BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002E20

Length=596
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009599477.1|  PREDICTED: bidirectional sugar transporter S...    262   4e-84   Nicotiana tomentosiformis
ref|XP_009758167.1|  PREDICTED: bidirectional sugar transporter S...    257   5e-82   Nicotiana sylvestris
ref|XP_009605549.1|  PREDICTED: bidirectional sugar transporter S...    257   6e-82   Nicotiana tomentosiformis
ref|XP_009605550.1|  PREDICTED: bidirectional sugar transporter S...    256   1e-81   Nicotiana tomentosiformis
ref|XP_009758165.1|  PREDICTED: bidirectional sugar transporter S...    256   2e-81   Nicotiana sylvestris
ref|XP_009597195.1|  PREDICTED: bidirectional sugar transporter S...    255   2e-81   Nicotiana tomentosiformis
ref|XP_009802608.1|  PREDICTED: bidirectional sugar transporter S...    255   2e-81   Nicotiana sylvestris
ref|XP_009614916.1|  PREDICTED: bidirectional sugar transporter S...    255   4e-81   Nicotiana tomentosiformis
ref|XP_009758166.1|  PREDICTED: bidirectional sugar transporter S...    254   1e-80   Nicotiana sylvestris
ref|XP_009787633.1|  PREDICTED: bidirectional sugar transporter N...    253   2e-80   Nicotiana sylvestris
ref|XP_009591687.1|  PREDICTED: bidirectional sugar transporter N...    253   2e-80   Nicotiana tomentosiformis
ref|XP_009794695.1|  PREDICTED: bidirectional sugar transporter N...    253   2e-80   Nicotiana sylvestris
ref|XP_009587580.1|  PREDICTED: bidirectional sugar transporter S...    253   3e-80   Nicotiana tomentosiformis
ref|XP_009762335.1|  PREDICTED: bidirectional sugar transporter S...    253   3e-80   Nicotiana sylvestris
ref|XP_009796436.1|  PREDICTED: bidirectional sugar transporter S...    250   3e-79   Nicotiana sylvestris
ref|XP_009614915.1|  PREDICTED: bidirectional sugar transporter S...    249   1e-78   Nicotiana tomentosiformis
ref|XP_006347346.1|  PREDICTED: bidirectional sugar transporter S...    248   1e-78   Solanum tuberosum [potatoes]
ref|XP_006347652.1|  PREDICTED: bidirectional sugar transporter S...    254   2e-78   
ref|XP_009802194.1|  PREDICTED: bidirectional sugar transporter S...    248   3e-78   Nicotiana sylvestris
ref|XP_004241452.1|  PREDICTED: bidirectional sugar transporter S...    247   3e-78   Solanum lycopersicum
ref|XP_006347635.1|  PREDICTED: bidirectional sugar transporter S...    246   7e-78   Solanum tuberosum [potatoes]
ref|XP_006347634.1|  PREDICTED: bidirectional sugar transporter S...    246   1e-77   Solanum tuberosum [potatoes]
ref|XP_004235342.2|  PREDICTED: uncharacterized protein LOC101265905    254   2e-77   
ref|XP_004235339.1|  PREDICTED: bidirectional sugar transporter S...    245   2e-77   Solanum lycopersicum
gb|ACV71016.1|  UPA16                                                   245   3e-77   Capsicum annuum
ref|XP_009601078.1|  PREDICTED: bidirectional sugar transporter S...    239   7e-77   Nicotiana tomentosiformis
ref|XP_006363981.1|  PREDICTED: bidirectional sugar transporter S...    243   2e-76   Solanum tuberosum [potatoes]
ref|XP_004235326.1|  PREDICTED: bidirectional sugar transporter N3      243   3e-76   Solanum lycopersicum
ref|XP_006347633.1|  PREDICTED: bidirectional sugar transporter S...    241   1e-75   Solanum tuberosum [potatoes]
ref|XP_004235333.1|  PREDICTED: bidirectional sugar transporter S...    240   2e-75   Solanum lycopersicum
ref|XP_006347347.1|  PREDICTED: bidirectional sugar transporter S...    236   6e-74   Solanum tuberosum [potatoes]
ref|XP_004235334.1|  PREDICTED: bidirectional sugar transporter S...    236   2e-73   Solanum lycopersicum
ref|XP_004242139.1|  PREDICTED: bidirectional sugar transporter S...    235   2e-73   Solanum lycopersicum
ref|XP_011073577.1|  PREDICTED: bidirectional sugar transporter S...    233   1e-72   
ref|XP_011069470.1|  PREDICTED: bidirectional sugar transporter S...    226   1e-71   Sesamum indicum [beniseed]
ref|XP_009794853.1|  PREDICTED: bidirectional sugar transporter S...    229   3e-71   Nicotiana sylvestris
ref|XP_009802195.1|  PREDICTED: bidirectional sugar transporter S...    227   3e-70   Nicotiana sylvestris
ref|XP_009803865.1|  PREDICTED: bidirectional sugar transporter S...    220   1e-67   Nicotiana sylvestris
ref|XP_009614917.1|  PREDICTED: bidirectional sugar transporter S...    218   1e-66   Nicotiana tomentosiformis
ref|XP_011083538.1|  PREDICTED: bidirectional sugar transporter S...    207   1e-62   Sesamum indicum [beniseed]
ref|XP_006347632.1|  PREDICTED: bidirectional sugar transporter S...    206   6e-62   Solanum tuberosum [potatoes]
ref|XP_004235340.1|  PREDICTED: bidirectional sugar transporter S...    204   2e-61   Solanum lycopersicum
ref|XP_011073105.1|  PREDICTED: bidirectional sugar transporter N...    201   3e-60   Sesamum indicum [beniseed]
gb|EYU43028.1|  hypothetical protein MIMGU_mgv1a019383mg                197   3e-60   Erythranthe guttata [common monkey flower]
ref|XP_009601079.1|  PREDICTED: bidirectional sugar transporter S...    200   7e-60   Nicotiana tomentosiformis
ref|XP_006578712.1|  PREDICTED: bidirectional sugar transporter S...    200   7e-60   Glycine max [soybeans]
gb|EYU43031.1|  hypothetical protein MIMGU_mgv1a011488mg                200   7e-60   Erythranthe guttata [common monkey flower]
ref|XP_009779208.1|  PREDICTED: bidirectional sugar transporter S...    199   9e-60   Nicotiana sylvestris
gb|EPS64389.1|  hypothetical protein M569_10392                         197   3e-59   Genlisea aurea
gb|EYU24137.1|  hypothetical protein MIMGU_mgv1a022637mg                195   3e-59   Erythranthe guttata [common monkey flower]
ref|XP_004297512.1|  PREDICTED: bidirectional sugar transporter S...    199   3e-59   Fragaria vesca subsp. vesca
emb|CDP21121.1|  unnamed protein product                                197   5e-59   Coffea canephora [robusta coffee]
ref|XP_008392763.1|  PREDICTED: bidirectional sugar transporter S...    196   8e-59   
gb|EYU43030.1|  hypothetical protein MIMGU_mgv1a011435mg                197   8e-59   Erythranthe guttata [common monkey flower]
ref|XP_009605548.1|  PREDICTED: bidirectional sugar transporter S...    197   1e-58   Nicotiana tomentosiformis
ref|XP_003523161.1|  PREDICTED: bidirectional sugar transporter S...    196   1e-58   
gb|EYU43032.1|  hypothetical protein MIMGU_mgv1a010677mg                197   1e-58   Erythranthe guttata [common monkey flower]
ref|XP_009801964.1|  PREDICTED: bidirectional sugar transporter S...    197   2e-58   Nicotiana sylvestris
emb|CAN71371.1|  hypothetical protein VITISV_023352                     196   3e-58   Vitis vinifera
gb|EYU23059.1|  hypothetical protein MIMGU_mgv1a019104mg                196   3e-58   Erythranthe guttata [common monkey flower]
ref|XP_002284244.1|  PREDICTED: bidirectional sugar transporter S...    195   3e-58   Vitis vinifera
gb|ACU23483.1|  unknown                                                 195   3e-58   Glycine max [soybeans]
ref|NP_001237418.1|  N3 protein                                         195   3e-58   Glycine max [soybeans]
ref|XP_009337539.1|  PREDICTED: bidirectional sugar transporter N3      195   9e-58   Pyrus x bretschneideri [bai li]
ref|XP_006436900.1|  hypothetical protein CICLE_v10033645mg             194   9e-58   Citrus clementina [clementine]
gb|KHN23963.1|  Bidirectional sugar transporter SWEET14                 192   4e-57   Glycine soja [wild soybean]
emb|CDP21733.1|  unnamed protein product                                192   6e-57   Coffea canephora [robusta coffee]
ref|XP_007137870.1|  hypothetical protein PHAVU_009G162700g             192   6e-57   Phaseolus vulgaris [French bean]
ref|XP_010929602.1|  PREDICTED: bidirectional sugar transporter S...    192   8e-57   Elaeis guineensis
gb|AFK48645.1|  unknown                                                 191   9e-57   Lotus japonicus
ref|XP_004490502.1|  PREDICTED: bidirectional sugar transporter N...    190   4e-56   Cicer arietinum [garbanzo]
ref|XP_008464393.1|  PREDICTED: bidirectional sugar transporter S...    190   6e-56   Cucumis melo [Oriental melon]
ref|XP_009347840.1|  PREDICTED: bidirectional sugar transporter N...    191   6e-56   
ref|XP_007209422.1|  hypothetical protein PRUPE_ppa009422mg             190   8e-56   Prunus persica
ref|XP_009385515.1|  PREDICTED: bidirectional sugar transporter S...    189   8e-56   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006844581.1|  hypothetical protein AMTR_s00016p00202420          189   1e-55   Amborella trichopoda
ref|XP_008374287.1|  PREDICTED: bidirectional sugar transporter N...    190   1e-55   
ref|XP_003602778.1|  Protein RUPTURED POLLEN GRAIN                      190   1e-55   Medicago truncatula
ref|XP_007137871.1|  hypothetical protein PHAVU_009G162800g             186   1e-55   Phaseolus vulgaris [French bean]
ref|XP_004138032.1|  PREDICTED: bidirectional sugar transporter S...    189   1e-55   Cucumis sativus [cucumbers]
ref|XP_004297511.1|  PREDICTED: bidirectional sugar transporter N3      189   2e-55   Fragaria vesca subsp. vesca
ref|XP_008239633.1|  PREDICTED: bidirectional sugar transporter S...    189   2e-55   
ref|XP_007038075.1|  Nodulin MtN3 family protein, putative isoform 1    188   4e-55   
ref|XP_010250599.1|  PREDICTED: bidirectional sugar transporter S...    188   4e-55   Nelumbo nucifera [Indian lotus]
ref|NP_001242732.1|  uncharacterized protein LOC100810962               187   5e-55   
emb|CDP21120.1|  unnamed protein product                                186   1e-54   Coffea canephora [robusta coffee]
ref|XP_009412768.1|  PREDICTED: bidirectional sugar transporter S...    186   1e-54   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008239523.1|  PREDICTED: bidirectional sugar transporter N3      187   2e-54   Prunus mume [ume]
ref|XP_003526939.1|  PREDICTED: bidirectional sugar transporter S...    187   2e-54   
gb|KJB19799.1|  hypothetical protein B456_003G119400                    186   2e-54   Gossypium raimondii
gb|KHN23961.1|  Bidirectional sugar transporter SWEET12                 187   2e-54   Glycine soja [wild soybean]
gb|KFK27668.1|  hypothetical protein AALP_AA8G413300                    186   3e-54   Arabis alpina [alpine rockcress]
ref|XP_010093933.1|  Bidirectional sugar transporter SWEET10            186   3e-54   Morus notabilis
emb|CDY70861.1|  BnaCnng70080D                                          182   3e-54   Brassica napus [oilseed rape]
ref|XP_006288378.1|  hypothetical protein CARUB_v10001629mg             186   4e-54   Capsella rubella
ref|XP_008392764.1|  PREDICTED: bidirectional sugar transporter S...    185   5e-54   
gb|KJB07961.1|  hypothetical protein B456_001G055600                    185   6e-54   Gossypium raimondii
gb|KHG27148.1|  Bidirectional sugar transporter SWEET10 -like pro...    184   8e-54   Gossypium arboreum [tree cotton]
ref|XP_006366912.1|  PREDICTED: bidirectional sugar transporter S...    184   1e-53   
ref|XP_002453892.1|  hypothetical protein SORBIDRAFT_04g021000          186   1e-53   Sorghum bicolor [broomcorn]
ref|XP_006436901.1|  hypothetical protein CICLE_v10032313mg             184   1e-53   Citrus clementina [clementine]
ref|XP_011020821.1|  PREDICTED: bidirectional sugar transporter N...    184   1e-53   Populus euphratica
ref|XP_006347653.1|  PREDICTED: bidirectional sugar transporter S...    184   1e-53   
ref|NP_001241307.1|  uncharacterized protein LOC100810946               183   1e-53   Glycine max [soybeans]
ref|XP_002442119.1|  hypothetical protein SORBIDRAFT_08g014040          184   1e-53   Sorghum bicolor [broomcorn]
gb|KHN24976.1|  Bidirectional sugar transporter N3                      183   2e-53   Glycine soja [wild soybean]
ref|NP_190443.1|  bidirectional sugar transporter SWEET11               184   2e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007038076.1|  Nodulin MtN3 family protein, putative isoform 2    183   2e-53   
gb|KJB51264.1|  hypothetical protein B456_008G209000                    181   2e-53   Gossypium raimondii
ref|XP_002443167.1|  hypothetical protein SORBIDRAFT_08g013840          184   2e-53   
ref|XP_009150896.1|  PREDICTED: bidirectional sugar transporter S...    183   2e-53   Brassica rapa
emb|CDX88041.1|  BnaA06g26320D                                          183   2e-53   
ref|XP_003532478.1|  PREDICTED: bidirectional sugar transporter S...    182   3e-53   
ref|XP_006663471.1|  PREDICTED: bidirectional sugar transporter S...    184   3e-53   Oryza brachyantha
ref|XP_004235470.1|  PREDICTED: bidirectional sugar transporter S...    182   3e-53   Solanum lycopersicum
ref|XP_011023930.1|  PREDICTED: bidirectional sugar transporter S...    182   3e-53   Populus euphratica
ref|XP_010421173.1|  PREDICTED: bidirectional sugar transporter S...    182   5e-53   Camelina sativa [gold-of-pleasure]
ref|XP_006394628.1|  hypothetical protein EUTSA_v10004719mg             182   5e-53   Eutrema salsugineum [saltwater cress]
ref|XP_006404221.1|  hypothetical protein EUTSA_v10010591mg             182   6e-53   Eutrema salsugineum [saltwater cress]
ref|XP_010454652.1|  PREDICTED: bidirectional sugar transporter S...    182   6e-53   Camelina sativa [gold-of-pleasure]
ref|XP_010093935.1|  Bidirectional sugar transporter SWEET12            183   6e-53   Morus notabilis
ref|XP_006366913.1|  PREDICTED: bidirectional sugar transporter S...    184   7e-53   
ref|XP_010493487.1|  PREDICTED: bidirectional sugar transporter S...    182   7e-53   Camelina sativa [gold-of-pleasure]
sp|A2X5B4.1|SWT15_ORYSI  RecName: Full=Bidirectional sugar transp...    183   7e-53   Oryza sativa Indica Group [Indian rice]
ref|NP_197755.1|  bidirectional sugar transporter SWEET12               182   7e-53   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001046944.1|  Os02g0513100                                       183   8e-53   
ref|XP_004501726.1|  PREDICTED: bidirectional sugar transporter S...    182   9e-53   Cicer arietinum [garbanzo]
gb|KHN03192.1|  Bidirectional sugar transporter N3                      181   9e-53   Glycine soja [wild soybean]
ref|XP_004145146.1|  PREDICTED: bidirectional sugar transporter S...    182   9e-53   
gb|AHB08882.1|  bidirectional sugar transporter SWEET14-like protein    183   9e-53   Suaeda glauca
emb|CDX80379.1|  BnaC07g30650D                                          182   9e-53   
ref|XP_003551863.1|  PREDICTED: bidirectional sugar transporter N...    181   1e-52   Glycine max [soybeans]
ref|XP_003530901.1|  PREDICTED: bidirectional sugar transporter N...    181   1e-52   Glycine max [soybeans]
emb|CDY16863.1|  BnaA09g05190D                                          181   1e-52   Brassica napus [oilseed rape]
emb|CDX87161.1|  BnaC09g04760D                                          181   1e-52   
ref|XP_007159993.1|  hypothetical protein PHAVU_002G283900g             180   2e-52   Phaseolus vulgaris [French bean]
gb|KJB31535.1|  hypothetical protein B456_005G195100                    181   2e-52   Gossypium raimondii
gb|KJB51265.1|  hypothetical protein B456_008G209000                    177   2e-52   Gossypium raimondii
ref|XP_006493253.1|  PREDICTED: bidirectional sugar transporter S...    181   2e-52   Citrus sinensis [apfelsine]
ref|XP_010678288.1|  PREDICTED: bidirectional sugar transporter N3      182   2e-52   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB51261.1|  hypothetical protein B456_008G209000                    180   2e-52   Gossypium raimondii
ref|XP_010545940.1|  PREDICTED: bidirectional sugar transporter S...    181   3e-52   Tarenaya hassleriana [spider flower]
ref|XP_009141677.1|  PREDICTED: bidirectional sugar transporter S...    180   3e-52   Brassica rapa
ref|NP_001141106.1|  uncharacterized protein LOC100273190               180   4e-52   Zea mays [maize]
ref|XP_002877629.1|  nodulin MtN3 family protein                        180   4e-52   
ref|XP_004161952.1|  PREDICTED: bidirectional sugar transporter S...    180   5e-52   
emb|CDX83046.1|  BnaA01g20460D                                          180   5e-52   
ref|XP_006647263.1|  PREDICTED: bidirectional sugar transporter S...    181   5e-52   Oryza brachyantha
emb|CDX77928.1|  BnaC03g52910D                                          180   5e-52   
ref|XP_002877428.1|  hypothetical protein ARALYDRAFT_484952             180   6e-52   
gb|AGV54262.1|  bidirectional sugar transporter SWEET12                 181   6e-52   Phaseolus vulgaris [French bean]
gb|KHG02402.1|  Bidirectional sugar transporter SWEET10 -like pro...    179   6e-52   Gossypium arboreum [tree cotton]
ref|XP_008677256.1|  PREDICTED: LOC100282648 isoform X1                 180   6e-52   Zea mays [maize]
ref|NP_001149028.1|  LOC100282648                                       180   7e-52   Zea mays [maize]
ref|XP_006413354.1|  hypothetical protein EUTSA_v10025975mg             179   7e-52   Eutrema salsugineum [saltwater cress]
ref|XP_007159992.1|  hypothetical protein PHAVU_002G283900g             176   8e-52   Phaseolus vulgaris [French bean]
tpg|DAA54931.1|  TPA: hypothetical protein ZEAMMB73_176833              176   8e-52   
ref|XP_002511128.1|  conserved hypothetical protein                     179   8e-52   Ricinus communis
ref|XP_010678287.1|  PREDICTED: bidirectional sugar transporter S...    180   8e-52   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004153501.1|  PREDICTED: bidirectional sugar transporter S...    179   9e-52   Cucumis sativus [cucumbers]
ref|XP_004952573.1|  PREDICTED: bidirectional sugar transporter S...    180   9e-52   Setaria italica
ref|NP_001131289.1|  mtN3-like protein                                  179   1e-51   Zea mays [maize]
ref|XP_009149800.1|  PREDICTED: bidirectional sugar transporter S...    179   1e-51   Brassica rapa
ref|XP_010412639.1|  PREDICTED: bidirectional sugar transporter S...    175   1e-51   Camelina sativa [gold-of-pleasure]
gb|ACG28570.1|  MTN3                                                    179   1e-51   Zea mays [maize]
ref|XP_011023931.1|  PREDICTED: bidirectional sugar transporter S...    178   1e-51   Populus euphratica
ref|XP_010426372.1|  PREDICTED: bidirectional sugar transporter S...    179   1e-51   Camelina sativa [gold-of-pleasure]
ref|XP_009150178.1|  PREDICTED: bidirectional sugar transporter S...    179   1e-51   Brassica rapa
emb|CDY05867.1|  BnaC08g20440D                                          179   1e-51   
emb|CDY08093.1|  BnaA06g16330D                                          179   1e-51   Brassica napus [oilseed rape]
ref|XP_010503515.1|  PREDICTED: bidirectional sugar transporter S...    179   1e-51   Camelina sativa [gold-of-pleasure]
ref|XP_011023934.1|  PREDICTED: bidirectional sugar transporter S...    179   1e-51   Populus euphratica
gb|KHN31280.1|  Bidirectional sugar transporter SWEET14-like protein    179   2e-51   Glycine soja [wild soybean]
gb|EMT20808.1|  Protein RUPTURED POLLEN GRAIN 1                         179   2e-51   
gb|AAM65058.1|  MtN3-like protein                                       179   2e-51   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001149087.1|  MTN3                                               179   2e-51   Zea mays [maize]
ref|NP_001067955.1|  Os11g0508600                                       179   2e-51   
gb|EMT11081.1|  Protein RUPTURED POLLEN GRAIN 1                         178   2e-51   
sp|B8BKP4.1|SWT14_ORYSI  RecName: Full=Bidirectional sugar transp...    179   2e-51   Oryza sativa Indica Group [Indian rice]
ref|XP_006444236.1|  hypothetical protein CICLE_v10023774mg             178   2e-51   Citrus clementina [clementine]
ref|XP_008791098.1|  PREDICTED: bidirectional sugar transporter S...    179   2e-51   
ref|XP_008392727.1|  PREDICTED: bidirectional sugar transporter S...    179   2e-51   
ref|XP_009411801.1|  PREDICTED: bidirectional sugar transporter S...    178   2e-51   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002321731.1|  N3 like family protein                             178   2e-51   Populus trichocarpa [western balsam poplar]
ref|XP_009337540.1|  PREDICTED: bidirectional sugar transporter NEC1    178   3e-51   Pyrus x bretschneideri [bai li]
ref|XP_004161953.1|  PREDICTED: bidirectional sugar transporter S...    178   3e-51   
ref|XP_008440025.1|  PREDICTED: bidirectional sugar transporter S...    178   3e-51   Cucumis melo [Oriental melon]
ref|XP_002321730.2|  N3 like family protein                             177   3e-51   
gb|KDO87388.1|  hypothetical protein CISIN_1g036251mg                   177   3e-51   Citrus sinensis [apfelsine]
ref|XP_006376915.1|  hypothetical protein POPTR_0012s10500g             177   3e-51   
gb|EMS46194.1|  Bidirectional sugar transporter SWEET15                 179   4e-51   Triticum urartu
ref|XP_010235464.1|  PREDICTED: bidirectional sugar transporter S...    178   4e-51   Brachypodium distachyon [annual false brome]
ref|NP_199893.1|  bidirectional sugar transporter SWEET13               178   4e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011071246.1|  PREDICTED: bidirectional sugar transporter N3      178   4e-51   Sesamum indicum [beniseed]
gb|EMT03611.1|  Protein RUPTURED POLLEN GRAIN 1                         177   5e-51   
ref|XP_002303766.2|  hypothetical protein POPTR_0003s16520g             177   5e-51   Populus trichocarpa [western balsam poplar]
gb|KJB40042.1|  hypothetical protein B456_007G043800                    177   6e-51   Gossypium raimondii
ref|XP_004174114.1|  PREDICTED: bidirectional sugar transporter S...    174   6e-51   
ref|XP_004145147.1|  PREDICTED: bidirectional sugar transporter S...    177   6e-51   
ref|XP_011015361.1|  PREDICTED: bidirectional sugar transporter S...    176   7e-51   Populus euphratica
emb|CDP13388.1|  unnamed protein product                                177   8e-51   Coffea canephora [robusta coffee]
ref|XP_004503778.1|  PREDICTED: bidirectional sugar transporter S...    176   8e-51   Cicer arietinum [garbanzo]
ref|XP_002443163.1|  hypothetical protein SORBIDRAFT_08g013620          177   9e-51   Sorghum bicolor [broomcorn]
ref|XP_009393865.1|  PREDICTED: bidirectional sugar transporter S...    176   1e-50   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX68492.1|  BnaC01g25700D                                          177   1e-50   
ref|XP_004491680.1|  PREDICTED: bidirectional sugar transporter N...    176   1e-50   Cicer arietinum [garbanzo]
dbj|BAJ85621.1|  predicted protein                                      177   1e-50   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009765830.1|  PREDICTED: bidirectional sugar transporter N...    176   1e-50   Nicotiana sylvestris
ref|NP_001141654.1|  hypothetical protein                               177   1e-50   Zea mays [maize]
ref|XP_007043874.1|  Senescence-associated gene 29                      176   1e-50   Theobroma cacao [chocolate]
ref|XP_007137872.1|  hypothetical protein PHAVU_009G162900g             176   1e-50   Phaseolus vulgaris [French bean]
sp|Q2QR07.1|SWT13_ORYSJ  RecName: Full=Bidirectional sugar transp...    177   1e-50   Oryza sativa Japonica Group [Japonica rice]
gb|EMS51422.1|  Bidirectional sugar transporter SWEET13                 176   1e-50   Triticum urartu
ref|XP_011023933.1|  PREDICTED: bidirectional sugar transporter S...    176   1e-50   Populus euphratica
gb|EYU42078.1|  hypothetical protein MIMGU_mgv1a010705mg                177   1e-50   Erythranthe guttata [common monkey flower]
ref|XP_002322281.2|  N3 like family protein                             176   1e-50   Populus trichocarpa [western balsam poplar]
gb|EAY83053.1|  hypothetical protein OsI_38270                          176   1e-50   Oryza sativa Indica Group [Indian rice]
ref|XP_006347482.1|  PREDICTED: bidirectional sugar transporter S...    176   2e-50   Solanum tuberosum [potatoes]
ref|NP_001239695.1|  uncharacterized protein LOC100777741               176   2e-50   Glycine max [soybeans]
emb|CAC44123.1|  N3 like protein                                        175   2e-50   Medicago truncatula
gb|KEH20983.1|  bidirectional sugar transporter                         175   2e-50   Medicago truncatula
ref|XP_010550745.1|  PREDICTED: bidirectional sugar transporter S...    176   2e-50   Tarenaya hassleriana [spider flower]
gb|KDP26857.1|  hypothetical protein JCGZ_18015                         176   2e-50   Jatropha curcas
ref|XP_002514863.1|  conserved hypothetical protein                     175   2e-50   
dbj|BAJ94651.1|  predicted protein                                      176   3e-50   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006664549.1|  PREDICTED: bidirectional sugar transporter S...    174   3e-50   
ref|XP_003620983.1|  Protein RUPTURED POLLEN GRAIN                      174   4e-50   
ref|XP_004138250.1|  PREDICTED: bidirectional sugar transporter S...    176   4e-50   Cucumis sativus [cucumbers]
gb|EMS48886.1|  Bidirectional sugar transporter SWEET13                 178   4e-50   Triticum urartu
ref|XP_009109231.1|  PREDICTED: bidirectional sugar transporter S...    174   4e-50   Brassica rapa
gb|KEH21447.1|  sugar efflux transporter for intercellular exchan...    175   4e-50   Medicago truncatula
ref|XP_010519500.1|  PREDICTED: bidirectional sugar transporter S...    175   4e-50   Tarenaya hassleriana [spider flower]
gb|EMT09236.1|  Protein RUPTURED POLLEN GRAIN 1                         176   4e-50   
ref|XP_004239304.1|  PREDICTED: bidirectional sugar transporter N3      175   5e-50   Solanum lycopersicum
ref|XP_009612477.1|  PREDICTED: bidirectional sugar transporter N...    176   5e-50   Nicotiana tomentosiformis
ref|XP_002322282.2|  hypothetical protein POPTR_0015s11380g             174   5e-50   Populus trichocarpa [western balsam poplar]
emb|CDP14988.1|  unnamed protein product                                174   6e-50   Coffea canephora [robusta coffee]
ref|XP_004979336.1|  PREDICTED: bidirectional sugar transporter S...    175   7e-50   Setaria italica
gb|AFK35161.1|  unknown                                                 173   7e-50   Medicago truncatula
ref|XP_007159040.1|  hypothetical protein PHAVU_002G203600g             174   1e-49   Phaseolus vulgaris [French bean]
ref|XP_010045490.1|  PREDICTED: bidirectional sugar transporter S...    170   1e-49   Eucalyptus grandis [rose gum]
gb|KHN39181.1|  Bidirectional sugar transporter N3                      173   1e-49   Glycine soja [wild soybean]
ref|XP_011084749.1|  PREDICTED: bidirectional sugar transporter N...    174   1e-49   
ref|XP_003531061.1|  PREDICTED: bidirectional sugar transporter N...    173   1e-49   Glycine max [soybeans]
ref|XP_008464392.1|  PREDICTED: bidirectional sugar transporter S...    174   1e-49   Cucumis melo [Oriental melon]
ref|XP_006402061.1|  hypothetical protein EUTSA_v10014268mg             174   1e-49   Eutrema salsugineum [saltwater cress]
ref|XP_009403777.1|  PREDICTED: bidirectional sugar transporter S...    173   2e-49   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAM65389.1|  senescence-associated protein (SAG29)                   174   2e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006480106.1|  PREDICTED: bidirectional sugar transporter S...    173   2e-49   Citrus sinensis [apfelsine]
gb|AES73031.2|  sugar efflux transporter for intercellular exchan...    171   2e-49   Medicago truncatula
ref|NP_196821.1|  senescence-associated protein 29                      173   2e-49   Arabidopsis thaliana [mouse-ear cress]
emb|CDY24854.1|  BnaA08g14560D                                          173   2e-49   Brassica napus [oilseed rape]
gb|AFW71563.1|  hypothetical protein ZEAMMB73_472818                    174   2e-49   
gb|AHL43546.1|  nodule-specific sucrose transporter                     172   2e-49   Medicago truncatula
ref|XP_009137488.1|  PREDICTED: bidirectional sugar transporter S...    172   3e-49   Brassica rapa
ref|XP_004310113.1|  PREDICTED: bidirectional sugar transporter N3      173   3e-49   Fragaria vesca subsp. vesca
ref|XP_010438942.1|  PREDICTED: bidirectional sugar transporter S...    173   3e-49   Camelina sativa [gold-of-pleasure]
ref|XP_010448490.1|  PREDICTED: bidirectional sugar transporter S...    172   3e-49   Camelina sativa [gold-of-pleasure]
emb|CDX92666.1|  BnaC07g39240D                                          172   3e-49   
ref|XP_002867630.1|  nodulin MtN3 family protein                        172   3e-49   Arabidopsis lyrata subsp. lyrata
ref|NP_001132836.1|  hypothetical protein                               174   3e-49   Zea mays [maize]
gb|EMT22394.1|  Protein RUPTURED POLLEN GRAIN 1                         173   3e-49   
ref|XP_006282018.1|  hypothetical protein CARUB_v10028257mg             172   4e-49   Capsella rubella
ref|XP_010027258.1|  PREDICTED: bidirectional sugar transporter N...    172   4e-49   
ref|XP_009405955.1|  PREDICTED: bidirectional sugar transporter S...    172   4e-49   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK26708.1|  hypothetical protein AALP_AA8G283000                    172   4e-49   Arabis alpina [alpine rockcress]
ref|XP_006285021.1|  hypothetical protein CARUB_v10006328mg             172   4e-49   Capsella rubella
ref|XP_010536596.1|  PREDICTED: bidirectional sugar transporter S...    173   5e-49   Tarenaya hassleriana [spider flower]
ref|NP_194231.1|  bidirectional sugar transporter SWEET14               172   5e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010242697.1|  PREDICTED: bidirectional sugar transporter S...    172   6e-49   Nelumbo nucifera [Indian lotus]
ref|XP_010025273.1|  PREDICTED: bidirectional sugar transporter N...    172   6e-49   Eucalyptus grandis [rose gum]
ref|XP_009609628.1|  PREDICTED: bidirectional sugar transporter N...    172   6e-49   Nicotiana tomentosiformis
ref|XP_002862913.1|  nodulin MtN3 family protein                        172   8e-49   
ref|XP_004501816.1|  PREDICTED: bidirectional sugar transporter S...    171   8e-49   Cicer arietinum [garbanzo]
gb|KJB19801.1|  hypothetical protein B456_003G119400                    172   9e-49   Gossypium raimondii
ref|XP_003602780.1|  Protein RUPTURED POLLEN GRAIN                      171   9e-49   
ref|XP_007038077.1|  Medicago truncatula MTN3, putative                 171   1e-48   Theobroma cacao [chocolate]
gb|EMT20480.1|  Protein RUPTURED POLLEN GRAIN 1                         171   1e-48   
ref|XP_002511125.1|  conserved hypothetical protein                     171   1e-48   
ref|XP_002270131.1|  PREDICTED: bidirectional sugar transporter S...    171   1e-48   
ref|XP_008222221.1|  PREDICTED: bidirectional sugar transporter N3      171   1e-48   
ref|XP_006291603.1|  hypothetical protein CARUB_v10017757mg             171   1e-48   
ref|XP_003524088.1|  PREDICTED: bidirectional sugar transporter N...    171   1e-48   
ref|XP_006399805.1|  hypothetical protein EUTSA_v10014234mg             171   1e-48   
emb|CDY03395.1|  BnaC01g16870D                                          171   1e-48   
ref|XP_009138751.1|  PREDICTED: bidirectional sugar transporter S...    171   2e-48   
emb|CDY34333.1|  BnaA01g14360D                                          171   2e-48   
gb|KDP22573.1|  hypothetical protein JCGZ_26404                         171   2e-48   
gb|KFK26707.1|  hypothetical protein AALP_AA8G282900                    171   2e-48   
ref|XP_008356571.1|  PREDICTED: bidirectional sugar transporter S...    171   2e-48   
ref|XP_010090683.1|  Bidirectional sugar transporter N3                 171   2e-48   
ref|XP_002264875.1|  PREDICTED: bidirectional sugar transporter N3      171   2e-48   
ref|XP_009777590.1|  PREDICTED: bidirectional sugar transporter N...    171   2e-48   
ref|XP_010045482.1|  PREDICTED: bidirectional sugar transporter S...    170   2e-48   
gb|EMT20481.1|  Protein RUPTURED POLLEN GRAIN 1                         171   2e-48   
ref|XP_006493252.1|  PREDICTED: bidirectional sugar transporter S...    171   2e-48   
ref|XP_007222479.1|  hypothetical protein PRUPE_ppa009789mg             170   2e-48   
gb|KJB51267.1|  hypothetical protein B456_008G209100                    171   2e-48   
ref|XP_010492063.1|  PREDICTED: bidirectional sugar transporter S...    171   2e-48   
ref|XP_002865824.1|  nodulin MtN3 family protein                        171   3e-48   
emb|CBI32263.3|  unnamed protein product                                172   3e-48   
ref|XP_010442559.1|  PREDICTED: bidirectional sugar transporter S...    171   3e-48   
ref|XP_010453373.1|  PREDICTED: bidirectional sugar transporter S...    171   3e-48   
ref|XP_002450786.1|  hypothetical protein SORBIDRAFT_05g018110          170   3e-48   
ref|XP_009123765.1|  PREDICTED: bidirectional sugar transporter S...    170   3e-48   
ref|XP_002873602.1|  nodulin MtN3 family protein                        170   3e-48   
ref|XP_007205793.1|  hypothetical protein PRUPE_ppa010594mg             169   3e-48   
ref|XP_010419882.1|  PREDICTED: bidirectional sugar transporter S...    170   3e-48   
ref|XP_010027260.1|  PREDICTED: bidirectional sugar transporter N...    170   3e-48   
ref|XP_007050795.1|  Medicago truncatula MTN3                           171   3e-48   
emb|CDX71659.1|  BnaC09g27000D                                          170   3e-48   
gb|KJB07960.1|  hypothetical protein B456_001G055500                    169   4e-48   
gb|KJB12520.1|  hypothetical protein B456_002G022600                    171   4e-48   
ref|XP_003615405.1|  Protein RUPTURED POLLEN GRAIN                      169   4e-48   
ref|XP_010482381.1|  PREDICTED: bidirectional sugar transporter S...    170   5e-48   
ref|XP_010442358.1|  PREDICTED: bidirectional sugar transporter S...    170   5e-48   
emb|CDP03543.1|  unnamed protein product                                169   5e-48   
ref|XP_010027262.1|  PREDICTED: bidirectional sugar transporter N...    169   5e-48   
ref|XP_011036129.1|  PREDICTED: bidirectional sugar transporter S...    169   6e-48   
gb|EYU46728.1|  hypothetical protein MIMGU_mgv1a011381mg                169   6e-48   
emb|CDY69440.1|  BnaCnng63490D                                          167   6e-48   
ref|XP_011042931.1|  PREDICTED: LOW QUALITY PROTEIN: bidirectiona...    169   6e-48   
ref|XP_007200238.1|  hypothetical protein PRUPE_ppa015264mg             169   6e-48   
gb|KGN61326.1|  hypothetical protein Csa_2G083730                       168   8e-48   
ref|XP_004962649.1|  PREDICTED: bidirectional sugar transporter S...    169   9e-48   
ref|XP_004138978.1|  PREDICTED: bidirectional sugar transporter N...    167   9e-48   
ref|XP_006438820.1|  hypothetical protein CICLE_v10032218mg             169   9e-48   
ref|XP_004155149.1|  PREDICTED: LOW QUALITY PROTEIN: bidirectiona...    168   9e-48   
ref|XP_004962650.1|  PREDICTED: bidirectional sugar transporter S...    168   1e-47   
ref|XP_003576225.1|  PREDICTED: bidirectional sugar transporter S...    169   1e-47   
ref|XP_004169143.1|  PREDICTED: bidirectional sugar transporter N...    165   1e-47   
ref|XP_010027261.1|  PREDICTED: bidirectional sugar transporter N...    169   1e-47   
ref|XP_002511127.1|  conserved hypothetical protein                     168   1e-47   
gb|KFK34174.1|  hypothetical protein AALP_AA5G110100                    169   1e-47   
emb|CDX84877.1|  BnaA03g13530D                                          168   2e-47   
ref|XP_009132693.1|  PREDICTED: bidirectional sugar transporter S...    168   2e-47   
ref|XP_002511126.1|  conserved hypothetical protein                     168   2e-47   
ref|XP_008218389.1|  PREDICTED: bidirectional sugar transporter N...    165   2e-47   
ref|NP_199892.1|  bidirectional sugar transporter SWEET10               168   2e-47   
ref|XP_004980522.1|  PREDICTED: bidirectional sugar transporter S...    168   3e-47   
ref|XP_008235079.1|  PREDICTED: bidirectional sugar transporter S...    167   3e-47   
ref|XP_006289174.1|  hypothetical protein CARUB_v10002612mg             167   3e-47   
ref|XP_010926783.1|  PREDICTED: bidirectional sugar transporter S...    167   3e-47   
ref|XP_003576036.1|  PREDICTED: bidirectional sugar transporter S...    167   4e-47   
ref|XP_010249453.1|  PREDICTED: bidirectional sugar transporter S...    167   4e-47   
gb|KJB23188.1|  hypothetical protein B456_004G086000                    167   4e-47   
ref|XP_010036837.1|  PREDICTED: bidirectional sugar transporter N...    166   4e-47   
ref|XP_002520679.1|  conserved hypothetical protein                     167   5e-47   
gb|KDP28088.1|  hypothetical protein JCGZ_13859                         166   5e-47   
emb|CDX91144.1|  BnaC02g04530D                                          167   6e-47   
gb|KHG20984.1|  Bidirectional sugar transporter SWEET15 -like pro...    167   7e-47   
ref|XP_011085139.1|  PREDICTED: bidirectional sugar transporter N...    166   7e-47   
ref|XP_010556111.1|  PREDICTED: bidirectional sugar transporter S...    167   7e-47   
gb|KJB77185.1|  hypothetical protein B456_012G124700                    166   8e-47   
ref|XP_002865823.1|  nodulin MtN3 family protein                        166   9e-47   
gb|KJB77186.1|  hypothetical protein B456_012G124700                    164   9e-47   
ref|XP_010037373.1|  PREDICTED: bidirectional sugar transporter S...    166   1e-46   
gb|KEH21448.1|  bidirectional sugar transporter                         166   1e-46   
ref|XP_004302124.1|  PREDICTED: bidirectional sugar transporter N...    165   1e-46   
gb|EMT20482.1|  Protein RUPTURED POLLEN GRAIN 1                         167   1e-46   
gb|KDO64482.1|  hypothetical protein CISIN_1g047365mg                   165   1e-46   
sp|P93332.1|NOD3_MEDTR  RecName: Full=Bidirectional sugar transpo...    166   1e-46   
gb|KJB23187.1|  hypothetical protein B456_004G086000                    164   1e-46   
gb|KDO64485.1|  hypothetical protein CISIN_1g020739mg                   164   1e-46   
gb|EYU30738.1|  hypothetical protein MIMGU_mgv1a012552mg                165   1e-46   
ref|XP_004138979.1|  PREDICTED: bidirectional sugar transporter N...    166   1e-46   
ref|XP_008441812.1|  PREDICTED: bidirectional sugar transporter N...    165   1e-46   
ref|XP_010482380.1|  PREDICTED: bidirectional sugar transporter S...    166   2e-46   
ref|XP_010025272.1|  PREDICTED: bidirectional sugar transporter N...    166   2e-46   
ref|XP_010442555.1|  PREDICTED: bidirectional sugar transporter S...    166   2e-46   
gb|KHG13555.1|  Bidirectional sugar transporter SWEET15                 165   2e-46   
ref|XP_010943754.1|  PREDICTED: bidirectional sugar transporter S...    165   2e-46   
ref|XP_004247459.1|  PREDICTED: bidirectional sugar transporter NEC1    165   2e-46   
ref|XP_002299333.2|  hypothetical protein POPTR_0001s13410g             165   2e-46   
ref|XP_008340254.1|  PREDICTED: bidirectional sugar transporter N...    166   2e-46   
ref|XP_009125890.1|  PREDICTED: bidirectional sugar transporter S...    166   2e-46   
ref|XP_009349481.1|  PREDICTED: bidirectional sugar transporter N...    166   3e-46   
emb|CDX85668.1|  BnaA02g01450D                                          165   3e-46   
ref|XP_008441813.1|  PREDICTED: LOW QUALITY PROTEIN: bidirectiona...    164   3e-46   
gb|KCW49071.1|  hypothetical protein EUGRSUZ_K02671                     164   3e-46   
ref|XP_010442345.1|  PREDICTED: bidirectional sugar transporter S...    165   3e-46   
ref|XP_010037362.1|  PREDICTED: bidirectional sugar transporter S...    165   3e-46   
gb|KDP22572.1|  hypothetical protein JCGZ_26403                         165   4e-46   
gb|EMS53876.1|  Bidirectional sugar transporter SWEET14                 170   4e-46   
emb|CDY53626.1|  BnaC03g71480D                                          165   4e-46   
gb|KDO64483.1|  hypothetical protein CISIN_1g020739mg                   164   4e-46   
gb|EMS45810.1|  Bidirectional sugar transporter SWEET11                 164   5e-46   
emb|CDX97233.1|  BnaC09g43920D                                          165   5e-46   
emb|CDX78511.1|  BnaA03g04230D                                          164   5e-46   
emb|CDX69663.1|  BnaA10g20120D                                          164   8e-46   
gb|EMS51423.1|  Bidirectional sugar transporter SWEET13                 165   8e-46   
ref|XP_010037364.1|  PREDICTED: bidirectional sugar transporter S...    163   1e-45   
ref|XP_010534707.1|  PREDICTED: bidirectional sugar transporter S...    164   1e-45   
gb|KJB51266.1|  hypothetical protein B456_008G209000                    160   1e-45   
gb|KHG03157.1|  Bidirectional sugar transporter SWEET15 -like pro...    163   1e-45   
ref|XP_010039121.1|  PREDICTED: bidirectional sugar transporter S...    163   2e-45   
ref|XP_009783143.1|  PREDICTED: bidirectional sugar transporter N...    162   2e-45   
gb|KFK25541.1|  hypothetical protein AALP_AA8G128400                    163   2e-45   
ref|XP_010039124.1|  PREDICTED: bidirectional sugar transporter S...    161   2e-45   
ref|XP_007038078.1|  Medicago truncatula MTN3, putative                 162   2e-45   
gb|EMT23597.1|  Protein RUPTURED POLLEN GRAIN 1                         162   2e-45   
ref|XP_008389921.1|  PREDICTED: bidirectional sugar transporter N...    163   2e-45   
ref|XP_011079737.1|  PREDICTED: bidirectional sugar transporter N...    162   3e-45   
ref|XP_004957300.1|  PREDICTED: bidirectional sugar transporter S...    162   3e-45   
ref|XP_007159991.1|  hypothetical protein PHAVU_002G283800g             163   3e-45   
ref|XP_010042796.1|  PREDICTED: bidirectional sugar transporter N...    162   3e-45   
gb|AFK47472.1|  unknown                                                 161   3e-45   
gb|KCW61897.1|  hypothetical protein EUGRSUZ_H04592                     162   4e-45   
ref|XP_003532471.1|  PREDICTED: bidirectional sugar transporter S...    162   4e-45   
ref|XP_009421186.1|  PREDICTED: bidirectional sugar transporter S...    162   5e-45   
ref|XP_006402062.1|  hypothetical protein EUTSA_v10014273mg             161   8e-45   
gb|AGL98401.1|  sucrose transporter SWEET9                              161   8e-45   
gb|KCW61894.1|  hypothetical protein EUGRSUZ_H04587                     160   1e-44   
gb|EMT20483.1|  Protein RUPTURED POLLEN GRAIN 1                         161   1e-44   
dbj|BAK04274.1|  predicted protein                                      161   1e-44   
dbj|BAK07340.1|  predicted protein                                      160   1e-44   
ref|XP_010943755.1|  PREDICTED: bidirectional sugar transporter S...    159   2e-44   
ref|XP_004491681.1|  PREDICTED: bidirectional sugar transporter N...    159   2e-44   
ref|XP_009121791.1|  PREDICTED: LOW QUALITY PROTEIN: bidirectiona...    160   2e-44   
ref|XP_011079738.1|  PREDICTED: bidirectional sugar transporter S...    159   2e-44   
ref|XP_007139174.1|  hypothetical protein PHAVU_008G007600g             159   3e-44   
ref|XP_010037363.1|  PREDICTED: bidirectional sugar transporter S...    159   3e-44   
ref|XP_003578398.1|  PREDICTED: bidirectional sugar transporter S...    160   3e-44   
ref|XP_010027259.1|  PREDICTED: bidirectional sugar transporter N...    159   3e-44   
ref|XP_008386620.1|  PREDICTED: bidirectional sugar transporter S...    160   4e-44   
ref|XP_007139099.1|  hypothetical protein PHAVU_008G001100g             159   4e-44   
gb|AFK39311.1|  unknown                                                 158   7e-44   
ref|XP_009336454.1|  PREDICTED: bidirectional sugar transporter N...    159   8e-44   
emb|CDP09549.1|  unnamed protein product                                158   1e-43   
ref|XP_003552719.1|  PREDICTED: bidirectional sugar transporter N...    157   1e-43   
gb|KCW61896.1|  hypothetical protein EUGRSUZ_H04589                     157   1e-43   
gb|EPS72542.1|  hypothetical protein M569_02215                         156   1e-43   
gb|KHN17298.1|  Bidirectional sugar transporter NEC1                    157   2e-43   
ref|XP_009383909.1|  PREDICTED: bidirectional sugar transporter N...    159   2e-43   
ref|XP_006281748.1|  hypothetical protein CARUB_v10027907mg             157   2e-43   
ref|XP_003532319.1|  PREDICTED: bidirectional sugar transporter N...    157   3e-43   
ref|XP_010039128.1|  PREDICTED: bidirectional sugar transporter S...    157   3e-43   
ref|XP_009586714.1|  PREDICTED: bidirectional sugar transporter N...    156   3e-43   
gb|KCW49087.1|  hypothetical protein EUGRSUZ_K02694                     157   3e-43   
gb|KHN24975.1|  Bidirectional sugar transporter N3                      157   4e-43   
ref|XP_008370771.1|  PREDICTED: bidirectional sugar transporter N...    156   4e-43   
ref|XP_010243612.1|  PREDICTED: bidirectional sugar transporter S...    156   5e-43   
gb|KCW61900.1|  hypothetical protein EUGRSUZ_H04596                     156   5e-43   
ref|XP_004489106.1|  PREDICTED: bidirectional sugar transporter S...    155   6e-43   
ref|XP_009337947.1|  PREDICTED: bidirectional sugar transporter N...    155   7e-43   
ref|XP_010027132.1|  PREDICTED: bidirectional sugar transporter N...    155   8e-43   
ref|XP_010045483.1|  PREDICTED: bidirectional sugar transporter S...    155   1e-42   
ref|XP_010112742.1|  Bidirectional sugar transporter NEC1               155   1e-42   
ref|XP_010037379.1|  PREDICTED: bidirectional sugar transporter S...    155   1e-42   
gb|EMS49335.1|  Bidirectional sugar transporter SWEET14                 157   2e-42   
gb|KJB51262.1|  hypothetical protein B456_008G209000                    154   2e-42   
ref|XP_010037372.1|  PREDICTED: bidirectional sugar transporter S...    154   2e-42   
ref|XP_004157602.1|  PREDICTED: bidirectional sugar transporter S...    154   3e-42   
gb|EPS65273.1|  hypothetical protein M569_09501                         152   3e-42   
ref|XP_010039123.1|  PREDICTED: bidirectional sugar transporter S...    153   3e-42   
sp|Q9FPN0.1|NEC1_PETHY  RecName: Full=Bidirectional sugar transpo...    154   3e-42   
ref|XP_004140547.1|  PREDICTED: bidirectional sugar transporter S...    154   3e-42   
ref|XP_003593107.1|  Protein RUPTURED POLLEN GRAIN                      154   3e-42   
ref|XP_008459891.1|  PREDICTED: bidirectional sugar transporter N3      154   5e-42   
gb|AFW62436.1|  hypothetical protein ZEAMMB73_320886                    149   7e-42   
ref|XP_009379704.1|  PREDICTED: bidirectional sugar transporter N...    153   8e-42   
gb|KDO64484.1|  hypothetical protein CISIN_1g020739mg                   154   9e-42   
ref|XP_006661417.1|  PREDICTED: bidirectional sugar transporter S...    151   1e-41   
gb|EMS53874.1|  Bidirectional sugar transporter SWEET14                 155   1e-41   
gb|EAZ45313.1|  hypothetical protein OsJ_29956                          153   2e-41   
ref|XP_010037381.1|  PREDICTED: bidirectional sugar transporter S...    152   2e-41   
gb|EAZ09693.1|  hypothetical protein OsI_31976                          153   2e-41   
ref|XP_008234052.1|  PREDICTED: bidirectional sugar transporter N...    150   2e-41   
ref|XP_004503779.1|  PREDICTED: bidirectional sugar transporter S...    152   2e-41   
gb|EPS66344.1|  hypothetical protein M569_08433                         149   2e-41   
gb|KEH21559.1|  bidirectional sugar transporter                         151   2e-41   
ref|XP_002280599.1|  PREDICTED: bidirectional sugar transporter S...    152   3e-41   
ref|XP_010926782.1|  PREDICTED: bidirectional sugar transporter S...    152   3e-41   
ref|XP_010696414.1|  PREDICTED: bidirectional sugar transporter S...    153   3e-41   
ref|XP_006479044.1|  PREDICTED: bidirectional sugar transporter S...    151   3e-41   
ref|XP_007030240.1|  Nodulin MtN3 family protein isoform 1              152   4e-41   
ref|XP_007148462.1|  hypothetical protein PHAVU_006G210800g             151   4e-41   
gb|AFW71562.1|  hypothetical protein ZEAMMB73_472818                    152   4e-41   
ref|XP_003617528.1|  Protein RUPTURED POLLEN GRAIN                      150   5e-41   
gb|EYU43027.1|  hypothetical protein MIMGU_mgv1a022177mg                149   9e-41   
gb|ACJ84828.1|  unknown                                                 150   9e-41   
gb|ACU14542.1|  unknown                                                 148   1e-40   
ref|XP_006443343.1|  hypothetical protein CICLE_v100226331mg            147   1e-40   
emb|CBI15715.3|  unnamed protein product                                150   2e-40   
gb|ABD78942.1|  disease resistant allele xa13                           150   2e-40   
ref|NP_001062354.1|  Os08g0535200                                       150   2e-40   
ref|XP_010674202.1|  PREDICTED: bidirectional sugar transporter N...    149   2e-40   
gb|AFK36312.1|  unknown                                                 149   2e-40   
ref|XP_008802109.1|  PREDICTED: bidirectional sugar transporter S...    149   2e-40   
ref|XP_007139100.1|  hypothetical protein PHAVU_008G001200g             149   3e-40   
ref|XP_008350796.1|  PREDICTED: bidirectional sugar transporter S...    145   3e-40   
ref|XP_011471005.1|  PREDICTED: LOW QUALITY PROTEIN: bidirectiona...    147   3e-40   
ref|XP_003518628.1|  PREDICTED: bidirectional sugar transporter NEC1    148   4e-40   
ref|XP_009103141.1|  PREDICTED: bidirectional sugar transporter S...    147   4e-40   
ref|XP_010999465.1|  PREDICTED: bidirectional sugar transporter S...    147   5e-40   
ref|XP_002462642.1|  hypothetical protein SORBIDRAFT_02g029430          148   6e-40   
gb|EMS50325.1|  Bidirectional sugar transporter SWEET11                 147   6e-40   
ref|XP_010322967.1|  PREDICTED: bidirectional sugar transporter S...    148   7e-40   
ref|XP_006659632.1|  PREDICTED: bidirectional sugar transporter S...    149   9e-40   
gb|EMT31640.1|  Protein RUPTURED POLLEN GRAIN 1                         147   1e-39   



