E+ RG ++L
Sbjct  201  QAEDELIRGRTKL  213



>ref|XP_001771369.1| predicted protein [Physcomitrella patens]
 gb|EDQ63759.1| predicted protein [Physcomitrella patens]
Length=342

 Score = 81.3 bits (199),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 58/165 (35%), Positives = 92/165 (56%), Gaps = 6/165 (4%)
 Frame = +3

Query  84   PQQRDKPWHAYI--SEDLPRTVQESTDSAIRSAR----LFQNTSSGHLRSLQDFLPQLSS  245
            P+  ++ W  Y   ++ L +    STD  I  AR       + SS +  + Q +  +   
Sbjct  52   PENAEETWKFYSMQAQTLGKRALSSTDETIEVARNQMKQLTDASSQYFAAAQGYAARAQQ  111

Query  246  QYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQ  425
            +Y  YE   F+K+K+ V  A ++P    G+   T ++ +R  RR L+R T+GRF++E+A 
Sbjct  112  EYNYYESLFFKKLKEGVHTAAQNPNATCGVLGVTTILALRTSRRMLYRYTIGRFQNEQAL  171

Query  426  FNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMN  560
              +AE  VKE+R +VDL++ E+ KL ERA LA  E+ RG S+L N
Sbjct  172  LARAETKVKEMRQTVDLLRNETKKLEERARLAEEELLRGRSKLKN  216



>emb|CDP09483.1| unnamed protein product [Coffea canephora]
Length=272

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 56/166 (34%), Positives = 85/166 (51%), Gaps = 9/166 (5%)
 Frame = +3

Query  81   TPQQRDKPWHAYI---SEDLPRTVQESTDSAIR--SARL--FQNTSSGHLRSLQDFLPQL  239
            T ++   PW  Y    ++   +T+      AI    +RL   + TSS H     D L   
Sbjct  37   TLEETASPWIDYALKQAQAAQKTIGHHLQDAIEVTKSRLDRIRTTSSAHFNQTLDSLQDA  96

Query  240  SSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEE  419
             S + AYED    K+++   +A  +P +  G   A GL+ ++ PRR L+      F SE+
Sbjct  97   KSDFNAYEDLAIGKIREGFNLAAANPFIAAGSIFAVGLLGLKTPRRILYYKLRRLFASEQ  156

Query  420  AQFNKAEKNVKELRLSVDLMKKESGKLFERAAL-AHTEMKRGHSEL  554
               +KA+  VKELR S +++K E+ KL E+AAL A  EM RG ++L
Sbjct  157  VLLSKADAKVKELRQSFEVLKAEAEKL-EKAALQAEEEMTRGRTKL  201



>ref|XP_002983323.1| hypothetical protein SELMODRAFT_445444 [Selaginella moellendorffii]
 gb|EFJ15665.1| hypothetical protein SELMODRAFT_445444 [Selaginella moellendorffii]
Length=403

 Score = 76.3 bits (186),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 56/148 (38%), Positives = 82/148 (55%), Gaps = 4/148 (3%)
 Frame = +3

Query  129  LPRTVQESTDSAIRSA----RLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEV  296
            L   + E+TD A+R+A       Q++S+      +D   +   +Y+ YE+  F  +KD V
Sbjct  187  LKNGMSETTDVAVRAACNQLSELQDSSTTQYYYAKDMFWRFKREYREYENVFFSTLKDGV  246

Query  297  EIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDL  476
            + A   P +   +A     +F+R PRR LF+ TLGRFRS+EA    A+K V ELR +++L
Sbjct  247  KAATASPGMAAMVATGAAFLFLRRPRRLLFKYTLGRFRSQEAMAASAQKKVVELREALEL  306

Query  477  MKKESGKLFERAALAHTEMKRGHSELMN  560
             K E  KL ER  LA  E  RG S++ N
Sbjct  307  QKNEKRKLEERFRLAEDEFLRGQSKMAN  334



>ref|XP_002987624.1| hypothetical protein SELMODRAFT_447060 [Selaginella moellendorffii]
 gb|EFJ11199.1| hypothetical protein SELMODRAFT_447060 [Selaginella moellendorffii]
Length=403

 Score = 75.5 bits (184),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 56/148 (38%), Positives = 82/148 (55%), Gaps = 4/148 (3%)
 Frame = +3