>ref|XP_009599477.1| PREDICTED: bidirectional sugar transporter SWEET11-like [Nicotiana 
tomentosiformis]
Length=282

 Score =   262 bits (670),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 125/156 (80%), Positives = 142/156 (91%), Gaps = 1/156 (1%)
 Frame = +3

Query  129  MALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYY  308
            MA+SGHW FAFGVLGNI+SFIVFLSPLPTFY+IYKKKS EGYQSIPYV+ALFSSMLWIYY
Sbjct  1    MAISGHWAFAFGVLGNIVSFIVFLSPLPTFYKIYKKKSTEGYQSIPYVIALFSSMLWIYY  60

Query  309  AFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQ  488
            AFLK+N TLLITINSFG  +ETIY+GFY++YA KKARVQT+KML+L V+ GFGA+ L++Q
Sbjct  61   AFLKTNTTLLITINSFGVFIETIYVGFYLFYAPKKARVQTVKMLLLTVVAGFGAIILIAQ  120

Query  489  FLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            FLFK    R QVVGWVCLVFSLCVFVAPLCIV++VI
Sbjct  121  FLFKGV-ARGQVVGWVCLVFSLCVFVAPLCIVRKVI  155



>ref|XP_009758167.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Nicotiana 
sylvestris]
Length=296

 Score =   257 bits (657),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 140/155 (90%), Gaps = 1/155 (1%)
 Frame = +3

Query  132  ALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYA  311
            A+SGHW FAFGVLGNI+SFIVFLSPLPTFY+IYKKKS EGYQSIPYVVALFSSMLW+YYA
Sbjct  3    AISGHWAFAFGVLGNIVSFIVFLSPLPTFYKIYKKKSTEGYQSIPYVVALFSSMLWVYYA  62

Query  312  FLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQF  491
            FLK+N TL+ITINSFGC +ETIY+GFY++YA KKAR+QT+KMLVL V+ GFG + LV+QF
Sbjct  63   FLKTNTTLIITINSFGCFIETIYVGFYLFYAPKKARIQTVKMLVLSVVGGFGVIVLVTQF  122

Query  492  LFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            LFK A  R Q VGW+CLVFSLCVFVAPL IV+QVI
Sbjct  123  LFKGA-ARGQAVGWICLVFSLCVFVAPLGIVRQVI  156



>ref|XP_009605549.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Nicotiana 
tomentosiformis]
Length=296

 Score =   257 bits (657),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 124/155 (80%), Positives = 140/155 (90%), Gaps = 1/155 (1%)
 Frame = +3

Query  132  ALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYA  311
            A+SGHW FAFGVLGNI+SFIVFLSPLPTFY+IYKKKS EGYQSIPYVVALFSSMLWIYYA
Sbjct  3    AISGHWAFAFGVLGNIVSFIVFLSPLPTFYKIYKKKSTEGYQSIPYVVALFSSMLWIYYA  62

Query  312  FLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQF  491
            FLK+N TL+ITINSFGC +ETIY+GFY++YA KKARVQT+KML+L V+ GFG + LV+QF
Sbjct  63   FLKTNTTLIITINSFGCFIETIYVGFYLFYAPKKARVQTVKMLLLSVVGGFGVIVLVTQF  122

Query  492  LFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            LFK A  R Q VGW+CLVFSLCVFVAPL IV+QVI
Sbjct  123  LFKGA-ARGQAVGWICLVFSLCVFVAPLGIVRQVI  156



>ref|XP_009605550.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Nicotiana 
tomentosiformis]
Length=296

 Score =   256 bits (655),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 124/155 (80%), Positives = 139/155 (90%), Gaps = 1/155 (1%)
 Frame = +3

Query  132  ALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYA  311
             +SGHW FAFGVLGNI+SFIVFLSPLPTFY+IYKKKS EGYQSIPYVVALFSSMLWIYYA
Sbjct  3    GISGHWAFAFGVLGNIVSFIVFLSPLPTFYKIYKKKSTEGYQSIPYVVALFSSMLWIYYA  62

Query  312  FLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQF  491
            FLK+N TL+ITINSFGC +ETIY+ FY++YA KKARVQT+KMLVL V+ GFGA+ LV+QF
Sbjct  63   FLKTNTTLIITINSFGCFIETIYVSFYLFYAPKKARVQTVKMLVLSVVGGFGAIVLVTQF  122

Query  492  LFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            LFK A  R Q VGW+CLVFSLCVFVAPL IV+QVI
Sbjct  123  LFKGA-ARGQAVGWICLVFSLCVFVAPLGIVRQVI  156



>ref|XP_009758165.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Nicotiana 
sylvestris]
Length=296

 Score =   256 bits (653),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 124/155 (80%), Positives = 139/155 (90%), Gaps = 1/155 (1%)
 Frame = +3

Query  132  ALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYA  311
             +SGHW FAFGVLGNIISFIVFLSPLPTFY+IYKKKS EGYQSIPYVVALFSSMLWIYYA
Sbjct  3    GISGHWAFAFGVLGNIISFIVFLSPLPTFYKIYKKKSTEGYQSIPYVVALFSSMLWIYYA  62

Query  312  FLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQF  491
            FLK+N TL+ITINSFGC +ETIY+GFY++YA KKARVQT+KML+L V+ GFG + LV+QF
Sbjct  63   FLKTNTTLIITINSFGCFIETIYVGFYLFYAPKKARVQTLKMLLLSVVGGFGVIVLVTQF  122

Query  492  LFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            LFK A  R Q VGW+CLVFSLCVFVAPL IV+QVI
Sbjct  123  LFKGA-ARGQAVGWICLVFSLCVFVAPLGIVRQVI  156



>ref|XP_009597195.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Nicotiana 
tomentosiformis]
Length=291

 Score =   255 bits (652),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 141/154 (92%), Gaps = 1/154 (1%)
 Frame = +3

Query  135  LSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAF  314
            +SGHW FAFGVLGNI+SFIVFLSPLPTFY+IYKKKS EGYQSIPYVVALFSSMLWIYYAF
Sbjct  1    MSGHWAFAFGVLGNIVSFIVFLSPLPTFYRIYKKKSTEGYQSIPYVVALFSSMLWIYYAF  60

Query  315  LKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFL  494
            LK+N TLLITINSFG  +ETIY+GFY++YA KKARVQT+KML+L V+ GFGA+ LV+QFL
Sbjct  61   LKTNTTLLITINSFGVFIETIYVGFYLFYAPKKARVQTMKMLLLSVVGGFGAIVLVTQFL  120

Query  495  FKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            FK A VR QVVGW+CLVFSLCVFVAPL IV++VI
Sbjct  121  FKGA-VRGQVVGWICLVFSLCVFVAPLGIVRKVI  153



>ref|XP_009802608.1| PREDICTED: bidirectional sugar transporter SWEET9-like [Nicotiana 
sylvestris]
 ref|XP_009792803.1| PREDICTED: bidirectional sugar transporter SWEET9-like [Nicotiana 
sylvestris]
Length=293

 Score =   255 bits (652),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 137/152 (90%), Gaps = 1/152 (1%)
 Frame = +3

Query  129  MALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYY  308
            MA+SGHW FAFGVLGNI+SFIVFLSPLPTFY+IYKKKS EGYQSIPYV+ALFSSMLWIYY
Sbjct  1    MAISGHWAFAFGVLGNIVSFIVFLSPLPTFYKIYKKKSTEGYQSIPYVIALFSSMLWIYY  60

Query  309  AFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQ  488
            AFLK+N TLLITINSFG  +ETIY+GFY++YA KKAR+QT+KML L V+ GFGA+ L++Q
Sbjct  61   AFLKTNTTLLITINSFGVFIETIYVGFYLFYAPKKARIQTVKMLFLTVVGGFGAIILIAQ  120

Query  489  FLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIV  584
            FLFK    R QVVGWVCLVFSLCVFVAPLCIV
Sbjct  121  FLFKGV-ARGQVVGWVCLVFSLCVFVAPLCIV  151



>ref|XP_009614916.1| PREDICTED: bidirectional sugar transporter SWEET12-like isoform 
X2 [Nicotiana tomentosiformis]
Length=298

 Score =   255 bits (651),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 122/153 (80%), Positives = 138/153 (90%), Gaps = 1/153 (1%)
 Frame = +3

Query  138  SGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFL  317
            SGHW F FGVLGNI+SF VFLSPLPTFY+IY+KKS EGYQSIPYVVALFS+MLWIYYAFL
Sbjct  5    SGHWAFTFGVLGNIVSFFVFLSPLPTFYKIYRKKSTEGYQSIPYVVALFSAMLWIYYAFL  64

Query  318  KSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLF  497
            KSN TLLITINSFGC VETIY+GFY++YA KKARVQT+K+L+L V  GFGA+ LV+QFLF
Sbjct  65   KSNTTLLITINSFGCFVETIYVGFYLFYAPKKARVQTVKLLLLSVFAGFGAIVLVTQFLF  124

Query  498  KSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            K   VR QVVGW+CLVFSLCVFV+PLCI++QVI
Sbjct  125  KGV-VRVQVVGWICLVFSLCVFVSPLCIMRQVI  156



>ref|XP_009758166.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Nicotiana 
sylvestris]
Length=296

 Score =   254 bits (648),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 139/155 (90%), Gaps = 1/155 (1%)
 Frame = +3

Query  132  ALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYA  311
             +SGHW FAFGVLGNI+SFIVFLSPLPTFY+IYKKKS EGYQSIPYVVALFSSMLWIYYA
Sbjct  3    GISGHWAFAFGVLGNIVSFIVFLSPLPTFYKIYKKKSTEGYQSIPYVVALFSSMLWIYYA  62

Query  312  FLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQF  491
            FLK+N TL+ITINSFGC +ETIY+GFY++YA KKARVQT+KML+L V+ GFG + LV+QF
Sbjct  63   FLKTNTTLIITINSFGCFIETIYVGFYLFYAPKKARVQTVKMLLLSVVGGFGVIVLVTQF  122

Query  492  LFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            LFK A  R Q VGW+CLVFSLCVFVAPL IV++VI
Sbjct  123  LFKGA-ARGQAVGWICLVFSLCVFVAPLGIVRKVI  156



>ref|XP_009787633.1| PREDICTED: bidirectional sugar transporter N3-like [Nicotiana 
sylvestris]
Length=295

 Score =   253 bits (647),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 141/155 (91%), Gaps = 1/155 (1%)
 Frame = +3

Query  132  ALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYA  311
             +SGHW FAFGVLGNI+SFIVFLSPLPTFY+IYKKKS EGYQSIPYVVALFSSMLWIYYA
Sbjct  3    GISGHWAFAFGVLGNIVSFIVFLSPLPTFYKIYKKKSTEGYQSIPYVVALFSSMLWIYYA  62

Query  312  FLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQF  491
            FLK+N TLLITINSFG  +ETIY+GFY++YA KKA+VQT+KML+L V+ GFGA+ LV+QF
Sbjct  63   FLKTNTTLLITINSFGVFIETIYVGFYLFYAPKKAKVQTVKMLLLSVVGGFGAIVLVTQF  122

Query  492  LFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            LFK A VR QVVGW+CLVFSLCVF+APL IV++VI
Sbjct  123  LFKGA-VRGQVVGWICLVFSLCVFIAPLGIVRKVI  156



>ref|XP_009591687.1| PREDICTED: bidirectional sugar transporter N3-like [Nicotiana 
tomentosiformis]
Length=297

 Score =   253 bits (647),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 124/155 (80%), Positives = 140/155 (90%), Gaps = 1/155 (1%)
 Frame = +3

Query  132  ALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYA  311
             +SGHW FAFGVLGNIISFIVFLSPLPTFY+IYKKKS EGYQSIPYVVALFSSMLWIYYA
Sbjct  3    GISGHWAFAFGVLGNIISFIVFLSPLPTFYRIYKKKSTEGYQSIPYVVALFSSMLWIYYA  62

Query  312  FLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQF  491
             LK+N TLLITINSFG  +ETIY+GFY++YA KKA+VQT+KML+L V+ GFGA+ LV+QF
Sbjct  63   LLKTNTTLLITINSFGVFIETIYVGFYLFYAPKKAKVQTVKMLLLSVVGGFGAIVLVTQF  122

Query  492  LFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            LFK A VR QVVGW+CLVFSLCVFVAPL IV++VI
Sbjct  123  LFKGA-VRGQVVGWICLVFSLCVFVAPLGIVRKVI  156



>ref|XP_009794695.1| PREDICTED: bidirectional sugar transporter N3-like [Nicotiana 
sylvestris]
Length=295

 Score =   253 bits (646),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 124/155 (80%), Positives = 140/155 (90%), Gaps = 1/155 (1%)
 Frame = +3

Query  132  ALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYA  311
             +SGHW FAFGVLGNI+SFIVFLSPLPTFY+IYKKKS EGYQSIPYVVALFSSMLWIYYA
Sbjct  3    GISGHWAFAFGVLGNIVSFIVFLSPLPTFYRIYKKKSTEGYQSIPYVVALFSSMLWIYYA  62

Query  312  FLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQF  491
            FLK+N TLLITINSFG  +ETIY+G Y++YA KKARVQT+KML+L V+ GFGA+ LV+QF
Sbjct  63   FLKTNTTLLITINSFGVFIETIYVGVYLFYAPKKARVQTVKMLLLSVVGGFGAIVLVTQF  122

Query  492  LFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            LFK A VR QVVGW+CLVFSLCVFVAPL IV++VI
Sbjct  123  LFKGA-VRGQVVGWICLVFSLCVFVAPLGIVRKVI  156



>ref|XP_009587580.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Nicotiana 
tomentosiformis]
Length=298

 Score =   253 bits (646),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 122/153 (80%), Positives = 140/153 (92%), Gaps = 1/153 (1%)
 Frame = +3

Query  138  SGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFL  317
            + HW FAFGVLGNI+SFIVFLSP+PTFY+IYKKKSAEGYQSIPYV+ALFSSMLWIYYAFL
Sbjct  6    TDHWAFAFGVLGNIVSFIVFLSPMPTFYKIYKKKSAEGYQSIPYVIALFSSMLWIYYAFL  65

Query  318  KSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLF  497
            K+N TLLITINSFG  +ETIY+GFY++YA KKARVQT+KML+L V+ GFGA+ LV+QFLF
Sbjct  66   KTNTTLLITINSFGVFIETIYVGFYLFYAPKKARVQTVKMLLLSVVGGFGAIVLVTQFLF  125

Query  498  KSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            K A VR QVVGW+CLVFSLCVFVAPL IV++VI
Sbjct  126  KGA-VRGQVVGWICLVFSLCVFVAPLGIVRKVI  157



>ref|XP_009762335.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Nicotiana 
sylvestris]
Length=299

 Score =   253 bits (645),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 122/153 (80%), Positives = 140/153 (92%), Gaps = 1/153 (1%)
 Frame = +3

Query  138  SGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFL  317
            + HW FAFGVLGNI+SFIVFLSP+PTFY+IYKKKSAEGYQSIPYV+ALFSSMLWIYYAFL
Sbjct  6    TDHWAFAFGVLGNIVSFIVFLSPMPTFYKIYKKKSAEGYQSIPYVIALFSSMLWIYYAFL  65

Query  318  KSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLF  497
            K+N TLLITINSFG  +ETIY+GFY++YA KKARVQT+KML+L V+ GFGA+ LV+QFLF
Sbjct  66   KTNTTLLITINSFGVFIETIYVGFYLFYAPKKARVQTVKMLLLSVVGGFGAIVLVTQFLF  125

Query  498  KSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            K A VR QVVGW+CLVFSLCVFVAPL IV++VI
Sbjct  126  KGA-VRGQVVGWICLVFSLCVFVAPLGIVRKVI  157



>ref|XP_009796436.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Nicotiana 
sylvestris]
Length=297

 Score =   250 bits (639),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 121/155 (78%), Positives = 139/155 (90%), Gaps = 1/155 (1%)
 Frame = +3

Query  132  ALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYA  311
             +SGHW FAFGVLGNI+SFIVFLSPLPTFY I+KKKS EGYQSIPYVVALFSSMLWIYYA
Sbjct  3    GISGHWAFAFGVLGNIVSFIVFLSPLPTFYSIFKKKSTEGYQSIPYVVALFSSMLWIYYA  62

Query  312  FLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQF  491
             LK+N TLLITINSFG  +ETIY+GFY++YA KKA+VQT+KML+L V+ GFGA+ LV+QF
Sbjct  63   LLKTNTTLLITINSFGVFIETIYVGFYLFYAPKKAKVQTVKMLLLSVVGGFGAIVLVTQF  122

Query  492  LFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            LFK A VR Q+VGW+CLVFSLCVFVAPL IV++VI
Sbjct  123  LFKGA-VRGQIVGWICLVFSLCVFVAPLGIVRKVI  156



>ref|XP_009614915.1| PREDICTED: bidirectional sugar transporter SWEET12-like isoform 
X1 [Nicotiana tomentosiformis]
Length=302

 Score =   249 bits (636),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 122/157 (78%), Positives = 138/157 (88%), Gaps = 5/157 (3%)
 Frame = +3

Query  138  SGHWVFAFGVLGNIISFIVFLSPL----PTFYQIYKKKSAEGYQSIPYVVALFSSMLWIY  305
            SGHW F FGVLGNI+SF VFLSPL    PTFY+IY+KKS EGYQSIPYVVALFS+MLWIY
Sbjct  5    SGHWAFTFGVLGNIVSFFVFLSPLYVRRPTFYKIYRKKSTEGYQSIPYVVALFSAMLWIY  64

Query  306  YAFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVS  485
            YAFLKSN TLLITINSFGC VETIY+GFY++YA KKARVQT+K+L+L V  GFGA+ LV+
Sbjct  65   YAFLKSNTTLLITINSFGCFVETIYVGFYLFYAPKKARVQTVKLLLLSVFAGFGAIVLVT  124

Query  486  QFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            QFLFK   VR QVVGW+CLVFSLCVFV+PLCI++QVI
Sbjct  125  QFLFKGV-VRVQVVGWICLVFSLCVFVSPLCIMRQVI  160



>ref|XP_006347346.1| PREDICTED: bidirectional sugar transporter SWEET11-like [Solanum 
tuberosum]
Length=287

 Score =   248 bits (634),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 141/155 (91%), Gaps = 1/155 (1%)
 Frame = +3

Query  132  ALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYA  311
              S HW FAFGVLGNIISF VFLSPLPTFY IYKKKS EGYQSIPYVVALFS+MLWIYYA
Sbjct  3    GFSDHWTFAFGVLGNIISFFVFLSPLPTFYNIYKKKSTEGYQSIPYVVALFSAMLWIYYA  62

Query  312  FLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQF  491
            FLK+N TLL+TIN+FGC +ET+Y+GFY++YA KKARVQTIK+L+LLV+ GFGA+ LV+QF
Sbjct  63   FLKTNTTLLVTINTFGCFIETLYVGFYLFYAPKKARVQTIKLLLLLVVGGFGAIVLVTQF  122

Query  492  LFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            LFK A +RAQ+VGW+CLVFSLCVFVAPLCIV+QVI
Sbjct  123  LFKGA-IRAQIVGWICLVFSLCVFVAPLCIVRQVI  156



>ref|XP_006347652.1| PREDICTED: bidirectional sugar transporter SWEET11-like [Solanum 
tuberosum]
Length=482

 Score =   254 bits (649),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 140/155 (90%), Gaps = 1/155 (1%)
 Frame = +3

Query  132  ALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYA  311
             +SGHW FAFGVLGNIISFIVFLSP+PTFY+IYKKKS EGYQSIPYVVALFSSMLWIYYA
Sbjct  3    GISGHWAFAFGVLGNIISFIVFLSPIPTFYKIYKKKSTEGYQSIPYVVALFSSMLWIYYA  62

Query  312  FLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQF  491
            FLK+N TLLITIN+FG  +ETIY+GFY++YA KKARVQTIKML L V+ GFGA+ +V+QF
Sbjct  63   FLKTNTTLLITINTFGVFIETIYVGFYLFYAPKKARVQTIKMLSLFVVGGFGAIIVVTQF  122

Query  492  LFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            LFK A +R QVVGW+CL+FSLCVFVAPL IV+QVI
Sbjct  123  LFKGA-IRGQVVGWICLIFSLCVFVAPLGIVRQVI  156


 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 33/38 (87%), Gaps = 2/38 (5%)
 Frame = +3

Query  483  SQFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            ++FLFK A VR QVVGW+CL+FSLCVFVAPL I +QVI
Sbjct  306  TEFLFKGA-VRGQVVGWICLIFSLCVFVAPLGI-RQVI  341



>ref|XP_009802194.1| PREDICTED: bidirectional sugar transporter SWEET12-like isoform 
X1 [Nicotiana sylvestris]
Length=298

 Score =   248 bits (633),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 119/153 (78%), Positives = 135/153 (88%), Gaps = 1/153 (1%)
 Frame = +3

Query  138  SGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFL  317
            SGHW F FGVLGNI+SF VFLSPLPTFY+IYKKKS E YQSIPYVVALFS+M WIYYAFL
Sbjct  5    SGHWAFTFGVLGNIVSFFVFLSPLPTFYKIYKKKSTEDYQSIPYVVALFSAMFWIYYAFL  64

Query  318  KSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLF  497
            KSN TLLITINSFGC +ETIY+GFY++YA KKARVQT+K+L+L V  GFGA+ LV+Q LF
Sbjct  65   KSNTTLLITINSFGCFIETIYVGFYLFYAPKKARVQTVKLLLLSVFGGFGAIVLVTQLLF  124

Query  498  KSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            K   VR QVVGW+CLVFSLCVFV+PLCI++QVI
Sbjct  125  KGV-VRVQVVGWICLVFSLCVFVSPLCIMRQVI  156



>ref|XP_004241452.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Solanum 
lycopersicum]
Length=287

 Score =   247 bits (631),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 141/155 (91%), Gaps = 1/155 (1%)
 Frame = +3

Query  132  ALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYA  311
              S HW FAFGVLGNIISF VFLSPLPTFY IYKKKS EGYQSIPYVVALFS+MLWIYYA
Sbjct  3    GFSDHWTFAFGVLGNIISFFVFLSPLPTFYNIYKKKSTEGYQSIPYVVALFSAMLWIYYA  62

Query  312  FLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQF  491
            FLK+N TLL+TIN+FGC +ET+Y+GFY++YA KKARVQTIK+L+LLV+ GFGA+ L++QF
Sbjct  63   FLKTNTTLLVTINTFGCFIETLYVGFYLFYAPKKARVQTIKLLLLLVVGGFGAIILITQF  122

Query  492  LFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            LFK A +RAQ+VGW+CLVFSLCVFVAPLCIV+QVI
Sbjct  123  LFKGA-IRAQIVGWICLVFSLCVFVAPLCIVRQVI  156



>ref|XP_006347635.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Solanum 
tuberosum]
Length=286

 Score =   246 bits (629),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 118/156 (76%), Positives = 138/156 (88%), Gaps = 1/156 (1%)
 Frame = +3

Query  129  MALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYY  308
            MA+SGHW F FGVLGNIISFIVFLSP+PTF +IYKKKS EGYQSIPYV+ALFS MLWIYY
Sbjct  1    MAISGHWAFVFGVLGNIISFIVFLSPIPTFNKIYKKKSTEGYQSIPYVIALFSCMLWIYY  60

Query  309  AFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQ  488
            AFLK+N TLLITINSFG L+ETIY+G ++YYA KKARV T+KML+L V+ GFGA+ +V+Q
Sbjct  61   AFLKTNTTLLITINSFGMLIETIYVGLFLYYAPKKARVNTVKMLLLTVVGGFGAIIVVTQ  120

Query  489  FLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            F+FK   VR Q+VGW+CL+FSLCVFVAPL IV+QVI
Sbjct  121  FVFKGV-VRGQIVGWICLIFSLCVFVAPLGIVRQVI  155



>ref|XP_006347634.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Solanum 
tuberosum]
Length=296

 Score =   246 bits (628),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 121/157 (77%), Positives = 139/157 (89%), Gaps = 2/157 (1%)
 Frame = +3

Query  129  MALS-GHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIY  305
            MA S  HW F FGVLGNI+SFIVFLSPLPTFY IYKKK+AEGYQSIPYVVALFSSMLWIY
Sbjct  1    MAFSADHWAFVFGVLGNIVSFIVFLSPLPTFYTIYKKKTAEGYQSIPYVVALFSSMLWIY  60

Query  306  YAFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVS  485
            YAFLK+N TLLITIN+FG  +ETIY+GFY++YA KK+RVQTIKML L V+ GFGA+ LV+
Sbjct  61   YAFLKTNTTLLITINTFGVFIETIYVGFYLFYAPKKSRVQTIKMLSLFVVGGFGAIILVT  120

Query  486  QFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            +FLFK A +R QVVGW+CL+FSLCVFVAPL IV++VI
Sbjct  121  EFLFKGA-IRGQVVGWICLIFSLCVFVAPLGIVRKVI  156



>ref|XP_004235342.2| PREDICTED: uncharacterized protein LOC101265905 [Solanum lycopersicum]
Length=599

 Score =   254 bits (650),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 124/160 (78%), Positives = 143/160 (89%), Gaps = 2/160 (1%)
 Frame = +3

Query  120  DRSMA-LSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSML  296
            + SMA +SGHW FAFGVLGNI+SFIVFLSPLPTFY+IYKKKS +GYQSIPYVVALFSSML
Sbjct  300  EASMAGISGHWAFAFGVLGNIVSFIVFLSPLPTFYKIYKKKSTDGYQSIPYVVALFSSML  359

Query  297  WIYYAFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVA  476
            WIYYAFLK+N TLLITINSFG  +ETIY+GFY++YA KK RVQTIKML+L V+ GFGA+ 
Sbjct  360  WIYYAFLKTNTTLLITINSFGVFIETIYVGFYLFYAPKKDRVQTIKMLMLSVVGGFGAIV  419

Query  477  LVSQFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            L+++FLFK   VR Q+VGW+CL+FSLCVFVAPL IVKQVI
Sbjct  420  LITEFLFKGV-VRGQIVGWICLIFSLCVFVAPLGIVKQVI  458


 Score =   251 bits (642),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 121/155 (78%), Positives = 138/155 (89%), Gaps = 1/155 (1%)
 Frame = +3

Query  132  ALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYA  311
             +SGHW FAFG+LGNIISFIVFLSP+PTFY+IYKKKS EGYQSIPYVVALFSSMLWIYYA
Sbjct  3    GISGHWAFAFGILGNIISFIVFLSPIPTFYKIYKKKSTEGYQSIPYVVALFSSMLWIYYA  62

Query  312  FLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQF  491
             LK+N TLLITINSFG  +ETIY+GFY++YA KK RVQTIKML+L V+ GFGA+ LV++F
Sbjct  63   LLKTNTTLLITINSFGVFIETIYVGFYLFYAPKKDRVQTIKMLMLSVVGGFGAIVLVTEF  122

Query  492  LFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            LFK   VR QVVGW+CL+FSLCVFVAPL IV+QVI
Sbjct  123  LFKGV-VRGQVVGWICLIFSLCVFVAPLGIVRQVI  156



>ref|XP_004235339.1| PREDICTED: bidirectional sugar transporter SWEET10 [Solanum lycopersicum]
Length=282

 Score =   245 bits (625),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 118/156 (76%), Positives = 137/156 (88%), Gaps = 1/156 (1%)
 Frame = +3

Query  129  MALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYY  308
            MA++GHW F FGVLGNIISFIVFLSP+PTF +IYKKKS EGYQSIPYV+ALFS MLWIYY
Sbjct  1    MAIAGHWAFVFGVLGNIISFIVFLSPIPTFNKIYKKKSTEGYQSIPYVIALFSCMLWIYY  60

Query  309  AFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQ  488
            AFLK+N TLLITINSFG L+ETIY+  ++YYA KKARV T+KML+L V+ GFGA+ LV+Q
Sbjct  61   AFLKTNTTLLITINSFGMLIETIYVSLFLYYAPKKARVNTVKMLLLTVVGGFGAIILVTQ  120

Query  489  FLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            FLFK   VR Q+VGW+CL+FSLCVFVAPL IV+QVI
Sbjct  121  FLFKGV-VRGQIVGWICLIFSLCVFVAPLGIVRQVI  155



>gb|ACV71016.1| UPA16 [Capsicum annuum]
Length=301

 Score =   245 bits (626),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 137/155 (88%), Gaps = 1/155 (1%)
 Frame = +3

Query  132  ALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYA  311
             +SGHW FAFGVLGNIISFIVFLSP+PTFY IYKKK+AEGYQSIPYV+ALFSSMLWIYYA
Sbjct  3    GISGHWAFAFGVLGNIISFIVFLSPIPTFYTIYKKKTAEGYQSIPYVIALFSSMLWIYYA  62

Query  312  FLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQF  491
            FLK+N TLLITINSFG  +ETIY+G Y++YA KKARV T+KML+L V+ GFGA+ LV+QF
Sbjct  63   FLKTNVTLLITINSFGIFIETIYVGLYLFYAPKKARVHTVKMLLLTVVGGFGAIVLVTQF  122

Query  492  LFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            LFK   VR Q+VGW+CL+F+L VFVAPL IV+QVI
Sbjct  123  LFKGV-VRGQIVGWICLIFALSVFVAPLGIVRQVI  156



>ref|XP_009601078.1| PREDICTED: bidirectional sugar transporter SWEET11-like [Nicotiana 
tomentosiformis]
Length=160

 Score =   239 bits (611),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 131/147 (89%), Gaps = 1/147 (1%)
 Frame = +3

Query  129  MALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYY  308
            MA+SGHW FAFGV GNI+SFIVFLSPLPTFY+IYKKKS EGYQSIPYV+ALFSSMLWIYY
Sbjct  1    MAISGHWAFAFGVRGNIVSFIVFLSPLPTFYKIYKKKSTEGYQSIPYVIALFSSMLWIYY  60

Query  309  AFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQ  488
            AFLK+N TLLITINSFG  +ETIY+GFY++YA KKAR+QT+KML+L V+ GFGA+ L++Q
Sbjct  61   AFLKTNTTLLITINSFGVFIETIYVGFYLFYAPKKARIQTVKMLLLTVVGGFGAIILIAQ  120

Query  489  FLFKSAPVRAQVVGWVCLVFSLCVFVA  569
            FLFK    R QVVGWVCLVFSLCVF A
Sbjct  121  FLFKGV-ARGQVVGWVCLVFSLCVFAA  146



>ref|XP_006363981.1| PREDICTED: bidirectional sugar transporter SWEET11-like [Solanum 
tuberosum]
Length=300

 Score =   243 bits (620),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 134/152 (88%), Gaps = 1/152 (1%)
 Frame = +3

Query  141  GHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLK  320
            GH+ FAFGVLGNI+SFIVFLSP+PTFY IYKKKS EGYQSIPYVVALFSSMLWIYYA LK
Sbjct  6    GHYAFAFGVLGNIVSFIVFLSPIPTFYNIYKKKSTEGYQSIPYVVALFSSMLWIYYALLK  65

Query  321  SNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFK  500
            SN  LLITINSFG  +ETIY+GFY++YA KKARV TIKML+L V+ GFGA+ LV++FLFK
Sbjct  66   SNMPLLITINSFGMFIETIYVGFYLFYAPKKARVHTIKMLMLSVVGGFGAIVLVTEFLFK  125

Query  501  SAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
               VR Q+VGWVCL+FSLCVFVAPL IV+QVI
Sbjct  126  GV-VRGQIVGWVCLIFSLCVFVAPLGIVRQVI  156



>ref|XP_004235326.1| PREDICTED: bidirectional sugar transporter N3 [Solanum lycopersicum]
Length=300

 Score =   243 bits (619),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 134/152 (88%), Gaps = 1/152 (1%)
 Frame = +3

Query  141  GHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLK  320
            GH+ FAFGVLGNIISFIVFLSP+PTFY IYKKKS EGYQSIPYVVALFSSMLWIYYA LK
Sbjct  6    GHYAFAFGVLGNIISFIVFLSPIPTFYSIYKKKSTEGYQSIPYVVALFSSMLWIYYALLK  65

Query  321  SNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFK  500
            SN  LLITINSFG  +ETIY+GFY++YA KKARV TIKML+L V+ GFGA+ LV++FLFK
Sbjct  66   SNMPLLITINSFGMFIETIYVGFYLFYAPKKARVHTIKMLMLSVVGGFGAIVLVTEFLFK  125

Query  501  SAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
               VR Q+VGW+CL+FSLCVFVAPL IV+QVI
Sbjct  126  GV-VRGQIVGWICLIFSLCVFVAPLGIVRQVI  156



>ref|XP_006347633.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Solanum 
tuberosum]
Length=296

 Score =   241 bits (615),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 135/155 (87%), Gaps = 1/155 (1%)
 Frame = +3

Query  132  ALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYA  311
             +S HW FAFGVLGNI+SFIVFLSP+PTFY IYKKKS EGYQSIPYVVALFSSMLWIYYA
Sbjct  3    GISNHWAFAFGVLGNIVSFIVFLSPIPTFYNIYKKKSTEGYQSIPYVVALFSSMLWIYYA  62

Query  312  FLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQF  491
             LK+N  LLITINSFG  +ETIY+G Y++YA KKARVQT+KML+L V+ GFGA+ LV++ 
Sbjct  63   LLKTNMPLLITINSFGMFIETIYVGLYLFYAPKKARVQTVKMLMLSVVGGFGAIILVTEL  122

Query  492  LFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            LFK A +R QVVGW+CL+FSLCVFVAPL IV++VI
Sbjct  123  LFKGA-IRGQVVGWICLIFSLCVFVAPLGIVRKVI  156



>ref|XP_004235333.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Solanum 
lycopersicum]
Length=296

 Score =   240 bits (613),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 121/157 (77%), Positives = 136/157 (87%), Gaps = 2/157 (1%)
 Frame = +3

Query  129  MALS-GHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIY  305
            MA S  HW F FGVLGNI+SFIVFLSPLPTFY IYKKK+AEGYQSIPYVVALFSSMLWIY
Sbjct  1    MAFSADHWAFVFGVLGNIVSFIVFLSPLPTFYTIYKKKTAEGYQSIPYVVALFSSMLWIY  60

Query  306  YAFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVS  485
            YAFLK+N TLLITIN+FG  VETIY+ FY+ YA KK+RVQTIKML L V+ GFGA+ LV+
Sbjct  61   YAFLKTNTTLLITINTFGVFVETIYVVFYLIYAPKKSRVQTIKMLSLFVVGGFGAIILVT  120

Query  486  QFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            QFLFK   +R QVVGW+CL+FSLCVFVAPL IV++VI
Sbjct  121  QFLFKGV-IRGQVVGWICLIFSLCVFVAPLGIVRKVI  156



>ref|XP_006347347.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Solanum 
tuberosum]
Length=289

 Score =   236 bits (603),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 122/153 (80%), Positives = 139/153 (91%), Gaps = 1/153 (1%)
 Frame = +3

Query  138  SGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFL  317
            S HWVFAFGVLGNI+SF VFLSPLPTF ++YKK S EGYQSIPYVVALFS+MLWIYYAFL
Sbjct  5    SVHWVFAFGVLGNIVSFFVFLSPLPTFCKMYKKNSTEGYQSIPYVVALFSAMLWIYYAFL  64

Query  318  KSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLF  497
            K+N TLLITIN+FGC VE IY+GFY++YA+K+ARVQTIK+L+LLV+ GFGA+ LVSQFLF
Sbjct  65   KTNTTLLITINTFGCFVEIIYVGFYLFYASKEARVQTIKLLLLLVVGGFGAIVLVSQFLF  124

Query  498  KSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            + A VR QVVGW+CLV SLCVFVAPLCIVKQVI
Sbjct  125  EGA-VRVQVVGWICLVCSLCVFVAPLCIVKQVI  156



>ref|XP_004235334.1| PREDICTED: bidirectional sugar transporter SWEET12 [Solanum lycopersicum]
Length=298

 Score =   236 bits (601),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 114/152 (75%), Positives = 130/152 (86%), Gaps = 1/152 (1%)
 Frame = +3

Query  141  GHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLK  320
             HW FAFGVLGNI+SFIVFLSP+PTFY IYKKKS EGYQSIPYVVALFSSMLWIYYA LK
Sbjct  4    NHWAFAFGVLGNIVSFIVFLSPIPTFYNIYKKKSTEGYQSIPYVVALFSSMLWIYYALLK  63

Query  321  SNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFK  500
            SN  LLITINSFG  +ETIY+G Y+ YA  KARV TIKML+L V+ GFGA+ L+++FLFK
Sbjct  64   SNMPLLITINSFGMFIETIYVGLYLLYAPNKARVHTIKMLMLSVVGGFGAIVLITEFLFK  123

Query  501  SAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
               VR Q+VGW+CL+FSLCVFVAPL IV++VI
Sbjct  124  GV-VRGQIVGWICLIFSLCVFVAPLGIVRKVI  154



>ref|XP_004242139.1| PREDICTED: bidirectional sugar transporter SWEET9-like [Solanum 
lycopersicum]
Length=289

 Score =   235 bits (600),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 120/153 (78%), Positives = 140/153 (92%), Gaps = 1/153 (1%)
 Frame = +3

Query  138  SGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFL  317
            S HWVFAFGVLGNIISF VFLSPLPTFY++YKKKS EGYQSIPY+VALFS+MLWIYYAFL
Sbjct  5    SVHWVFAFGVLGNIISFFVFLSPLPTFYKMYKKKSTEGYQSIPYIVALFSAMLWIYYAFL  64

Query  318  KSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLF  497
            K+N TLLITIN+FGC VE +YIGFY++YA+K+ARVQT+K+L+LLV+ GFGA+ LVSQFLF
Sbjct  65   KTNTTLLITINTFGCFVEIMYIGFYLFYASKEARVQTVKLLLLLVVGGFGAIVLVSQFLF  124

Query  498  KSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            + A VR QVVG +CL+ SLCVFVAPLCIV+QVI
Sbjct  125  EGA-VRVQVVGCICLICSLCVFVAPLCIVRQVI  156



>ref|XP_011073577.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Sesamum 
indicum]
 ref|XP_011073579.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Sesamum 
indicum]
Length=270

 Score =   233 bits (593),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/153 (71%), Positives = 136/153 (89%), Gaps = 1/153 (1%)
 Frame = +3

Query  138  SGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFL  317
            SGHW FAFG+LGNI+SF+VFLSP+PTFYQIYKKK++EG+QS+PYVVALFS+MLWIYYAFL
Sbjct  5    SGHWAFAFGLLGNIVSFMVFLSPIPTFYQIYKKKTSEGFQSVPYVVALFSAMLWIYYAFL  64

Query  318  KSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLF  497
            KSN TL+ITINS GC ++TIYI FY++YA KK RVQT+K+L LL++ GFG + + + FL 
Sbjct  65   KSNTTLIITINSVGCFIQTIYICFYLFYAPKKQRVQTLKLLFLLIVCGFGFILVSTHFLV  124

Query  498  KSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            K A ++A VVGW+CLVFSLCVF+APLCIV++VI
Sbjct  125  K-ASLQANVVGWICLVFSLCVFIAPLCIVRKVI  156



>ref|XP_011069470.1| PREDICTED: bidirectional sugar transporter SWEET14-like, partial 
[Sesamum indicum]
Length=157

 Score =   226 bits (575),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 107/151 (71%), Positives = 132/151 (87%), Gaps = 1/151 (1%)
 Frame = +3

Query  132  ALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYA  311
              SGHW FAFG+LGNI+SF+VFLSP+PTFYQIYKKK++EG+QS+PYVVALFS+MLWIYYA
Sbjct  3    GFSGHWAFAFGLLGNIVSFMVFLSPIPTFYQIYKKKTSEGFQSVPYVVALFSAMLWIYYA  62

Query  312  FLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQF  491
            FLKSN TL+ITINS GC ++TIYI FY++YA KK RVQT+K+L LL++ GFG + + + F
Sbjct  63   FLKSNTTLIITINSVGCFIQTIYICFYLFYAPKKQRVQTLKLLFLLIVCGFGFILVSTHF  122

Query  492  LFKSAPVRAQVVGWVCLVFSLCVFVAPLCIV  584
            L K A ++A VVGW+CLVFSLCVF+APLCIV
Sbjct  123  LVK-ASLQANVVGWICLVFSLCVFIAPLCIV  152



>ref|XP_009794853.1| PREDICTED: bidirectional sugar transporter SWEET9-like, partial 
[Nicotiana sylvestris]
Length=282

 Score =   229 bits (585),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 110/138 (80%), Positives = 124/138 (90%), Gaps = 1/138 (1%)
 Frame = +3

Query  171  GNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNATLLITIN  350
            GNI+SFIVFLSPLPTFY+IYKKKS EGYQSIPYV+ALFSSMLWIYYAFLK+N TLLITIN
Sbjct  4    GNIVSFIVFLSPLPTFYKIYKKKSTEGYQSIPYVIALFSSMLWIYYAFLKTNTTLLITIN  63

Query  351  SFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAPVRAQVVG  530
            SFG  +ETIY+GFY++YA KKAR+QT+KML L V+ GFGA+ L++QFLFK    R QVVG
Sbjct  64   SFGVFIETIYVGFYLFYAPKKARIQTVKMLFLTVVGGFGAIILIAQFLFKGV-ARGQVVG  122

Query  531  WVCLVFSLCVFVAPLCIV  584
            WVCLVFSLCVFVAPLCIV
Sbjct  123  WVCLVFSLCVFVAPLCIV  140



>ref|XP_009802195.1| PREDICTED: bidirectional sugar transporter SWEET9-like isoform 
X2 [Nicotiana sylvestris]
Length=297

 Score =   227 bits (579),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 111/147 (76%), Positives = 127/147 (86%), Gaps = 1/147 (1%)
 Frame = +3

Query  156  AFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNATL  335
             F   GNI+SF VFLSPLPTFY+IYKKKS E YQSIPYVVALFS+M WIYYAFLKSN TL
Sbjct  10   GFPFAGNIVSFFVFLSPLPTFYKIYKKKSTEDYQSIPYVVALFSAMFWIYYAFLKSNTTL  69

Query  336  LITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAPVR  515
            LITINSFGC +ETIY+GFY++YA KKARVQT+K+L+L V  GFGA+ LV+Q LFK   VR
Sbjct  70   LITINSFGCFIETIYVGFYLFYAPKKARVQTVKLLLLSVFGGFGAIVLVTQLLFKGV-VR  128

Query  516  AQVVGWVCLVFSLCVFVAPLCIVKQVI  596
             QVVGW+CLVFSLCVFV+PLCI++QVI
Sbjct  129  VQVVGWICLVFSLCVFVSPLCIMRQVI  155



>ref|XP_009803865.1| PREDICTED: bidirectional sugar transporter SWEET9-like [Nicotiana 
sylvestris]
Length=288

 Score =   220 bits (561),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 109/154 (71%), Positives = 129/154 (84%), Gaps = 3/154 (2%)
 Frame = +3

Query  141  GHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFL-  317
            G W  AFGVLGNI+SF+VFLSPLPTFY IYKKKS EGYQSIPYVVALFS +LWIYYA L 
Sbjct  7    GIWTSAFGVLGNIVSFMVFLSPLPTFYSIYKKKSTEGYQSIPYVVALFSCVLWIYYALLM  66

Query  318  -KSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFL  494
             +SN   +ITIN+ GC +ET Y+G Y++YA KKARVQT+KML+LLV+ GFGA+ LV QFL
Sbjct  67   PQSNLIFIITINTIGCFIETFYVGIYLFYAPKKARVQTVKMLLLLVVGGFGAMVLVIQFL  126

Query  495  FKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            FK A VR Q+VGW+CLVFS+C F APLCI+++VI
Sbjct  127  FKGA-VRGQIVGWICLVFSVCTFAAPLCILRKVI  159



>ref|XP_009614917.1| PREDICTED: bidirectional sugar transporter SWEET11-like [Nicotiana 
tomentosiformis]
Length=286

 Score =   218 bits (554),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 115/156 (74%), Positives = 134/156 (86%), Gaps = 2/156 (1%)
 Frame = +3

Query  132  ALSGH-WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYY  308
             +S H W  AFGVLG+I+SFIVFLSPLPTFY IYKKKS EGYQSIPYVVALFS +LWIYY
Sbjct  3    GISVHVWASAFGVLGDIVSFIVFLSPLPTFYTIYKKKSTEGYQSIPYVVALFSCILWIYY  62

Query  309  AFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQ  488
            A L SN   +ITIN+FGC +ETIY+GFY++YA KKARVQT+KML+LLV+ GFGA+ LV+Q
Sbjct  63   ALLMSNMIFIITINTFGCFIETIYVGFYLFYAPKKARVQTVKMLLLLVLGGFGAIVLVTQ  122

Query  489  FLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            FLFK A VR Q+VGW+CLVFSLC F APLCIV++VI
Sbjct  123  FLFKGA-VRGQIVGWICLVFSLCTFAAPLCIVRKVI  157



>ref|XP_011083538.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Sesamum 
indicum]
Length=278

 Score =   207 bits (527),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 97/148 (66%), Positives = 126/148 (85%), Gaps = 1/148 (1%)
 Frame = +3

Query  153  FAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNAT  332
            F FG+LGN++SF+VFL+P+PTFYQIYKKKS EG+QS+PYVV LFS+MLWIYYAFLK + T
Sbjct  6    FVFGLLGNVVSFMVFLAPIPTFYQIYKKKSTEGFQSVPYVVGLFSAMLWIYYAFLKPDTT  65

Query  333  LLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAPV  512
            LLITINS GC +++ YI FY+++A + ARVQT+K+L+LL  VGFG + +++ FL K +  
Sbjct  66   LLITINSVGCFIQSAYICFYLFFAPRNARVQTVKLLLLLNTVGFGLIMVLTYFLAKGSN-  124

Query  513  RAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            RA  VGW+CLVFSLCVFVAPLC+V+QV+
Sbjct  125  RANFVGWICLVFSLCVFVAPLCVVRQVL  152



>ref|XP_006347632.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Solanum 
tuberosum]
Length=294

 Score =   206 bits (523),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 93/151 (62%), Positives = 125/151 (83%), Gaps = 1/151 (1%)
 Frame = +3

Query  144  HWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKS  323
            H  F FG+LGNI+SF+V+L+P+PTFY+IYKKKS EG+QS+PYVV LFS+MLWIYYAFLK 
Sbjct  4    HLAFVFGLLGNIVSFMVYLAPVPTFYKIYKKKSTEGFQSVPYVVGLFSAMLWIYYAFLKP  63

Query  324  NATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKS  503
            + TLLITINS GC ++T YI F+++YA KKA++ T+K+L+ + +VG G + L++QF F  
Sbjct  64   DTTLLITINSVGCFIQTFYICFFLFYATKKAKMDTVKLLLSMNVVGLGLIILLTQF-FSK  122

Query  504  APVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
               RAQ+VGW+CL+FS CVFVAPL +++QVI
Sbjct  123  GSNRAQIVGWICLIFSFCVFVAPLGVLRQVI  153



>ref|XP_004235340.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Solanum 
lycopersicum]
Length=295

 Score =   204 bits (519),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 126/154 (82%), Gaps = 1/154 (1%)
 Frame = +3

Query  135  LSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAF  314
            ++ H  F FG+LGNI+SF+V+L+P+PTFY+IYKKKS EG+QS+PYVV LFS+MLWIYYAF
Sbjct  1    MTTHLAFVFGLLGNIVSFMVYLAPVPTFYKIYKKKSTEGFQSVPYVVGLFSAMLWIYYAF  60

Query  315  LKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFL  494
            LK + TLLITINS GC ++T YI F+++YA KKA++ T+K+L+ + +VG G +  ++QF 
Sbjct  61   LKPDTTLLITINSVGCFIQTFYICFFLFYATKKAKMDTMKLLLSMNVVGLGLIIFLTQF-  119

Query  495  FKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            F     RAQ+VGW+CL+FS CVFVAPL +++QVI
Sbjct  120  FAKGSNRAQIVGWICLIFSFCVFVAPLGVLRQVI  153



>ref|XP_011073105.1| PREDICTED: bidirectional sugar transporter NEC1-like [Sesamum 
indicum]
Length=290

 Score =   201 bits (512),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 98/154 (64%), Positives = 128/154 (83%), Gaps = 1/154 (1%)
 Frame = +3

Query  135  LSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAF  314
            +S +  F FG+LGNIISF+VFL+P+PTFYQIYK+KS EG+QS+PYVV LFS+ML IYYAF
Sbjct  1    MSANLAFVFGLLGNIISFMVFLAPIPTFYQIYKRKSTEGFQSLPYVVGLFSAMLLIYYAF  60

Query  315  LKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFL  494
            L  ++TLLITINSFGC +ET+YI FY++YA K AR+QT  +L+LL +VG G + +++ FL
Sbjct  61   LLPDSTLLITINSFGCFIETLYICFYLFYAPKTARLQTATLLLLLNVVGMGLIVVLTHFL  120

Query  495  FKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
             K +  RA +VGW+CLVFS+ VFVAPLC+V+QVI
Sbjct  121  AKDS-TRAHIVGWICLVFSVSVFVAPLCVVRQVI  153



>gb|EYU43028.1| hypothetical protein MIMGU_mgv1a019383mg, partial [Erythranthe 
guttata]
Length=170

 Score =   197 bits (501),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 96/136 (71%), Positives = 120/136 (88%), Gaps = 2/136 (1%)
 Frame = +3

Query  189  IVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNATLLITINSFGCLV  368
            +V+L+P+PTF QIYKKK++EG+QSIPYVVALFS+MLWIYYAFLKSN TLLITINS GCL+
Sbjct  1    MVYLAPIPTFRQIYKKKTSEGFQSIPYVVALFSAMLWIYYAFLKSNTTLLITINSVGCLI  60

Query  369  ETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAPVRAQVVGWVCLVF  548
            ET+YI  +I+YA+KKARVQT+K+LVLL++ G G V  V+QF+ K++  RA VVGW CL+ 
Sbjct  61   ETVYILLFIFYASKKARVQTVKLLVLLMVCGMGLVG-VTQFVVKASE-RANVVGWFCLIL  118

Query  549  SLCVFVAPLCIVKQVI  596
            SLCVF+APLCIV+QVI
Sbjct  119  SLCVFIAPLCIVRQVI  134



>ref|XP_009601079.1| PREDICTED: bidirectional sugar transporter SWEET13-like [Nicotiana 
tomentosiformis]
Length=272

 Score =   200 bits (508),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 95/149 (64%), Positives = 122/149 (82%), Gaps = 1/149 (1%)
 Frame = +3

Query  150  VFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNA  329
            +FAFG+LGNI SF+VF+SP+PTFY I KKKSAEG+QS+PYVVALFSSMLWIYYA +K+N 
Sbjct  7    IFAFGILGNIFSFMVFISPVPTFYGIVKKKSAEGFQSVPYVVALFSSMLWIYYAMVKTNE  66

Query  330  TLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAP  509
            TL+ITINSFGC+ ETIY+  Y  YA K AR+QT+++++LL   GFG +  ++Q L K  P
Sbjct  67   TLIITINSFGCIAETIYVAIYFAYATKNARMQTLRLVLLLNFGGFGLILFLTQILCK-GP  125

Query  510  VRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
             RA+VVGW+C+ FS+ VFVAPL I+ +VI
Sbjct  126  KRAEVVGWICMAFSISVFVAPLSIMGRVI  154



>ref|XP_006578712.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Glycine 
max]
 gb|KHN31281.1| Bidirectional sugar transporter SWEET14-like protein [Glycine 
soja]
Length=282

 Score =   200 bits (509),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 96/151 (64%), Positives = 125/151 (83%), Gaps = 2/151 (1%)
 Frame = +3

Query  147  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  326
            W F FG+LGN+ISF+VFL+PLPTFYQIYKKKS+EG+QS+PYVVALFSSMLWIYYAF+K +
Sbjct  8    WAFVFGLLGNVISFMVFLAPLPTFYQIYKKKSSEGFQSLPYVVALFSSMLWIYYAFVKKD  67

Query  327  AT-LLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKS  503
            A+ LLITINSFGC++ETIY+  ++ YA  K R+ TIK+L++L + GFGA+ L+S     +
Sbjct  68   ASLLLITINSFGCVIETIYLAIFLVYAPSKTRLWTIKLLLMLNVFGFGAM-LLSTLYLTT  126

Query  504  APVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
               R  V+GW+CLVF++ VF APLCI+K+VI
Sbjct  127  GSKRLTVIGWICLVFNISVFAAPLCIMKRVI  157



>gb|EYU43031.1| hypothetical protein MIMGU_mgv1a011488mg [Erythranthe guttata]
Length=280

 Score =   200 bits (508),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 92/148 (62%), Positives = 124/148 (84%), Gaps = 1/148 (1%)
 Frame = +3

Query  153  FAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNAT  332
            F FG+LGN++SF+VFL+P+PTFYQI+KKKS EG+QS+PY V LFS+MLWIYYAFLK   T
Sbjct  6    FVFGLLGNVVSFMVFLAPIPTFYQIFKKKSTEGFQSVPYAVGLFSAMLWIYYAFLKPETT  65

Query  333  LLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAPV  512
            LLITINS GC++++ YI FY+++A K AR+QT+K+++LL +VGFG + +++ F + +   
Sbjct  66   LLITINSVGCVIQSAYICFYLFFATKNARIQTVKLILLLNVVGFGLIIVLTHF-WANDSN  124

Query  513  RAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            R  VVGW+CLVFSLCVFVAPL +V+QVI
Sbjct  125  RDDVVGWICLVFSLCVFVAPLGVVRQVI  152



>ref|XP_009779208.1| PREDICTED: bidirectional sugar transporter SWEET12-like, partial 
[Nicotiana sylvestris]
Length=264

 Score =   199 bits (506),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 96/149 (64%), Positives = 121/149 (81%), Gaps = 1/149 (1%)
 Frame = +3

Query  150  VFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNA  329
            +FAFG+LGNIISF VF+SP+PTFY I KKKSAEG+QS+PYVVALFSSMLWIYYA  K+N 
Sbjct  1    IFAFGILGNIISFTVFISPVPTFYGIVKKKSAEGFQSVPYVVALFSSMLWIYYAMTKTNE  60

Query  330  TLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAP  509
            TL+ITINSFGC+ ETIYI  Y  YA KK R+QT+++++LL   GFG +  ++Q L K A 
Sbjct  61   TLIITINSFGCIAETIYIAIYFAYATKKTRMQTLRLVLLLNFGGFGLILFLTQILCKGAK  120

Query  510  VRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
             RA+V+GW+C+ FS+ VFVAPL I+ +VI
Sbjct  121  -RAEVIGWICMAFSISVFVAPLSIMGRVI  148



>gb|EPS64389.1| hypothetical protein M569_10392, partial [Genlisea aurea]
Length=248

 Score =   197 bits (502),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 94/148 (64%), Positives = 121/148 (82%), Gaps = 1/148 (1%)
 Frame = +3

Query  153  FAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNAT  332
            F FG+LGN ISF+VFL+P+PTFY+IYKKKS EG+Q +PY+V LFS+MLWIYYAFLK + T
Sbjct  5    FVFGLLGNAISFMVFLAPIPTFYKIYKKKSTEGFQCVPYIVGLFSAMLWIYYAFLKPDTT  64

Query  333  LLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAPV  512
            LL+TINS GC  ++IYIGFY+Y+++KK RV T K L +L +  FG +  V++F+  S   
Sbjct  65   LLVTINSVGCFFQSIYIGFYLYFSSKKTRVVTTKQLFVLNVASFGVIIAVTRFVV-SPSQ  123

Query  513  RAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            +A VVGW+CLVFSLCVFVAPLC+V+QVI
Sbjct  124  QASVVGWICLVFSLCVFVAPLCVVRQVI  151



>gb|EYU24137.1| hypothetical protein MIMGU_mgv1a022637mg, partial [Erythranthe 
guttata]
Length=171

 Score =   195 bits (495),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 95/136 (70%), Positives = 119/136 (88%), Gaps = 2/136 (1%)
 Frame = +3

Query  189  IVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNATLLITINSFGCLV  368
            +V+L+P+PTF QIYKKKS+EG+QSIPYVVALFS+MLWIYYAFLKSN TLLITINS GCL+
Sbjct  1    MVYLAPIPTFRQIYKKKSSEGFQSIPYVVALFSAMLWIYYAFLKSNTTLLITINSVGCLI  60

Query  369  ETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAPVRAQVVGWVCLVF  548
            ET+YI  +I+YA+KKARV+T+K+L LL++ G G V  V+QF+ K++  RA VVGW CL+ 
Sbjct  61   ETVYILLFIFYASKKARVETVKLLALLMVCGTGLVG-VTQFVVKASE-RANVVGWFCLIL  118

Query  549  SLCVFVAPLCIVKQVI  596
            SLCVF+APLCIV+QVI
Sbjct  119  SLCVFIAPLCIVRQVI  134



>ref|XP_004297512.1| PREDICTED: bidirectional sugar transporter SWEET10 [Fragaria 
vesca subsp. vesca]
Length=292

 Score =   199 bits (505),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 92/156 (59%), Positives = 127/156 (81%), Gaps = 1/156 (1%)
 Frame = +3

Query  129  MALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYY  308
            MA+      AFG+LGNIISF+VFL+P+PTFY+IYKKK+ EG+Q++PY VALFS MLWIYY
Sbjct  1    MAIHHPLTLAFGLLGNIISFMVFLAPMPTFYKIYKKKTTEGFQALPYAVALFSCMLWIYY  60

Query  309  AFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQ  488
            A LK +AT LITINS GC++ET+Y+  +++Y+ KKAR+ T+K L+LL ++G+G + +++ 
Sbjct  61   ALLKQDATFLITINSVGCVIETVYLAIFLFYSPKKARISTVKFLLLLNVLGYGLMLVLTL  120

Query  489  FLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            FL K   +R +VVGW+CLVF+L VF APLCI+K+VI
Sbjct  121  FLAKGE-IRLKVVGWICLVFNLTVFAAPLCILKKVI  155



>emb|CDP21121.1| unnamed protein product [Coffea canephora]
Length=278

 Score =   197 bits (502),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 93/152 (61%), Positives = 123/152 (81%), Gaps = 1/152 (1%)
 Frame = +3

Query  141  GHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLK  320
                F FG+LGNI+SF+V+L+PLPTFY IYKKKS EG+QS+PYVV LFS+ML IYYAFLK
Sbjct  2    AQLAFIFGLLGNIVSFMVYLAPLPTFYSIYKKKSTEGFQSVPYVVGLFSAMLRIYYAFLK  61

Query  321  SNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFK  500
             + TL ITINS GC  +T+Y+ +Y++YA ++AR+QT K+L LLV++GFG++ L++Q L  
Sbjct  62   PDTTLRITINSVGCFFQTVYLCYYLFYAPRRARIQTAKLLALLVVMGFGSIILLTQ-LLS  120

Query  501  SAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            +   RA++VGW+ LV SLCVFVAPL IV+QVI
Sbjct  121  TGKTRARIVGWIGLVLSLCVFVAPLAIVRQVI  152



>ref|XP_008392763.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Malus 
domestica]
Length=248

 Score =   196 bits (498),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 95/164 (58%), Positives = 124/164 (76%), Gaps = 10/164 (6%)
 Frame = +3

Query  105  SSRHPDRSMALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALF  284
            +S HP           FAFG+LGNI+SFIVFL+PLPTF+++YKKKS EG+QS+PYV ALF
Sbjct  5    TSHHP---------LAFAFGILGNIVSFIVFLAPLPTFWRVYKKKSTEGFQSVPYVFALF  55

Query  285  SSMLWIYYAFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGF  464
            S+M+WIYYAFLKS+  LLITINSFGC++ETIYI  Y+ YA K ARV T+++L+L+   GF
Sbjct  56   SAMIWIYYAFLKSHVILLITINSFGCVIETIYIAIYLTYATKHARVSTLRLLLLVNFGGF  115

Query  465  GAVALVSQFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
              + L+S FL    P R +V+GWVC+ FS+ VF APL +++ VI
Sbjct  116  CLILLLSHFL-SQGPTRVEVLGWVCVTFSVSVFAAPLSVMRMVI  158



>gb|EYU43030.1| hypothetical protein MIMGU_mgv1a011435mg [Erythranthe guttata]
Length=282

 Score =   197 bits (501),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 90/148 (61%), Positives = 124/148 (84%), Gaps = 1/148 (1%)
 Frame = +3

Query  153  FAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNAT  332
            F FG+LGN++SF+VFL+P+PTFY I+KKKS +G+QS+PYVV LFS+MLWIYYAFLK   T
Sbjct  6    FVFGLLGNVVSFMVFLAPIPTFYTIFKKKSTQGFQSVPYVVGLFSAMLWIYYAFLKPETT  65

Query  333  LLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAPV  512
            LLITIN+ GC V++ YI FY+++A+K AR+QT+K+++LL +VGFG + +++ F + +   
Sbjct  66   LLITINTVGCFVQSTYICFYLFFASKNARIQTVKLILLLNVVGFGLIIVLTHF-WANDSN  124

Query  513  RAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            R  +VGW+CLVFSLCVFVAPL +V+QVI
Sbjct  125  RDDIVGWICLVFSLCVFVAPLGVVRQVI  152



>ref|XP_009605548.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Nicotiana 
tomentosiformis]
Length=294

 Score =   197 bits (502),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 98/151 (65%), Positives = 127/151 (84%), Gaps = 1/151 (1%)
 Frame = +3

Query  144  HWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKS  323
            H  F FG+LGNI+SF+V+L+P PTFY+IYKKKS EG+QS+PYVV LFS+MLWIYYAFLK 
Sbjct  3    HLAFTFGLLGNIVSFMVYLAPAPTFYKIYKKKSTEGFQSVPYVVGLFSAMLWIYYAFLKP  62

Query  324  NATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKS  503
            + TLLITINS GC +++ YI F+++YA KKA++ T+K+L+LL   G G + L++QFL KS
Sbjct  63   DTTLLITINSVGCCIQSFYICFFLFYATKKAKMDTVKLLLLLNFFGLGLIILLTQFLAKS  122

Query  504  APVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            +  RAQ+VGW+CL+FSLCVFVAPL IV+QVI
Sbjct  123  SN-RAQIVGWICLIFSLCVFVAPLGIVRQVI  152



>ref|XP_003523161.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Glycine 
max]
 gb|KHN31282.1| Bidirectional sugar transporter SWEET14-like protein [Glycine 
soja]
Length=258

 Score =   196 bits (498),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 97/158 (61%), Positives = 127/158 (80%), Gaps = 3/158 (2%)
 Frame = +3

Query  129  MALSGH-WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIY  305
            MA+S   W F FG+LGN+ISF+VFL+PLPTFYQIYKKKS+EG+QS+PYVVALFSSMLWIY
Sbjct  1    MAISHETWAFIFGLLGNVISFMVFLAPLPTFYQIYKKKSSEGFQSLPYVVALFSSMLWIY  60

Query  306  YAFLKSNAT-LLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALV  482
            YA +K +A+ LLITINSFGC++ETIY+  ++ YA  K R+ TIK+L++L + GFG + L+
Sbjct  61   YALVKKDASLLLITINSFGCVIETIYLAIFLVYAPSKTRLWTIKLLLMLNVFGFGGM-LL  119

Query  483  SQFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            S     +   R  V+GW+CLVF++ VF APLCI+K+VI
Sbjct  120  STLYLTTGSKRLSVIGWICLVFNISVFAAPLCIMKRVI  157



>gb|EYU43032.1| hypothetical protein MIMGU_mgv1a010677mg [Erythranthe guttata]
Length=305

 Score =   197 bits (502),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 94/162 (58%), Positives = 126/162 (78%), Gaps = 4/162 (2%)
 Frame = +3

Query  111  RHPDRSMALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSS  290
            R+  R M       F FG+LGN+ISF+VFL+P+PTFY I+KKKS EG+QS+PYVV LFS+
Sbjct  24   RNQLREM---NQLAFVFGLLGNVISFMVFLAPIPTFYTIFKKKSTEGFQSVPYVVGLFSA  80

Query  291  MLWIYYAFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGA  470
             LWIYYAFLK   TLLITIN+ GC V++ YI FY+++A K AR+QT+K+++LL +VGFG 
Sbjct  81   QLWIYYAFLKPETTLLITINTVGCFVQSAYICFYLFFATKNARIQTVKLILLLNVVGFGL  140

Query  471  VALVSQFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            + +++ F + +   R  +VGW+CLVFSLCVFVAPL +V+QVI
Sbjct  141  IIVLTHF-WANDSNRDDIVGWICLVFSLCVFVAPLGVVRQVI  181



>ref|XP_009801964.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Nicotiana 
sylvestris]
Length=294

 Score =   197 bits (500),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 97/151 (64%), Positives = 128/151 (85%), Gaps = 1/151 (1%)
 Frame = +3

Query  144  HWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKS  323
            H  F FG+LGNI+SF+V+L+P+PTFY+I+KKKS EG+QS+PYVV LFS+MLWIYYAFLK 
Sbjct  3    HLAFTFGLLGNIVSFMVYLAPVPTFYKIHKKKSTEGFQSVPYVVGLFSAMLWIYYAFLKP  62

Query  324  NATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKS  503
            + TLLITINS GC +++ YI F+++YA KKA++ T+K+L+LL   G G + L++QFL KS
Sbjct  63   DTTLLITINSVGCCIQSFYICFFLFYATKKAKMDTVKLLLLLNFFGLGLIILLTQFLAKS  122

Query  504  APVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            +  RAQ+VGW+CL+FSLCVFVAPL IV+QVI
Sbjct  123  SN-RAQIVGWICLIFSLCVFVAPLGIVRQVI  152



>emb|CAN71371.1| hypothetical protein VITISV_023352 [Vitis vinifera]
Length=273

 Score =   196 bits (497),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 95/149 (64%), Positives = 127/149 (85%), Gaps = 1/149 (1%)
 Frame = +3

Query  150  VFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNA  329
            VF FG+LGN+ISF+V+L+PLPTFYQIYK+KS EG+QS+PYVVALFS+MLWIYYAFL ++A
Sbjct  11   VFIFGILGNLISFMVYLAPLPTFYQIYKRKSTEGFQSVPYVVALFSAMLWIYYAFLNTDA  70

Query  330  TLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAP  509
            +LLITINS GC++ET YI  ++ YA KKAR+ T+K++ L+ I GFG++ L++  L + A 
Sbjct  71   SLLITINSVGCVIETSYIVMFLVYAPKKARITTVKLVFLMNICGFGSILLLTLLLAEGAN  130

Query  510  VRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
             R +++GWVCLVFSL VF+APLCI++QVI
Sbjct  131  -RVRILGWVCLVFSLSVFLAPLCIMRQVI  158



>gb|EYU23059.1| hypothetical protein MIMGU_mgv1a019104mg [Erythranthe guttata]
Length=278

 Score =   196 bits (497),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 120/142 (85%), Gaps = 1/142 (1%)
 Frame = +3

Query  171  GNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNATLLITIN  350
            GNI+SF+VFL+PLPTF+QIYK+KS+EG+QS+PYVV LFS+MLWIYYA LK + TLLITIN
Sbjct  5    GNIVSFMVFLAPLPTFHQIYKRKSSEGFQSVPYVVGLFSAMLWIYYALLKPDTTLLITIN  64

Query  351  SFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAPVRAQVVG  530
            S GC ++T YI FY++YA K AR+QT+ ++ LL +VG G + +++QF+ K    RA +VG
Sbjct  65   SVGCFIQTTYICFYLFYAPKSARLQTLALVFLLNVVGMGLIVVLTQFVAKGYN-RAAIVG  123

Query  531  WVCLVFSLCVFVAPLCIVKQVI  596
            W+CLVFSLCVF+APLC+V+QV+
Sbjct  124  WICLVFSLCVFIAPLCVVRQVV  145



>ref|XP_002284244.1| PREDICTED: bidirectional sugar transporter SWEET14 [Vitis vinifera]
 emb|CBI15714.3| unnamed protein product [Vitis vinifera]
Length=270

 Score =   195 bits (496),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 95/149 (64%), Positives = 127/149 (85%), Gaps = 1/149 (1%)
 Frame = +3

Query  150  VFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNA  329
            VF FG+LGN+ISF+V+L+PLPTFYQIYK+KS EG+QS+PYVVALFS+MLWIYYAFL ++A
Sbjct  11   VFIFGILGNLISFMVYLAPLPTFYQIYKRKSTEGFQSVPYVVALFSAMLWIYYAFLNTDA  70

Query  330  TLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAP  509
            +LLITINS GC++ET YI  ++ YA KKAR+ T+K++ L+ I GFG++ L++  L + A 
Sbjct  71   SLLITINSVGCVIETSYIVMFLVYAPKKARITTVKLVFLMNICGFGSILLLTLLLAEGAN  130

Query  510  VRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
             R +++GWVCLVFSL VF+APLCI++QVI
Sbjct  131  -RVRILGWVCLVFSLSVFLAPLCIMRQVI  158



>gb|ACU23483.1| unknown [Glycine max]
Length=258

 Score =   195 bits (495),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 96/158 (61%), Positives = 127/158 (80%), Gaps = 3/158 (2%)
 Frame = +3

Query  129  MALSGH-WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIY  305
            MA+S   W F FG+LGN+ISF+VFL+PLPTFYQIYKKKS+EG+QS+PYVVALFSSMLWIY
Sbjct  1    MAISHETWAFIFGLLGNVISFMVFLAPLPTFYQIYKKKSSEGFQSLPYVVALFSSMLWIY  60

Query  306  YAFLKSNAT-LLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALV  482
            YA +K +A+ LLITINSFGC++ETI++  ++ YA  K R+ TIK+L++L + GFG + L+
Sbjct  61   YALVKKDASLLLITINSFGCVIETIHLAIFLVYAPSKTRLWTIKLLLMLNVFGFGGM-LL  119

Query  483  SQFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            S     +   R  V+GW+CLVF++ VF APLCI+K+VI
Sbjct  120  STLYLTTGSKRLSVIGWICLVFNISVFAAPLCIMKRVI  157



>ref|NP_001237418.1| N3 protein [Glycine max]
 gb|ABT17358.1| N3 protein [Glycine max]
 gb|KHN23962.1| Bidirectional sugar transporter SWEET14 [Glycine soja]
Length=260

 Score =   195 bits (495),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 96/158 (61%), Positives = 126/158 (80%), Gaps = 3/158 (2%)
 Frame = +3

Query  129  MALSGH-WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIY  305
            MA++   W F FG+LGN+ISF+VFL+PLPTFYQIYKKKS E +QS+PYVVALFSSMLWIY
Sbjct  1    MAINHETWAFVFGLLGNVISFMVFLAPLPTFYQIYKKKSTEEFQSLPYVVALFSSMLWIY  60

Query  306  YAFLKSNAT-LLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALV  482
            YA +K +A+ LLITINSFGC++ETIY+  ++ YA  K R+ TIK+L++L + GFGA+ L+
Sbjct  61   YALVKKDASLLLITINSFGCVIETIYLAIFLIYAPSKTRLWTIKLLLMLNVFGFGAM-LL  119

Query  483  SQFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            S     +   R  V+GW+CLVF++ VF APLCI+K+VI
Sbjct  120  STLYLTTGSKRLTVIGWICLVFNISVFAAPLCIIKRVI  157



>ref|XP_009337539.1| PREDICTED: bidirectional sugar transporter N3 [Pyrus x bretschneideri]
Length=298

 Score =   195 bits (496),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 94/164 (57%), Positives = 126/164 (77%), Gaps = 10/164 (6%)
 Frame = +3

Query  105  SSRHPDRSMALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALF  284
            +S HP           FAFG+LGNI+SFIVFL+PLPTF+++YK+KS EG+QS+PYV ALF
Sbjct  5    TSHHP---------LAFAFGILGNIVSFIVFLAPLPTFWRVYKRKSTEGFQSVPYVFALF  55