Query  129  LPRTVQESTDSAIRSA----RLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEV  296
            L   + E+TD A+R+A       Q++S+      +D   +   +Y+ YE+  F  +KD V
Sbjct  187  LKNGMSETTDVAVRAACNQLSELQDSSTTQYYYAKDMFWRFKREYREYENVFFSTLKDGV  246

Query  297  EIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDL  476
            + A   P +   +A     +F+R PRR LF+ TLGRFRS+EA    A+K V ELR +++L
Sbjct  247  KAATVSPGMAAMVATGAAFLFLRRPRRLLFKYTLGRFRSQEAMAASAQKKVVELREALEL  306

Query  477  MKKESGKLFERAALAHTEMKRGHSELMN  560
             K E  KL ER  LA  E  RG S++ N
Sbjct  307  QKNERRKLEERFRLAEDEFLRGQSKMAN  334



>gb|EPS62058.1| hypothetical protein M569_12732, partial [Genlisea aurea]
Length=221

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 47/148 (32%), Positives = 76/148 (51%), Gaps = 12/148 (8%)
 Frame = +3

Query  135  RTVQESTDSAIRSAR----LFQNTSSGHL----RSLQDFLPQLSSQYKAYEDALFQKVKD  290
            RT+  + ++ I + R     F  T+S H      S QDF      +Y  YE     K+K+
Sbjct  7    RTIANTVENTIEATRSRLDRFLTTASIHFDQTAESFQDF----KFEYHKYEAVALGKIKE  62

Query  291  EVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSV  470
               +A  HP +  G  +  G I ++G R++ + NTL  F +EE   ++A+  VK+L+ S 
Sbjct  63   SFVVASSHPYLTTGAVLGLGFISLKGTRQYFYYNTLRFFVTEEKLVSRADAKVKQLKQSF  122

Query  471  DLMKKESGKLFERAALAHTEMKRGHSEL  554
            D +K E  KL +RA  A  ++ RG ++L
Sbjct  123  DALKLEGEKLEKRALEAEEDLLRGRTKL  150



>ref|XP_011396980.1| hypothetical protein F751_1359 [Auxenochlorella protothecoides]
 gb|KFM24094.1| hypothetical protein F751_1359 [Auxenochlorella protothecoides]
Length=254

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 58/112 (52%), Gaps = 0/112 (0%)
 Frame = +3

Query  219  QDFLPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTL  398
            +D   Q   QYK  E A F  +K+ V    ++      +A+    I +RGPRRFL+R+TL
Sbjct  70   KDLYSQAELQYKQGEAAAFGYLKEGVRTVVDNKETSIAMAIGVAAIGLRGPRRFLWRHTL  129

Query  399  GRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSEL  554
            GR RSEEA F  AE     L   V+    E  KL ER  LA  E  RG S+L
Sbjct  130  GRLRSEEAVFKSAELRSVVLAEKVEGQALELKKLQERLGLAQAEYTRGLSKL  181



>ref|XP_006659070.1| PREDICTED: uncharacterized protein LOC102721384 [Oryza brachyantha]
Length=282

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 59/109 (54%), Gaps = 0/109 (0%)
 Frame = +3

Query  228  LPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRF  407
            L  + ++Y A+E  +F K+K+ V +A EHP +  G     G++  + PR +L +     F
Sbjct  103  LEWIKNEYMAHEQMVFGKIKESVIVAIEHPRIAAGSTTIAGIVLFKRPRSYLIQRVRRIF  162

Query  408  RSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSEL  554
             S+E   +  +  V  +R +V+L+  ES KL +RAA A    ++G + L
Sbjct  163  VSKETLLSGIQAEVNHMRQTVNLVSNESQKLMDRAATAEKRFQKGWNTL  211



>ref|NP_001144763.1| uncharacterized protein LOC100277822 [Zea mays]
 gb|ACG42816.1| hypothetical protein [Zea mays]
Length=278

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 57/109 (52%), Gaps = 0/109 (0%)
 Frame = +3

Query  228  LPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRF  407
            L    ++Y A+E  +F K+K+ V +A  HP +  G A   G+I  + PR +L +     F
Sbjct  99   LEWFKTEYSAHEQIVFGKIKEGVVMAIMHPGIAAGSATLAGIILFKRPRSYLIQRVRHMF  158

Query  408  RSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSEL  554
             S+E   +  +  V  +R +V+L+  E  KL +RAA A    ++G + L
Sbjct  159  VSKETLLSGVQAEVNHMRQTVNLVSNERQKLLDRAATAEKRFQKGWNTL  207



>gb|AFW66822.1| hypothetical protein ZEAMMB73_141697 [Zea mays]
Length=278

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 57/109 (52%), Gaps = 0/109 (0%)
 Frame = +3

Query  228  LPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRF  407
            L    ++Y A+E  +F K+K+ V +A  HP +  G A   G+I  + PR +L +     F
Sbjct  99   LEWFKTEYSAHEQIVFGKIKEGVVMAIMHPGIAAGSATLAGIILFKRPRSYLIQRVRHMF  158

Query  408  RSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSEL  554
             S+E   +  +  V  +R +V+L+  E  KL +RAA A    ++G + L
Sbjct  159  VSKETLLSGVQAEVNHMRQTVNLVSNERQKLLDRAATAEKRFQKGWNTL  207



>dbj|BAJ98005.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=277

 Score = 66.2 bits (160),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 57/109 (52%), Gaps = 0/109 (0%)
 Frame = +3

Query  228  LPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRF  407
            L  +  +Y A E     K+K+ V +A EHP +  G A   G++ ++ PR +L +     F
Sbjct  98   LEWVKKEYFAREQMALGKIKEGVIMAIEHPGIAAGSATVAGIVLLKRPRSYLIQRVRRVF  157

Query  408  RSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSEL  554
             S+E   +  +  V  +R +V+LM  ES KL +RAA A    ++G + L
Sbjct  158  VSKETLLSGIQAEVNHMRQTVNLMSNESQKLMDRAATAEKRFQKGWNTL  206



>ref|XP_005846915.1| hypothetical protein CHLNCDRAFT_134807 [Chlorella variabilis]
 gb|EFN54813.1| hypothetical protein CHLNCDRAFT_134807 [Chlorella variabilis]
Length=289

 Score = 65.9 bits (159),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 59/121 (49%), Gaps = 8/121 (7%)
 Frame = +3

Query  216  LQDFLPQLSSQYKAYEDALFQKVKDEVEIAR-EHPAVVGGIAVATGLIFMRGPRRFLFRN  392
            LQ F     + Y+A E    + +K  V   R EHP       VA   + + GPRRFL R+
Sbjct  99   LQRFYDTGLAHYQATEQQALELMKQGVRFVRKEHPEASMATGVAAFFVLLPGPRRFLLRH  158

Query  393  TLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKL-------FERAALAHTEMKRGHSE  551
            T+GRFRSEEA F  AE+    L+   +    E  KL        ER  LA  E +RG ++
Sbjct  159  TIGRFRSEEAMFKSAEQRYAGLKEKAEGHNGELQKLQASTAVTQERLQLAELEYQRGRAK  218

Query  552  L  554
            L
Sbjct  219  L  219



>gb|EEE56139.1| hypothetical protein OsJ_05019 [Oryza sativa Japonica Group]
Length=257

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 55/106 (52%), Gaps = 0/106 (0%)
 Frame = +3

Query  237  LSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSE  416
            L  +Y  +E  +F K+K+   +A EHP +  G     G++  + PR +L +     F S+
Sbjct  52   LKKEYTVHEQVVFGKIKEGAIMAIEHPGIAAGSTAIAGIVLFKRPRSYLIQRVRRIFVSK  111

Query  417  EAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSEL  554
            E   +  +  V  +R +V+L+  ES KL +RAA A    ++G + L
Sbjct  112  ETLLSGIQAGVNHMRQTVNLVSNESQKLLDRAATAEKRFQKGWNTL  157



>gb|EMT05527.1| hypothetical protein F775_07413 [Aegilops tauschii]
Length=193

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 55/103 (53%), Gaps = 0/103 (0%)
 Frame = +3

Query  246  QYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQ  425
            +Y A E     K+K+ V +A EHP +  G A   G++ ++ PR +L +     F S+E  
Sbjct  25   EYFAREQMALGKIKEGVIMAIEHPGIAAGSATVAGIVLLKRPRSYLIQRVRRVFVSKETL  84

Query  426  FNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSEL  554
             +  +  V  +R +V+LM  ES KL +RAA A    ++G + L
Sbjct  85   LSGIQAEVNHMRQTVNLMSNESQKLMDRAATAEKRFQKGWNTL  127