Query  285  SSMLWIYYAFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGF  464
            S+M+WIYYAFLKS+  LLITINSFGC++ETIYI  Y+ YA K+ARV T+++L+L+   GF
Sbjct  56   SAMIWIYYAFLKSHVILLITINSFGCVIETIYIAIYLTYATKQARVSTLRLLLLVNFGGF  115

Query  465  GAVALVSQFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
              + L+S+FL    P R +V+GWVC+ FS+ VF APL +++ VI
Sbjct  116  CLILLLSRFL-SQGPTRVEVLGWVCVTFSVGVFAAPLSVMRMVI  158



>ref|XP_006436900.1| hypothetical protein CICLE_v10033645mg [Citrus clementina]
 ref|XP_006493251.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Citrus 
sinensis]
 gb|ESR50140.1| hypothetical protein CICLE_v10033645mg [Citrus clementina]
Length=271

 Score =   194 bits (493),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 91/156 (58%), Positives = 127/156 (81%), Gaps = 1/156 (1%)
 Frame = +3

Query  129  MALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYY  308
            MA+   W  AFG+LGNI SF+V L+P+PTFY+IYKKKS EG+QS+PYV++LFS+M+WIYY
Sbjct  1    MAIHHSWATAFGLLGNITSFLVCLAPMPTFYKIYKKKSTEGFQSVPYVISLFSAMIWIYY  60

Query  309  AFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQ  488
            A LK NA  L+TIN+F C+++TIYI  Y++YA KK R+QT+K+L+LL I GFGA+ L++ 
Sbjct  61   ALLKQNAIFLMTINTFCCVMQTIYIAVYVFYAPKKVRIQTVKLLLLLNIFGFGAICLLTF  120

Query  489  FLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            FL K A +R +++G++C+ F+L VF APL IV++VI
Sbjct  121  FLSKGA-IREKILGYICMTFALSVFAAPLFIVRKVI  155



>gb|KHN23963.1| Bidirectional sugar transporter SWEET14 [Glycine soja]
Length=258

 Score =   192 bits (488),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 94/158 (59%), Positives = 126/158 (80%), Gaps = 3/158 (2%)
 Frame = +3

Query  129  MALSGH-WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIY  305
            MA++   W F FG+LGN+ISF+VFL+PLPTFYQIYKKKS +G+QS+PY+VALFSSMLWIY
Sbjct  1    MAINHETWAFIFGLLGNVISFMVFLAPLPTFYQIYKKKSTDGFQSLPYIVALFSSMLWIY  60

Query  306  YAFLKSNAT-LLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALV  482
            YA +K +A+ LLITINSFGC++ETIY+  ++ YA  K R+ TIK+L++L + GFGA+ L+
Sbjct  61   YALVKKDASLLLITINSFGCVIETIYLAIFLIYAPSKTRLWTIKLLLMLNVFGFGAM-LL  119

Query  483  SQFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            S     +   R  V+GW+CLV ++ VF APLCI+K+VI
Sbjct  120  STLYLTTGSKRLSVIGWICLVLNISVFAAPLCIMKRVI  157



>emb|CDP21733.1| unnamed protein product [Coffea canephora]
Length=260

 Score =   192 bits (487),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 89/142 (63%), Positives = 117/142 (82%), Gaps = 1/142 (1%)
 Frame = +3

Query  171  GNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNATLLITIN  350
            GNI+SF  +L+PLPTFY IYKKKS EG+QS+PYVV LF +MLWIYYAFLK + TLLITIN
Sbjct  7    GNIVSFTDYLAPLPTFYSIYKKKSTEGFQSVPYVVGLFRAMLWIYYAFLKPDTTLLITIN  66

Query  351  SFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAPVRAQVVG  530
            S GC  +T+Y+ +Y++YA ++AR+QT K+L LLV++GFG++ L++Q L  +   RA++VG
Sbjct  67   SVGCFFQTVYLCYYLFYAPRRARIQTAKLLALLVVMGFGSIILLTQ-LLSTGKTRARIVG  125

Query  531  WVCLVFSLCVFVAPLCIVKQVI  596
            W+ LV SLCVFVAPL IV+QVI
Sbjct  126  WIGLVLSLCVFVAPLAIVRQVI  147



>ref|XP_007137870.1| hypothetical protein PHAVU_009G162700g [Phaseolus vulgaris]
 gb|ESW09864.1| hypothetical protein PHAVU_009G162700g [Phaseolus vulgaris]
Length=264

 Score =   192 bits (487),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 96/151 (64%), Positives = 125/151 (83%), Gaps = 2/151 (1%)
 Frame = +3

Query  147  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  326
            W F FG+LGN+ISF+VFL+PLPTFYQIYKKK+AEG+QS+PYVVALFSSMLWIYYA +K +
Sbjct  8    WAFVFGLLGNVISFMVFLAPLPTFYQIYKKKTAEGFQSLPYVVALFSSMLWIYYALVKKD  67

Query  327  AT-LLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKS  503
            A+ LLITINSFGC++E+IY+  ++ YA  K R+ TIK+L+LL + GFGA+ L+S   F +
Sbjct  68   ASLLLITINSFGCVIESIYLAIFLLYAPSKTRLCTIKLLLLLNVFGFGAM-LLSTLYFTT  126

Query  504  APVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
               R  V+GW+CLVF++ VF APLCI+K+VI
Sbjct  127  GSKRLSVIGWICLVFNISVFAAPLCIMKRVI  157



>ref|XP_010929602.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Elaeis 
guineensis]
 ref|XP_010929603.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Elaeis 
guineensis]
Length=295

 Score =   192 bits (489),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 93/157 (59%), Positives = 125/157 (80%), Gaps = 1/157 (1%)
 Frame = +3

Query  126  SMALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIY  305
             ++L   W F FG+LGNIISF+V+L+PLPTFY++YKKKS EG+QS+PYVVALFS+MLWIY
Sbjct  3    GLSLDHPWAFTFGILGNIISFMVYLAPLPTFYRVYKKKSTEGFQSVPYVVALFSAMLWIY  62

Query  306  YAFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVS  485
            YAF+K++A LL+TINS GC++ET+YI  Y+ YA KKAR+ T ++L+LL +  FG + LV+
Sbjct  63   YAFIKADAYLLVTINSIGCVIETMYIVMYLSYAPKKARIFTAQVLLLLNVGLFGLIVLVT  122

Query  486  QFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
              + K  P R  V+GWVC+ FS+ VFVAPL I++ VI
Sbjct  123  LMVAK-GPERVHVLGWVCVSFSISVFVAPLSIIRLVI  158



>gb|AFK48645.1| unknown [Lotus japonicus]
Length=247

 Score =   191 bits (485),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 97/158 (61%), Positives = 132/158 (84%), Gaps = 3/158 (2%)
 Frame = +3

Query  129  MALSGH-WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIY  305
            MA++   W F FG++GN+ISF+VFL+PLPTFYQIYKKK+AEG+Q++PYVVALFS+MLWIY
Sbjct  1    MAMTRESWAFVFGLMGNVISFMVFLAPLPTFYQIYKKKTAEGFQALPYVVALFSAMLWIY  60

Query  306  YAFLK-SNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALV  482
            YAF+K  +A LLITIN+FG +VE+IYI F+++YA KK+R+ TIK+L+LL + GFGA+ L 
Sbjct  61   YAFVKRESALLLITINTFGIVVESIYIAFFLFYAPKKSRLSTIKLLLLLNVFGFGAMLLA  120

Query  483  SQFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            + +L K A  R Q++GW+CLVF++ VF APL I+ +VI
Sbjct  121  TLYLSKGAK-RLQIIGWICLVFNISVFAAPLFIISKVI  157



>ref|XP_004490502.1| PREDICTED: bidirectional sugar transporter N3-like [Cicer arietinum]
Length=270

 Score =   190 bits (482),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 89/151 (59%), Positives = 120/151 (79%), Gaps = 1/151 (1%)
 Frame = +3

Query  144  HWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKS  323
            H  F FG+LGNIISF+VFL+PLPTFY+I+KKKS +G+QS+PY+VALFSSMLW+YYA +K+
Sbjct  6    HLAFVFGILGNIISFMVFLAPLPTFYRIWKKKSTQGFQSLPYLVALFSSMLWLYYAIVKT  65

Query  324  NATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKS  503
            NA LLITINSFGC++ETIYI  Y  YA K AR+ T+K+ +++ +  F  +   +QF    
Sbjct  66   NARLLITINSFGCVIETIYIVIYTIYATKDARILTVKLFMVMNVGSFALIFFTTQFGMHG  125

Query  504  APVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            + +R QV+GW+C+ F++CVF APLCIV +VI
Sbjct  126  S-LRVQVLGWICVSFAVCVFAAPLCIVAKVI  155



>ref|XP_008464393.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Cucumis 
melo]
Length=296

 Score =   190 bits (483),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 98/157 (62%), Positives = 125/157 (80%), Gaps = 2/157 (1%)
 Frame = +3

Query  129  MALSGHWV-FAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIY  305
            MA+S   + F FG+LGNIISF+VFL+PLPTFY+IYKKKSAEGYQS+PYVVALFS+MLWIY
Sbjct  1    MAISPQTLAFVFGLLGNIISFMVFLAPLPTFYKIYKKKSAEGYQSVPYVVALFSAMLWIY  60

Query  306  YAFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVS  485
            YA LK+NAT LITINSFGC++E++YI  +I YA  K R QT K++ LL ++GFG +  ++
Sbjct  61   YALLKTNATFLITINSFGCVIESLYILLFIIYAPTKLRFQTAKVIFLLNVLGFGLMLALT  120

Query  486  QFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
              L K    R +V+GW+CLVF+L VF APL I+ +VI
Sbjct  121  LVLAKGEK-RLKVLGWICLVFNLSVFAAPLLIMGKVI  156



>ref|XP_009347840.1| PREDICTED: bidirectional sugar transporter N3-like [Pyrus x bretschneideri]
Length=327

 Score =   191 bits (485),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 95/164 (58%), Positives = 121/164 (74%), Gaps = 10/164 (6%)
 Frame = +3

Query  105  SSRHPDRSMALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALF  284
            +S HP           FAFGVLGNI SFIVFL+PLPTF+++YKKKS EG+QS+PYV ALF
Sbjct  5    TSHHP---------LAFAFGVLGNIASFIVFLAPLPTFWRVYKKKSTEGFQSVPYVFALF  55

Query  285  SSMLWIYYAFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGF  464
            ++ +WIYYAFLKSN  LLITINSFGC++ETIYI  Y+ YA K+ARV T+++L L+   GF
Sbjct  56   TATIWIYYAFLKSNEILLITINSFGCVIETIYIAIYLTYATKQARVSTLRLLFLVNFGGF  115

Query  465  GAVALVSQFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
              + L++ FL    P R  V+GWVC+ FS+ VF APL ++K VI
Sbjct  116  CFILLLAHFL-SQGPTRVAVLGWVCVTFSVSVFAAPLSVMKMVI  158



>ref|XP_007209422.1| hypothetical protein PRUPE_ppa009422mg [Prunus persica]
 gb|EMJ10621.1| hypothetical protein PRUPE_ppa009422mg [Prunus persica]
Length=293

 Score =   190 bits (482),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 91/160 (57%), Positives = 127/160 (79%), Gaps = 5/160 (3%)
 Frame = +3

Query  129  MALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYY  308
            MA+      +FG+LGNIISF+VFL+P+PTFY IYK+K+AEG+Q++PYV+AL SSML+IYY
Sbjct  1    MAIQHPLTLSFGLLGNIISFLVFLAPVPTFYTIYKRKTAEGFQALPYVIALLSSMLYIYY  60

Query  309  AFL----KSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVA  476
            A L    K +AT LITINSFGC+VET+YI  +++YA KKAR+ T+ ++ LL + GFG + 
Sbjct  61   ALLKEEFKEDATFLITINSFGCVVETLYISLFLFYAPKKARISTLTLVFLLNLFGFGLMM  120

Query  477  LVSQFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            L++ FL  +  +R ++VGW+CLVFSL VFVAPL ++++VI
Sbjct  121  LLTHFL-ATGEMRLKIVGWICLVFSLSVFVAPLGVLRRVI  159



>ref|XP_009385515.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Musa 
acuminata subsp. malaccensis]
Length=282

 Score =   189 bits (481),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 95/156 (61%), Positives = 120/156 (77%), Gaps = 1/156 (1%)
 Frame = +3

Query  129  MALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYY  308
            ++L     F FG+LGNIISF+VFLSPLPTFY+IY+KKS EG+QS+PYVVAL S ML IYY
Sbjct  4    LSLEQPLPFIFGILGNIISFMVFLSPLPTFYRIYRKKSTEGFQSVPYVVALSSCMLLIYY  63

Query  309  AFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQ  488
            A +K+NA LLITINSFGC +ET YI  Y+ YA KKAR+  I++ VLL +V F A+ L+++
Sbjct  64   ALVKTNAVLLITINSFGCFIETAYITIYLIYATKKARIFCIQIFVLLNVVAFAAIVLLTR  123

Query  489  FLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
              F + P R  VVGW+C+ FSLCVF APL I++ VI
Sbjct  124  LAF-TGPDRVTVVGWICVGFSLCVFAAPLSIIRLVI  158



>ref|XP_006844581.1| hypothetical protein AMTR_s00016p00202420 [Amborella trichopoda]
 gb|ERN06256.1| hypothetical protein AMTR_s00016p00202420 [Amborella trichopoda]
Length=282

 Score =   189 bits (481),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 94/164 (57%), Positives = 123/164 (75%), Gaps = 10/164 (6%)
 Frame = +3

Query  105  SSRHPDRSMALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALF  284
            S  HP         W F FG+LGNIISF+V+LSPLPTF+++YKKKS EG+QS+PYVVALF
Sbjct  5    SVHHP---------WAFTFGLLGNIISFMVYLSPLPTFHRVYKKKSTEGFQSVPYVVALF  55

Query  285  SSMLWIYYAFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGF  464
            S+MLWIYYA LK++  LLITIN+ GC++E+IYI  YI YA KKA++ T K++VLL +  F
Sbjct  56   SAMLWIYYALLKTDGYLLITINTLGCIIESIYITMYIIYAPKKAKIATAKLVVLLNLGVF  115

Query  465  GAVALVSQFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
              + L++ F F   P R +V+GWVC+ FS+CVF APL I++ VI
Sbjct  116  CMILLLTLF-FVQGPKRVRVLGWVCVTFSVCVFAAPLSIMRLVI  158



>ref|XP_008374287.1| PREDICTED: bidirectional sugar transporter N3-like [Malus domestica]
Length=298

 Score =   190 bits (482),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 95/164 (58%), Positives = 119/164 (73%), Gaps = 10/164 (6%)
 Frame = +3

Query  105  SSRHPDRSMALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALF  284
            +S HP           FAFGVLGNI SFIVFL+PLPTF+++YKKKS EG+QS+PYV ALF
Sbjct  5    TSHHP---------LAFAFGVLGNIASFIVFLAPLPTFWRVYKKKSTEGFQSVPYVFALF  55

Query  285  SSMLWIYYAFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGF  464
            ++ +WIYYAFLKSN  LLITINSFGC++ETIYI  Y+ YA K+ARV T+ +L L+   GF
Sbjct  56   TATIWIYYAFLKSNEILLITINSFGCVIETIYIAIYLTYATKQARVSTLTLLFLVNFGGF  115

Query  465  GAVALVSQFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
              + L++ FL    P R  V+GWVC+ FS+ VF APL  +K VI
Sbjct  116  CLILLLAHFL-SQGPTRVAVLGWVCVTFSVSVFAAPLSAMKMVI  158



>ref|XP_003602778.1| Protein RUPTURED POLLEN GRAIN [Medicago truncatula]
 gb|AES73029.1| sugar efflux transporter for intercellular exchange protein [Medicago 
truncatula]
Length=311

 Score =   190 bits (482),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 87/152 (57%), Positives = 117/152 (77%), Gaps = 0/152 (0%)
 Frame = +3

Query  141  GHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLK  320
             H  FAFGVLGNI SF+ FL+PLPTFY+I KKKS EG+QSIPYV ALFS+MLW++YA+ K
Sbjct  6    SHLSFAFGVLGNISSFVCFLAPLPTFYRICKKKSTEGFQSIPYVAALFSAMLWMFYAYTK  65

Query  321  SNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFK  500
               TLLITIN+FGC++ETIY+  ++ Y  KK R+ T++M+VL+  VGFG + L++ FL K
Sbjct  66   KGETLLITINAFGCVIETIYLAVFVTYCPKKVRMSTLRMIVLMNFVGFGTIVLLTHFLAK  125

Query  501  SAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
                R +++GW+C+VF+  VF APL I++ VI
Sbjct  126  QEEGRIKLLGWICVVFATSVFAAPLSIIRVVI  157



>ref|XP_007137871.1| hypothetical protein PHAVU_009G162800g [Phaseolus vulgaris]
 gb|ESW09865.1| hypothetical protein PHAVU_009G162800g [Phaseolus vulgaris]
Length=195

 Score =   186 bits (473),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/149 (62%), Positives = 119/149 (80%), Gaps = 2/149 (1%)
 Frame = +3

Query  153  FAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNAT  332
            F FG+LGNIISF+VFL+PLPTFY+IYKKKS EG+QS+PY+VALFSSMLWIYYA +K   T
Sbjct  10   FIFGLLGNIISFMVFLAPLPTFYKIYKKKSTEGFQSLPYIVALFSSMLWIYYALVKREGT  69

Query  333  -LLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAP  509
             LLITINSFGCL+ETIY+  ++ YA  K R+ TIK+++ L + GFGA+ L++ FL K + 
Sbjct  70   LLLITINSFGCLIETIYLAIFLVYAANKTRLSTIKIILFLNVFGFGAMLLLTLFLTKGSK  129

Query  510  VRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
             R   +GW+ LVF++ VF APL I+K+VI
Sbjct  130  -RISAIGWISLVFNISVFAAPLGIMKRVI  157



>ref|XP_004138032.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Cucumis 
sativus]
 ref|XP_004161361.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Cucumis 
sativus]
 gb|KGN63458.1| hypothetical protein Csa_1G001300 [Cucumis sativus]
Length=292

 Score =   189 bits (480),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 98/157 (62%), Positives = 125/157 (80%), Gaps = 2/157 (1%)
 Frame = +3

Query  129  MALSGHWV-FAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIY  305
            MA+S   + F FG+LGNIISF+VFL+PLPTFY+IYKKKSAEGYQS+PYVVALFS+MLWIY
Sbjct  1    MAISPQTLAFVFGLLGNIISFMVFLAPLPTFYKIYKKKSAEGYQSVPYVVALFSAMLWIY  60

Query  306  YAFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVS  485
            YA LK+NAT LITINSFGC++E++YI  +I YA  K R QT K++ LL ++GFG +  ++
Sbjct  61   YALLKTNATFLITINSFGCVIESLYILLFIIYAPTKLRFQTAKVIFLLNVLGFGLMLALT  120

Query  486  QFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
              L K    R +V+GW+CLVF+L VF APL I+ +VI
Sbjct  121  LVLAKGEK-RLKVLGWICLVFNLSVFAAPLFIMGKVI  156



>ref|XP_004297511.1| PREDICTED: bidirectional sugar transporter N3 [Fragaria vesca 
subsp. vesca]
Length=310

 Score =   189 bits (481),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 118/148 (80%), Gaps = 1/148 (1%)
 Frame = +3

Query  153  FAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNAT  332
            FAFG+LGNI+SFIVFL+P+PTFY++YKKKS EG+QSIPY+ ALFS+ +WIYYA LKS+  
Sbjct  10   FAFGILGNIVSFIVFLAPVPTFYRVYKKKSTEGFQSIPYIFALFSATIWIYYASLKSDEM  69

Query  333  LLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAPV  512
            LLITIN FGC++ETIYI  YI YA KKARV T+++L+L+   GF  +  +S FL +  P 
Sbjct  70   LLITINGFGCVIETIYIAMYITYAPKKARVNTLRLLLLVNFGGFCLILFLSHFLTQ-GPT  128

Query  513  RAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            R +V+GWVC+ FS+ VF APL I++ VI
Sbjct  129  RVKVLGWVCVAFSVSVFAAPLSIMRLVI  156



>ref|XP_008239633.1| PREDICTED: bidirectional sugar transporter SWEET10 [Prunus mume]
Length=291

 Score =   189 bits (479),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/160 (56%), Positives = 127/160 (79%), Gaps = 5/160 (3%)
 Frame = +3

Query  129  MALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYY  308
            MA+      AFG+LGNIISF+VFL+P+PTFY +YK+K+AEG+Q++PYV+AL SSML+IYY
Sbjct  1    MAIQHPLTLAFGLLGNIISFLVFLAPVPTFYTVYKRKTAEGFQALPYVIALLSSMLYIYY  60

Query  309  AFL----KSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVA  476
            A L    K +AT LITINSFGC+VET+YI  +++YA KKAR+ T+ ++ LL + G+G + 
Sbjct  61   ALLKEEFKEDATFLITINSFGCVVETLYISLFLFYAPKKARISTLTLVFLLNVFGYGLMM  120

Query  477  LVSQFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            +++ FL  +  +R ++VGW+CLVFSL VFVAPL +++QVI
Sbjct  121  MLTHFL-ATGEIRLKIVGWICLVFSLSVFVAPLGVLRQVI  159



>ref|XP_007038075.1| Nodulin MtN3 family protein, putative isoform 1 [Theobroma cacao]
 gb|EOY22576.1| Nodulin MtN3 family protein, putative isoform 1 [Theobroma cacao]
Length=280

 Score =   188 bits (477),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 91/156 (58%), Positives = 121/156 (78%), Gaps = 1/156 (1%)
 Frame = +3

Query  129  MALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYY  308
            MAL   W F FGVLGN++SF+V L+PLPTFYQIYKK+++EG+QSIPYVV+LFS+MLWIYY
Sbjct  1    MALHLSWAFVFGVLGNVVSFLVSLAPLPTFYQIYKKRTSEGFQSIPYVVSLFSAMLWIYY  60

Query  309  AFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQ  488
            A LK +A LLITIN+F C ++T YI  Y YYA KK +V T+K+++L  I GFG + L S 
Sbjct  61   ALLKKDAMLLITINTFCCFIQTFYIVAYFYYAPKKEKVVTVKLILLFNIFGFGVIFL-ST  119

Query  489  FLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            F  ++   R  V+G++C+ F+L VF APLCI+++VI
Sbjct  120  FFLQNPLTRLHVLGYICMAFALSVFAAPLCILRKVI  155



>ref|XP_010250599.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Nelumbo 
nucifera]
Length=287

 Score =   188 bits (477),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 91/150 (61%), Positives = 119/150 (79%), Gaps = 1/150 (1%)
 Frame = +3

Query  147  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  326
            W F FG+LGN+ISF+V+L+PLPTF++IYKKKS EG+QS+PYVVALFS+MLWIYYAFLK +
Sbjct  10   WTFTFGLLGNLISFMVYLAPLPTFFRIYKKKSTEGFQSVPYVVALFSAMLWIYYAFLKPD  69

Query  327  ATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSA  506
            A LLITINSFGC +ET+YI  ++ YA+KK R++TIK+L+LL  VG   + L+        
Sbjct  70   AHLLITINSFGCFIETVYIVMFMIYASKKVRIETIKLLLLLN-VGTFCLILLLTLFLAHG  128

Query  507  PVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
              RAQ+VGW+C+ FS+ VF APL I++ VI
Sbjct  129  TKRAQIVGWLCVAFSVSVFAAPLSIMRLVI  158



>ref|NP_001242732.1| uncharacterized protein LOC100810962 [Glycine max]
 gb|ACU20322.1| unknown [Glycine max]
Length=258

 Score =   187 bits (474),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 92/158 (58%), Positives = 124/158 (78%), Gaps = 3/158 (2%)
 Frame = +3

Query  129  MALSGH-WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIY  305
            MA++   W F FG+LGN+ISF+VFL+ LPT YQIYKKKS +G+QS+PY+VALFSSMLWIY
Sbjct  1    MAINHETWAFIFGLLGNVISFMVFLASLPTLYQIYKKKSTDGFQSLPYIVALFSSMLWIY  60

Query  306  YAFLKSNAT-LLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALV  482
            YA +K +A+ LLITINSFGC++ETIY+  ++ YA  K R+ TIK+L++L + GFGA+ L+
Sbjct  61   YALVKKDASLLLITINSFGCVIETIYLAIFLIYAPSKTRLWTIKLLLMLNVFGFGAM-LL  119

Query  483  SQFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            S     +   R  V+GW+CLV ++ VF APLCI+K+VI
Sbjct  120  STLYLTTGSKRLSVIGWICLVLNISVFAAPLCIMKRVI  157



>emb|CDP21120.1| unnamed protein product, partial [Coffea canephora]
Length=264

 Score =   186 bits (472),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/135 (67%), Positives = 111/135 (82%), Gaps = 1/135 (1%)
 Frame = +3

Query  192  VFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNATLLITINSFGCLVE  371
            +FL+P+PTFYQIYKKKS EG+QSIPYV+ALFS+MLWIYYAFLK   T LITINSFGC +E
Sbjct  1    MFLAPVPTFYQIYKKKSTEGFQSIPYVIALFSAMLWIYYAFLKPKTTFLITINSFGCFIE  60

Query  372  TIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAPVRAQVVGWVCLVFS  551
            TIYI  +++Y  KKARV+T+K+LVLL+  GFG   L++ FL K +  R ++VGW+CLVF+
Sbjct  61   TIYICLFLFYTTKKARVETVKLLVLLLACGFGLNVLLTHFLAKDS-TRVRIVGWICLVFA  119

Query  552  LCVFVAPLCIVKQVI  596
            L VFVAPL IV QVI
Sbjct  120  LLVFVAPLRIVIQVI  134



>ref|XP_009412768.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Musa 
acuminata subsp. malaccensis]
Length=284

 Score =   186 bits (473),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/157 (57%), Positives = 123/157 (78%), Gaps = 1/157 (1%)
 Frame = +3

Query  126  SMALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIY  305
             ++L     FAFG+LGN+ISF+VFL+P+PTFY++Y+KKS EG+ S+PYVVALFS MLWIY
Sbjct  3    GLSLQHPLPFAFGMLGNLISFMVFLAPIPTFYRVYRKKSTEGFHSVPYVVALFSCMLWIY  62

Query  306  YAFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVS  485
            YAF+K+N+ LLITINSFG  +ETIYI  Y+ YA KKAR+  I++ VLL +V F A+ L++
Sbjct  63   YAFVKTNSMLLITINSFGLFIETIYITIYLIYAPKKARIFCIQIFVLLDVVAFAAIVLLT  122

Query  486  QFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            Q +FK +  R  V+GW+C+ FS+ VF APL +++ VI
Sbjct  123  QLVFKGSN-RVTVLGWICVGFSISVFAAPLSVIRLVI  158



>ref|XP_008239523.1| PREDICTED: bidirectional sugar transporter N3 [Prunus mume]
Length=296

 Score =   187 bits (474),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/149 (60%), Positives = 121/149 (81%), Gaps = 1/149 (1%)
 Frame = +3

Query  150  VFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNA  329
            V AFG+LGN++SF+VFL+P+PTF++IYKKKS EG+QS+PYV ALFS+M+WIYYAFLKS+ 
Sbjct  11   VIAFGILGNVVSFVVFLAPVPTFWRIYKKKSTEGFQSVPYVFALFSAMIWIYYAFLKSDE  70

Query  330  TLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAP  509
             LLITIN+FGC++ETIYI  YI YA K+ARV  +++L+L+   GF  + L+S FL +  P
Sbjct  71   FLLITINAFGCIIETIYISMYITYAPKQARVFALRLLLLVNFGGFCLILLLSHFLAQ-GP  129

Query  510  VRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
             R +V+GWVC+ FS+ VF APL I++ VI
Sbjct  130  TRVEVLGWVCVAFSVSVFAAPLSIMRVVI  158



>ref|XP_003526939.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Glycine 
max]
Length=309

 Score =   187 bits (475),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 86/151 (57%), Positives = 117/151 (77%), Gaps = 0/151 (0%)
 Frame = +3

Query  144  HWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKS  323
            H  FAFG+LGNI SF+ FL+PLPTFY++ KKKS EG+QSIPYV ALFS+MLWI+YA++K+
Sbjct  5    HLSFAFGILGNIASFVCFLAPLPTFYRVCKKKSTEGFQSIPYVAALFSAMLWIFYAYVKT  64

Query  324  NATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKS  503
              TLLITIN+FGC++ETIY+  +I Y  KKAR+ T++M+VLL   GF  + L++  L K 
Sbjct  65   GETLLITINAFGCVIETIYLAVFITYCPKKARMSTLRMIVLLNFGGFCTIVLLTHLLAKG  124

Query  504  APVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
               R +++GW+C+VF+  VF APL I++ VI
Sbjct  125  EEARVKLLGWICVVFATSVFAAPLSIIRVVI  155



>gb|KJB19799.1| hypothetical protein B456_003G119400 [Gossypium raimondii]
Length=278

 Score =   186 bits (472),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/156 (57%), Positives = 122/156 (78%), Gaps = 1/156 (1%)
 Frame = +3

Query  129  MALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYY  308
            MAL   W F FG+LGN++SF+V L+PLPTFYQIYKK+++EGYQSIPYVV+LFS+MLWIYY
Sbjct  1    MALHVSWAFVFGILGNVVSFLVSLAPLPTFYQIYKKRTSEGYQSIPYVVSLFSAMLWIYY  60

Query  309  AFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQ  488
            A LK +A LLITIN+F   ++T YI  Y YY  KK ++ T+K+++L  + GFGA+   S 
Sbjct  61   ALLKKDAMLLITINTFCVFIQTFYIVVYFYYGPKKEKLVTLKLILLFNVFGFGAI-FFST  119

Query  489  FLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            F  K+  +R Q++G++C+ F+LCVFVAPL I+++VI
Sbjct  120  FFLKNPLIRLQILGYICMGFALCVFVAPLGILRKVI  155



>gb|KHN23961.1| Bidirectional sugar transporter SWEET12 [Glycine soja]
Length=309

 Score =   187 bits (474),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 86/151 (57%), Positives = 117/151 (77%), Gaps = 0/151 (0%)
 Frame = +3

Query  144  HWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKS  323
            H  FAFG+LGNI SF+ FL+PLPTFY++ KKKS EG+QSIPYV ALFS+MLWI+YA++K+
Sbjct  5    HLSFAFGILGNIASFVCFLAPLPTFYRVCKKKSTEGFQSIPYVAALFSAMLWIFYAYVKT  64

Query  324  NATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKS  503
              TLLITIN+FGC++ETIY+  +I Y  KKAR+ T++M+VLL   GF  + L++  L K 
Sbjct  65   GETLLITINAFGCVIETIYLAVFITYCPKKARMSTLRMIVLLNFGGFCTIVLLTHLLAKG  124

Query  504  APVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
               R +++GW+C+VF+  VF APL I++ VI
Sbjct  125  EEARVKLLGWICVVFATSVFAAPLSIIRVVI  155



>gb|KFK27668.1| hypothetical protein AALP_AA8G413300 [Arabis alpina]
Length=288

 Score =   186 bits (472),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 89/150 (59%), Positives = 120/150 (80%), Gaps = 1/150 (1%)
 Frame = +3

Query  147  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  326
            W F FG+LGN+ISF VFLSP+PTFY+I+KKK+ EG+QS+PYVVALFS+MLW+YYA  K +
Sbjct  10   WAFVFGMLGNLISFAVFLSPVPTFYRIWKKKTTEGFQSLPYVVALFSAMLWLYYATQKKD  69

Query  327  ATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSA  506
              LL+TINSFGC +ETIYI  +I +ANKKAR+ T+K+L+L+   GF  + L+ QFL K +
Sbjct  70   VFLLVTINSFGCFIETIYISIFIAFANKKARMLTVKLLLLMNFGGFCLILLLCQFLAKGS  129

Query  507  PVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
              RA+++G +C+ FS+CVF APL I++ VI
Sbjct  130  -TRAKIIGGICVGFSVCVFAAPLSIIRTVI  158



>ref|XP_010093933.1| Bidirectional sugar transporter SWEET10 [Morus notabilis]
 gb|EXB54896.1| Bidirectional sugar transporter SWEET10 [Morus notabilis]
Length=295

 Score =   186 bits (472),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 92/156 (59%), Positives = 127/156 (81%), Gaps = 1/156 (1%)
 Frame = +3

Query  129  MALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYY  308
            MA   +   AFG+LGNI+SF+VFL+P+PTF++IYKKKSAEG+QS+PYV+AL SSMLWIYY
Sbjct  1    MASHHYLTLAFGLLGNIVSFMVFLAPIPTFHKIYKKKSAEGFQSLPYVIALLSSMLWIYY  60

Query  309  AFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQ  488
            A LK +A LLITINS GC++ET+YI  +++YA KK R++T+K+L++L +VG+G + +++ 
Sbjct  61   ALLKKDALLLITINSVGCVIETVYIALFLFYAPKKTRIETVKLLLMLNVVGYGLMLVLTI  120

Query  489  FLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            FL +    R Q VGW+CL F+L VF APLCI++QVI
Sbjct  121  FLAEGEK-RLQAVGWICLAFNLSVFAAPLCIMRQVI  155



>emb|CDY70861.1| BnaCnng70080D, partial [Brassica napus]
Length=194

 Score =   182 bits (463),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 88/153 (58%), Positives = 119/153 (78%), Gaps = 1/153 (1%)
 Frame = +3

Query  138  SGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFL  317
               W FAFG+LGNIISF VFLSP+PTFY+I+KKK+ E +QS+PYVVALFS+MLW+YYA  
Sbjct  7    QNTWAFAFGLLGNIISFAVFLSPVPTFYRIWKKKTTEDFQSLPYVVALFSAMLWLYYATQ  66

Query  318  KSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLF  497
            K +  LL+TINSFGC +ETIYI  ++ +A KKAR+ T+K+L+L+   GF  + L+ QFL 
Sbjct  67   KKDVFLLVTINSFGCFIETIYIAIFVAFATKKARMLTVKLLLLMNFGGFCLILLLCQFLA  126

Query  498  KSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            K +  RA+++G +C+ FS+CVF APL I++ VI
Sbjct  127  KGS-TRAKIIGGICVGFSVCVFAAPLSIIRTVI  158



>ref|XP_006288378.1| hypothetical protein CARUB_v10001629mg [Capsella rubella]
 gb|EOA21276.1| hypothetical protein CARUB_v10001629mg [Capsella rubella]
Length=287

 Score =   186 bits (471),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 89/150 (59%), Positives = 119/150 (79%), Gaps = 1/150 (1%)
 Frame = +3

Query  147  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  326
            W F FG+LGN+ISF VFLSP+PTFY+I KKK+ EG+QSIPYVVALFS+MLW+YYA  K +
Sbjct  10   WAFVFGLLGNLISFAVFLSPVPTFYRICKKKTTEGFQSIPYVVALFSAMLWLYYATQKKD  69

Query  327  ATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSA  506
              LL+TINSFGC +ETIYI  ++ +A K AR+ T+K+L+L+ + GF A+ L+ QFL K A
Sbjct  70   VFLLVTINSFGCFIETIYISIFLAFATKNARMLTVKLLLLMNVGGFCAILLLCQFLAKGA  129

Query  507  PVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
              RA+++G +C+ FS+CVF APL I++ VI
Sbjct  130  -TRAKIIGGICVGFSVCVFAAPLSIIRTVI  158



>ref|XP_008392764.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Malus 
domestica]
Length=283

 Score =   185 bits (469),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 87/142 (61%), Positives = 114/142 (80%), Gaps = 1/142 (1%)
 Frame = +3

Query  171  GNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNATLLITIN  350
            GNI+SFIVFL+PLPTF+++YKKKS EG+QS+PYV ALFS+M+WIYYAFLKS+  LLITIN
Sbjct  3    GNIVSFIVFLAPLPTFWRVYKKKSTEGFQSVPYVFALFSAMIWIYYAFLKSHVILLITIN  62

Query  351  SFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAPVRAQVVG  530
            SFGC++ETIYI  Y+ YA K ARV T+++L+L+   GF  + L+S FL    P R +V+G
Sbjct  63   SFGCVIETIYIAIYLTYATKHARVSTLRLLLLVNFGGFCLILLLSHFL-SQGPTRVEVLG  121

Query  531  WVCLVFSLCVFVAPLCIVKQVI  596
            WVC+ FS+ VF APL +++ VI
Sbjct  122  WVCVTFSVSVFAAPLSVMRMVI  143



>gb|KJB07961.1| hypothetical protein B456_001G055600 [Gossypium raimondii]
Length=280

 Score =   185 bits (469),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 88/156 (56%), Positives = 119/156 (76%), Gaps = 1/156 (1%)
 Frame = +3

Query  129  MALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYY  308
            MAL   WVF FG+LGN++SF+V LSPLPTFYQIYKKK++EG+QS+PYVV+LFS+MLWIYY
Sbjct  1    MALHLSWVFVFGILGNVVSFMVSLSPLPTFYQIYKKKTSEGFQSLPYVVSLFSAMLWIYY  60

Query  309  AFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQ  488
            A LK +A LLITIN+F C +++ YI  Y YY  KK +++T+K+++L  + GFG V   + 
Sbjct  61   ALLKKDAMLLITINTFCCFIQSFYIVTYFYYGRKKEKLETVKLMLLFNVFGFGLVFFSTY  120

Query  489  FLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            FL      R  ++G++C+ FSL VF APL IV++VI
Sbjct  121  FLHNPM-TRLHILGYICMGFSLSVFAAPLAIVRKVI  155



>gb|KHG27148.1| Bidirectional sugar transporter SWEET10 -like protein [Gossypium 
arboreum]
Length=278

 Score =   184 bits (467),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 89/156 (57%), Positives = 121/156 (78%), Gaps = 1/156 (1%)
 Frame = +3

Query  129  MALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYY  308
            MAL   W F FG+LGN++SF+V L+PLPTFYQIYKK+++EGYQSIPYVV+LFS+MLWIYY
Sbjct  1    MALHVSWAFVFGILGNVVSFLVSLAPLPTFYQIYKKRTSEGYQSIPYVVSLFSAMLWIYY  60

Query  309  AFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQ  488
            A LK +A LLITIN+F   ++T YI  Y YY  KK ++ T+K+++L  + GFG V   S 
Sbjct  61   ALLKKDAMLLITINTFCVFIQTFYIVVYFYYGPKKEKLVTLKLILLFNVFGFG-VIFFST  119

Query  489  FLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            F  K+  +R Q++G++C+ F+LCVFVAPL I+++VI
Sbjct  120  FFLKNPLIRLQILGYICMGFALCVFVAPLGILRKVI  155



>ref|XP_006366912.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Solanum 
tuberosum]
Length=276

 Score =   184 bits (467),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/157 (55%), Positives = 123/157 (78%), Gaps = 1/157 (1%)
 Frame = +3

Query  126  SMALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIY  305
            S++ +   VF FG+LGN++SF+VF++P+PTFY+I KKKS+EG+ S+PYVV LFS+MLWIY
Sbjct  3    SVSHTHPLVFTFGILGNLVSFMVFIAPVPTFYRIVKKKSSEGFHSLPYVVGLFSAMLWIY  62

Query  306  YAFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVS  485
            YA +K+N TLLITINSFGC+ ETIY+  Y  YA KKAR++T+ +++LL    FG +  ++
Sbjct  63   YAMVKTNVTLLITINSFGCIAETIYVAIYFTYATKKARMKTLGLVLLLNFGVFGLILFLT  122

Query  486  QFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            Q L +    RA+V+GW+C+ FS+ VFVAPL I+ +VI
Sbjct  123  QILCQGTK-RAEVIGWICMAFSISVFVAPLSIMGRVI  158



>ref|XP_002453892.1| hypothetical protein SORBIDRAFT_04g021000 [Sorghum bicolor]
 gb|EES06868.1| hypothetical protein SORBIDRAFT_04g021000 [Sorghum bicolor]
Length=336

 Score =   186 bits (471),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/150 (60%), Positives = 114/150 (76%), Gaps = 1/150 (1%)
 Frame = +3

Query  147  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  326
            W F FG+LGNIIS +VFLSPLPTFY++Y+KKS EG+QS PYVV LFS MLWI+YA LKS 
Sbjct  11   WAFTFGILGNIISLMVFLSPLPTFYRVYRKKSTEGFQSTPYVVTLFSCMLWIFYALLKSG  70

Query  327  ATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSA  506
            A LL+TIN  GC++ET+Y+G Y+ YA K ARV T KML+ L +  FG VALV+  L    
Sbjct  71   AELLVTINGVGCVIETVYLGMYLLYAPKAARVLTAKMLLGLNVGVFGLVALVTMVLSNGG  130

Query  507  PVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
             +R +V+GW+C+  +L VF APL I++QVI
Sbjct  131  -LRVKVLGWICVSVALSVFAAPLSIMRQVI  159



>ref|XP_006436901.1| hypothetical protein CICLE_v10032313mg [Citrus clementina]
 gb|ESR50141.1| hypothetical protein CICLE_v10032313mg [Citrus clementina]
Length=285

 Score =   184 bits (467),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 91/150 (61%), Positives = 126/150 (84%), Gaps = 0/150 (0%)
 Frame = +3

Query  147  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  326
            WVFAFG+LGNI+SFIVFL+P+PTFY++ KKKS EG+QS+PYVVALFS+MLWIYYA +K +
Sbjct  10   WVFAFGLLGNIVSFIVFLAPMPTFYRVCKKKSTEGFQSLPYVVALFSAMLWIYYAMMKKD  69

Query  327  ATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSA  506
            A LLITIN+FGC++ETIY+  YI +A K+AR+ T+++L+LL   GFG++ L+S FL K +
Sbjct  70   AFLLITINAFGCVIETIYLALYITFAPKQARLYTLRLLLLLNFGGFGSILLLSHFLAKGS  129

Query  507  PVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
              R +++GW+C+VFS+ VF APL I++ V+
Sbjct  130  AARLRLLGWICVVFSVSVFAAPLSIMRLVV  159



>ref|XP_011020821.1| PREDICTED: bidirectional sugar transporter N3-like [Populus euphratica]
Length=285

 Score =   184 bits (467),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/151 (58%), Positives = 117/151 (77%), Gaps = 1/151 (1%)
 Frame = +3

Query  144  HWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKS  323
            H  F FG+LGNIIS +VFL+P+PTF +I+KKKS E +QS+PY++ALFSSMLW+YYA LK 
Sbjct  8    HLAFTFGILGNIISTMVFLAPVPTFIRIFKKKSTEDFQSLPYLMALFSSMLWLYYAMLKK  67

Query  324  NATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKS  503
            +  LL+TINSFGCL+ET YI  YI YA +++RV TIK+L+ + +  F  + L++ FL  S
Sbjct  68   DTILLVTINSFGCLIETTYIAIYIVYATRESRVSTIKLLISMNMGLFSLILLLAHFLV-S  126

Query  504  APVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
              VR +V+GW+C+  S+CVF APL I+KQVI
Sbjct  127  GSVRVKVLGWLCVALSVCVFAAPLNILKQVI  157



>ref|XP_006347653.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Solanum 
tuberosum]
Length=276

 Score =   184 bits (466),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/157 (55%), Positives = 123/157 (78%), Gaps = 1/157 (1%)
 Frame = +3

Query  126  SMALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIY  305
            S++ +   VF FG+LGN++SF+VF++P+PTFY+I KKKS+EG+ S+PYVV LFS+MLWIY
Sbjct  3    SVSHTHPLVFTFGILGNLVSFMVFIAPVPTFYRIVKKKSSEGFHSLPYVVGLFSAMLWIY  62

Query  306  YAFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVS  485
            YA +K+N TLLITINSFGC+ ETIY+  Y  YA KKAR++T+ +++LL    FG +  ++
Sbjct  63   YAMVKTNVTLLITINSFGCIAETIYVAIYFTYATKKARMKTLGLVLLLNFGVFGLILFLT  122

Query  486  QFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            Q L +    RA+V+GW+C+ FS+ VFVAPL I+ +VI
Sbjct  123  QILCQGTK-RAEVIGWICMAFSISVFVAPLSIMGRVI  158



>ref|NP_001241307.1| uncharacterized protein LOC100810946 [Glycine max]
 gb|ACU19376.1| unknown [Glycine max]
 gb|KHN17481.1| Bidirectional sugar transporter SWEET13 [Glycine soja]
Length=257

 Score =   183 bits (465),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 94/151 (62%), Positives = 122/151 (81%), Gaps = 2/151 (1%)
 Frame = +3

Query  147  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  326
            W F FGV+GNIISF VFL+PLPTFYQIYKKKS EG+QS+PYVVALFS+MLWIYYAF+K  
Sbjct  8    WAFVFGVMGNIISFGVFLAPLPTFYQIYKKKSTEGFQSLPYVVALFSAMLWIYYAFVKRE  67

Query  327  AT-LLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKS  503
            A  LLITIN+FG +VE+IY+  ++ YA +K R+ TIK+L+LL + GFGA+ L + +L K 
Sbjct  68   AALLLITINTFGIVVESIYLAIFLLYAPRKPRLTTIKLLLLLNVFGFGAMLLSTLYLSKG  127

Query  504  APVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            A  R  ++GW+CLVF++ VF APL I+++VI
Sbjct  128  AK-RLAIIGWICLVFNISVFAAPLFIIRRVI  157



>ref|XP_002442119.1| hypothetical protein SORBIDRAFT_08g014040 [Sorghum bicolor]
 gb|EES15957.1| hypothetical protein SORBIDRAFT_08g014040 [Sorghum bicolor]
Length=302

 Score =   184 bits (468),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/156 (58%), Positives = 122/156 (78%), Gaps = 1/156 (1%)
 Frame = +3

Query  129  MALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYY  308
            ++L   W FAFG+LGN+ISF+ FL+P+PTFY+IYK KS EG+QS+PYVVALFS+MLWI+Y
Sbjct  4    LSLQHPWAFAFGLLGNVISFLTFLAPIPTFYRIYKSKSTEGFQSVPYVVALFSAMLWIFY  63

Query  309  AFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQ  488
            A +KSN T LITIN+ GC++ETIYI  Y  YA KKA++ T K+++LL +  FG + LV+ 
Sbjct  64   ALIKSNETFLITINAAGCVIETIYIVMYFVYAPKKAKLFTAKIMLLLNVGVFGVILLVTL  123

Query  489  FLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
             LFK    R  ++GW+C+ FS+ VFVAPL I+++VI
Sbjct  124  LLFKGDK-RVVMLGWICVGFSVSVFVAPLSIMRRVI  158



>gb|KHN24976.1| Bidirectional sugar transporter N3 [Glycine soja]
Length=272

 Score =   183 bits (465),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 90/157 (57%), Positives = 118/157 (75%), Gaps = 2/157 (1%)
 Frame = +3

Query  129  MALSGHWV-FAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIY  305
            MA++ H + F FG+LGN+ISF+VFL+P+PTFY+IYKKKS E +QS+PY+VALFSSMLW+Y
Sbjct  1    MAITHHTLAFTFGMLGNVISFLVFLAPVPTFYRIYKKKSTESFQSLPYLVALFSSMLWLY  60

Query  306  YAFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVS  485
            YA LK +A LLITINSFGC++E IYI  YI YA + AR  TIK+   + +  F  + LV+
Sbjct  61   YALLKRDAVLLITINSFGCVIEIIYIVLYITYATRDARNLTIKLFSAMNMTSFAVILLVT  120

Query  486  QFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
             F     P+R QV+GW+C+  S+ VF APL IV QV+
Sbjct  121  HFGVH-GPLRVQVLGWICVSISVSVFAAPLSIVAQVV  156



>ref|NP_190443.1| bidirectional sugar transporter SWEET11 [Arabidopsis thaliana]
 sp|Q9SMM5.1|SWT11_ARATH RecName: Full=Bidirectional sugar transporter SWEET11; Short=AtSWEET11 
[Arabidopsis thaliana]
 gb|AAK32837.1|AF361825_1 AT3g48740/T8P19_250 [Arabidopsis thaliana]
 gb|AAL31891.1|AF419559_1 AT3g48740/T8P19_250 [Arabidopsis thaliana]
 emb|CAB62363.1| MTN3-like protein [Arabidopsis thaliana]
 gb|AAL49908.1| putative MTN3 protein [Arabidopsis thaliana]
 gb|AAL77742.1| AT3g48740/T8P19_250 [Arabidopsis thaliana]
 gb|AAM20244.1| putative MTN3 protein [Arabidopsis thaliana]
 gb|AEE78451.1| bidirectional sugar transporter SWEET11 [Arabidopsis thaliana]
Length=289

 Score =   184 bits (466),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/150 (59%), Positives = 118/150 (79%), Gaps = 1/150 (1%)
 Frame = +3

Query  147  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  326
            W F FG+LGN+ISF VFLSP+PTFY+I+KKK+ EG+QSIPYVVALFS+ LW+YYA  K +
Sbjct  10   WAFVFGLLGNLISFAVFLSPVPTFYRIWKKKTTEGFQSIPYVVALFSATLWLYYATQKKD  69

Query  327  ATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSA  506
              LL+TIN+FGC +ETIYI  ++ YA K AR+ T+KML+L+   GF A+ L+ QFL K A
Sbjct  70   VFLLVTINAFGCFIETIYISMFLAYAPKPARMLTVKMLLLMNFGGFCAILLLCQFLVKGA  129

Query  507  PVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
              RA+++G +C+ FS+CVF APL I++ VI
Sbjct  130  -TRAKIIGGICVGFSVCVFAAPLSIIRTVI  158



>ref|XP_007038076.1| Nodulin MtN3 family protein, putative isoform 2 [Theobroma cacao]
 gb|EOY22577.1| Nodulin MtN3 family protein, putative isoform 2 [Theobroma cacao]
Length=281

 Score =   183 bits (465),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 91/157 (58%), Positives = 121/157 (77%), Gaps = 2/157 (1%)
 Frame = +3

Query  129  MALSGHWVFAFGVL-GNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIY  305
            MAL   W F FGVL GN++SF+V L+PLPTFYQIYKK+++EG+QSIPYVV+LFS+MLWIY
Sbjct  1    MALHLSWAFVFGVLVGNVVSFLVSLAPLPTFYQIYKKRTSEGFQSIPYVVSLFSAMLWIY  60

Query  306  YAFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVS  485
            YA LK +A LLITIN+F C ++T YI  Y YYA KK +V T+K+++L  I GFG + L S
Sbjct  61   YALLKKDAMLLITINTFCCFIQTFYIVAYFYYAPKKEKVVTVKLILLFNIFGFGVIFL-S  119

Query  486  QFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
             F  ++   R  V+G++C+ F+L VF APLCI+++VI
Sbjct  120  TFFLQNPLTRLHVLGYICMAFALSVFAAPLCILRKVI  156



>gb|KJB51264.1| hypothetical protein B456_008G209000 [Gossypium raimondii]
Length=193

 Score =   181 bits (458),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/156 (56%), Positives = 120/156 (77%), Gaps = 1/156 (1%)
 Frame = +3

Query  129  MALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYY  308
            MAL   WVF FG+LGN +SF+V L+PLPTFYQIYKKK++EG+QSIPYVV+LFS+MLWIYY
Sbjct  1    MALHLSWVFVFGILGNAVSFMVSLAPLPTFYQIYKKKTSEGFQSIPYVVSLFSAMLWIYY  60

Query  309  AFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQ  488
            A LK +A  LITIN+F   ++T YI  Y YY  KK ++ T+K+++L  + GFG + L + 
Sbjct  61   ALLKKDAIFLITINTFCVFIQTFYIVTYFYYGPKKEKIVTVKLMLLFNVFGFGVIFLATY  120

Query  489  FLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            FL K+  +R  ++G++C+ F+L VFVAPL IV++VI
Sbjct  121  FL-KNPSLRLLILGYICMAFALAVFVAPLAIVRKVI  155



>ref|XP_002443167.1| hypothetical protein SORBIDRAFT_08g013840 [Sorghum bicolor]
 gb|EES17005.1| hypothetical protein SORBIDRAFT_08g013840 [Sorghum bicolor]
Length=302

 Score =   184 bits (466),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 90/157 (57%), Positives = 122/157 (78%), Gaps = 1/157 (1%)
 Frame = +3

Query  126  SMALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIY  305
             ++L   W FAFG+LGN+ISF+ FL+P+PTFY+IYK KS EG+QS+PYVVALFS+MLWI+
Sbjct  3    GLSLQHPWAFAFGLLGNLISFLTFLAPIPTFYRIYKTKSTEGFQSVPYVVALFSAMLWIF  62

Query  306  YAFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVS  485
            YA +KSN T LITIN+ GC++ETIYI  Y  YA KKA++ T K+++LL +  FG + LV+
Sbjct  63   YALIKSNETFLITINAAGCVIETIYIVMYFVYAPKKAKLFTAKIMLLLNVGVFGVILLVT  122

Query  486  QFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
              LFK    R  ++GW+C+ FS+ VFVAPL I+++VI
Sbjct  123  LLLFKGDK-RVVMLGWICVGFSVSVFVAPLSIMRRVI  158



>ref|XP_009150896.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Brassica 
rapa]
Length=288

 Score =   183 bits (465),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/150 (59%), Positives = 119/150 (79%), Gaps = 1/150 (1%)
 Frame = +3

Query  147  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  326
            W FAFG+LGNIISF VFLSP+PTFY+I+KKK+ E +QS+PYVVALFS+MLW+YYA  K +
Sbjct  10   WAFAFGLLGNIISFAVFLSPVPTFYRIWKKKTTEDFQSLPYVVALFSAMLWLYYATQKKD  69

Query  327  ATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSA  506
              LL+TINSFGC +ETIYI  ++ +A KKAR+ T+K+L+L+   GF  + L+ QFL K +
Sbjct  70   VFLLVTINSFGCFIETIYIAIFVAFATKKARMLTVKLLLLMNFGGFCLILLLCQFLAKGS  129

Query  507  PVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
              RA+++G +C+ FS+CVF APL I++ VI
Sbjct  130  -TRAKIIGGICVGFSVCVFAAPLSIIRTVI  158



>emb|CDX88041.1| BnaA06g26320D [Brassica napus]
Length=288

 Score =   183 bits (465),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/150 (59%), Positives = 119/150 (79%), Gaps = 1/150 (1%)
 Frame = +3

Query  147  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  326
            W FAFG+LGNIISF VFLSP+PTFY+I+KKK+ E +QS+PYVVALFS+MLW+YYA  K +
Sbjct  10   WAFAFGLLGNIISFAVFLSPVPTFYRIWKKKTTEDFQSLPYVVALFSAMLWLYYATQKKD  69

Query  327  ATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSA  506
              LL+TINSFGC +ETIYI  ++ +A KKAR+ T+K+L+L+   GF  + L+ QFL K +
Sbjct  70   VFLLVTINSFGCFIETIYIAIFVAFATKKARMLTVKLLLLMNFGGFCLILLLCQFLAKGS  129

Query  507  PVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
              RA+++G +C+ FS+CVF APL I++ VI
Sbjct  130  -TRAKIIGGICVGFSVCVFAAPLSIIRTVI  158



>ref|XP_003532478.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Glycine 
max]
 gb|KHN16865.1| Bidirectional sugar transporter SWEET13 [Glycine soja]
Length=254

 Score =   182 bits (462),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 94/151 (62%), Positives = 122/151 (81%), Gaps = 2/151 (1%)
 Frame = +3

Query  147  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLK-S  323
            W F FGV+GNIISF VFL+PLPTFYQIYKKKS EG+QS+PYVVALFS+MLWIYYAF+K  
Sbjct  8    WAFVFGVMGNIISFGVFLAPLPTFYQIYKKKSTEGFQSLPYVVALFSAMLWIYYAFVKRE  67

Query  324  NATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKS  503
             A LLITIN+FG +VE+IY+  ++ YA +K R+ TIK+L+LL + GFGA+ L + +L K 
Sbjct  68   TALLLITINTFGIVVESIYLSIFLIYAPRKPRLTTIKLLLLLNVFGFGAMLLSTLYLSKG  127

Query  504  APVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            A  R  ++GW+CLVF++ VF APL I+++VI
Sbjct  128  AK-RLAIIGWICLVFNISVFAAPLFIIRRVI  157



>ref|XP_006663471.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Oryza 
brachyantha]
Length=310

 Score =   184 bits (466),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 95/156 (61%), Positives = 120/156 (77%), Gaps = 1/156 (1%)
 Frame = +3

Query  129  MALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYY  308
            M+L   W FAFG+LGNIISF+ +L+PLPTFY+IYK KS +G+QSIPYVVALFS+MLWIYY
Sbjct  4    MSLQHPWAFAFGLLGNIISFMTYLAPLPTFYRIYKSKSTQGFQSIPYVVALFSAMLWIYY  63

Query  309  AFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQ  488
            A LKS+  LLITINS GC++ET+YI  Y+ YA KKARV T ++L LLV VG   + L+  
Sbjct  64   ALLKSDECLLITINSAGCVIETLYIAVYLVYAPKKARVFTARLL-LLVNVGVFGLILLLT  122

Query  489  FLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
             L  + P R  V+GWVC+ FS+ VFVAPL I++ V+
Sbjct  123  LLLSAGPRRVVVLGWVCVGFSVSVFVAPLSIMRLVV  158



>ref|XP_004235470.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Solanum 
lycopersicum]
Length=276

 Score =   182 bits (463),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 86/157 (55%), Positives = 123/157 (78%), Gaps = 1/157 (1%)
 Frame = +3

Query  126  SMALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIY  305
            S++ +   V+ FG+LGN++SF+VF++P+PTFY+I KKKS+EG+ S+PYVV LFS+MLWIY
Sbjct  3    SVSHTHPLVYTFGILGNLVSFMVFIAPVPTFYRIVKKKSSEGFHSLPYVVGLFSAMLWIY  62

Query  306  YAFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVS  485
            YA +K+N TLLITINSFGC+ ETIY+  Y  YA KKAR++T+ +++LL    FG +  ++
Sbjct  63   YAMVKTNVTLLITINSFGCIAETIYVAIYFTYATKKARMKTLGLVLLLNFGVFGLILFLT  122

Query  486  QFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            Q L +    RA+V+GW+C+ FS+ VFVAPL I+ +VI
Sbjct  123  QILCQGTK-RAEVIGWICMAFSISVFVAPLSIMGRVI  158



>ref|XP_011023930.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Populus 
euphratica]
Length=276

 Score =   182 bits (463),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 89/157 (57%), Positives = 122/157 (78%), Gaps = 1/157 (1%)
 Frame = +3

Query  126  SMALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIY  305
            S ++   W+F FG+LGN +SF+VFL+P+PTF +I +KKS EG+QS+PYVVALFS+M+W+Y
Sbjct  3    SFSIHCPWIFTFGLLGNFVSFVVFLAPIPTFSRICRKKSTEGFQSLPYVVALFSAMIWLY  62

Query  306  YAFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVS  485
            YA LKS+A LLITINS GC +E IYI  Y+ YA K+AR+ T+++L+LL   GF AV L+S
Sbjct  63   YASLKSDALLLITINSVGCFIEIIYIALYVAYAPKQARIATLRILILLNFGGFCAVLLLS  122

Query  486  QFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
             F  K +  R +V+GWVC++FS+ VF APL I++ VI
Sbjct  123  HFFVKGSN-RVKVLGWVCVIFSVSVFAAPLSIMRIVI  158



>ref|XP_010421173.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Camelina 
sativa]
Length=289

 Score =   182 bits (463),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 87/150 (58%), Positives = 118/150 (79%), Gaps = 1/150 (1%)
 Frame = +3

Query  147  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  326
            W F FG+LGN+ISF VFLSP+PTFY+I KKK+ EG+QS+PYVVALFS+ LW+YYA  K +
Sbjct  10   WAFVFGLLGNVISFAVFLSPVPTFYRICKKKTTEGFQSLPYVVALFSATLWLYYATQKKD  69

Query  327  ATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSA  506
              LL+TIN FGC +ETIYI  ++ +A KKAR+ T+K+L+L+ + GF A+ L+ QFL K A
Sbjct  70   VFLLVTINCFGCFIETIYISIFVAFATKKARMLTVKLLLLMNVGGFCAILLLCQFLTKGA  129

Query  507  PVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
              RA+++G +C+ FS+CVF APL I++ VI
Sbjct  130  -TRAKIIGGICVGFSVCVFAAPLSIIRTVI  158



>ref|XP_006394628.1| hypothetical protein EUTSA_v10004719mg [Eutrema salsugineum]
 gb|ESQ31914.1| hypothetical protein EUTSA_v10004719mg [Eutrema salsugineum]
Length=288

 Score =   182 bits (463),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 88/150 (59%), Positives = 119/150 (79%), Gaps = 1/150 (1%)
 Frame = +3

Query  147  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  326
            W FAFG+LGN+ISF VFLSP+PTFY+I+KKK+ EG+QS+PYVVALFS+MLW+YYA  K +
Sbjct  10   WAFAFGLLGNLISFAVFLSPVPTFYRIWKKKTTEGFQSLPYVVALFSAMLWLYYATQKKD  69

Query  327  ATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSA  506
              LL+TINSFGC +ETIYI  ++ +A KKAR+ T+K+L+L+   GF  + L+ QFL K  
Sbjct  70   VFLLVTINSFGCFIETIYIAIFVAFAPKKARMFTVKLLLLMNFGGFCLILLLCQFLAKGT  129

Query  507  PVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
              RA+++G +C+ FS+CVF APL I++ VI
Sbjct  130  -TRAKIIGGICVGFSVCVFAAPLSIIRTVI  158



>ref|XP_006404221.1| hypothetical protein EUTSA_v10010591mg [Eutrema salsugineum]
 gb|ESQ45674.1| hypothetical protein EUTSA_v10010591mg [Eutrema salsugineum]
Length=291

 Score =   182 bits (463),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 85/150 (57%), Positives = 118/150 (79%), Gaps = 1/150 (1%)
 Frame = +3

Query  147  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  326
            W F FG++GN+ISF VFLSP+PTFY+++KKK+ EG+QS+PYVVALFS+ LW+YYA  K +
Sbjct  10   WAFVFGLMGNVISFAVFLSPVPTFYRVWKKKTTEGFQSLPYVVALFSATLWLYYATQKKD  69

Query  327  ATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSA  506
              LL+TIN+FGC +ETIYI  Y+ YA K A++ T+K+L+L+   GF  + L+ QFLFK  
Sbjct  70   VFLLVTINAFGCFIETIYISMYLAYAPKTAKMLTVKLLLLMNFGGFCLILLICQFLFK-G  128

Query  507  PVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            P RA+++G +C+ FS+CVF APL I++ VI
Sbjct  129  PTRAKIIGGICVGFSVCVFAAPLSIIRTVI  158



>ref|XP_010454652.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Camelina 
sativa]
Length=289

 Score =   182 bits (463),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 87/150 (58%), Positives = 118/150 (79%), Gaps = 1/150 (1%)
 Frame = +3

Query  147  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  326
            W F FG+LGN+ISF VFLSP+PTFY+I KKK+ EG+QS+PYVVALFS+ LW+YYA  K +
Sbjct  10   WAFVFGLLGNVISFAVFLSPVPTFYRICKKKTTEGFQSLPYVVALFSATLWLYYATQKKD  69

Query  327  ATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSA  506
              LL+TIN FGC +ETIYI  ++ +A KKAR+ T+K+L+L+ + GF A+ L+ QFL K A
Sbjct  70   VFLLVTINCFGCFIETIYISIFVAFATKKARMLTVKLLLLMNVGGFCAILLLCQFLTKGA  129

Query  507  PVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
              RA+++G +C+ FS+CVF APL I++ VI
Sbjct  130  -TRAKIIGGICVGFSVCVFAAPLSIIRTVI  158



>ref|XP_010093935.1| Bidirectional sugar transporter SWEET12 [Morus notabilis]
 gb|EXB54898.1| Bidirectional sugar transporter SWEET12 [Morus notabilis]
Length=304

 Score =   183 bits (464),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 89/149 (60%), Positives = 119/149 (80%), Gaps = 1/149 (1%)
 Frame = +3

Query  150  VFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNA  329
            VF FG+LGN+ S IVFL+P+PTFY++YKKKS EG+QS+PYVVALFS+M+W+YYA LKS+ 
Sbjct  11   VFIFGLLGNVTSLIVFLAPVPTFYRVYKKKSTEGFQSVPYVVALFSAMMWLYYATLKSDL  70

Query  330  TLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAP  509
             LLITINS GC++ETIYI  YI YA K+AR+ T+++++LL   GF  + L+S FL K + 
Sbjct  71   ILLITINSVGCVIETIYIALYIAYATKQARIFTLRLILLLNFGGFCLILLLSHFLAKGS-  129

Query  510  VRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            +RA V+GWVC  F++ VF APL I++ VI
Sbjct  130  LRATVLGWVCTSFAVSVFAAPLSIIRVVI  158



>ref|XP_006366913.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Solanum 
tuberosum]
Length=357

 Score =   184 bits (467),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 87/157 (55%), Positives = 123/157 (78%), Gaps = 1/157 (1%)
 Frame = +3

Query  126  SMALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIY  305
            S++ +   VF FG+LGN++SF+VF++P+PTFY+I KKKS+EG+ S+PYVV LFS+MLWIY
Sbjct  3    SVSHTHPLVFTFGILGNLVSFMVFIAPVPTFYRIVKKKSSEGFHSLPYVVGLFSAMLWIY  62

Query  306  YAFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVS  485
            YA +K+N TLLITINSFGC+ ETIY+  Y  YA KKAR++T+ +++LL    FG +  ++
Sbjct  63   YAMVKTNVTLLITINSFGCIAETIYVAIYFTYATKKARMKTLGLVLLLNFGVFGLILFLT  122

Query  486  QFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            Q L +    RA+V+GW+C+ FS+ VFVAPL I+ +VI
Sbjct  123  QILCQGTK-RAEVIGWICMAFSISVFVAPLSIMGRVI  158



>ref|XP_010493487.1| PREDICTED: bidirectional sugar transporter SWEET12 [Camelina 
sativa]
Length=289

 Score =   182 bits (462),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 87/150 (58%), Positives = 118/150 (79%), Gaps = 1/150 (1%)
 Frame = +3

Query  147  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  326
            W F FG+LGN+ISF VFLSP+PTFY+I KKK+ EG+QS+PYVVALFS+ LW+YYA  K +
Sbjct  10   WAFVFGLLGNLISFAVFLSPVPTFYRICKKKTTEGFQSLPYVVALFSATLWLYYATQKKD  69

Query  327  ATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSA  506
              LL+TIN FGC +ETIYI  ++ +A KKAR+ T+K+L+L+ + GF A+ L+ QFL K A
Sbjct  70   VFLLVTINCFGCFIETIYISIFVAFATKKARMLTVKLLLLMNVGGFCAILLLCQFLTKGA  129

Query  507  PVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
              RA+++G +C+ FS+CVF APL I++ VI
Sbjct  130  -TRAKIIGGICVGFSVCVFAAPLSIIRTVI  158



>sp|A2X5B4.1|SWT15_ORYSI RecName: Full=Bidirectional sugar transporter SWEET15; Short=OsSWEET15 
[Oryza sativa Indica Group]
 gb|EAY86024.1| hypothetical protein OsI_07385 [Oryza sativa Indica Group]
Length=319

 Score =   183 bits (465),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 87/150 (58%), Positives = 112/150 (75%), Gaps = 1/150 (1%)
 Frame = +3

Query  147  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  326
            W F FG+LGN+IS +VFLSPLPTFY++Y+KKS EG+QS PYVV LFS MLW+YYAF+KS 
Sbjct  11   WAFTFGILGNLISLMVFLSPLPTFYRVYRKKSTEGFQSTPYVVTLFSCMLWMYYAFVKSG  70

Query  327  ATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSA  506
            A LL+TIN  GC++ET+Y+  Y+ YA K AR+ T KML+ L I  FG +ALV+  L    
Sbjct  71   AELLVTINGVGCVIETVYLAMYLAYAPKSARMLTAKMLLGLNIGLFGVIALVT-LLLSRG  129

Query  507  PVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
             +R  V+GW+C+  SL VF APL I++ VI
Sbjct  130  ELRVHVLGWICVAVSLSVFAAPLSIIRLVI  159



>ref|NP_197755.1| bidirectional sugar transporter SWEET12 [Arabidopsis thaliana]
 sp|O82587.1|SWT12_ARATH RecName: Full=Bidirectional sugar transporter SWEET12; Short=AtSWEET12; 
AltName: Full=MtN3-like protein [Arabidopsis thaliana]
 gb|AAC64192.1| MTN3 homolog [Arabidopsis thaliana]
 dbj|BAA97235.1| MtN3-like protein [Arabidopsis thaliana]
 gb|AAL09814.1| putative MtN3 protein [Arabidopsis thaliana]
 gb|AAL15214.1| putative MtN3 protein [Arabidopsis thaliana]
 gb|AAM47150.1| putative MtN3 protein [Arabidopsis thaliana]
 gb|AED93195.1| bidirectional sugar transporter SWEET12 [Arabidopsis thaliana]
Length=285

 Score =   182 bits (462),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 88/150 (59%), Positives = 118/150 (79%), Gaps = 1/150 (1%)
 Frame = +3

Query  147  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  326
            W F FG+LGN+ISF VFLSP+PTFY+I KKK+ EG+QSIPYVVALFS+MLW+YYA  K +
Sbjct  10   WAFVFGLLGNLISFAVFLSPVPTFYRICKKKTTEGFQSIPYVVALFSAMLWLYYATQKKD  69

Query  327  ATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSA  506
              LL+TINSFGC +ETIYI  ++ +A+KKAR+ T+K+L+L+   GF  + L+ QFL K  
Sbjct  70   VFLLVTINSFGCFIETIYISIFVAFASKKARMLTVKLLLLMNFGGFCLILLLCQFLAKGT  129

Query  507  PVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
              RA+++G +C+ FS+CVF APL I++ VI
Sbjct  130  -TRAKIIGGICVGFSVCVFAAPLSIIRTVI  158



>ref|NP_001046944.1| Os02g0513100 [Oryza sativa Japonica Group]
 sp|Q6K602.1|SWT15_ORYSJ RecName: Full=Bidirectional sugar transporter SWEET15; Short=OsSWEET15 
[Oryza sativa Japonica Group]
 dbj|BAD23245.1| putative nodulin 3 [Oryza sativa Japonica Group]
 dbj|BAF08858.1| Os02g0513100 [Oryza sativa Japonica Group]
 dbj|BAG95984.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE57067.1| hypothetical protein OsJ_06889 [Oryza sativa Japonica Group]
Length=319

 Score =   183 bits (464),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 87/150 (58%), Positives = 112/150 (75%), Gaps = 1/150 (1%)
 Frame = +3

Query  147  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  326
            W F FG+LGN+IS +VFLSPLPTFY++Y+KKS EG+QS PYVV LFS MLW+YYAF+KS 
Sbjct  11   WAFTFGILGNLISLMVFLSPLPTFYRVYRKKSTEGFQSTPYVVTLFSCMLWMYYAFVKSG  70

Query  327  ATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSA  506
            A LL+TIN  GC++ET+Y+  Y+ YA K AR+ T KML+ L I  FG +ALV+  L    
Sbjct  71   AELLVTINGVGCVIETVYLAMYLAYAPKSARMLTAKMLLGLNIGLFGVIALVT-LLLSRG  129

Query  507  PVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
             +R  V+GW+C+  SL VF APL I++ VI
Sbjct  130  ELRVHVLGWICVAVSLSVFAAPLSIIRLVI  159



>ref|XP_004501726.1| PREDICTED: bidirectional sugar transporter SWEET13-like [Cicer 
arietinum]
Length=296

 Score =   182 bits (462),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 87/156 (56%), Positives = 120/156 (77%), Gaps = 1/156 (1%)
 Frame = +3

Query  129  MALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYY  308
            M+   H  FAFGVLGNI SF+ FL+PLPTFY++ KKKS EG+QSIPYV ALFS+MLWI+Y
Sbjct  1    MSSHTHLSFAFGVLGNISSFVCFLAPLPTFYRVCKKKSTEGFQSIPYVAALFSAMLWIFY  60

Query  309  AFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQ  488
            A++K+  TLLITIN+FGC++ETIY+  Y+ Y  KKAR+ T++M+VL+   GF A+ +++ 
Sbjct  61   AYVKTGETLLITINAFGCVIETIYLAIYVAYCPKKARMSTLRMIVLMNFGGFCAIVVLTH  120

Query  489  FLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
             L K    R +++GW+C+VF+  VF APL I++ VI
Sbjct  121  VLAK-GEARFKLLGWICVVFATSVFAAPLSIIRVVI  155



>gb|KHN03192.1| Bidirectional sugar transporter N3 [Glycine soja]
Length=271

 Score =   181 bits (460),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 90/157 (57%), Positives = 117/157 (75%), Gaps = 2/157 (1%)
 Frame = +3

Query  129  MALSGHWV-FAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIY  305
            M +S H + F FG+LGN+ISF+VFL+P+PTFY+IYKKKS E +QS+PY+VALFSSMLW+Y
Sbjct  1    MVISHHTLAFTFGMLGNLISFLVFLAPVPTFYRIYKKKSTESFQSLPYLVALFSSMLWLY  60

Query  306  YAFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVS  485
            YA LK +A LLITINSFGC++E IYI  YI YA + AR  TIK+   + +  F  + LV+
Sbjct  61   YAMLKRDAVLLITINSFGCVIEIIYIVLYITYATRDARNLTIKLFSAMNMSSFALILLVT  120

Query  486  QFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
             F     P+R QV+GW+C+  S+ VF APL IV QV+
Sbjct  121  HFAVH-GPLRVQVLGWICVSISVSVFAAPLSIVAQVV  156



>ref|XP_004145146.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Cucumis 
sativus]
 ref|XP_004153502.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Cucumis 
sativus]
Length=291

 Score =   182 bits (461),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 92/164 (56%), Positives = 120/164 (73%), Gaps = 10/164 (6%)
 Frame = +3

Query  105  SSRHPDRSMALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALF  284
             + HP          VFAFG+LGNIISFIVFL+P+PTF +IYKKKS EG+QS+PYVVALF
Sbjct  5    DTHHPG---------VFAFGLLGNIISFIVFLAPVPTFMRIYKKKSTEGFQSVPYVVALF  55

Query  285  SSMLWIYYAFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGF  464
            S+MLW+YYA   SN TLLITINS GCL+ET+YI  +I +A K+ RV T++ ++LL   GF
Sbjct  56   SAMLWLYYASFNSNETLLITINSVGCLIETLYIAIFIVFAPKQIRVSTLRFVLLLNFGGF  115

Query  465  GAVALVSQFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
              + LV+ FL   +  + +VVGW+C+ FS+ VF APL I++ VI
Sbjct  116  CIILLVTHFLVHGSN-QVKVVGWICVAFSVSVFAAPLTIMRLVI  158



>gb|AHB08882.1| bidirectional sugar transporter SWEET14-like protein [Suaeda 
glauca]
Length=323

 Score =   183 bits (464),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 88/155 (57%), Positives = 119/155 (77%), Gaps = 1/155 (1%)
 Frame = +3

Query  132  ALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYA  311
             +   WVFAFG+LGNIISF+VFL+PLPTF ++YKKKS EG+QS+PYVVA+FS+MLWIYYA
Sbjct  3    TIHNPWVFAFGILGNIISFMVFLAPLPTFIRVYKKKSTEGFQSVPYVVAIFSAMLWIYYA  62

Query  312  FLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQF  491
             LK N+ LLITIN  G ++ETIY+  +I YA ++AR+ T+K+L+LL   GF  + L+  +
Sbjct  63   MLKGNSVLLITINIAGVIIETIYVAIFITYAPRQARISTLKLLMLLNFGGFCGIILLCHY  122

Query  492  LFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            L K    R Q+ GW+C+ FS+ VFVAPL +++ VI
Sbjct  123  LAKGQ-ARLQLYGWICVAFSISVFVAPLSVIRTVI  156



>emb|CDX80379.1| BnaC07g30650D [Brassica napus]
Length=288

 Score =   182 bits (461),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 87/150 (58%), Positives = 119/150 (79%), Gaps = 1/150 (1%)
 Frame = +3

Query  147  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  326
            W FAFG++GNIISF VFLSP+PTFY+I+KKK+ E +QS+PYVVALFS+MLW+YYA  K +
Sbjct  10   WAFAFGLVGNIISFAVFLSPVPTFYRIWKKKTTEDFQSLPYVVALFSAMLWLYYATQKKD  69

Query  327  ATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSA  506
              LL+TINSFGC +ETIYI  ++ +A KKAR+ T+K+L+L+   GF  + L+ QFL K +
Sbjct  70   VFLLVTINSFGCFIETIYIAIFVAFATKKARMLTVKLLLLMNFGGFCLILLLCQFLAKGS  129

Query  507  PVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
              RA+++G +C+ FS+CVF APL I++ VI
Sbjct  130  -TRAKIIGGICVGFSVCVFAAPLSIIRTVI  158



>ref|XP_003551863.1| PREDICTED: bidirectional sugar transporter N3-like [Glycine max]
Length=271

 Score =   181 bits (460),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 90/157 (57%), Positives = 117/157 (75%), Gaps = 2/157 (1%)
 Frame = +3

Query  129  MALSGHWV-FAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIY  305
            M +S H + F FG+LGN+ISF+VFL+P+PTFY+IYKKKS E +QS+PY+VALFSSMLW+Y
Sbjct  1    MVISHHTLAFTFGMLGNLISFLVFLAPVPTFYRIYKKKSTESFQSLPYLVALFSSMLWLY  60

Query  306  YAFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVS  485
            YA LK +A LLITINSFGC++E IYI  YI YA + AR  TIK+   + +  F  + LV+
Sbjct  61   YAMLKRDAVLLITINSFGCVIEIIYIVLYITYATRDARNLTIKLFSAMNMSSFALILLVT  120

Query  486  QFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
             F     P+R QV+GW+C+  S+ VF APL IV QV+
Sbjct  121  HFAVH-GPLRVQVLGWICVSISVSVFAAPLSIVAQVV  156



>ref|XP_003530901.1| PREDICTED: bidirectional sugar transporter N3-like [Glycine max]
Length=272

 Score =   181 bits (459),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/157 (57%), Positives = 117/157 (75%), Gaps = 2/157 (1%)
 Frame = +3

Query  129  MALSGHWV-FAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIY  305
            M ++ H + F FG+LGN+ISF+VFL+P+PTFY+IYKKKS E +QS+PY+VALFSSMLW+Y
Sbjct  1    MVITHHTLAFTFGMLGNVISFLVFLAPVPTFYRIYKKKSTESFQSLPYLVALFSSMLWLY  60

Query  306  YAFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVS  485
            YA LK +A LLITINSFGC++E IYI  YI YA + AR  TIK+   + +  F  + LV+
Sbjct  61   YALLKRDAVLLITINSFGCVIEIIYIVLYITYATRDARNLTIKLFSAMNMTSFAVILLVT  120

Query  486  QFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
             F     P+R QV+GW+C+  S+ VF APL IV QV+
Sbjct  121  HFGVH-GPLRVQVLGWICVSISVSVFAAPLSIVAQVV  156



>emb|CDY16863.1| BnaA09g05190D [Brassica napus]
Length=277

 Score =   181 bits (460),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/150 (58%), Positives = 119/150 (79%), Gaps = 1/150 (1%)
 Frame = +3

Query  147  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  326
            W FAFG+LGN+ISF VFLSP+PTFY+I KKK+ EG+QS+PYVVALFS+MLW+YYA  K +
Sbjct  10   WAFAFGLLGNLISFAVFLSPVPTFYRICKKKTTEGFQSLPYVVALFSAMLWLYYATQKKD  69

Query  327  ATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSA  506
              LL+TINSFGC++ETIYI  ++ +A K+AR+ T+K+L+L+   GF  + L+ QFL K  
Sbjct  70   VFLLVTINSFGCVIETIYIAIFVAFATKEARMLTVKLLLLMNFGGFFLILLLCQFLAKGT  129

Query  507  PVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
              RA+++G +C+ FS+CVF APL I++ VI
Sbjct  130  -TRAKIIGGICVGFSVCVFAAPLSIIRTVI  158



>emb|CDX87161.1| BnaC09g04760D [Brassica napus]
Length=277

 Score =   181 bits (459),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/150 (58%), Positives = 119/150 (79%), Gaps = 1/150 (1%)
 Frame = +3

Query  147  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  326
            W FAFG+LGN+ISF VFLSP+PTFY+I KKK+ EG+QS+PYVVALFS+MLW+YYA  K +
Sbjct  10   WAFAFGLLGNLISFAVFLSPVPTFYRICKKKTTEGFQSLPYVVALFSAMLWLYYATQKKD  69

Query  327  ATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSA  506
              LL+TINSFGC++ETIYI  ++ +A K+AR+ T+K+L+L+   GF  + L+ QFL K  
Sbjct  70   VFLLVTINSFGCVIETIYIAIFVAFATKEARMLTVKLLLLMNFGGFFLILLLCQFLAKGT  129

Query  507  PVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
              RA+++G +C+ FS+CVF APL I++ VI
Sbjct  130  -TRAKIIGGICVGFSVCVFAAPLSIIRTVI  158



>ref|XP_007159993.1| hypothetical protein PHAVU_002G283900g [Phaseolus vulgaris]
 gb|ESW31987.1| hypothetical protein PHAVU_002G283900g [Phaseolus vulgaris]
Length=258

 Score =   180 bits (457),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 94/151 (62%), Positives = 121/151 (80%), Gaps = 2/151 (1%)
 Frame = +3

Query  147  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  326
            W F FG+LGNIISF VFL+PLPTFYQIYKKKS EG+QS+PYVVALFS+MLWIYYAF+K  
Sbjct  8    WAFVFGLLGNIISFGVFLAPLPTFYQIYKKKSTEGFQSLPYVVALFSAMLWIYYAFVKRE  67

Query  327  AT-LLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKS  503
            A  LLITIN+FG +VE+IY+  ++ YA +K R+ TIK+L+LL + GFGA+ L + +L K 
Sbjct  68   AALLLITINTFGIVVESIYLTIFLIYAPRKPRLTTIKLLLLLNVFGFGAMLLSTLYLTKG  127

Query  504  APVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            A  R  ++GW+CLVF++ VF APL I+ +VI
Sbjct  128  AK-RLAIIGWICLVFNISVFAAPLFIISRVI  157



>gb|KJB31535.1| hypothetical protein B456_005G195100 [Gossypium raimondii]
Length=288

 Score =   181 bits (459),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 92/158 (58%), Positives = 117/158 (74%), Gaps = 3/158 (2%)
 Frame = +3

Query  129  MALSGHWVFA--FGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWI  302
            MA + H   A  FGVLGNIIS +V+L+PLPTFY+IYKKKS E +QS+PY VALFSSMLW+
Sbjct  4    MADADHHSLAVAFGVLGNIISVLVYLAPLPTFYRIYKKKSTESFQSLPYQVALFSSMLWL  63

Query  303  YYAFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALV  482
            YYA +K  A LLITINSFGC+VETIYI  YI YA K +RV  IK+ V + +  F  + ++
Sbjct  64   YYALMKKGAFLLITINSFGCVVETIYIAMYIAYATKNSRVSAIKLFVAMNVALFSFIIIL  123

Query  483  SQFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            + FL K + +R QV+GW+C+  S+ VF APL IV +VI
Sbjct  124  THFLVKGS-IRVQVLGWICVAISVSVFAAPLNIVARVI  160



>gb|KJB51265.1| hypothetical protein B456_008G209000 [Gossypium raimondii]
Length=160

 Score =   177 bits (448),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/155 (55%), Positives = 118/155 (76%), Gaps = 1/155 (1%)
 Frame = +3