>ref|NP_001045615.1| Os02g0104800 [Oryza sativa Japonica Group]
 dbj|BAD06279.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD07539.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF07529.1| Os02g0104800 [Oryza sativa Japonica Group]
 dbj|BAG92178.1| unnamed protein product [Oryza sativa Japonica Group]
Length=279

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 55/106 (52%), Gaps = 0/106 (0%)
 Frame = +3

Query  237  LSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSE  416
            L  +Y  +E  +F K+K+   +A EHP +  G     G++  + PR +L +     F S+
Sbjct  103  LKKEYTVHEQVVFGKIKEGAIMAIEHPGIAAGSTAIAGIVLFKRPRSYLIQRVRRIFVSK  162

Query  417  EAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSEL  554
            E   +  +  V  +R +V+L+  ES KL +RAA A    ++G + L
Sbjct  163  ETLLSGIQAGVNHMRQTVNLVSNESQKLLDRAATAEKRFQKGWNTL  208



>gb|EEC75159.1| hypothetical protein OsI_11373 [Oryza sativa Indica Group]
Length=195

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +3

Query  363  RGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRG  542
            R PRRFL+RNTLGRF++E+   N AE+++ E + S++ +KK+S    ++ A+  ++++RG
Sbjct  61   RSPRRFLYRNTLGRFKTEKDLLNDAEQSMMEYKTSIEQLKKDSKYTLDKIAVGESDLQRG  120

Query  543  HSEL  554
             ++L
Sbjct  121  QTDL  124



>ref|XP_004951200.1| PREDICTED: uncharacterized protein LOC101766807 [Setaria italica]
Length=280

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 57/109 (52%), Gaps = 0/109 (0%)
 Frame = +3

Query  228  LPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRF  407
            L  +  +Y  +E  +F K+K+ V +A  HP +  G A   G++  + PR +L +     F
Sbjct  101  LEWVKKEYSTHEQMVFGKIKEGVIMAIMHPGIAAGSATLAGIVLFKRPRSYLIQRVRRMF  160

Query  408  RSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSEL  554
             S+E   +  +  V  +R +V+L+  ES KL +RAA A    ++G + L
Sbjct  161  VSKETLLSGIQAEVNHMRQTVNLVSNESQKLMDRAATAEKRFQKGWNTL  209



>ref|XP_006375269.1| hypothetical protein POPTR_0014s05780g [Populus trichocarpa]
 gb|ERP53066.1| hypothetical protein POPTR_0014s05780g [Populus trichocarpa]
Length=168

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 60/121 (50%), Gaps = 16/121 (13%)
 Frame = +3

Query  84   PQQRDKPW------HAYISEDLPRTVQESTDSAIRSA--RLFQNTSSGHLRSLQDFLPQL  239
            P +   PW       A I +   + +Q S D+AI ++  R  + TS+      Q    Q 
Sbjct  38   PVEETAPWIDNAMQQALIYQ---KNIQYSLDTAIEASKSRFSEITSTS-----QAHFSQT  89

Query  240  SSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEE  419
             S+   YE  LF KVK+E+ +A  HP +   +AV  GL+ ++ PR+ L+  TL  F SEE
Sbjct  90   ISEIGVYEGKLFGKVKEEINVAASHPLITSAVAVGLGLVALKRPRQILYYKTLRLFTSEE  149

Query  420  A  422
             
Sbjct  150  V  150



>ref|XP_003570319.1| PREDICTED: uncharacterized protein LOC100834616 [Brachypodium 
distachyon]
Length=285

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 57/109 (52%), Gaps = 0/109 (0%)
 Frame = +3

Query  228  LPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRF  407
            L  +  +Y A E     K+K+ V +A EHP +  G A   G++ ++ PR +L +     F
Sbjct  106  LEWVKKEYLAREQMALGKIKEGVIMAIEHPGIAAGSATVAGIVLLKRPRSYLIQRVRRIF  165

Query  408  RSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSEL  554
             S+E   +  +  V  +R +V+L+  ES KL +RAA A    ++G + L
Sbjct  166  VSKETLLSGIQAEVNHMRQTVNLVSNESQKLMDRAATAEKRFQKGWNTL  214



>gb|AEJ54427.1| hypothetical protein [Fagopyrum esculentum subsp. ancestrale]
Length=48