Query  129  MALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYY  308
            MAL   WVF FG+LGN +SF+V L+PLPTFYQIYKKK++EG+QSIPYVV+LFS+MLWIYY
Sbjct  1    MALHLSWVFVFGILGNAVSFMVSLAPLPTFYQIYKKKTSEGFQSIPYVVSLFSAMLWIYY  60

Query  309  AFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQ  488
            A LK +A  LITIN+F   ++T YI  Y YY  KK ++ T+K+++L  + GFG + L + 
Sbjct  61   ALLKKDAIFLITINTFCVFIQTFYIVTYFYYGPKKEKIVTVKLMLLFNVFGFGVIFLATY  120

Query  489  FLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQV  593
            FL K+  +R  ++G++C+ F+L VFVAPL IV ++
Sbjct  121  FL-KNPSLRLLILGYICMAFALAVFVAPLAIVVRI  154



>ref|XP_006493253.1| PREDICTED: bidirectional sugar transporter SWEET13-like isoform 
X2 [Citrus sinensis]
Length=285

 Score =   181 bits (459),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 90/149 (60%), Positives = 125/149 (84%), Gaps = 0/149 (0%)
 Frame = +3

Query  150  VFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNA  329
            VFAFG+LGNI+SFIVFL+P+PTFY++ KKKS EG+QS+PYVVALFS+MLWIYYA +K +A
Sbjct  11   VFAFGLLGNIVSFIVFLAPMPTFYRVCKKKSTEGFQSLPYVVALFSAMLWIYYAMMKKDA  70

Query  330  TLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAP  509
             LLITIN+FGC++ETIY+  YI +A K+AR+ T+++L+LL   GFG++ L+S FL K + 
Sbjct  71   FLLITINAFGCVIETIYLALYITFAPKQARLYTLRLLLLLNFGGFGSILLLSHFLAKGSA  130

Query  510  VRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
             R +++GW+C+VFS+ VF APL I++ V+
Sbjct  131  ARLRLLGWICVVFSVSVFAAPLSIMRLVV  159



>ref|XP_010678288.1| PREDICTED: bidirectional sugar transporter N3 [Beta vulgaris 
subsp. vulgaris]
Length=324

 Score =   182 bits (461),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/150 (58%), Positives = 116/150 (77%), Gaps = 1/150 (1%)
 Frame = +3

Query  147  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  326
            WVFAFG+LGN+ISF+VFL+PLPTF ++YKKKS EG+QS+PYVVA+FS+MLWIYYA LK N
Sbjct  8    WVFAFGLLGNVISFMVFLAPLPTFIRVYKKKSTEGFQSVPYVVAIFSAMLWIYYALLKGN  67

Query  327  ATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSA  506
            + LLITIN  G ++ETIY+  YI YA ++AR+ T+K+L+ +   GF  + L   +L K A
Sbjct  68   SVLLITINVAGVIIETIYVAIYITYAPRQARISTLKLLLFMNFCGFCTIVLFCHYLVK-A  126

Query  507  PVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
              R QV GW+C+ FS+ VF APL +++ VI
Sbjct  127  ENRLQVFGWICVAFSISVFAAPLSVMRTVI  156



>gb|KJB51261.1| hypothetical protein B456_008G209000 [Gossypium raimondii]
Length=269

 Score =   180 bits (457),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/156 (56%), Positives = 120/156 (77%), Gaps = 1/156 (1%)
 Frame = +3

Query  129  MALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYY  308
            MAL   WVF FG+LGN +SF+V L+PLPTFYQIYKKK++EG+QSIPYVV+LFS+MLWIYY
Sbjct  1    MALHLSWVFVFGILGNAVSFMVSLAPLPTFYQIYKKKTSEGFQSIPYVVSLFSAMLWIYY  60

Query  309  AFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQ  488
            A LK +A  LITIN+F   ++T YI  Y YY  KK ++ T+K+++L  + GFG + L + 
Sbjct  61   ALLKKDAIFLITINTFCVFIQTFYIVTYFYYGPKKEKIVTVKLMLLFNVFGFGVIFLATY  120

Query  489  FLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            FL K+  +R  ++G++C+ F+L VFVAPL IV++VI
Sbjct  121  FL-KNPSLRLLILGYICMAFALAVFVAPLAIVRKVI  155



>ref|XP_010545940.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Tarenaya 
hassleriana]
Length=285

 Score =   181 bits (458),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 90/150 (60%), Positives = 119/150 (79%), Gaps = 1/150 (1%)
 Frame = +3

Query  147  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  326
            W FAFG+LGNIISF VFLSP+ TFY+I+KKKS EG+ S+PYVVALFS+MLW+YYA  KS+
Sbjct  10   WAFAFGLLGNIISFCVFLSPMTTFYRIWKKKSTEGFHSLPYVVALFSAMLWLYYATQKSD  69

Query  327  ATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSA  506
              LL+TINSFGC +ETIYI  +I +ANKKAR+ T+K+L+L+   GF  + L+ QFL K +
Sbjct  70   VFLLVTINSFGCFIETIYISLFIAFANKKARMFTLKLLLLMNFGGFCLILLLCQFLAKGS  129

Query  507  PVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
              RA+++G +C+ FS+ VF APL I++ VI
Sbjct  130  -TRAKIIGGICVGFSVSVFAAPLSIIRVVI  158



>ref|XP_009141677.1| PREDICTED: bidirectional sugar transporter SWEET12 [Brassica 
rapa]
Length=277

 Score =   180 bits (457),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 87/150 (58%), Positives = 119/150 (79%), Gaps = 1/150 (1%)
 Frame = +3

Query  147  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  326
            W FAFG+LGN+ISF VFLSP+PTFY+I KKK+ EG+QS+PYVVALFS+MLW+YYA  K +
Sbjct  10   WAFAFGLLGNLISFAVFLSPVPTFYRICKKKTTEGFQSLPYVVALFSAMLWLYYATQKKD  69

Query  327  ATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSA  506
              LL+TINSFGC++ETIYI  ++ +A K+AR+ T+K+L+L+   GF  + L+ QFL K  
Sbjct  70   VFLLVTINSFGCVIETIYIAIFVAFATKEARMFTVKLLLLMNFGGFFLILLLCQFLAKGT  129

Query  507  PVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
              RA+++G +C+ FS+CVF APL I++ VI
Sbjct  130  -TRAKIIGGICVGFSVCVFAAPLSIIRTVI  158



>ref|NP_001141106.1| uncharacterized protein LOC100273190 [Zea mays]
 gb|ACF85414.1| unknown [Zea mays]
Length=295

 Score =   180 bits (457),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 87/156 (56%), Positives = 121/156 (78%), Gaps = 1/156 (1%)
 Frame = +3

Query  129  MALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYY  308
            ++L   W F FG+LGN+ISF+ FL+P+PTFY+IYK KS EG+QS+PYVVALFS+MLWI+Y
Sbjct  4    LSLQHPWAFTFGLLGNVISFMTFLAPIPTFYRIYKSKSTEGFQSVPYVVALFSAMLWIFY  63

Query  309  AFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQ  488
            A +KSN T LITIN+ GC++ET+Y+  Y  YA KK R+ T K+++LL +  FGA+ L++ 
Sbjct  64   ALIKSNETFLITINAAGCVIETVYVVMYFVYATKKGRMFTAKIMLLLNVGAFGAILLLTL  123

Query  489  FLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
             LFK    R  ++GW+C+ FS+ VFVAPL I+++VI
Sbjct  124  LLFKGDK-RVVMLGWICVGFSVSVFVAPLSIMRRVI  158



>ref|XP_002877629.1| nodulin MtN3 family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53888.1| nodulin MtN3 family protein [Arabidopsis lyrata subsp. lyrata]
Length=289

 Score =   180 bits (457),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 87/150 (58%), Positives = 116/150 (77%), Gaps = 1/150 (1%)
 Frame = +3

Query  147  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  326
            W F FG+LGN+ISF VFLSP+PTFY+I+KKK+ EG+QSIPYVVALFS+ LW+YYA  K +
Sbjct  10   WAFVFGLLGNLISFAVFLSPVPTFYRIWKKKTTEGFQSIPYVVALFSATLWLYYATQKKD  69

Query  327  ATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSA  506
              LL+TIN+FGC +ETIYI  ++ YA K AR+ T+K L+L+   GF  + L+ QFL K A
Sbjct  70   VFLLVTINAFGCFIETIYIAMFLAYATKPARMLTVKTLLLMNFGGFCVILLLCQFLVKGA  129

Query  507  PVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
              RA+++G +C+ FS+CVF APL I++ VI
Sbjct  130  -TRAKIIGGICVGFSVCVFAAPLSIIRTVI  158



>ref|XP_004161952.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Cucumis 
sativus]
Length=294

 Score =   180 bits (457),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 114/148 (77%), Gaps = 1/148 (1%)
 Frame = +3

Query  153  FAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNAT  332
            F FG+LGNIISFIVFL+P+PTF +IYKKKS EG+QSIPYVVALFS+MLW+YYA    N T
Sbjct  13   FTFGLLGNIISFIVFLAPVPTFMRIYKKKSTEGFQSIPYVVALFSAMLWLYYASFNPNET  72

Query  333  LLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAPV  512
            LLITINS GCL+ETIY+  +I +A K+ RV T++ ++LL   GF  + LV+ FL   +  
Sbjct  73   LLITINSVGCLIETIYLAIFIVFAPKQIRVSTLRFVLLLNFGGFCIILLVTHFLVHGSN-  131

Query  513  RAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            R +VVGW+C+ FS+ VF APL I++ VI
Sbjct  132  RVKVVGWICVAFSISVFAAPLTIIRLVI  159



>emb|CDX83046.1| BnaA01g20460D [Brassica napus]
Length=286

 Score =   180 bits (456),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 85/150 (57%), Positives = 118/150 (79%), Gaps = 1/150 (1%)
 Frame = +3

Query  147  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  326
            W F FG++GN+ISF VFLSP+PTFY+++KKK+ EG+QS+PYVVALFS+ LW+YYA  K +
Sbjct  10   WAFVFGLMGNVISFAVFLSPVPTFYRVWKKKTTEGFQSLPYVVALFSATLWLYYATQKKD  69

Query  327  ATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSA  506
              LL+TINSFGC +ETIYI  ++ +A KKAR+ T+K+L+L+   GF  + L+SQFL K  
Sbjct  70   VFLLVTINSFGCFIETIYISIFLAFAPKKARMLTVKLLLLMNFGGFCLILLLSQFLAKGT  129

Query  507  PVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
              RA+++G +C+ FS+CVF APL I++ VI
Sbjct  130  -TRAKIIGGICVGFSVCVFAAPLSIIRTVI  158



>ref|XP_006647263.1| PREDICTED: bidirectional sugar transporter SWEET15-like [Oryza 
brachyantha]
Length=319

 Score =   181 bits (458),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 87/150 (58%), Positives = 113/150 (75%), Gaps = 1/150 (1%)
 Frame = +3

Query  147  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  326
            W F FG+LGNIIS +VFLSPLPTFY++Y+KKS EG+QS PYVV LFS MLW+YYAF+KS 
Sbjct  11   WAFTFGILGNIISLMVFLSPLPTFYRVYRKKSTEGFQSTPYVVTLFSCMLWMYYAFVKSG  70

Query  327  ATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSA  506
            A LL+TIN  GC++ET+Y+  Y+ YA K  R+ T +ML+ L +  FG +ALV+  L + A
Sbjct  71   AELLVTINGVGCVIETVYLAMYLAYAAKSTRMLTTRMLLGLNVGLFGLIALVTLLLPQGA  130

Query  507  PVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
             +R  V+GWVC+  SL VF APL I++ VI
Sbjct  131  -LRVHVLGWVCVAVSLSVFAAPLSIIRLVI  159



>emb|CDX77928.1| BnaC03g52910D [Brassica napus]
Length=285

 Score =   180 bits (456),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 85/150 (57%), Positives = 118/150 (79%), Gaps = 1/150 (1%)
 Frame = +3

Query  147  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  326
            W F FG++GN+ISF VFLSP+PTFY+++KKK+ EG+QS+PYVVALFS+ LW+YYA  K +
Sbjct  10   WAFVFGLMGNVISFAVFLSPVPTFYRVWKKKTTEGFQSLPYVVALFSATLWLYYATQKKD  69

Query  327  ATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSA  506
              LL+TINSFGC +ETIYI  ++ YA KKAR+ T+K+L+L+   GF  + L+ QFL K  
Sbjct  70   VFLLVTINSFGCFIETIYISIFLAYAPKKARMLTVKLLLLMNFGGFCLILLLCQFLAKGT  129

Query  507  PVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
              RA+++G +C+ FS+CVF APL I+++VI
Sbjct  130  -TRAKIIGGICVGFSVCVFAAPLSIIRKVI  158



>ref|XP_002877428.1| hypothetical protein ARALYDRAFT_484952 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53687.1| hypothetical protein ARALYDRAFT_484952 [Arabidopsis lyrata subsp. 
lyrata]
Length=285

 Score =   180 bits (456),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 87/150 (58%), Positives = 117/150 (78%), Gaps = 1/150 (1%)
 Frame = +3

Query  147  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  326
            W F FG+LGN+ISF VFLSP+PTFY+I KKK+ EG+QSIPYVVALFS+MLW+YYA  K +
Sbjct  10   WAFVFGLLGNLISFAVFLSPVPTFYRICKKKTTEGFQSIPYVVALFSAMLWLYYATQKKD  69

Query  327  ATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSA  506
              LL+TINSFGC +E IYI  ++ +A+KKAR+ T+K+L+L+   GF  + L+ QFL K  
Sbjct  70   VFLLVTINSFGCFIEIIYISIFVAFASKKARMLTVKLLLLMNFGGFCLILLLCQFLAKGT  129

Query  507  PVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
              RA+++G +C+ FS+CVF APL I++ VI
Sbjct  130  -TRAKIIGGICVGFSVCVFAAPLSIIRTVI  158



>gb|AGV54262.1| bidirectional sugar transporter SWEET12 [Phaseolus vulgaris]
Length=333

 Score =   181 bits (459),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 83/148 (56%), Positives = 115/148 (78%), Gaps = 0/148 (0%)
 Frame = +3

Query  153  FAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNAT  332
            F FGVLGN+ SF+ FL+PLPTFY++ KKKS EG+QS+PYV ALFS+MLWI+YA++K+  T
Sbjct  8    FLFGVLGNVASFVCFLAPLPTFYRVCKKKSTEGFQSVPYVAALFSAMLWIFYAYVKTGET  67

Query  333  LLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAPV  512
            LLITINSFGC++ETIY+  ++ Y  KKAR+ T++M+VL    GF  + L++  L K A  
Sbjct  68   LLITINSFGCVIETIYLAIFLTYCPKKARMSTLRMIVLFNFGGFCTIVLLTHLLAKGAGA  127

Query  513  RAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            R +++GW+C+VF+  VF APL I++ VI
Sbjct  128  RVKLLGWICVVFATSVFAAPLSIIRVVI  155



>gb|KHG02402.1| Bidirectional sugar transporter SWEET10 -like protein [Gossypium 
arboreum]
Length=273

 Score =   179 bits (454),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 87/156 (56%), Positives = 120/156 (77%), Gaps = 1/156 (1%)
 Frame = +3

Query  129  MALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYY  308
            MAL   WVF FG+LGN +SF+V L+PLPTFYQI+KKK++EG+QSIPYVV+LFS+MLWIYY
Sbjct  1    MALHLSWVFVFGILGNAVSFMVSLAPLPTFYQIFKKKTSEGFQSIPYVVSLFSAMLWIYY  60

Query  309  AFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQ  488
            A LK +A  LITIN+F   ++T YI  Y YY  KK ++ T+K+++L  + GFG + L + 
Sbjct  61   ALLKKDAIFLITINTFCVFIQTFYIVTYFYYGPKKEKIVTVKLMLLFNVFGFGVIFLATY  120

Query  489  FLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            FL K+  +R  ++G++C+ F+L VFVAPL IV++VI
Sbjct  121  FL-KNPSLRLLILGYICMAFALAVFVAPLAIVRKVI  155



>ref|XP_008677256.1| PREDICTED: LOC100282648 isoform X1 [Zea mays]
 gb|AFW62434.1| MTN3 isoform 1 [Zea mays]
 gb|AFW62435.1| MTN3 isoform 2 [Zea mays]
Length=304

 Score =   180 bits (457),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 88/150 (59%), Positives = 109/150 (73%), Gaps = 1/150 (1%)
 Frame = +3

Query  147  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  326
            W F FG+LGNI+S +VFLSPLPTFY++Y+ KS EG+QS PYVV LFS MLWI YA LK  
Sbjct  11   WAFTFGILGNIVSLMVFLSPLPTFYRVYRNKSTEGFQSTPYVVTLFSCMLWILYALLKPG  70

Query  327  ATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSA  506
            A LL+TIN  GC+VET+Y+  Y+ YA K ARV   KML+ L +  FG VALV+  L   A
Sbjct  71   AELLVTINGVGCVVETVYLAMYLVYAPKAARVLAAKMLLGLNVAVFGLVALVT-MLLSDA  129

Query  507  PVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
             +R  V+GW+C+  SL VF APL I++QVI
Sbjct  130  GLRVHVLGWICVSVSLSVFAAPLSIMRQVI  159



>ref|NP_001149028.1| LOC100282648 [Zea mays]
 gb|ACG33879.1| MTN3 [Zea mays]
Length=307

 Score =   180 bits (457),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 88/150 (59%), Positives = 109/150 (73%), Gaps = 1/150 (1%)
 Frame = +3

Query  147  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  326
            W F FG+LGNI+S +VFLSPLPTFY++Y+ KS EG+QS PYVV LFS MLWI YA LK  
Sbjct  11   WAFTFGILGNIVSLMVFLSPLPTFYRVYRNKSTEGFQSTPYVVTLFSCMLWILYALLKPG  70

Query  327  ATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSA  506
            A LL+TIN  GC+VET+Y+  Y+ YA K ARV   KML+ L +  FG VALV+  L   A
Sbjct  71   AELLVTINGVGCVVETVYLAMYLVYAPKAARVLAAKMLLGLNVAVFGLVALVT-MLLSDA  129

Query  507  PVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
             +R  V+GW+C+  SL VF APL I++QVI
Sbjct  130  GLRVHVLGWICVSVSLSVFAAPLSIMRQVI  159



>ref|XP_006413354.1| hypothetical protein EUTSA_v10025975mg [Eutrema salsugineum]
 gb|ESQ54807.1| hypothetical protein EUTSA_v10025975mg [Eutrema salsugineum]
Length=270

 Score =   179 bits (454),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 92/149 (62%), Positives = 117/149 (79%), Gaps = 2/149 (1%)
 Frame = +3

Query  153  FAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNAT  332
            F FG++GNIISFIVFL+P+PTF++IYKKKS EG+QS+PYV ALFS+MLWIYYA  K  + 
Sbjct  8    FTFGIMGNIISFIVFLAPVPTFFRIYKKKSIEGFQSLPYVSALFSAMLWIYYAMQKDGSG  67

Query  333  -LLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAP  509
             LLITIN+ GC +ETIYI  +I YANKKARV T+K+L LL  +GF A+ LV + L K A 
Sbjct  68   FLLITINAVGCFIETIYIVLFITYANKKARVSTLKVLGLLNFLGFAAIVLVCELLTK-AS  126

Query  510  VRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
             R +V+G +C+ FS+CVF APL I++ VI
Sbjct  127  NREKVLGGICVGFSVCVFAAPLSIMRVVI  155



>ref|XP_007159992.1| hypothetical protein PHAVU_002G283900g [Phaseolus vulgaris]
 gb|ESW31986.1| hypothetical protein PHAVU_002G283900g [Phaseolus vulgaris]
Length=189

 Score =   176 bits (447),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 92/147 (63%), Positives = 118/147 (80%), Gaps = 2/147 (1%)
 Frame = +3

Query  147  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  326
            W F FG+LGNIISF VFL+PLPTFYQIYKKKS EG+QS+PYVVALFS+MLWIYYAF+K  
Sbjct  8    WAFVFGLLGNIISFGVFLAPLPTFYQIYKKKSTEGFQSLPYVVALFSAMLWIYYAFVKRE  67

Query  327  AT-LLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKS  503
            A  LLITIN+FG +VE+IY+  ++ YA +K R+ TIK+L+LL + GFGA+ L + +L K 
Sbjct  68   AALLLITINTFGIVVESIYLTIFLIYAPRKPRLTTIKLLLLLNVFGFGAMLLSTLYLTKG  127

Query  504  APVRAQVVGWVCLVFSLCVFVAPLCIV  584
            A  R  ++GW+CLVF++ VF APL I+
Sbjct  128  AK-RLAIIGWICLVFNISVFAAPLFII  153



>tpg|DAA54931.1| TPA: hypothetical protein ZEAMMB73_176833 [Zea mays]
Length=160

 Score =   176 bits (445),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 118/154 (77%), Gaps = 1/154 (1%)
 Frame = +3

Query  126  SMALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIY  305
             ++L   W F FG+LGN+ISF+ FL+P+PTFY+IYK KS EG+QS+PYVVALFS+MLWI+
Sbjct  3    GLSLQHPWAFTFGLLGNVISFMTFLAPIPTFYRIYKSKSTEGFQSVPYVVALFSAMLWIF  62

Query  306  YAFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVS  485
            YA +KSN T LITIN+ GC++ET+Y+  Y  YA KK R+ T K+++LL +  FGA+ L++
Sbjct  63   YALIKSNETFLITINAAGCVIETVYVVMYFVYATKKGRMFTAKIMLLLNVGAFGAILLLT  122

Query  486  QFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVK  587
              LFK    R  ++GW+C+ FS+ VFVAPL I++
Sbjct  123  LLLFKGDK-RVVMLGWICVGFSVSVFVAPLSIMR  155



>ref|XP_002511128.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51730.1| conserved hypothetical protein [Ricinus communis]
Length=279

 Score =   179 bits (454),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 88/156 (56%), Positives = 120/156 (77%), Gaps = 1/156 (1%)
 Frame = +3

Query  129  MALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYY  308
            MA      FAFG+LGNIISF+V L+P+PTFYQI KKK++EG+QSIPYV+ALFS+ LW++Y
Sbjct  1    MAFHLTLAFAFGLLGNIISFLVCLAPMPTFYQICKKKTSEGFQSIPYVIALFSATLWLFY  60

Query  309  AFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQ  488
            A   ++ATLLITINSF   +ET YI  Y++YA KK R+ T K+++ L I  FG++ +++ 
Sbjct  61   AIFANDATLLITINSFAFFMETAYIAIYLFYAVKKDRLFTTKLVLSLNIFAFGSICVIAM  120

Query  489  FLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            FL      R Q++GW+C+VF+LCVFVAPL IV++VI
Sbjct  121  FL-THGQKRVQLLGWICMVFALCVFVAPLAIVRKVI  155



>ref|XP_010678287.1| PREDICTED: bidirectional sugar transporter SWEET12 [Beta vulgaris 
subsp. vulgaris]
Length=301

 Score =   180 bits (456),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 84/150 (56%), Positives = 115/150 (77%), Gaps = 0/150 (0%)
 Frame = +3

Query  147  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  326
            W+  FG+LGN ISF+VFLSP+PTFY+IYKKKS E +QSIPYVVA FS+MLW+ YA++K++
Sbjct  12   WITIFGLLGNTISFMVFLSPIPTFYRIYKKKSTEEFQSIPYVVAFFSAMLWLLYAYVKTD  71

Query  327  ATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSA  506
               L+TIN FG  +ETIY+  ++ YANK+AR+  IK L+L  + GFG +   +  + K+ 
Sbjct  72   VIFLVTINCFGLFIETIYLVIFLVYANKEARISAIKQLLLFNVFGFGVIVFFTAVIAKTT  131

Query  507  PVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
             VR  ++GWVCLVFS CVFVAPL ++++VI
Sbjct  132  RVRLLILGWVCLVFSFCVFVAPLGVMRKVI  161



>ref|XP_004153501.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Cucumis 
sativus]
 gb|KGN64433.1| hypothetical protein Csa_1G051710 [Cucumis sativus]
Length=295

 Score =   179 bits (455),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 114/148 (77%), Gaps = 1/148 (1%)
 Frame = +3

Query  153  FAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNAT  332
            F FG+LGNIISFIVFL+P+PTF +IYKKKS EG+QSIPYVVALFS+MLW+YYA    N T
Sbjct  13   FTFGLLGNIISFIVFLAPVPTFMRIYKKKSTEGFQSIPYVVALFSAMLWLYYASFNPNET  72

Query  333  LLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAPV  512
            LLITINS GCL+ETIY+  +I +A K+ RV T++ ++LL   GF  + LV+ FL   +  
Sbjct  73   LLITINSVGCLIETIYLAIFIVFAPKQIRVSTLRFVLLLNFGGFCIILLVTHFLVHGSN-  131

Query  513  RAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            R +VVGW+C+ FS+ VF APL I++ VI
Sbjct  132  RVKVVGWICVAFSISVFAAPLTIIRLVI  159



>ref|XP_004952573.1| PREDICTED: bidirectional sugar transporter SWEET15-like [Setaria 
italica]
Length=319

 Score =   180 bits (457),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 87/150 (58%), Positives = 113/150 (75%), Gaps = 1/150 (1%)
 Frame = +3

Query  147  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  326
            W F FG+LGNIIS +VFLSPLPTFY++Y+KKS EG+QS PYVV LFS MLWI+YA LK+ 
Sbjct  11   WAFTFGILGNIISLMVFLSPLPTFYRVYRKKSTEGFQSTPYVVTLFSCMLWIFYALLKTG  70

Query  327  ATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSA  506
            A LL+TIN  GC++ET+YI  Y+ YA + ARV T KML+ L +  FG V+LV+  L  + 
Sbjct  71   AVLLVTINGVGCVIETVYIAMYLVYAPRAARVLTAKMLLGLNVGVFGLVSLVTMVL-SNG  129

Query  507  PVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
             +R  V+GW+C+  +L VF APL I++QVI
Sbjct  130  NLRVHVLGWICVSVALSVFAAPLSIMRQVI  159



>ref|NP_001131289.1| mtN3-like protein [Zea mays]
 gb|ACF79630.1| unknown [Zea mays]
 gb|ACG31892.1| mtN3-like protein [Zea mays]
 gb|AFW60846.1| mtN3-like protein [Zea mays]
Length=293

 Score =   179 bits (455),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 118/148 (80%), Gaps = 1/148 (1%)
 Frame = +3

Query  153  FAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNAT  332
            FAFG+LGNIISF+ +L+PLPTFY+IYK KS EG+QS+PYVVALFS+MLWIYYA LKSN  
Sbjct  12   FAFGLLGNIISFMTYLAPLPTFYRIYKNKSTEGFQSVPYVVALFSAMLWIYYALLKSNEL  71

Query  333  LLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAPV  512
            LLITINS GC++ET+YI  Y+ YA KKA++ T K+L+LL +  FG + L++  L  +   
Sbjct  72   LLITINSAGCVIETLYIAMYLLYAPKKAKLFTAKILLLLNVGVFGLILLLTL-LLSAGQR  130

Query  513  RAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            R  V+GWVC+ FS+ VFVAPL I++QV+
Sbjct  131  RVVVLGWVCVAFSVSVFVAPLSIIRQVV  158



>ref|XP_009149800.1| PREDICTED: bidirectional sugar transporter SWEET11 [Brassica 
rapa]
Length=289

 Score =   179 bits (454),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/150 (57%), Positives = 117/150 (78%), Gaps = 1/150 (1%)
 Frame = +3

Query  147  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  326
            W F FG++GN+ISF VFLSP+PTFY+++KKK+ EG+QS+PYVVALFS+ LW+YYA  K +
Sbjct  10   WAFVFGLMGNVISFSVFLSPVPTFYRVWKKKTTEGFQSLPYVVALFSATLWLYYATQKKD  69

Query  327  ATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSA  506
              LL+TINSFGC +ETIYI  ++ YA KKAR+ T+K+L+L+   GF  + L+ QFL K  
Sbjct  70   VFLLVTINSFGCFIETIYISIFLAYAPKKARMLTVKLLLLMNFGGFCLILLLCQFLAKGT  129

Query  507  PVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
              RA+++G +C+ FS+CVF APL I++ VI
Sbjct  130  -TRAKIIGGICVGFSVCVFAAPLSIIRTVI  158



>ref|XP_010412639.1| PREDICTED: bidirectional sugar transporter SWEET11-like [Camelina 
sativa]
Length=158

 Score =   175 bits (443),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/149 (56%), Positives = 114/149 (77%), Gaps = 1/149 (1%)
 Frame = +3

Query  138  SGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFL  317
               W F FG+LGN+ISF VFLSP+PTFY+I+KKK+ EG+QS+PYVVALFS+ LW+YYA  
Sbjct  7    ENTWAFVFGLLGNVISFAVFLSPVPTFYRIWKKKTTEGFQSLPYVVALFSATLWLYYATQ  66

Query  318  KSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLF  497
            K +  LL+TIN+FGC +ETIYI  ++ YA K AR+ T+K+L+L+   GF  + L+ QFL 
Sbjct  67   KKDVFLLVTINAFGCFIETIYISMFLAYATKPARMLTVKILLLMNFGGFCIILLICQFLV  126

Query  498  KSAPVRAQVVGWVCLVFSLCVFVAPLCIV  584
            K A  RA+++G +C+ FS+CVF APL I+
Sbjct  127  KGA-TRAKIIGGICVGFSVCVFAAPLSII  154



>gb|ACG28570.1| MTN3 [Zea mays]
Length=295

 Score =   179 bits (455),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/156 (55%), Positives = 121/156 (78%), Gaps = 1/156 (1%)
 Frame = +3

Query  129  MALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYY  308
            ++L   W F FG+LGN+ISF+ FL+P+PTFY+IYK KS EG+QS+PYVVALFS+MLWI+Y
Sbjct  4    LSLQHPWAFTFGLLGNVISFMTFLAPIPTFYRIYKSKSTEGFQSVPYVVALFSAMLWIFY  63

Query  309  AFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQ  488
            A +KSN T LITIN+ GC++ET+Y+  Y  YA KK R+ T K+++LL +  FG++ L++ 
Sbjct  64   ALIKSNETFLITINAAGCVIETVYVVMYFVYATKKGRMFTAKIMLLLNVGAFGSILLLTL  123

Query  489  FLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
             LFK    R  ++GW+C+ FS+ VFVAPL I+++VI
Sbjct  124  LLFKGDK-RVVMLGWICVGFSVSVFVAPLSIMRRVI  158



>ref|XP_011023931.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Populus 
euphratica]
 ref|XP_011023932.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Populus 
euphratica]
Length=258

 Score =   178 bits (452),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 88/156 (56%), Positives = 120/156 (77%), Gaps = 1/156 (1%)
 Frame = +3

Query  129  MALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYY  308
            MAL   WVF FG+LGNIIS +V L+PLPTFY+I KKK+++G+ SIPYV+ALFS+MLW++Y
Sbjct  1    MALHLTWVFGFGLLGNIISCLVCLAPLPTFYRICKKKTSQGFHSIPYVIALFSAMLWLFY  60

Query  309  AFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQ  488
            A  K +A LLITINSF   +E  YI  Y++YA KK ++ T K+L+L  + GFG + ++++
Sbjct  61   ALYKEDALLLITINSFTFFMEIGYIFMYLFYATKKDKILTFKLLLLFNVFGFGLICVLTR  120

Query  489  FLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            FL +    R QV+GW+C+ FSLCVFVAPL IV++VI
Sbjct  121  FLTQRQK-RVQVLGWICMTFSLCVFVAPLFIVRKVI  155



>ref|XP_010426372.1| PREDICTED: bidirectional sugar transporter SWEET11 [Camelina 
sativa]
Length=292

 Score =   179 bits (454),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/153 (56%), Positives = 117/153 (76%), Gaps = 1/153 (1%)
 Frame = +3

Query  138  SGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFL  317
               W F FG+LGN+ISF VFLSP+PTFY+I+KKK+ EG+QS+PYVVALFS+ LW+YYA  
Sbjct  7    ENTWAFVFGLLGNVISFAVFLSPVPTFYRIWKKKTTEGFQSLPYVVALFSATLWLYYATQ  66

Query  318  KSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLF  497
            K +  LL+TIN+FGC +ETIYI  ++ YA K AR+ T+K+L+L+   GF  + L+ QFL 
Sbjct  67   KKDVFLLVTINAFGCFIETIYISMFLAYAPKPARMLTVKILLLMNFGGFCIILLICQFLV  126

Query  498  KSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            K A  RA+++G +C+ FS+CVF APL I++ VI
Sbjct  127  KGA-TRAKIIGGICVGFSVCVFAAPLSIIRTVI  158



>ref|XP_009150178.1| PREDICTED: bidirectional sugar transporter SWEET11-like [Brassica 
rapa]
Length=285

 Score =   179 bits (454),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/150 (57%), Positives = 117/150 (78%), Gaps = 1/150 (1%)
 Frame = +3

Query  147  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  326
            W F FG++GN+ISF VFLSP+PTFY+++KKK+ EG+QS+PYVVALFS+ LW+YYA  K +
Sbjct  10   WAFVFGLMGNVISFAVFLSPVPTFYRVWKKKTTEGFQSLPYVVALFSATLWLYYATQKKD  69

Query  327  ATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSA  506
              LL+TINSFGC +ETIYI  ++ YA KKAR+ T+K+L+L+   GF  + L+ QFL K  
Sbjct  70   VFLLVTINSFGCFIETIYISIFLAYAPKKARMLTVKLLLLMNFGGFCLILLLCQFLAKGT  129

Query  507  PVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
              RA+++G +C+ FS+CVF APL I++ VI
Sbjct  130  -TRAKIIGGICVGFSVCVFAAPLSIIRTVI  158



>emb|CDY05867.1| BnaC08g20440D [Brassica napus]
Length=289

 Score =   179 bits (454),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/150 (57%), Positives = 117/150 (78%), Gaps = 1/150 (1%)
 Frame = +3

Query  147  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  326
            W F FG++GN+ISF VFLSP+PTFY+++KKK+ EG+QS+PYVVALFS+ LW+YYA  K +
Sbjct  10   WAFVFGLMGNVISFSVFLSPVPTFYRVWKKKTTEGFQSLPYVVALFSATLWLYYATQKKD  69

Query  327  ATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSA  506
              LL+TINSFGC +ETIYI  ++ YA KKAR+ T+K+L+L+   GF  + L+ QFL K  
Sbjct  70   VFLLVTINSFGCFIETIYISIFLAYAPKKARMLTVKLLLLMNFGGFCLILLLCQFLAKGT  129

Query  507  PVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
              RA+++G +C+ FS+CVF APL I++ VI
Sbjct  130  -TRAKIIGGICVGFSVCVFAAPLSIIRTVI  158



>emb|CDY08093.1| BnaA06g16330D [Brassica napus]
Length=289

 Score =   179 bits (454),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/150 (57%), Positives = 117/150 (78%), Gaps = 1/150 (1%)
 Frame = +3

Query  147  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  326
            W F FG++GN+ISF VFLSP+PTFY+++KKK+ EG+QS+PYVVALFS+ LW+YYA  K +
Sbjct  10   WAFVFGLMGNVISFSVFLSPVPTFYRVWKKKTTEGFQSLPYVVALFSATLWLYYATQKKD  69

Query  327  ATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSA  506
              LL+TINSFGC +ETIYI  ++ YA KKAR+ T+K+L+L+   GF  + L+ QFL K  
Sbjct  70   VFLLVTINSFGCFIETIYISIFLAYAPKKARMLTVKLLLLMNFGGFCLILLLCQFLAKGT  129

Query  507  PVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
              RA+++G +C+ FS+CVF APL I++ VI
Sbjct  130  -TRAKIIGGICVGFSVCVFAAPLSIIRTVI  158



>ref|XP_010503515.1| PREDICTED: bidirectional sugar transporter SWEET11-like [Camelina 
sativa]
Length=294

 Score =   179 bits (454),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/153 (56%), Positives = 117/153 (76%), Gaps = 1/153 (1%)
 Frame = +3

Query  138  SGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFL  317
               W F FG+LGN+ISF VFLSP+PTFY+I+KKK+ EG+QS+PYVVALFS+ LW+YYA  
Sbjct  7    ENTWAFVFGLLGNVISFAVFLSPVPTFYRIWKKKTTEGFQSLPYVVALFSATLWLYYATQ  66

Query  318  KSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLF  497
            K +  LL+TIN+FGC +ETIYI  ++ YA K AR+ T+K+L+L+   GF  + L+ QFL 
Sbjct  67   KKDVFLLVTINAFGCFIETIYISMFLAYAPKPARMLTVKILLLMNFGGFCIILLICQFLV  126

Query  498  KSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            K A  RA+++G +C+ FS+CVF APL I++ VI
Sbjct  127  KGA-TRAKIIGGICVGFSVCVFAAPLSIIRTVI  158



>ref|XP_011023934.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Populus 
euphratica]
Length=283

 Score =   179 bits (453),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 89/156 (57%), Positives = 119/156 (76%), Gaps = 1/156 (1%)
 Frame = +3

Query  129  MALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYY  308
            MAL   W+ AFG+LGN+IS +V L+PLPTFYQIYKKK++EG+QSIPYV+ALFS+MLW++Y
Sbjct  1    MALHLTWMLAFGLLGNLISCLVCLAPLPTFYQIYKKKTSEGFQSIPYVIALFSAMLWLFY  60

Query  309  AFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQ  488
            A    +A LLITIN+F   +E  YI  Y+ YA KK ++ T K+L+L    GFG + L++ 
Sbjct  61   AIFSEDAILLITINTFAFFMEFGYIVVYLLYATKKDKILTFKLLLLFNSFGFGLICLLTL  120

Query  489  FLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            FL +    R QV+GW+C++FSLCVFVAPL IV++VI
Sbjct  121  FLTQGQK-RVQVLGWICMIFSLCVFVAPLFIVREVI  155



>gb|KHN31280.1| Bidirectional sugar transporter SWEET14-like protein [Glycine 
soja]
Length=316

 Score =   179 bits (455),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/156 (55%), Positives = 118/156 (76%), Gaps = 1/156 (1%)
 Frame = +3

Query  129  MALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYY  308
            M+   H  FAFGVLGNI SF+ FL+PLPTFY++ KKKS EG+QSIPYV ALFS+MLWI+Y
Sbjct  1    MSSHSHLSFAFGVLGNIASFVCFLAPLPTFYRVCKKKSTEGFQSIPYVAALFSAMLWIFY  60

Query  309  AFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQ  488
            A++K+   LLITIN+FGC++ETIY+  +I Y  KKAR+ T++M+VLL   GF  + L++ 
Sbjct  61   AYVKTGEMLLITINAFGCVIETIYLAVFITYCPKKARMSTLRMIVLLNFGGFCTIVLLTH  120

Query  489  FLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
             L +    R +++GW+C+VF+  VF APL I++ VI
Sbjct  121  LLAEGEG-RVKLLGWICVVFATSVFAAPLSIIRVVI  155



>gb|EMT20808.1| Protein RUPTURED POLLEN GRAIN 1 [Aegilops tauschii]
Length=290

 Score =   179 bits (453),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 90/172 (52%), Positives = 124/172 (72%), Gaps = 14/172 (8%)
 Frame = +3

Query  81   LGGL*IR*SSRHPDRSMALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQS  260
            +GGL    S  HP         W FAFG+LGN+ISF   L+P+PTFY+I+K KS EG+QS
Sbjct  1    MGGL----SMEHP---------WAFAFGLLGNVISFSSLLAPIPTFYRIFKSKSTEGFQS  47

Query  261  IPYVVALFSSMLWIYYAFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKML  440
            +PYVVALFS+MLWI+YA +K+   LLI+IN+ GC++ET+YI  Y+ YA++KA++ T K++
Sbjct  48   VPYVVALFSAMLWIFYALVKTGEGLLISINAAGCVIETVYIVMYLVYADRKAKIFTAKIV  107

Query  441  VLLVIVGFGAVALVSQFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            VLL I GFG + L++ F F     R   +GW+C+ FS+CVFVAPL I+ +VI
Sbjct  108  VLLNIAGFGLIFLLTLFAFHGE-TRVVTLGWICVGFSVCVFVAPLSIIGRVI  158



>gb|AAM65058.1| MtN3-like protein [Arabidopsis thaliana]
Length=294

 Score =   179 bits (453),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 91/158 (58%), Positives = 121/158 (77%), Gaps = 3/158 (2%)
 Frame = +3

Query  129  MALSGH-WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIY  305
            MAL+ + W F FG+LGNIISF+VFL+P+PTF +I KKKS EG+QS+PYV ALFS+MLWIY
Sbjct  1    MALTNNLWAFVFGILGNIISFVVFLAPVPTFVRICKKKSTEGFQSLPYVSALFSAMLWIY  60

Query  306  YAFLKS-NATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALV  482
            YA  K   A LLITIN+FGC++ETIYI  ++ YANKK R+ T+K+L LL  +GF A+ LV
Sbjct  61   YAMQKDGTAFLLITINAFGCVIETIYIVLFVSYANKKTRISTLKVLGLLNFLGFAAIVLV  120

Query  483  SQFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
             + L K +  R +V+G +C+ FS+ VF APL I++ V+
Sbjct  121  CZLLTKGS-TREKVLGGICVGFSVSVFAAPLSIMRVVV  157



>ref|NP_001149087.1| MTN3 [Zea mays]
 gb|ACF85462.1| unknown [Zea mays]
 gb|ACG34136.1| MTN3 [Zea mays]
 gb|AFW56330.1| MTN3 [Zea mays]
Length=302

 Score =   179 bits (454),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 90/156 (58%), Positives = 122/156 (78%), Gaps = 1/156 (1%)
 Frame = +3

Query  129  MALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYY  308
            M+L   W FAFG+LGN+ISF+ FL+P+PTFY+IYK KS EG+QS+PYVVALFS+MLWI+Y
Sbjct  4    MSLQHPWAFAFGLLGNVISFMTFLAPIPTFYRIYKSKSTEGFQSVPYVVALFSAMLWIFY  63