 Score = 60.1 bits (144),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +3

Query  402  RFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGH  545
            RF+SEE +F KAEKNV EL+LS+DL K ES KL +RAA A  EM++G 
Sbjct  1    RFQSEETKFLKAEKNVNELKLSIDLTKGESKKLLQRAAFAEKEMQQGR  48



>ref|XP_003078117.1| unnamed protein product [Ostreococcus tauri]
Length=214

 Score = 62.8 bits (151),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 51/99 (52%), Gaps = 1/99 (1%)
 Frame = +3

Query  261  EDALFQKV-KDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKA  437
            ED  F+   K  V+ AR +P  VGG       + +  PR  L+R+T+GR +SEEA FN  
Sbjct  45   EDEFFRSASKRVVDFARANPVSVGGTVACAVALALPAPRALLWRSTIGRLQSEEALFNAC  104

Query  438  EKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSEL  554
             +  + L L  +    E  +L E  + A  EMKRG S L
Sbjct  105  VRRSERLTLEAEAASAEIQRLAESVSAAEIEMKRGASNL  143



>gb|EEC72302.1| hypothetical protein OsI_05485 [Oryza sativa Indica Group]
Length=280

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 55/106 (52%), Gaps = 0/106 (0%)
 Frame = +3

Query  237  LSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSE  416
            +  +Y  +E  +F K+K+   +A EHP +  G     G++  + PR +L +     F S+
Sbjct  104  IKKEYTVHEQVVFGKIKEGAIMAIEHPGIAAGSTAIAGIVLFKRPRSYLIQRVRRIFVSK  163

Query  417  EAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSEL  554
            E   +  +  V  +R +V+L+  ES KL +RAA A    ++G + L
Sbjct  164  ETLLSGIQAEVNHMRQTVNLVSNESQKLLDRAATAEKRFQKGWNTL  209



>emb|CEF97085.1| unnamed product [Ostreococcus tauri]
Length=245

 Score = 63.2 bits (152),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 51/99 (52%), Gaps = 1/99 (1%)
 Frame = +3

Query  261  EDALFQKV-KDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKA  437
            ED  F+   K  V+ AR +P  VGG       + +  PR  L+R+T+GR +SEEA FN  
Sbjct  76   EDEFFRSASKRVVDFARANPVSVGGTVACAVALALPAPRALLWRSTIGRLQSEEALFNAC  135

Query  438  EKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSEL  554
             +  + L L  +    E  +L E  + A  EMKRG S L
Sbjct  136  VRRSERLTLEAEAASAEIQRLAESVSAAEIEMKRGASNL  174



>emb|CAN64905.1| hypothetical protein VITISV_042831 [Vitis vinifera]
Length=587

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 59/124 (48%), Gaps = 30/124 (24%)
 Frame = +3

Query  183  FQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFM  362
            F+    G   SL+D    + S+Y  YED    K+K                         
Sbjct  414  FEPVDGGIEESLKD----VKSEYDVYEDLAVGKIK-------------------------  444

Query  363  RGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRG  542
             GPR FL+ NTL    SEE+   +A+  V ELR S+DL+K ES KL +RA  A  EMKRG
Sbjct  445  -GPRHFLYYNTLRLLVSEESMVARADAKVNELRKSIDLLKAESEKLEKRALQAEDEMKRG  503

Query  543  HSEL  554
             ++L
Sbjct  504  RTKL  507



>gb|EMS57790.1| hypothetical protein TRIUR3_22595 [Triticum urartu]
Length=122

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 23/63 (37%), Positives = 45/63 (71%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  GPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGH  545
            GPRRFL+RNTLGRF++E+   N  E+++ E + S++ ++K+S    ++  +  ++++RG 
Sbjct  15   GPRRFLYRNTLGRFKTEKDLLNDVEQSMIEYKTSIESLRKDSKYTLDKVVIGESDLQRGR  74

Query  546  SEL  554
            ++L
Sbjct  75   TDL  77



>gb|EMT21115.1| hypothetical protein F775_32566 [Aegilops tauschii]
Length=211

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 23/63 (37%), Positives = 45/63 (71%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  GPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGH  545
            GPRRFL+RNTLGRF++E+   N  E+++ E + S++ ++K+S    ++  +  ++++RG 
Sbjct  100  GPRRFLYRNTLGRFKTEKDLLNDVEQSMIEYKTSIESLRKDSKYTLDKVVIGESDLQRGR  159