Query  309  AFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQ  488
            A +KSN T LITIN+ GC++ETIY+  Y  YA KKA++ T K++VLL    FG + L++ 
Sbjct  64   ALIKSNETFLITINAAGCVIETIYVVMYFVYAPKKAKLFTAKIMVLLNGGVFGVILLLTL  123

Query  489  FLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
             LFK +  R  ++GW+C+ FS+ VFVAPL I+++VI
Sbjct  124  LLFKGSK-RVVLLGWICVGFSVSVFVAPLSIMRRVI  158



>ref|NP_001067955.1| Os11g0508600 [Oryza sativa Japonica Group]
 sp|Q2R3P9.1|SWT14_ORYSJ RecName: Full=Bidirectional sugar transporter SWEET14; Short=OsSWEET14 
[Oryza sativa Japonica Group]
 gb|ABA93969.1| nodulin MtN3 family protein, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF28318.1| Os11g0508600 [Oryza sativa Japonica Group]
 gb|EAZ18482.1| hypothetical protein OsJ_34008 [Oryza sativa Japonica Group]
 dbj|BAG95290.1| unnamed protein product [Oryza sativa Japonica Group]
Length=303

 Score =   179 bits (454),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 93/156 (60%), Positives = 119/156 (76%), Gaps = 1/156 (1%)
 Frame = +3

Query  129  MALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYY  308
            M+L   W FAFG+LGNIISF+ +L+PLPTFY+IYK KS +G+QS+PYVVALFS+MLWIYY
Sbjct  4    MSLQHPWAFAFGLLGNIISFMTYLAPLPTFYRIYKSKSTQGFQSVPYVVALFSAMLWIYY  63

Query  309  AFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQ  488
            A LKS+  LLITINS GC++ETIYI  Y+ YA KKA++ T K+L LLV VG   + L+  
Sbjct  64   ALLKSDECLLITINSAGCVIETIYIAVYLVYAPKKAKMFTAKLL-LLVNVGVFGLILLLT  122

Query  489  FLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
             L  +   R  V+GWVC+ FS+ VFVAPL I++ V+
Sbjct  123  LLLSAGDRRIVVLGWVCVGFSVSVFVAPLSIIRLVV  158



>gb|EMT11081.1| Protein RUPTURED POLLEN GRAIN 1 [Aegilops tauschii]
Length=285

 Score =   178 bits (452),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/157 (54%), Positives = 119/157 (76%), Gaps = 1/157 (1%)
 Frame = +3

Query  126  SMALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIY  305
             ++L   W FAFG+LGNIISF   L+P+PTFY+I+K KS EG+QS+PYVVALFS+MLWI+
Sbjct  3    GLSLEHPWAFAFGLLGNIISFTSLLAPIPTFYRIFKSKSTEGFQSVPYVVALFSAMLWIF  62

Query  306  YAFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVS  485
            YA +K+   LLI+IN+ GC++ET+YI  Y+ YA +KA++ T K++VLL + GFG + L++
Sbjct  63   YALVKTGEGLLISINAAGCVIETVYIVMYLVYAPRKAKIFTAKIVVLLNVAGFGLILLLT  122

Query  486  QFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
             F F     R   +GW+C+ FS+CVFVAPL I+ +VI
Sbjct  123  LFAFHGE-TRVISLGWICVGFSVCVFVAPLSIIGRVI  158



>sp|B8BKP4.1|SWT14_ORYSI RecName: Full=Bidirectional sugar transporter SWEET14; Short=OsSWEET14 
[Oryza sativa Indica Group]
 gb|EEC68230.1| hypothetical protein OsI_36230 [Oryza sativa Indica Group]
Length=303

 Score =   179 bits (453),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 93/156 (60%), Positives = 119/156 (76%), Gaps = 1/156 (1%)
 Frame = +3

Query  129  MALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYY  308
            M+L   W FAFG+LGNIISF+ +L+PLPTFY+IYK KS +G+QS+PYVVALFS+MLWIYY
Sbjct  4    MSLQHPWAFAFGLLGNIISFMTYLAPLPTFYRIYKSKSTQGFQSVPYVVALFSAMLWIYY  63

Query  309  AFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQ  488
            A LKS+  LLITINS GC++ETIYI  Y+ YA KKA++ T K+L LLV VG   + L+  
Sbjct  64   ALLKSDECLLITINSAGCVIETIYIAVYLVYAPKKAKMFTAKLL-LLVNVGVFGLILLLT  122

Query  489  FLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
             L  +   R  V+GWVC+ FS+ VFVAPL I++ V+
Sbjct  123  LLLSAGDRRIVVLGWVCVGFSVSVFVAPLSIIRLVV  158



>ref|XP_006444236.1| hypothetical protein CICLE_v10023774mg [Citrus clementina]
 gb|ESR57476.1| hypothetical protein CICLE_v10023774mg [Citrus clementina]
Length=275

 Score =   178 bits (451),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 89/158 (56%), Positives = 122/158 (77%), Gaps = 2/158 (1%)
 Frame = +3

Query  129  MALSG-HWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIY  305
            MA+ G H V  FG+LGNI+SF+V+L+PLPTFY+I+KKKS +G+QSIPY VALFS+ML +Y
Sbjct  1    MAILGPHSVIIFGLLGNIVSFLVYLAPLPTFYRIFKKKSTQGFQSIPYSVALFSAMLLLY  60

Query  306  YAFLK-SNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALV  482
            YA LK SNA +LITIN  GC++E++Y+ F++ YA K A++ T K+L+L  I   G + L+
Sbjct  61   YASLKGSNAFMLITINGIGCIIESLYLLFFMIYATKTAKIYTTKLLILFNIGALGLIVLL  120

Query  483  SQFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            +  L KS+  R  +VGW+C VFS+CVF APL I++QVI
Sbjct  121  TYLLSKSSDQRLTIVGWICAVFSVCVFAAPLSIIRQVI  158



>ref|XP_008791098.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Phoenix 
dactylifera]
Length=296

 Score =   179 bits (453),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 87/156 (56%), Positives = 123/156 (79%), Gaps = 0/156 (0%)
 Frame = +3

Query  129  MALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYY  308
            ++L   W F FG+LGNIISF+V+++PLPTFY++Y KKS EG+QS+PYVVALFS+MLWIYY
Sbjct  4    LSLDHPWAFTFGILGNIISFMVYVAPLPTFYRVYIKKSTEGFQSVPYVVALFSAMLWIYY  63

Query  309  AFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQ  488
            A +K+++ LL+TINS GC++ET+YI  Y+ YA KKAR+ T ++L+LL +  FG + L++ 
Sbjct  64   ALIKTDSYLLVTINSIGCIIETMYIIMYLSYAPKKARIFTAQILLLLNVGLFGLIVLLTL  123

Query  489  FLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
             L K    + +V+GWVC+ FS+ VFVAPL I++ VI
Sbjct  124  LLAKGPREQVRVLGWVCVSFSISVFVAPLSIIRLVI  159



>ref|XP_008392727.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Malus 
domestica]
Length=295

 Score =   179 bits (453),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/160 (54%), Positives = 122/160 (76%), Gaps = 5/160 (3%)
 Frame = +3

Query  129  MALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYY  308
            MAL      AFG+LGNIIS +VFL+P+PTFY +YKKK+ EG+Q++PYV+ L SSM+++YY
Sbjct  1    MALHHTLSLAFGLLGNIISLLVFLAPVPTFYTVYKKKTTEGFQALPYVIGLLSSMMYVYY  60

Query  309  AF----LKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVA  476
            A     LK +ATL+ITINS GC++ETIYI  +++YA KKAR+ T  +L LL +  +G + 
Sbjct  61   ALLKEELKEDATLVITINSVGCVIETIYIXLFLFYAPKKARISTATLLFLLNLFSYGMMV  120

Query  477  LVSQFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            ++++FL  +   R ++VGW+CLVFSL VFVAPL +++QVI
Sbjct  121  VLTRFL-ATGETRFKIVGWICLVFSLSVFVAPLGVLRQVI  159



>ref|XP_009411801.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Musa 
acuminata subsp. malaccensis]
Length=281

 Score =   178 bits (451),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 119/148 (80%), Gaps = 1/148 (1%)
 Frame = +3

Query  153  FAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNAT  332
            F FG+LGN+ISF+VFL+P+PTFY++Y+KKS EG+ S+PYVVA+FS MLWIYYA++K+++ 
Sbjct  12   FTFGMLGNLISFMVFLAPIPTFYRVYRKKSTEGFHSLPYVVAVFSCMLWIYYAYVKTDSI  71

Query  333  LLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAPV  512
            LLITINSFG  +ET YI  Y+ YA KK R+ ++++ VLL +V F A+ L++Q LF +  +
Sbjct  72   LLITINSFGVFIETAYITIYLIYAPKKTRIMSMRIFVLLNVVVFAAIILLTQLLF-TGSI  130

Query  513  RAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            R +V+GW+C+ FS+ VF APL +++ VI
Sbjct  131  RLKVLGWICVGFSVSVFAAPLSVIRLVI  158



>ref|XP_002321731.1| N3 like family protein [Populus trichocarpa]
 gb|EEF05858.1| N3 like family protein [Populus trichocarpa]
Length=283

 Score =   178 bits (452),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/156 (56%), Positives = 119/156 (76%), Gaps = 1/156 (1%)
 Frame = +3

Query  129  MALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYY  308
            MAL   W+ AFG+LGN+IS +V L+PLPTFYQIYKKK++EG+QSIPYV+ALFS+MLW++Y
Sbjct  1    MALHLTWMLAFGLLGNLISCLVCLAPLPTFYQIYKKKTSEGFQSIPYVIALFSAMLWLFY  60

Query  309  AFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQ  488
            A    +A LLITIN+F   +E  YI  Y+ YA KK ++ T K+L+L    GFG + +++ 
Sbjct  61   AIFSEDAILLITINTFAFFMEFGYITVYLLYATKKDKILTFKLLLLFNSFGFGLICVLTL  120

Query  489  FLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            FL +    R QV+GW+C++FSLCVFVAPL IV++VI
Sbjct  121  FLTQGQK-RVQVLGWICMIFSLCVFVAPLFIVREVI  155



>ref|XP_009337540.1| PREDICTED: bidirectional sugar transporter NEC1 [Pyrus x bretschneideri]
Length=295

 Score =   178 bits (452),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 86/160 (54%), Positives = 121/160 (76%), Gaps = 5/160 (3%)
 Frame = +3

Query  129  MALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYY  308
            MAL      AFG+LGNIIS +VFL+P+PTFY +YKKK+ EG+Q++PYV+ L SSM++IYY
Sbjct  1    MALHHTLTLAFGLLGNIISLLVFLAPVPTFYTVYKKKTTEGFQALPYVIGLLSSMMYIYY  60

Query  309  AF----LKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVA  476
            A     LK +ATL+ITINS GC++ETIYI  +++YA KKAR+ T  +L LL +  +G + 
Sbjct  61   ALLKEELKEDATLVITINSVGCVIETIYISLFLFYAPKKARISTAMLLFLLNLFSYGMMV  120

Query  477  LVSQFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            ++++FL  +   R ++V W+CLVFSL VFVAPL +++QVI
Sbjct  121  VLTRFL-ATGETRFKIVAWICLVFSLSVFVAPLGVLRQVI  159



>ref|XP_004161953.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Cucumis 
sativus]
 gb|KGN64434.1| hypothetical protein Csa_1G051720 [Cucumis sativus]
Length=291

 Score =   178 bits (452),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 91/164 (55%), Positives = 119/164 (73%), Gaps = 10/164 (6%)
 Frame = +3

Query  105  SSRHPDRSMALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALF  284
             + HP          VFAFG+LGNIISFIVFL+P+PTF +I KKKS EG+QS+PYVVALF
Sbjct  5    DTHHPG---------VFAFGLLGNIISFIVFLAPVPTFMRICKKKSTEGFQSVPYVVALF  55

Query  285  SSMLWIYYAFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGF  464
            S+MLW+YYA   SN TLLITINS GCL+ET+YI  +I +A K+ RV T++ ++LL   GF
Sbjct  56   SAMLWLYYASFNSNETLLITINSVGCLIETLYIAIFIVFAPKQIRVSTLRFVLLLNFGGF  115

Query  465  GAVALVSQFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
              + LV+ FL   +  + +VVGW+C+ FS+ VF APL I++ VI
Sbjct  116  CIILLVTHFLVHGSN-QVKVVGWICVAFSVSVFAAPLTIMRLVI  158



>ref|XP_008440025.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Cucumis 
melo]
Length=291

 Score =   178 bits (452),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 91/164 (55%), Positives = 119/164 (73%), Gaps = 10/164 (6%)
 Frame = +3

Query  105  SSRHPDRSMALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALF  284
             + HP          VFAFG+LGNIISFIVFL+P+PTF +I KKKS EG+QS+PYVVALF
Sbjct  5    DTHHPG---------VFAFGLLGNIISFIVFLAPVPTFMRICKKKSTEGFQSVPYVVALF  55

Query  285  SSMLWIYYAFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGF  464
            S+MLW+YYA   SN TLLITINS GCL+ET+YI  +I +A K+ RV T++ ++LL   GF
Sbjct  56   SAMLWLYYASFNSNETLLITINSVGCLIETLYIAIFIVFAPKQIRVSTLRFVLLLNFGGF  115

Query  465  GAVALVSQFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
              + LV+ FL   +  + +VVGW+C+ FS+ VF APL I++ VI
Sbjct  116  CIILLVTHFLVHGSN-QVKVVGWICVAFSVSVFAAPLTIMRLVI  158



>ref|XP_002321730.2| N3 like family protein [Populus trichocarpa]
 gb|EEF05857.2| N3 like family protein [Populus trichocarpa]
Length=269

 Score =   177 bits (450),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 89/156 (57%), Positives = 116/156 (74%), Gaps = 1/156 (1%)
 Frame = +3

Query  129  MALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYY  308
            MAL   WVF FG+LGNIIS +V L+PLPTFYQI KKK+++G+QSIPYV+ALFS+MLW++Y
Sbjct  1    MALHFTWVFGFGLLGNIISCLVCLAPLPTFYQICKKKTSQGFQSIPYVIALFSAMLWLFY  60

Query  309  AFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQ  488
            A    NA LLITINSF   +E  YI  Y++YA KK ++ T K+L+L  I GFG +  +S 
Sbjct  61   ASFSENAMLLITINSFAFFMEIGYIAVYLFYATKKDKILTFKLLLLFNIFGFGLICALS-  119

Query  489  FLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
             L      R  V+GW+C+VF+LCVFVAPL +V++VI
Sbjct  120  LLLTEGTKRVHVLGWICMVFALCVFVAPLGVVRKVI  155



>gb|KDO87388.1| hypothetical protein CISIN_1g036251mg [Citrus sinensis]
Length=275

 Score =   177 bits (450),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 89/158 (56%), Positives = 122/158 (77%), Gaps = 2/158 (1%)
 Frame = +3

Query  129  MALSG-HWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIY  305
            MA+ G H V  FG+LGNI+SF+V+L+PLPTFY+I+KKKS +G+QSIPY VALFS+ML +Y
Sbjct  1    MAILGPHSVIIFGLLGNIVSFLVYLAPLPTFYRIFKKKSTQGFQSIPYSVALFSAMLLLY  60

Query  306  YAFLK-SNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALV  482
            YA LK SNA +LITIN  GC++E++Y+ F++ YA K A++ T K+L+L  I   G + L+
Sbjct  61   YASLKGSNAFMLITINGIGCIIESLYLLFFMIYATKTAKIYTTKLLILFNIGALGLIVLL  120

Query  483  SQFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            +  L KS+  R  +VGW+C VFS+CVF APL I++QVI
Sbjct  121  TYLLSKSSDQRLTIVGWICAVFSVCVFAAPLSIIRQVI  158



>ref|XP_006376915.1| hypothetical protein POPTR_0012s10500g, partial [Populus trichocarpa]
 gb|ERP54712.1| hypothetical protein POPTR_0012s10500g, partial [Populus trichocarpa]
Length=271

 Score =   177 bits (449),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 89/157 (57%), Positives = 118/157 (75%), Gaps = 1/157 (1%)
 Frame = +3

Query  126  SMALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIY  305
             MAL   WVF FG+LGNIIS +V LSPLPTFYQI KKK++EG+QSIPYV+ALFS+MLW++
Sbjct  1    EMALHLTWVFGFGLLGNIISCLVCLSPLPTFYQICKKKTSEGFQSIPYVIALFSAMLWLF  60

Query  306  YAFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVS  485
            YA  K +  LLITINSF   +   YI  Y++YA KK ++ T K+L+L  + GFG V +++
Sbjct  61   YAIFKKDTILLITINSFAFFMAIGYIVVYLFYATKKDKILTFKLLLLFNVFGFGLVCVLT  120

Query  486  QFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
             FL +    R QV+GW+C++FS+CVFVAPL I ++VI
Sbjct  121  LFLTQGHK-RVQVLGWICMIFSICVFVAPLFIARKVI  156



>gb|EMS46194.1| Bidirectional sugar transporter SWEET15 [Triticum urartu]
Length=345

 Score =   179 bits (455),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 85/150 (57%), Positives = 114/150 (76%), Gaps = 1/150 (1%)
 Frame = +3

Query  147  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  326
            W F FG+LGNIIS +VFLSPLPTFY++Y+KKS EG+QS PY+V LFS +LW+YYAFLKS 
Sbjct  11   WAFTFGILGNIISLMVFLSPLPTFYRVYRKKSTEGFQSTPYLVTLFSCLLWMYYAFLKSG  70

Query  327  ATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSA  506
            + LL+TIN+ GC++E++YI  Y+ YA K AR+ T K+ + L +  FG +ALV+  L    
Sbjct  71   SELLLTINAVGCVIESLYIAMYLVYAPKSARLLTAKLFIGLDVGLFGLIALVT-MLASHG  129

Query  507  PVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            P+R QVVGW+C+  +L VF APL I++ VI
Sbjct  130  PLRVQVVGWICVAVALGVFAAPLSIIRLVI  159



>ref|XP_010235464.1| PREDICTED: bidirectional sugar transporter SWEET15 [Brachypodium 
distachyon]
Length=309

 Score =   178 bits (452),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 86/150 (57%), Positives = 112/150 (75%), Gaps = 1/150 (1%)
 Frame = +3

Query  147  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  326
            W F FG+LGNIIS +VFLSPLPTFY++Y+KKS EG+QS PYVV LFS +LW+YYAFLKS 
Sbjct  11   WAFTFGILGNIISLMVFLSPLPTFYRVYRKKSTEGFQSTPYVVTLFSCLLWMYYAFLKSG  70

Query  327  ATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSA  506
            A LL+TIN  GC +ET+YI  Y+ YA K AR+ T K+ + L +  FG +ALV+  L  + 
Sbjct  71   AELLLTINGVGCGIETLYIAMYLIYAPKSARLLTAKLFLGLDVGLFGLIALVT-MLVSAG  129

Query  507  PVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
             +R Q+VGW+C+  +L VF APL I++ VI
Sbjct  130  TLRVQIVGWICVAVALGVFAAPLSIIRLVI  159



>ref|NP_199893.1| bidirectional sugar transporter SWEET13 [Arabidopsis thaliana]
 sp|Q9FGQ2.1|SWT13_ARATH RecName: Full=Bidirectional sugar transporter SWEET13; Short=AtSWEET13 
[Arabidopsis thaliana]
 dbj|BAB08903.1| MtN3-like protein [Arabidopsis thaliana]
 gb|AED95993.1| bidirectional sugar transporter SWEET13 [Arabidopsis thaliana]
Length=294

 Score =   178 bits (451),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 91/158 (58%), Positives = 121/158 (77%), Gaps = 3/158 (2%)
 Frame = +3

Query  129  MALSGH-WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIY  305
            MAL+ + W F FG+LGNIISF+VFL+P+PTF +I KKKS EG+QS+PYV ALFS+MLWIY
Sbjct  1    MALTNNLWAFVFGILGNIISFVVFLAPVPTFVRICKKKSTEGFQSLPYVSALFSAMLWIY  60

Query  306  YAFLKS-NATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALV  482
            YA  K   A LLITIN+FGC++ETIYI  ++ YANKK R+ T+K+L LL  +GF A+ LV
Sbjct  61   YAMQKDGTAFLLITINAFGCVIETIYIVLFVSYANKKTRISTLKVLGLLNFLGFAAIVLV  120

Query  483  SQFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
             + L K +  R +V+G +C+ FS+ VF APL I++ V+
Sbjct  121  CELLTKGS-TREKVLGGICVGFSVSVFAAPLSIMRVVV  157



>ref|XP_011071246.1| PREDICTED: bidirectional sugar transporter N3 [Sesamum indicum]
Length=297

 Score =   178 bits (451),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 87/150 (58%), Positives = 116/150 (77%), Gaps = 1/150 (1%)
 Frame = +3

Query  147  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  326
            W F FGVLGNIIS  V+L+PLPTF++IYK++S  G+ S+PYVVALFS+MLW+YYAFLK+N
Sbjct  10   WAFTFGVLGNIISVFVYLAPLPTFFRIYKERSTMGFDSLPYVVALFSAMLWMYYAFLKTN  69

Query  327  ATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSA  506
            A LLI+IN FGC++E IYI  Y++YA+KKAR  T K+L L+ +     + L++ F+FK  
Sbjct  70   AILLISINLFGCVIEAIYIFIYLFYASKKARTHTAKLLSLINVGLLALIFLLTFFIFK-G  128

Query  507  PVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            P+R  VVGW+C+  S+ VF APL IV QV+
Sbjct  129  PIRVHVVGWICVAVSVSVFAAPLTIVFQVV  158



>gb|EMT03611.1| Protein RUPTURED POLLEN GRAIN 1 [Aegilops tauschii]
Length=294

 Score =   177 bits (450),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 90/172 (52%), Positives = 123/172 (72%), Gaps = 14/172 (8%)
 Frame = +3

Query  81   LGGL*IR*SSRHPDRSMALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQS  260
            +GGL    S  HP         W FAFG+LGN+ISF   L+P+PTFY+I+K KS EG+QS
Sbjct  1    MGGL----SMEHP---------WAFAFGLLGNVISFSSLLAPIPTFYRIFKSKSTEGFQS  47

Query  261  IPYVVALFSSMLWIYYAFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKML  440
            +PYVVALFS+MLWI+YA +K+   LLI+IN+ GC++ET+YI  Y+ YA +KA++ T K++
Sbjct  48   VPYVVALFSAMLWIFYALVKTGEGLLISINAAGCVIETVYIVMYLVYAPRKAKIFTAKIV  107

Query  441  VLLVIVGFGAVALVSQFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            VLL I GFG + L++ F F     R   +GW+C+ FS+CVFVAPL I+ +VI
Sbjct  108  VLLNIAGFGLIFLLTLFAFHGE-TRVVTLGWICVGFSVCVFVAPLSIIGRVI  158



>ref|XP_002303766.2| hypothetical protein POPTR_0003s16520g [Populus trichocarpa]
 gb|EEE78745.2| hypothetical protein POPTR_0003s16520g [Populus trichocarpa]
Length=287

 Score =   177 bits (449),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 117/151 (77%), Gaps = 1/151 (1%)
 Frame = +3

Query  144  HWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKS  323
            H  F FG+LGNIIS +V+L+P+PTF +I+KKKS E +QS+PY++ALFSSMLW+YYA LK 
Sbjct  8    HLAFTFGILGNIISTMVYLAPVPTFIRIFKKKSTEDFQSLPYLMALFSSMLWLYYAMLKK  67

Query  324  NATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKS  503
            +  LL+TINSFGC++ET YI  YI YA +++RV TIK+L+ + +  F  + L++ FL  S
Sbjct  68   DTILLVTINSFGCVIETTYIAIYIVYATRESRVSTIKLLISMNLGLFSLILLLAHFLV-S  126

Query  504  APVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
              VR +V+GW+C+  S+CVF APL I+KQVI
Sbjct  127  GSVRVKVLGWLCVALSVCVFAAPLNILKQVI  157



>gb|KJB40042.1| hypothetical protein B456_007G043800 [Gossypium raimondii]
Length=298

 Score =   177 bits (450),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 87/150 (58%), Positives = 119/150 (79%), Gaps = 1/150 (1%)
 Frame = +3

Query  147  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  326
            WVF  G+LGNI S +VFL+PLPTF ++ KKKS EG+QSIPYVV+LFS+MLWIYYA++K+ 
Sbjct  10   WVFISGLLGNISSLVVFLAPLPTFIRVCKKKSTEGFQSIPYVVSLFSAMLWIYYAYVKTG  69

Query  327  ATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSA  506
            A LLITINSFGC++ET+YI  YI YA K+AR+ T+++L++L    F A+ L++ FL K +
Sbjct  70   AFLLITINSFGCVIETLYIALYITYAPKEARIFTLRILLMLDFGVFCAILLITHFLAKGS  129

Query  507  PVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
              R Q++GW+ +VF+  VF APL I++QVI
Sbjct  130  N-RVQLLGWISVVFATSVFAAPLSIIRQVI  158



>ref|XP_004174114.1| PREDICTED: bidirectional sugar transporter SWEET12-like, partial 
[Cucumis sativus]
Length=195

 Score =   174 bits (442),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 92/160 (58%), Positives = 124/160 (78%), Gaps = 5/160 (3%)
 Frame = +3

Query  129  MALS--GH--WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSML  296
            MALS   H  W+FAFG+LGNI SFIVFL+P+PTF ++ +KKS EG+QSIPYVVALFS++L
Sbjct  1    MALSFMNHNPWIFAFGLLGNIFSFIVFLAPVPTFIRVCRKKSTEGFQSIPYVVALFSALL  60

Query  297  WIYYAFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVA  476
             IYY+ L ++   L+TINS GC +ETIYI  YI YA KKAR+ T++ ++LL +VGF ++ 
Sbjct  61   LIYYSTLNADEFFLMTINSVGCFIETIYIALYIAYAPKKARIFTVRFVLLLDVVGFCSIL  120

Query  477  LVSQFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            +V+QFL K A  RA+V+G++C   S+ VF APL I+K+VI
Sbjct  121  VVTQFLVKRA-YRARVIGFICGGLSVSVFAAPLSIMKRVI  159



>ref|XP_004145147.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Cucumis 
sativus]
Length=295

 Score =   177 bits (449),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 88/148 (59%), Positives = 114/148 (77%), Gaps = 1/148 (1%)
 Frame = +3

Query  153  FAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNAT  332
            F FG+LGNIISFIVFL+P+PTF +IYKKKS EG+QSIPYVVALFS+MLW+YYA    N T
Sbjct  13   FTFGLLGNIISFIVFLAPVPTFMRIYKKKSTEGFQSIPYVVALFSAMLWLYYASFNPNET  72

Query  333  LLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAPV  512
            LLITINS GCL+ETIY+  +I +A K+ RV T++ ++LL   GF  + LV+ FL   +  
Sbjct  73   LLITINSVGCLIETIYLAIFIVFAPKQIRVSTLRFVLLLNFGGFCIILLVTHFLVHGSN-  131

Query  513  RAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            + +VVGW+C+ FS+ VF APL I++ VI
Sbjct  132  QVKVVGWICVAFSISVFAAPLTIIRLVI  159



>ref|XP_011015361.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Populus 
euphratica]
Length=269

 Score =   176 bits (447),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 88/156 (56%), Positives = 117/156 (75%), Gaps = 1/156 (1%)
 Frame = +3

Query  129  MALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYY  308
            MAL   WVF FG+LGNIIS +V L+PLPTFYQI +KK+++G+QSIPYV+ALFS+MLW++Y
Sbjct  1    MALHFTWVFGFGLLGNIISCLVCLAPLPTFYQICRKKTSQGFQSIPYVIALFSAMLWLFY  60

Query  309  AFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQ  488
            A    NA LLITINSF   +E  YI  Y++YA KK ++ T K+L+L  I GFG +  ++ 
Sbjct  61   AIFSENAMLLITINSFTFFMEIGYIAVYLFYATKKDKILTFKLLLLFNIFGFGLICALT-  119

Query  489  FLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
             L      R QV+GW+C+VF+LCVFVAPL +V++VI
Sbjct  120  LLLTEGIKRVQVLGWICMVFALCVFVAPLGVVRKVI  155



>emb|CDP13388.1| unnamed protein product [Coffea canephora]
Length=302

 Score =   177 bits (449),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 90/155 (58%), Positives = 118/155 (76%), Gaps = 3/155 (2%)
 Frame = +3

Query  138  SGH--WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYA  311
            S H  WVFAFGVLGN++S I +L PLPTFY+IY++KS  GY+++PYVVAL S+MLW+YYA
Sbjct  6    SDHHRWVFAFGVLGNLVSVIAYLGPLPTFYRIYREKSTMGYEALPYVVALSSAMLWMYYA  65

Query  312  FLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQF  491
             LK  ATLLI+INS GC++ET+YI FYI YA+K+AR  TIK++ +L +    A+ +V+ F
Sbjct  66   LLKP-ATLLISINSLGCIIETLYILFYILYASKQARKHTIKLVGMLNVGLICAIFVVANF  124

Query  492  LFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
              K   VR  VVGW+C+ FS+ VF APL IV QV+
Sbjct  125  ALKEVSVRIMVVGWICVAFSVSVFAAPLSIVFQVV  159



>ref|XP_004503778.1| PREDICTED: bidirectional sugar transporter SWEET13-like [Cicer 
arietinum]
Length=255

 Score =   176 bits (446),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 95/158 (60%), Positives = 124/158 (78%), Gaps = 3/158 (2%)
 Frame = +3

Query  129  MALSGH-WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIY  305
            MA++   W F FG+LGNIISF VFLSPLPTFY I+KKKS EG+QS+PYVVALFS+MLWIY
Sbjct  1    MAMTRESWAFVFGLLGNIISFAVFLSPLPTFYLIFKKKSTEGFQSLPYVVALFSAMLWIY  60

Query  306  YAFLKSNAT-LLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALV  482
            YAF+K  A  LLITIN+FG +VE+ Y+  ++ YA KK+R+ TIK+L+LL + GFGA+ L 
Sbjct  61   YAFVKREAALLLITINTFGIVVESCYLIVFLIYATKKSRLSTIKLLLLLNVFGFGAMLLS  120

Query  483  SQFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            + +L K A  R  ++GW+CLVF++ VF APL I+ +VI
Sbjct  121  TLYLAKGAK-RLAIIGWICLVFNITVFAAPLFIISRVI  157



>ref|XP_002443163.1| hypothetical protein SORBIDRAFT_08g013620 [Sorghum bicolor]
 gb|EES17001.1| hypothetical protein SORBIDRAFT_08g013620 [Sorghum bicolor]
Length=304

 Score =   177 bits (449),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 89/157 (57%), Positives = 121/157 (77%), Gaps = 1/157 (1%)
 Frame = +3

Query  126  SMALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIY  305
             ++L   W FAFG+LGN+ISF+ FL+P+PTFY+IYK KS EG+QS+PYVVALFS+MLWI+
Sbjct  3    GLSLQHPWAFAFGLLGNVISFMTFLAPIPTFYRIYKTKSTEGFQSVPYVVALFSAMLWIF  62

Query  306  YAFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVS  485
            YA +KSN T LITIN+ GC++ETIYI  Y  YA KK ++ T K+++LL +  FG + L++
Sbjct  63   YALIKSNETFLITINAAGCVIETIYIIMYFVYAPKKGKMFTAKIMLLLNVGIFGVILLLT  122

Query  486  QFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
              LFK    R  ++GW+C+ FS+ VFVAPL I+K+VI
Sbjct  123  LLLFKGDK-RVVMLGWICVGFSVSVFVAPLSIMKRVI  158



>ref|XP_009393865.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Musa 
acuminata subsp. malaccensis]
Length=281

 Score =   176 bits (447),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 88/157 (56%), Positives = 117/157 (75%), Gaps = 1/157 (1%)
 Frame = +3

Query  126  SMALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIY  305
             ++L   W F FG+LGNIISF+V+L+PLPTFY++ ++KS EG+ S+PYVVALFS+ LWI+
Sbjct  3    GLSLDHPWAFTFGILGNIISFMVYLAPLPTFYRVCRRKSTEGFHSVPYVVALFSATLWIF  62

Query  306  YAFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVS  485
            YAFLK+NA LLITIN+ GC++ET Y+  Y  YA K A++ T K LVLLV VG   + LV 
Sbjct  63   YAFLKTNAGLLITINAVGCVIETAYVVVYFTYAPKAAKMFTAK-LVLLVNVGMFGLILVL  121

Query  486  QFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
              LF     R +V+GW+C+ FS+ VFVAPL I++ VI
Sbjct  122  TLLFARGAKRVEVLGWICMSFSVSVFVAPLSIIRLVI  158



>emb|CDX68492.1| BnaC01g25700D [Brassica napus]
Length=286

 Score =   177 bits (448),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/150 (56%), Positives = 117/150 (78%), Gaps = 1/150 (1%)
 Frame = +3

Query  147  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  326
            W F FG++GN+ISF VFLSP+PTFY+++KKK+ EG+QS+PYVVALFS+ LW+YYA  K +
Sbjct  10   WAFVFGLMGNVISFAVFLSPVPTFYRVWKKKTTEGFQSLPYVVALFSATLWLYYATQKKD  69

Query  327  ATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSA  506
              LL+TINSFGC +ETIYI  ++ +A KKAR+ T+K+L+L+   GF  + L+ QFL K  
Sbjct  70   VFLLVTINSFGCFIETIYISIFLAFAPKKARMLTVKLLLLMNFGGFCLILLLCQFLAKGI  129

Query  507  PVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
              RA+++G +C+ FS+CVF APL I++ VI
Sbjct  130  -TRAKIIGGICVGFSVCVFAAPLSIIRTVI  158



>ref|XP_004491680.1| PREDICTED: bidirectional sugar transporter N3-like [Cicer arietinum]
Length=257

 Score =   176 bits (445),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/148 (59%), Positives = 113/148 (76%), Gaps = 1/148 (1%)
 Frame = +3

Query  153  FAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNAT  332
            F FG+LGN+ISF+VFL+P+ TFY+IYKKKS E +QS+PY+VALFSSMLW+YYA +K+N  
Sbjct  10   FGFGMLGNVISFMVFLAPMTTFYRIYKKKSTEQFQSLPYLVALFSSMLWLYYALVKTNEF  69

Query  333  LLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAPV  512
            LLITINSFGCLVE IYI  YI YA K AR  T+K+L+ + +  FG +  V+ +    A +
Sbjct  70   LLITINSFGCLVEIIYILLYITYAPKDARKLTLKLLLAMNMGSFGLILSVTHYAMHGA-L  128

Query  513  RAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            R QV+GW+C+  S+ VF APL IV QV+
Sbjct  129  RVQVLGWICVSISVSVFAAPLTIVAQVV  156



>dbj|BAJ85621.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=289

 Score =   177 bits (448),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/157 (54%), Positives = 119/157 (76%), Gaps = 1/157 (1%)
 Frame = +3

Query  126  SMALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIY  305
             +++   W FAFG+LGNIISF   L+P+PTFY+I+K KS EG+QS+PYVVALFS+MLWI+
Sbjct  3    GLSMEHPWAFAFGLLGNIISFTSLLAPIPTFYRIFKSKSTEGFQSVPYVVALFSAMLWIF  62

Query  306  YAFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVS  485
            YA +K+   LLITIN+ GC++ET+YI  Y+ YA +KA++ T K+++LL + GFG + L++
Sbjct  63   YALVKTGEGLLITINAAGCVIETVYIIMYLVYAPRKAKIFTAKIVLLLNVAGFGLIFLLT  122

Query  486  QFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
             F F     R   +GW+C+ FS+CVFVAPL I+ +VI
Sbjct  123  LFAFHGE-TRVVSLGWICVGFSVCVFVAPLSIIGRVI  158



>ref|XP_009765830.1| PREDICTED: bidirectional sugar transporter NEC1-like [Nicotiana 
sylvestris]
Length=278

 Score =   176 bits (447),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/154 (55%), Positives = 118/154 (77%), Gaps = 2/154 (1%)
 Frame = +3

Query  138  SGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFL  317
            + H  F FGVLGN +SF+V+LSP+PTFY+IYK+KS EG+QSIPY VALFS+ML++YYA+L
Sbjct  6    ASHLAFVFGVLGNGVSFLVYLSPIPTFYRIYKRKSTEGFQSIPYSVALFSAMLYLYYAYL  65

Query  318  KS-NATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFL  494
            K  N  LLITINSFG  +E IY+  ++ YA ++A++ T K+++LL I  FGA+  ++ ++
Sbjct  66   KEKNGILLITINSFGTAIEFIYLTIFLMYATREAKIYTTKLVLLLNIGSFGAIVALT-YI  124

Query  495  FKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            F     R  +VGW+C VFS+CVF APL I+++VI
Sbjct  125  FAKDKTRVTIVGWICAVFSVCVFAAPLSIMRRVI  158



>ref|NP_001141654.1| hypothetical protein [Zea mays]
 gb|ACF86797.1| unknown [Zea mays]
 gb|AFW56326.1| hypothetical protein ZEAMMB73_553683 [Zea mays]
Length=301

 Score =   177 bits (448),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 89/156 (57%), Positives = 121/156 (78%), Gaps = 1/156 (1%)
 Frame = +3

Query  129  MALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYY  308
            ++L   W FAFG+LGN+ISF+ FL+P+PTFY+IYK KS EG+QS+PYVVALFS+MLWI+Y
Sbjct  4    LSLEHPWAFAFGLLGNVISFMTFLAPIPTFYRIYKSKSTEGFQSVPYVVALFSAMLWIFY  63

Query  309  AFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQ  488
            A +KSN T LITIN+ GC++ETIYI  Y  YA KKA++ T K++ LL    FG + L++ 
Sbjct  64   ALIKSNETFLITINAAGCVIETIYIVMYFVYAPKKAKLFTAKIMALLNGGVFGVILLLTL  123

Query  489  FLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
             LFK +  R  ++GW+C+ FS+ VFVAPL I+++VI
Sbjct  124  LLFKGSK-RVVLLGWICVGFSVSVFVAPLSIMRRVI  158



>ref|XP_007043874.1| Senescence-associated gene 29 [Theobroma cacao]
 gb|EOX99705.1| Senescence-associated gene 29 [Theobroma cacao]
Length=287

 Score =   176 bits (447),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 118/156 (76%), Gaps = 1/156 (1%)
 Frame = +3

Query  129  MALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYY  308
            M     W  AFGV GNIIS +V+L+P+PTFY+IY+KKS E +QS+PY VALFSSMLW+YY
Sbjct  4    MGDHHSWAVAFGVFGNIISVLVYLAPVPTFYRIYRKKSTESFQSLPYQVALFSSMLWLYY  63

Query  309  AFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQ  488
            A +K +A LLITINSFGC+VET+YI  YI YA+K +R+  +K+ V + +  F  + ++++
Sbjct  64   ALIKKDAFLLITINSFGCIVETMYISIYIAYASKNSRMSAMKLFVGMNVGLFSLILILTR  123

Query  489  FLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            FL KS+ +R Q++GW+C+  S+ VF APL IV +VI
Sbjct  124  FLVKSS-IRIQLLGWICVAISVSVFAAPLNIVARVI  158



>ref|XP_007137872.1| hypothetical protein PHAVU_009G162900g [Phaseolus vulgaris]
 gb|ESW09866.1| hypothetical protein PHAVU_009G162900g [Phaseolus vulgaris]
Length=291

 Score =   176 bits (447),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 83/148 (56%), Positives = 115/148 (78%), Gaps = 1/148 (1%)
 Frame = +3

Query  153  FAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNAT  332
            F FGVLGN+ SF+ FL+PLPTFY++ KKKS EG+QS+PYV ALFS+MLWI+YA++K+  T
Sbjct  8    FLFGVLGNVASFVCFLAPLPTFYRVCKKKSTEGFQSVPYVAALFSAMLWIFYAYVKTGET  67

Query  333  LLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAPV  512
            LLITINSFGC++ETIY+  ++ Y  KKAR+ T++M+VL    GF  + L++  L K A  
Sbjct  68   LLITINSFGCVIETIYLAIFLTYCPKKARMSTLRMIVLFNFGGFCTIVLLTHLLAKGAG-  126

Query  513  RAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            R +++GW+C+VF+  VF APL I++ VI
Sbjct  127  RVKLLGWICVVFATSVFAAPLSIIRVVI  154



>sp|Q2QR07.1|SWT13_ORYSJ RecName: Full=Bidirectional sugar transporter SWEET13; Short=OsSWEET13 
[Oryza sativa Japonica Group]
 gb|ABA98216.1| N3 like protein, putative, expressed [Oryza sativa Japonica Group]
 gb|EAZ20456.1| hypothetical protein OsJ_36063 [Oryza sativa Japonica Group]
 dbj|BAH01364.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AGS56390.1| major disease resistance protein xa25 [Oryza sativa Indica Group]
Length=296

 Score =   177 bits (448),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 90/156 (58%), Positives = 119/156 (76%), Gaps = 1/156 (1%)
 Frame = +3

Query  129  MALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYY  308
            ++L   W FAFG+LGN+ISF  +L+P+PTFY+IYK KS EG+QS+PYVVALFS+MLWI+Y
Sbjct  4    LSLQHPWAFAFGLLGNLISFTTYLAPIPTFYRIYKSKSTEGFQSVPYVVALFSAMLWIFY  63

Query  309  AFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQ  488
            A +KSN  LLITIN+ GC++ETIYI  Y+ YA KKA+V T K+L+LL +  FG + L++ 
Sbjct  64   ALIKSNEALLITINAAGCVIETIYIVMYLAYAPKKAKVFTTKILLLLNVGVFGVILLLTL  123

Query  489  FLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
             L      R   +GWVC+ FS+ VFVAPL I+K+VI
Sbjct  124  -LLSHGEQRVVSLGWVCVAFSVSVFVAPLSIIKRVI  158