Query  546  SEL  554
            ++L
Sbjct  160  TDL  162



>ref|XP_001416629.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO94922.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=164

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 49/90 (54%), Gaps = 0/90 (0%)
 Frame = +3

Query  285  KDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRL  464
            K  VE  RE+PA     A+    + + GPR  L+R+TLGR +SEEA FN   +  + L L
Sbjct  4    KRVVETVRENPASATAGALTFLALALPGPRALLWRSTLGRLQSEEALFNACVRRSETLAL  63

Query  465  SVDLMKKESGKLFERAALAHTEMKRGHSEL  554
              +    E  +L E A+ A  EMKRG + L
Sbjct  64   DAEAASGEIQRLTEAASAAEVEMKRGAANL  93



>gb|KHN10117.1| hypothetical protein glysoja_048900 [Glycine soja]
Length=144

 Score = 58.9 bits (141),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 38/138 (28%), Positives = 61/138 (44%), Gaps = 7/138 (5%)
 Frame = +3

Query  21   MASDVPSTEIDETSSPAPAATPQQRDKPWHAYI---SEDLPRTVQESTDSAIRSARL---  182
            M ++ P ++ D  SS            P+  Y    ++   +   ++ DS I +A+    
Sbjct  3    MVAESPESDSDNNSSKTNNPQTLNETAPFLDYALAQAQLYHKAFNDAVDSTIDTAKSRFS  62

Query  183  -FQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIF  359
              ++TSS H     D L  L SQY AYE  LF K+K+ V +A  HP +  G   + GL+ 
Sbjct  63   QIRSTSSAHFHQTLDSLDDLKSQYTAYEGLLFGKIKEGVVVAASHPVITCGATASLGLLV  122

Query  360  MRGPRRFLFRNTLGRFRS  413
            ++   R      +  F S
Sbjct  123  LKSEIRCFLLCCVLIFHS  140



>gb|KDD75675.1| hypothetical protein H632_c557p1 [Helicosporidium sp. ATCC 50920]
Length=259

 Score = 60.1 bits (144),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 42/112 (38%), Positives = 58/112 (52%), Gaps = 0/112 (0%)
 Frame = +3

Query  219  QDFLPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTL  398
            Q ++ Q        E   F  +K+ V  A EH      +A+A   + + GPRR L+R TL
Sbjct  79   QGYVDQGRGTLAGLEAQAFGLLKEGVRTAYEHQEATAAVALAAAAVLLPGPRRLLWRMTL  138

Query  399  GRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSEL  554
            GR +S EA    AE+  K L  +V   K+E  KL ER ALA  E +RG ++L
Sbjct  139  GRLQSPEAGLRSAEQRAKALSEAVTFQKQEVSKLQERVALAQAEYERGRNKL  190



>gb|KJB09930.1| hypothetical protein B456_001G175600 [Gossypium raimondii]
Length=169

 Score = 53.1 bits (126),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 49/89 (55%), Gaps = 6/89 (7%)
 Frame = +3

Query  135  RTVQESTDSAIRSARL----FQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEI  302
            + ++++ + AI+++R      ++TSS H     + L  + SQ   YED  F KVK+ + I
Sbjct  59   KIIEQNVNDAIKASRSRLSEIRSTSSAHFNLTIESLKDVKSQLDVYEDLAFGKVKEGINI  118

Query  303  AREHPAVVGGIAVATGLIFMRG--PRRFL  383
            A  +P + GG AV  G + ++   PR ++
Sbjct  119  AASNPLITGGAAVGLGFLVLKSMVPRLYM  147



>gb|KJB09929.1| hypothetical protein B456_001G175600 [Gossypium raimondii]
Length=154

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 43/78 (55%), Gaps = 4/78 (5%)
 Frame = +3

Query  135  RTVQESTDSAIRSARL----FQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEI  302
            + ++++ + AI+++R      ++TSS H     + L  + SQ   YED  F KVK+ + I
Sbjct  59   KIIEQNVNDAIKASRSRLSEIRSTSSAHFNLTIESLKDVKSQLDVYEDLAFGKVKEGINI  118

Query  303  AREHPAVVGGIAVATGLI  356
            A  +P + GG AV  G +
Sbjct  119  AASNPLITGGAAVGLGFL  136



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 631248065840