>gb|EMS51422.1| Bidirectional sugar transporter SWEET13 [Triticum urartu]
Length=290

 Score =   176 bits (447),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 90/172 (52%), Positives = 123/172 (72%), Gaps = 14/172 (8%)
 Frame = +3

Query  81   LGGL*IR*SSRHPDRSMALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQS  260
            +GGL    S  HP         W FAFG+LGN+ISF   L+P+PTFY+I+K KS EG+QS
Sbjct  1    MGGL----SMEHP---------WAFAFGLLGNVISFSSLLAPIPTFYRIFKSKSTEGFQS  47

Query  261  IPYVVALFSSMLWIYYAFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKML  440
            +PYVVALFS+MLWI+YA +K+   LLI+IN+ GC++ET+YI  Y+ YA +KA++ T K++
Sbjct  48   VPYVVALFSAMLWIFYALVKTGEGLLISINAAGCVIETVYIVMYLVYAPRKAKIFTAKIV  107

Query  441  VLLVIVGFGAVALVSQFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            VLL I GFG + L++ F F     R   +GW+C+ FS+CVFVAPL I+ +VI
Sbjct  108  VLLNITGFGLIFLLTLFAFHGE-TRVVSLGWICVGFSVCVFVAPLSIIGRVI  158



>ref|XP_011023933.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Populus 
euphratica]
Length=269

 Score =   176 bits (445),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/156 (56%), Positives = 117/156 (75%), Gaps = 1/156 (1%)
 Frame = +3

Query  129  MALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYY  308
            MAL   WVF FG+LGNIIS +V L+PLPTFYQI +KK+++G+QSIPYV+ALFS+MLW++Y
Sbjct  1    MALHFTWVFGFGLLGNIISCLVCLAPLPTFYQICRKKTSQGFQSIPYVIALFSAMLWLFY  60

Query  309  AFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQ  488
            A    NA LLITINSF   +E  YI  Y++Y+ KK ++ T K+L+L  I GFG +  ++ 
Sbjct  61   AIFSENAMLLITINSFTFFMEIGYIAVYLFYSTKKDKILTFKLLLLFNIFGFGLICALT-  119

Query  489  FLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
             L      R QV+GW+C+VF+LCVFVAPL +V++VI
Sbjct  120  LLLTEGIKRVQVLGWICMVFALCVFVAPLGVVRKVI  155



>gb|EYU42078.1| hypothetical protein MIMGU_mgv1a010705mg [Erythranthe guttata]
Length=304

 Score =   177 bits (448),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 90/153 (59%), Positives = 117/153 (76%), Gaps = 7/153 (5%)
 Frame = +3

Query  147  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  326
            W F FGVLGNIIS  V+L+PLPTF +I+K+KS  G+ S+PY VALFS+MLW+YYAFLK+N
Sbjct  10   WAFTFGVLGNIISIFVYLAPLPTFRRIFKEKSTMGFDSLPYAVALFSAMLWLYYAFLKTN  69

Query  327  ATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVAL---VSQFLF  497
            A LLI+IN+FGC+VETIYI  +++YA+KKAR +T K   LL +V  G ++L   V+ F+F
Sbjct  70   AVLLISINTFGCIVETIYISMFLFYASKKARGRTAK---LLGVVNVGVLSLIFVVTFFIF  126

Query  498  KSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            K    R  VVGW+C+  S+CVF APL IV QV+
Sbjct  127  KGQN-RVHVVGWICVAVSVCVFAAPLSIVFQVV  158



>ref|XP_002322281.2| N3 like family protein [Populus trichocarpa]
 gb|EEF06408.2| N3 like family protein [Populus trichocarpa]
Length=283

 Score =   176 bits (446),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/156 (56%), Positives = 118/156 (76%), Gaps = 1/156 (1%)
 Frame = +3

Query  129  MALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYY  308
            MAL   WVF FG+LGN IS +V L+PLPTFY+I KKK+++G+ SIPYV+ALFS+MLW++Y
Sbjct  1    MALHLTWVFGFGLLGNFISCLVCLAPLPTFYRICKKKTSQGFHSIPYVIALFSAMLWLFY  60

Query  309  AFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQ  488
            A  K +A LLITINSF   +E  YI  Y+ YA KK ++ T K+L+L  + GFG + ++++
Sbjct  61   ALFKEDALLLITINSFTFFMEIGYIFMYLLYATKKDKILTFKLLLLFNVFGFGLICVLTR  120

Query  489  FLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            FL +    R QV+GW+C+ FSLCVFVAPL IV++VI
Sbjct  121  FLTQRQK-RVQVLGWICMTFSLCVFVAPLFIVRKVI  155



>gb|EAY83053.1| hypothetical protein OsI_38270 [Oryza sativa Indica Group]
 gb|AGS56391.1| disease susceptible protein Xa25 [Oryza sativa Indica Group]
Length=293

 Score =   176 bits (447),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 90/156 (58%), Positives = 119/156 (76%), Gaps = 1/156 (1%)
 Frame = +3

Query  129  MALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYY  308
            ++L   W FAFG+LGN+ISF  +L+P+PTFY+IYK KS EG+QS+PYVVALFS+MLWI+Y
Sbjct  4    LSLQHPWAFAFGLLGNLISFTTYLAPIPTFYRIYKSKSTEGFQSVPYVVALFSAMLWIFY  63

Query  309  AFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQ  488
            A +KSN  LLITIN+ GC++ETIYI  Y+ YA KKA+V T K+L+LL +  FG + L++ 
Sbjct  64   ALIKSNEALLITINAAGCVIETIYIVMYLAYAPKKAKVFTTKILLLLNVGVFGVILLLTL  123

Query  489  FLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
             L      R   +GWVC+ FS+ VFVAPL I+K+VI
Sbjct  124  -LLSHGEQRVVSLGWVCVAFSVSVFVAPLSIIKRVI  158



>ref|XP_006347482.1| PREDICTED: bidirectional sugar transporter SWEET11-like [Solanum 
tuberosum]
Length=267

 Score =   176 bits (445),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 88/139 (63%), Positives = 111/139 (80%), Gaps = 1/139 (1%)
 Frame = +3

Query  180  ISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNATLLITINSFG  359
            +SFIVFL+PLPTFY IYKKKS EGYQSIPYVVAL S+M+ IYY  LK +   +I IN+ G
Sbjct  3    VSFIVFLAPLPTFYNIYKKKSTEGYQSIPYVVALCSAMILIYYVHLKGDLVYVIIINAIG  62

Query  360  CLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAPVRAQVVGWVC  539
              +ETIYI FYI+YA KKA+VQTIK+L+L V+VG+G V LV+QFL K A +R  +VGW+ 
Sbjct  63   VFIETIYIVFYIFYAPKKAKVQTIKLLLLFVVVGYGGVFLVAQFLLKGA-IRTTIVGWIS  121

Query  540  LVFSLCVFVAPLCIVKQVI  596
            + FS+C FVAPL I+++VI
Sbjct  122  IAFSVCTFVAPLGIMRKVI  140



>ref|NP_001239695.1| uncharacterized protein LOC100777741 [Glycine max]
 gb|ACU24541.1| unknown [Glycine max]
 gb|KHN03191.1| Bidirectional sugar transporter N3 [Glycine soja]
Length=268

 Score =   176 bits (445),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/148 (57%), Positives = 113/148 (76%), Gaps = 1/148 (1%)
 Frame = +3

Query  153  FAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNAT  332
            FAFG+LGN+ISF+VFL+P+ TFY+I+KKKS EG+QS+PY+VALFSSMLW+YYA LK +A 
Sbjct  10   FAFGMLGNVISFLVFLAPITTFYRIFKKKSTEGFQSLPYLVALFSSMLWLYYALLKKDAM  69

Query  333  LLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAPV  512
            LL+TINSFGC++E IYI  YI YA + AR  T+K+   + +  F  + LV+ F    + +
Sbjct  70   LLLTINSFGCVIEVIYIILYITYATRDARNLTLKLFFAMNVGAFALILLVTHFAVHGS-L  128

Query  513  RAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            R QV+GW+C+  S+ VF APL IV QV+
Sbjct  129  RVQVLGWICVSLSISVFAAPLSIVAQVV  156



>emb|CAC44123.1| N3 like protein [Medicago truncatula]
Length=255

 Score =   175 bits (444),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 94/158 (59%), Positives = 125/158 (79%), Gaps = 3/158 (2%)
 Frame = +3

Query  129  MALSGH-WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIY  305
            MA++   W F FG++GNIISF VFLSPLPTFY I+KKKSAEG+Q++PYVVALFS+MLWIY
Sbjct  1    MAMTRESWAFVFGIIGNIISFAVFLSPLPTFYVIFKKKSAEGFQALPYVVALFSAMLWIY  60

Query  306  YAFLK-SNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALV  482
            YAF+K  +A LLITIN+FG +VE+ YI  ++ YA KK R+ TIK+L+LL + GFGA+ L 
Sbjct  61   YAFVKRESALLLITINTFGIVVESAYIIMFLIYAPKKQRLSTIKLLLLLNVFGFGAMLLS  120

Query  483  SQFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            + +L K A  R  ++GW+CLVF++ VF APL ++ +VI
Sbjct  121  TLYLSKGAK-RLAIIGWICLVFNISVFAAPLFVISKVI  157



>gb|KEH20983.1| bidirectional sugar transporter [Medicago truncatula]
Length=255

 Score =   175 bits (443),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 94/158 (59%), Positives = 125/158 (79%), Gaps = 3/158 (2%)
 Frame = +3

Query  129  MALSGH-WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIY  305
            MA++   W F FG++GNIISF VFLSPLPTFY I+KKKSAEG+Q++PYVVALFS+MLWIY
Sbjct  1    MAMTRESWAFVFGIIGNIISFAVFLSPLPTFYVIFKKKSAEGFQALPYVVALFSAMLWIY  60

Query  306  YAFLK-SNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALV  482
            YAF+K  +A LLITIN+FG +VE+ YI  ++ YA KK R+ TIK+L+LL + GFGA+ L 
Sbjct  61   YAFVKRESALLLITINTFGIVVESAYIIMFLIYAPKKQRLSTIKLLLLLNVFGFGAMLLS  120

Query  483  SQFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            + +L K A  R  ++GW+CLVF++ VF APL ++ +VI
Sbjct  121  TLYLSKGAK-RLAIIGWICLVFNISVFAAPLFVISKVI  157



>ref|XP_010550745.1| PREDICTED: bidirectional sugar transporter SWEET11-like [Tarenaya 
hassleriana]
Length=287

 Score =   176 bits (445),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 89/150 (59%), Positives = 118/150 (79%), Gaps = 1/150 (1%)
 Frame = +3

Query  147  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  326
            W FAFG+LGNIISF VFLSP+ TFY+I+KKKS EG+ S+PY+VALFS+MLW+YYA  KS+
Sbjct  10   WAFAFGLLGNIISFCVFLSPVLTFYRIWKKKSTEGFHSLPYLVALFSAMLWLYYATQKSD  69

Query  327  ATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSA  506
              LL+TINSFGC +ETIYI  +I +ANKKAR+ T+K+L+L+   GF  + L+ QFL K +
Sbjct  70   VFLLVTINSFGCFIETIYISLFIAFANKKARMFTLKVLLLMNFGGFCLILLLCQFLVKGS  129

Query  507  PVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
              RA+++G +C+ FS+ VF APL I + VI
Sbjct  130  -TRAKIIGGICVGFSVSVFAAPLNIYRVVI  158



>gb|KDP26857.1| hypothetical protein JCGZ_18015 [Jatropha curcas]
Length=293

 Score =   176 bits (446),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 118/156 (76%), Gaps = 3/156 (2%)
 Frame = +3

Query  135  LSGHW--VFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYY  308
            LS H    FAFG+LGNIIS +V+L+P+PTF +IY+KKS EG+ S+PY+VALFSSMLW++Y
Sbjct  4    LSTHQPLAFAFGLLGNIISVLVYLAPVPTFLRIYRKKSTEGFHSLPYLVALFSSMLWLHY  63

Query  309  AFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQ  488
            A LK +  LL+TIN FGC +ETIYI  Y++YA+K+ RV T ++LV + I  F ++ L + 
Sbjct  64   AMLKKDVFLLVTINVFGCAIETIYIFLYMFYASKEIRVSTFRLLVSMNIALFSSIVLFTH  123

Query  489  FLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            FL K + +R QV+GW+C+  S+ VF +PL IV QV+
Sbjct  124  FLMKGS-IRVQVLGWICVAVSVSVFASPLSIVAQVV  158



>ref|XP_002514863.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF47417.1| conserved hypothetical protein [Ricinus communis]
Length=272

 Score =   175 bits (444),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 96/163 (59%), Positives = 122/163 (75%), Gaps = 9/163 (6%)
 Frame = +3

Query  108  SRHPDRSMALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFS  287
            S HP  +        FAFG+LGNIIS +V+L+P+PTFY+IY+KKS EG+QS+PY+VALFS
Sbjct  5    STHPPLA--------FAFGILGNIISILVYLAPVPTFYRIYRKKSTEGFQSLPYLVALFS  56

Query  288  SMLWIYYAFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFG  467
            SMLW+YYA LK +  LL+TIN+FGC++ETIYI  YI YA KK RV T K+L  + +  F 
Sbjct  57   SMLWLYYAMLKKDVFLLVTINAFGCVIETIYIIMYIIYATKKNRVSTFKVLTSMNLGLFA  116

Query  468  AVALVSQFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
             + L S FL KS+ VRAQV+GW+C+  S+CVF APL IV QVI
Sbjct  117  FIILFSHFLVKSS-VRAQVLGWICVAVSVCVFAAPLSIVAQVI  158



>dbj|BAJ94651.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=292

 Score =   176 bits (445),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 92/172 (53%), Positives = 127/172 (74%), Gaps = 14/172 (8%)
 Frame = +3

Query  81   LGGL*IR*SSRHPDRSMALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQS  260
            +GGL    S++HP         W F FG+LGN+ISF+ +L+PLPTFY+IYK KS +G+QS
Sbjct  1    MGGL----SAQHP---------WAFTFGLLGNVISFMTYLAPLPTFYRIYKNKSTQGFQS  47

Query  261  IPYVVALFSSMLWIYYAFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKML  440
            +PYVVALFS+MLWIYYA LKS+  LLITIN+ GC++ETIYI  Y+ YA K+AR+ T K+L
Sbjct  48   VPYVVALFSAMLWIYYALLKSDEYLLITINTAGCVIETIYIVLYLAYAPKQARLFTAKIL  107

Query  441  VLLVIVGFGAVALVSQFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            +LL +  FG + L++  L  +   R  ++GWVC+ FS+CVFVAPL +++ V+
Sbjct  108  LLLNVGVFGLILLLTL-LLTAGERRVVMLGWVCVGFSVCVFVAPLSVIRLVV  158



>ref|XP_006664549.1| PREDICTED: bidirectional sugar transporter SWEET13-like [Oryza 
brachyantha]
Length=256

 Score =   174 bits (442),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 88/157 (56%), Positives = 120/157 (76%), Gaps = 1/157 (1%)
 Frame = +3

Query  126  SMALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIY  305
             ++L   W FAFG+LGN+ISF  +L+P+PTFY+IYK KS EG+QS+PYVVALFS+MLWI+
Sbjct  3    GLSLQHPWAFAFGLLGNLISFTTYLAPIPTFYRIYKSKSTEGFQSVPYVVALFSAMLWIF  62

Query  306  YAFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVS  485
            YA +KSN  LLITIN+ GC++ETIYI  Y+ YA+KKA+V T K+L+ L +  FG + L++
Sbjct  63   YALIKSNEALLITINAAGCVIETIYIVIYLAYASKKAKVFTTKILLGLNVGVFGVILLLT  122

Query  486  QFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
              L K    R   +GWVC+ FS+ VFVAPL I+++V+
Sbjct  123  LLLSKGEN-RVVSLGWVCVAFSVSVFVAPLSIIRRVV  158



>ref|XP_003620983.1| Protein RUPTURED POLLEN GRAIN [Medicago truncatula]
Length=268

 Score =   174 bits (442),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 95/157 (61%), Positives = 123/157 (78%), Gaps = 2/157 (1%)
 Frame = +3

Query  129  MALSGHWV-FAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIY  305
            MA+S + + FAFG+LGN+ISF+VFL+P+ TFY+IYKKKS EG+QS+PY+VALFSSMLW+Y
Sbjct  1    MAISHNTLAFAFGMLGNVISFMVFLAPMTTFYRIYKKKSTEGFQSLPYLVALFSSMLWLY  60

Query  306  YAFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVS  485
            YAFLK +  LLITINSFGC+VE IYI  YI YA K AR  TIK+L+ + I  FG + LV+
Sbjct  61   YAFLKKDEFLLITINSFGCVVELIYIILYIIYATKDARKLTIKLLLAMNIGSFGLILLVT  120

Query  486  QFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            ++     P+R QV+GW+C+  S+ VF APL IV QV+
Sbjct  121  KYAVH-GPIRVQVLGWICVSISVSVFAAPLTIVAQVV  156



>ref|XP_004138250.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Cucumis 
sativus]
Length=302

 Score =   176 bits (445),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 91/160 (57%), Positives = 123/160 (77%), Gaps = 5/160 (3%)
 Frame = +3

Query  129  MALS----GHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSML  296
            MALS      W+FAFG+LGNI SFIVFL+P+PTF ++ +KKS EG+QSIPYVVALFS++L
Sbjct  1    MALSFMNHNPWIFAFGLLGNIFSFIVFLAPVPTFIRVCRKKSTEGFQSIPYVVALFSALL  60

Query  297  WIYYAFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVA  476
             IYY+ L ++   L+TINS GC +ETIYI  YI YA KKAR+ T++ ++LL +VGF ++ 
Sbjct  61   LIYYSTLNADEFFLMTINSVGCFIETIYIALYIAYAPKKARIFTVRFVLLLDVVGFCSIL  120

Query  477  LVSQFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            +V+QFL K A  RA+V+G++C   S+ VF APL I+K+VI
Sbjct  121  VVTQFLVKRA-YRARVIGFICGGLSVSVFAAPLSIMKRVI  159



>gb|EMS48886.1| Bidirectional sugar transporter SWEET13 [Triticum urartu]
Length=395

 Score =   178 bits (451),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 86/157 (55%), Positives = 120/157 (76%), Gaps = 1/157 (1%)
 Frame = +3

Query  126  SMALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIY  305
             +++   W FAFG+LGNIISF   L+P+PTFY+I+K KS EG+QS+PYVVALFS+MLWI+
Sbjct  3    GLSMEHPWAFAFGLLGNIISFTSLLAPIPTFYRIFKSKSTEGFQSVPYVVALFSAMLWIF  62

Query  306  YAFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVS  485
            YA +K+   LLITIN+ GC++ETIYI  Y+ YA +KA++ T K+++LL I GFG + L++
Sbjct  63   YALVKTGEGLLITINAAGCVIETIYIVMYLVYAPRKAKIFTAKIVLLLNIAGFGLIFLLT  122

Query  486  QFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
             F F+    R   +GW+C+ FS+CVFVAPL I+ +VI
Sbjct  123  VFAFQGE-TRVVSLGWICVGFSVCVFVAPLSIIGRVI  158



>ref|XP_009109231.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Brassica 
rapa]
Length=272

 Score =   174 bits (442),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 90/149 (60%), Positives = 115/149 (77%), Gaps = 2/149 (1%)
 Frame = +3

Query  153  FAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNAT  332
            F FG++GNIISFIVFL+P+PTF +I KKKS EG+QS+PYV ALFS+MLWIYYA  K  + 
Sbjct  8    FTFGIMGNIISFIVFLAPVPTFVRICKKKSTEGFQSLPYVSALFSAMLWIYYAMQKDGSG  67

Query  333  -LLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAP  509
             LLITINS GC +ETIYI  +I YANKKAR+ T+K+L LL  +GF A+ LV + L K + 
Sbjct  68   FLLITINSVGCFIETIYIVLFITYANKKARISTLKVLGLLNFLGFAAIILVCELLTKGSN  127

Query  510  VRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
             R +V+G +C+ FS+CVF APL I++ VI
Sbjct  128  -REKVLGGICVGFSVCVFAAPLSIMRVVI  155



>gb|KEH21447.1| sugar efflux transporter for intercellular exchange protein [Medicago 
truncatula]
Length=279

 Score =   175 bits (443),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 95/157 (61%), Positives = 123/157 (78%), Gaps = 2/157 (1%)
 Frame = +3

Query  129  MALSGHWV-FAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIY  305
            MA+S + + FAFG+LGN+ISF+VFL+P+ TFY+IYKKKS EG+QS+PY+VALFSSMLW+Y
Sbjct  1    MAISHNTLAFAFGMLGNVISFMVFLAPMTTFYRIYKKKSTEGFQSLPYLVALFSSMLWLY  60

Query  306  YAFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVS  485
            YAFLK +  LLITINSFGC+VE IYI  YI YA K AR  TIK+L+ + I  FG + LV+
Sbjct  61   YAFLKKDEFLLITINSFGCVVELIYIILYIIYATKDARKLTIKLLLAMNIGSFGLILLVT  120

Query  486  QFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            ++     P+R QV+GW+C+  S+ VF APL IV QV+
Sbjct  121  KYAVH-GPIRVQVLGWICVSISVSVFAAPLTIVAQVV  156



>ref|XP_010519500.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Tarenaya 
hassleriana]
Length=282

 Score =   175 bits (443),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 83/150 (55%), Positives = 118/150 (79%), Gaps = 1/150 (1%)
 Frame = +3

Query  147  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  326
            W FAFG++GNIISF VFLSP+PTFY+I+KKK+ EG+ S+PYVVALFS+MLW+YYA  +S+
Sbjct  10   WAFAFGLIGNIISFCVFLSPVPTFYRIWKKKTTEGFHSLPYVVALFSAMLWLYYATQRSD  69

Query  327  ATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSA  506
              LL+TINSFGC +ET+YI  ++ +A+K AR+ T+K+ +L+   GF  + L+ QFL K +
Sbjct  70   VLLLVTINSFGCFIETLYISLFLAFADKSARMFTLKLALLMNFGGFCMILLLCQFLAKGS  129

Query  507  PVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
              RA+++G +C+ FS+ VF APL I++ VI
Sbjct  130  -TRAKIIGGICVGFSVSVFAAPLSIIRVVI  158



>gb|EMT09236.1| Protein RUPTURED POLLEN GRAIN 1 [Aegilops tauschii]
Length=310

 Score =   176 bits (445),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 84/150 (56%), Positives = 112/150 (75%), Gaps = 1/150 (1%)
 Frame = +3

Query  147  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  326
            W F FG+LGNIIS +VFLSPLPTFY++Y+KKS EG Q  PY+V LFS +LW+YYAFLKS 
Sbjct  11   WAFTFGILGNIISLMVFLSPLPTFYRVYRKKSTEGVQPTPYLVTLFSCLLWMYYAFLKSG  70

Query  327  ATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSA  506
            + LL+TIN+ GC++E++YI  Y+ YA K AR+ T K+ + L +  FG +ALV+  L    
Sbjct  71   SELLLTINAVGCVIESLYIAMYLVYAPKSARLLTAKLFIGLDVGLFGLIALVT-MLASYG  129

Query  507  PVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            P+R QVVGW+C+  +L VF APL I++ VI
Sbjct  130  PLRVQVVGWICVAVALGVFAAPLSIIRLVI  159



>ref|XP_004239304.1| PREDICTED: bidirectional sugar transporter N3 [Solanum lycopersicum]
Length=295

 Score =   175 bits (444),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 88/154 (57%), Positives = 118/154 (77%), Gaps = 1/154 (1%)
 Frame = +3

Query  135  LSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAF  314
            L   W+F FGVLGN+IS +VFL+P+P F +I K+KS  GYQS+PYVVALFSSMLW+YYAF
Sbjct  6    LHHPWLFVFGVLGNVISILVFLAPVPAFRRICKEKSTMGYQSVPYVVALFSSMLWMYYAF  65

Query  315  LKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFL  494
            +K NA LL++INSFGC+VETIYI  +I YA+K+AR QT+++LVLL+   +  + L++ F 
Sbjct  66   IKKNAILLVSINSFGCIVETIYITIFILYASKEARRQTVQLLVLLIGGLYTLIFLITLFP  125

Query  495  FKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
                 +R QVVGW+C+  ++ VF APL IV QV+
Sbjct  126  LNGV-LRVQVVGWICVTVAVGVFAAPLSIVFQVV  158



>ref|XP_009612477.1| PREDICTED: bidirectional sugar transporter N3-like [Nicotiana 
tomentosiformis]
Length=314

 Score =   176 bits (445),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 93/154 (60%), Positives = 120/154 (78%), Gaps = 1/154 (1%)
 Frame = +3

Query  135  LSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAF  314
            L   W+F FGVLGNIIS  VFL+P+PTF +IYK+KS  G+QS+PYVVALFSSMLW+YYAF
Sbjct  6    LHHPWLFVFGVLGNIISIFVFLAPVPTFRRIYKEKSTMGFQSVPYVVALFSSMLWMYYAF  65

Query  315  LKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFL  494
            +K NATLLI+INSFGC+VETIYI  ++ YA+K+AR QT+K+LV L+   +  + LV+ F 
Sbjct  66   IKKNATLLISINSFGCIVETIYISIFLLYASKEARRQTVKLLVSLIGGLYTLIFLVTLFP  125

Query  495  FKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
               A +R QVVGW+C+  ++ VF APL IV QV+
Sbjct  126  LNGA-LRVQVVGWICVAVAVAVFAAPLSIVCQVV  158



>ref|XP_002322282.2| hypothetical protein POPTR_0015s11380g [Populus trichocarpa]
 gb|EEF06409.2| hypothetical protein POPTR_0015s11380g [Populus trichocarpa]
Length=276

 Score =   174 bits (442),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 83/157 (53%), Positives = 119/157 (76%), Gaps = 1/157 (1%)
 Frame = +3

Query  126  SMALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIY  305
            S ++   W+F FG+LGN +SF+VFL+P+PTF +I +KK+ EG+QS+PYVVALFS+M+W+Y
Sbjct  3    SFSIHCPWIFTFGLLGNFVSFVVFLAPIPTFLRICRKKTTEGFQSLPYVVALFSAMIWLY  62

Query  306  YAFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVS  485
            YA LKS+  LLITINS GC +E IYI  Y+ YA K+AR+ T+++L+L    GF ++ L+S
Sbjct  63   YASLKSDVLLLITINSVGCFIEMIYIALYVAYAPKQARIATLRILILFNFGGFCSILLLS  122

Query  486  QFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
             F  K +  R +V+GW C++FS+ VF APL I++ VI
Sbjct  123  HFFVKGSN-RVKVLGWACVIFSVSVFAAPLNIMRIVI  158



>emb|CDP14988.1| unnamed protein product [Coffea canephora]
Length=275

 Score =   174 bits (442),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 121/155 (78%), Gaps = 2/155 (1%)
 Frame = +3

Query  132  ALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYA  311
             +   WVFA GV+GN++SF+V+L+P+PTF +I KKKS EG+ S PYVV+LFS+MLW+ YA
Sbjct  5    PIQNPWVFALGVIGNLVSFLVYLAPVPTFRRIVKKKSTEGFHSFPYVVSLFSAMLWVDYA  64

Query  312  FLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQF  491
             +KSN  LL+T+NS GCL+ETIYI F+I +A KK R+ T+K+++LL  +GFG++ +++++
Sbjct  65   RVKSNV-LLVTVNSIGCLIETIYIAFFIVHAPKKPRMFTLKLVILLNFIGFGSICILTEY  123

Query  492  LFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            L K A  + Q +GW+C+  S  V++APL ++KQVI
Sbjct  124  LAKGA-RKTQALGWLCVASSAMVYIAPLSVMKQVI  157



>ref|XP_004979336.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Setaria 
italica]
Length=296

 Score =   175 bits (443),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 89/156 (57%), Positives = 121/156 (78%), Gaps = 1/156 (1%)
 Frame = +3

Query  129  MALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYY  308
            ++L     FAFG+LGNIISF+ +L+PLPTFY+IYK KS +G+QS+PYVVALFS+MLWIYY
Sbjct  4    LSLQHPLAFAFGLLGNIISFMTYLAPLPTFYRIYKNKSTQGFQSVPYVVALFSAMLWIYY  63

Query  309  AFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQ  488
            A LKSN  LLITIN+ GC++ET+YI  Y+ YA KKA++ T K+L+LL +  FG + L++ 
Sbjct  64   ALLKSNECLLITINAAGCVIETLYIAMYLTYAPKKAKLFTAKILLLLNVGVFGLILLLT-  122

Query  489  FLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
             L  +   R  ++GWVC+ FS+ VFVAPL I++QV+
Sbjct  123  LLLSAGQNRLVILGWVCVGFSVSVFVAPLSIIRQVV  158



>gb|AFK35161.1| unknown [Medicago truncatula]
Length=255

 Score =   173 bits (439),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 93/158 (59%), Positives = 124/158 (78%), Gaps = 3/158 (2%)
 Frame = +3

Query  129  MALSGH-WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIY  305
            MA++   W F FG++GNIISF VFLSPLPTFY I+KKKSAEG+Q++PYVVALFS+MLWIY
Sbjct  1    MAMTRESWAFVFGIIGNIISFAVFLSPLPTFYVIFKKKSAEGFQALPYVVALFSAMLWIY  60

Query  306  YAFLK-SNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALV  482
            YAF+K  +A LLITIN+FG +VE+ YI  ++ YA KK R+ TIK+L+LL + GFGA+ L 
Sbjct  61   YAFVKRESALLLITINTFGIVVESAYIIMFLIYAPKKQRLSTIKLLLLLNVFGFGAMLLS  120

Query  483  SQFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            + +L K A  R  ++GW+CLVF++ VF  PL ++ +VI
Sbjct  121  TLYLSKGAK-RLAIIGWICLVFNISVFATPLFVISKVI  157



>ref|XP_007159040.1| hypothetical protein PHAVU_002G203600g [Phaseolus vulgaris]
 gb|ESW31034.1| hypothetical protein PHAVU_002G203600g [Phaseolus vulgaris]
Length=273

 Score =   174 bits (440),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 90/153 (59%), Positives = 115/153 (75%), Gaps = 2/153 (1%)
 Frame = +3

Query  141  GHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLK  320
             H   AFG+LGNIISF+V+L+PLPTFY+IYKKKS EG+QS+PY+VALFSSMLW+YYA LK
Sbjct  8    NHLALAFGLLGNIISFMVYLAPLPTFYRIYKKKSTEGFQSLPYLVALFSSMLWLYYAVLK  67

Query  321  -SNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLF  497
             ++ATLLITINS G ++ET+YI  +  YA   AR  T+K+ V++ +  F  + LV+ F  
Sbjct  68   PADATLLITINSVGTVIETVYIVLFTVYATTDARKLTVKLFVVMNVGSFALIFLVTFFTM  127

Query  498  KSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
              A +R QVVGWVC+  S+ VF APL IV QVI
Sbjct  128  HGA-LRIQVVGWVCVAISVGVFAAPLSIVTQVI  159



>ref|XP_010045490.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Eucalyptus 
grandis]
Length=169

 Score =   170 bits (431),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/144 (58%), Positives = 111/144 (77%), Gaps = 2/144 (1%)
 Frame = +3

Query  153  FAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNAT  332
            FAFGVLGNI+SF+ FL+PLPTFY IYK K  +G+QSIPYVV+L S+ML +YY  +K N T
Sbjct  11   FAFGVLGNIVSFMTFLAPLPTFYGIYKTKKTQGFQSIPYVVSLLSAMLLLYYGLVK-NDT  69

Query  333  LLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAPV  512
            LLITIN  GC++ET Y+  Y+ YA+K  RV T+K+ +++ I+G+GAV   + FL K A  
Sbjct  70   LLITINGIGCVIETAYVAAYLIYASKNDRVLTLKLFLIMNILGYGAVLSTTFFLSKGAK-  128

Query  513  RAQVVGWVCLVFSLCVFVAPLCIV  584
            RA ++GW+C+ FSL VFVAPLCI+
Sbjct  129  RAWIIGWICMTFSLGVFVAPLCIL  152



>gb|KHN39181.1| Bidirectional sugar transporter N3 [Glycine soja]
Length=274

 Score =   173 bits (439),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 90/159 (57%), Positives = 120/159 (75%), Gaps = 4/159 (3%)
 Frame = +3

Query  129  MALS--GHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWI  302
            MAL+   H   AFG+LGN+ISF+V+L+PLPTFY+IYKKKS EG+QS+PY+VALFSSMLW+
Sbjct  1    MALNSHNHLALAFGMLGNVISFMVYLAPLPTFYRIYKKKSTEGFQSLPYLVALFSSMLWL  60

Query  303  YYAFLK-SNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVAL  479
            YYA LK ++ATLLITINS GC++E +YI  +  YA K AR  T+K+ +++ +  F  + L
Sbjct  61   YYASLKPADATLLITINSLGCVIEIVYIVMFTIYATKDARNLTVKLFMVMNVGSFALIFL  120

Query  480  VSQFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            V+ F    + +R QVVGWVC+  ++ VF APL IV QVI
Sbjct  121  VTYFAIHGS-LRVQVVGWVCVSIAVGVFAAPLSIVAQVI  158



>ref|XP_011084749.1| PREDICTED: bidirectional sugar transporter N3-like [Sesamum indicum]
Length=292

 Score =   174 bits (441),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 91/149 (61%), Positives = 116/149 (78%), Gaps = 1/149 (1%)
 Frame = +3

Query  150  VFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNA  329
            VF FG+LGN++SF V+L+P+PTFY+I+KKKS EG+QS+PYVVAL SSMLWIYYA LKSN 
Sbjct  11   VFTFGILGNLVSFAVYLAPMPTFYRIFKKKSTEGFQSVPYVVALLSSMLWIYYATLKSNE  70

Query  330  TLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAP  509
            TLLITINS GC +E+IYI  YI YA KK R+  +K+L LL  VGFG + + + FL K  P
Sbjct  71   TLLITINSAGCFIESIYIAIYIAYAPKKPRMGALKLLSLLNFVGFGLIVIFTHFLVK-GP  129

Query  510  VRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
             R QV+GW+ +  S  V++APL I++QVI
Sbjct  130  ERVQVLGWISVTLSASVYIAPLSIMRQVI  158



>ref|XP_003531061.1| PREDICTED: bidirectional sugar transporter N3-like [Glycine max]
Length=274

 Score =   173 bits (439),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 90/159 (57%), Positives = 120/159 (75%), Gaps = 4/159 (3%)
 Frame = +3

Query  129  MALS--GHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWI  302
            MAL+   H   AFG+LGN+ISF+V+L+PLPTFY+IYKKKS EG+QS+PY+VALFSSMLW+
Sbjct  1    MALNSHNHLALAFGMLGNVISFMVYLAPLPTFYRIYKKKSTEGFQSLPYLVALFSSMLWL  60

Query  303  YYAFLK-SNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVAL  479
            YYA LK ++ATLLITINS GC++E +YI  +  YA K AR  T+K+ +++ +  F  + L
Sbjct  61   YYASLKPADATLLITINSLGCVIEIVYIVMFTIYATKDARNLTVKLFMVMNVGSFALIFL  120

Query  480  VSQFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            V+ F    + +R QVVGWVC+  ++ VF APL IV QVI
Sbjct  121  VTYFAIHGS-LRVQVVGWVCVSIAVGVFAAPLSIVAQVI  158



>ref|XP_008464392.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Cucumis 
melo]
Length=297

 Score =   174 bits (441),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 91/160 (57%), Positives = 124/160 (78%), Gaps = 5/160 (3%)
 Frame = +3

Query  129  MALS--GH--WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSML  296
            MALS   H  W+FAFG+LGNI SFIVFL+P+PTF ++ +KKS EG+QSIPYVVALFS++L
Sbjct  1    MALSFMNHNPWIFAFGLLGNIFSFIVFLAPVPTFIRVCRKKSTEGFQSIPYVVALFSALL  60

Query  297  WIYYAFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVA  476
             IYY+ L ++   L+TINS GC +ET+YI  YI YA KKAR+ T++ ++LL +VGF ++ 
Sbjct  61   LIYYSTLNADEFFLMTINSVGCFIETVYIALYIAYAPKKARIFTVRFVLLLDVVGFCSIL  120

Query  477  LVSQFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            +V+QFL K A  RA+V+G++C   S+ VF APL I+K+VI
Sbjct  121  VVTQFLVKRA-YRARVIGFICGGLSVSVFAAPLSIMKKVI  159



>ref|XP_006402061.1| hypothetical protein EUTSA_v10014268mg [Eutrema salsugineum]
 gb|ESQ43514.1| hypothetical protein EUTSA_v10014268mg [Eutrema salsugineum]
Length=290

 Score =   174 bits (440),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 87/151 (58%), Positives = 114/151 (75%), Gaps = 2/151 (1%)
 Frame = +3

Query  147  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  326
            W F+FG++GNIISF+VFL+P+PTF +I KKKS EG+QSIPYV ALFSSMLWIYYA  K  
Sbjct  8    WAFSFGIMGNIISFVVFLAPVPTFVRICKKKSTEGFQSIPYVAALFSSMLWIYYAMQKDG  67

Query  327  AT-LLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKS  503
            +  LLITINS GC +ETIYI  ++ YANKK R+ T+K+L LL  +GF A+ LV Q L  +
Sbjct  68   SGFLLITINSVGCFIETIYIVLFVTYANKKTRISTLKVLGLLNFLGFAAIVLVCQ-LLTT  126

Query  504  APVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
               R +V+G +C+ F++ VF APL I++ V+
Sbjct  127  GSTREKVLGGICVGFAVIVFAAPLSIMRLVV  157



>ref|XP_009403777.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Musa 
acuminata subsp. malaccensis]
Length=288

 Score =   173 bits (439),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/157 (54%), Positives = 122/157 (78%), Gaps = 1/157 (1%)
 Frame = +3

Query  126  SMALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIY  305
             ++L   W F FG+LGNIISF+V+L+PLPTFY++Y+ KS EG+QS+PYVVALFS+MLW+ 
Sbjct  3    GLSLDHPWAFTFGILGNIISFMVYLAPLPTFYRVYRGKSTEGFQSVPYVVALFSAMLWVL  62

Query  306  YAFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVS  485
            YAFLK++A LLITINSFGC++E++Y+  Y  YA K A++ T K++++L +  FG++ L++
Sbjct  63   YAFLKTDAFLLITINSFGCVIESVYVVLYFTYAPKLAKILTAKLVLVLNVGMFGSILLLT  122

Query  486  QFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
              L      R +V+GW+C+ FS+ VFVAPL I++ VI
Sbjct  123  L-LLPDGLKRVRVLGWICMCFSVSVFVAPLSIIRLVI  158



>gb|AAM65389.1| senescence-associated protein (SAG29) [Arabidopsis thaliana]
Length=292

 Score =   174 bits (440),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 77/148 (52%), Positives = 113/148 (76%), Gaps = 0/148 (0%)
 Frame = +3

Query  153  FAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNAT  332
            F FG+LGN+ISF+VFL+P+PTFY+IYK+KS E +QS+PY V+LFS MLW+YYA +K +A 
Sbjct  12   FIFGILGNVISFLVFLAPVPTFYRIYKRKSTESFQSLPYQVSLFSCMLWLYYALIKKDAF  71

Query  333  LLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAPV  512
            LLITINSFGC+VET+YI  +  YA ++ R+  +K+ + + +  F  + +V+ F+ K+ P+
Sbjct  72   LLITINSFGCVVETLYIAMFFAYATREKRISAMKLFIAMNVAFFSLILMVTHFVVKTPPL  131

Query  513  RAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            +  V+GW+C+  S+ VF APL IV +VI
Sbjct  132  QVSVLGWICVAISVSVFAAPLMIVARVI  159



>ref|XP_006480106.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Citrus 
sinensis]
Length=275

 Score =   173 bits (438),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 88/158 (56%), Positives = 121/158 (77%), Gaps = 2/158 (1%)
 Frame = +3

Query  129  MALSG-HWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIY  305
            MA+ G H V  FG+LGNI+SF+V+L+PLPTFY+I+KKKS +G+QSIPY VALFS+ML +Y
Sbjct  1    MAILGPHSVIIFGLLGNIVSFLVYLAPLPTFYRIFKKKSTQGFQSIPYSVALFSAMLLLY  60

Query  306  YAFLK-SNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALV  482
            YA LK SNA +LITIN  G ++E++Y+ F++ YA K A++ T K+L+L  I   G + L+
Sbjct  61   YASLKGSNAFMLITINGIGYIIESLYLLFFMIYATKTAKIYTTKLLILFNIGALGLIVLL  120

Query  483  SQFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            +  L KS+  R  +VGW+C VFS+CVF APL I++QVI
Sbjct  121  TYLLSKSSDQRLTIVGWICAVFSVCVFAAPLSIIRQVI  158



>gb|AES73031.2| sugar efflux transporter for intercellular exchange protein [Medicago 
truncatula]
Length=206

 Score =   171 bits (433),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 87/159 (55%), Positives = 122/159 (77%), Gaps = 5/159 (3%)
 Frame = +3

Query  129  MAL--SGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWI  302
            MAL  S +W F FGV+GN+IS + FL+PLPTFY+IYKKKS EG+QS+PYV AL S+MLWI
Sbjct  1    MALFYSEYWAFVFGVIGNVISCMTFLAPLPTFYRIYKKKSTEGFQSVPYVTALLSAMLWI  60

Query  303  YYAFLKSNAT-LLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVAL  479
            YYA +K+ AT LL+TIN +G  +E IYI  ++ YA+ KAR+ TIK+L  L + G+G + +
Sbjct  61   YYAHVKNKATLLLLTINIYGFGIEAIYIIIFLLYASNKARLSTIKLL-FLTVCGYGTMVI  119

Query  480  VSQFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVI  596
            ++ +L K +  R  ++GW+C+VF++CVF +PL I+KQVI
Sbjct  120  LTTYLTKGSK-RLSIIGWICMVFNICVFASPLFILKQVI  157



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 778590373395