BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002E19

Length=540
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_003619702.1|  Ubiquitin-like protein                             223   1e-70   
ref|XP_007154493.1|  hypothetical protein PHAVU_003G123500g             223   2e-70   Phaseolus vulgaris [French bean]
gb|AEZ49160.1|  polyubiquitin                                           222   2e-70   Wolffia australiana
ref|XP_009412006.1|  PREDICTED: polyubiquitin 11-like                   221   3e-70   
ref|XP_003574865.1|  PREDICTED: polyubiquitin-like                      222   3e-70   Brachypodium distachyon [annual false brome]
ref|XP_006287868.1|  hypothetical protein CARUB_v10001095mg             222   3e-70   
ref|XP_007512209.1|  polyubiquitin                                      221   3e-70   Bathycoccus prasinos
ref|XP_003626479.1|  Ubiquitin-like protein                             222   3e-70   
emb|CBI22349.3|  unnamed protein product                                222   3e-70   Vitis vinifera
gb|EGA81850.1|  Ubi4p                                                   220   4e-70   Saccharomyces cerevisiae Lalvin QA23
ref|XP_010240636.1|  PREDICTED: polyubiquitin isoform X1                221   4e-70   
ref|NP_001147027.1|  polyubiquitin containing 7 ubiquitin monomers      222   4e-70   
ref|XP_010062974.1|  PREDICTED: polyubiquitin                           221   4e-70   Eucalyptus grandis [rose gum]
gb|AFW66445.1|  ubiquitin2                                              221   4e-70   
ref|XP_002872805.1|  hypothetical protein ARALYDRAFT_490270             222   4e-70   
gb|AIS40894.1|  polyubiquitin                                           221   4e-70   Kalanchoe fedtschenkoi [lavender-scallops]
ref|XP_006495490.1|  PREDICTED: polyubiquitin 4-like                    220   5e-70   Citrus sinensis [apfelsine]
ref|XP_008358804.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    221   5e-70   
ref|XP_003590494.1|  Ubiquitin                                          221   5e-70   
dbj|BAJ61942.1|  ubiquitin                                              221   6e-70   Nymphaea hybrid cultivar
emb|CBI22354.3|  unnamed protein product                                221   6e-70   Vitis vinifera
gb|AFC36452.1|  ubiquitin                                               221   6e-70   Anoectochilus roxburghii
emb|CAB81074.1|  polyubiquitin (ubq10)                                  221   6e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002267206.2|  PREDICTED: polyubiquitin-C-like                    221   6e-70   
gb|AFW70219.1|  polyubiquitin-like protein                              220   7e-70   
dbj|BAF00213.1|  polyubiquitin 4 UBQ4                                   220   7e-70   Arabidopsis thaliana [mouse-ear cress]
emb|CAA40323.1|  polyubiquitin protein                                  220   7e-70   Helianthus annuus
emb|CDP08567.1|  unnamed protein product                                222   7e-70   Coffea canephora [robusta coffee]
gb|AFW66438.1|  putative ubiquitin family protein                       220   7e-70   
gb|AAB36545.1|  ubiquitin-like protein                                  221   8e-70   Phaseolus vulgaris [French bean]
ref|XP_010436682.1|  PREDICTED: polyubiquitin 4-like                    220   8e-70   
gb|AEW46688.1|  polyubiquitin                                           220   8e-70   Ulva linza
ref|XP_006370634.1|  hypothetical protein POPTR_0001s44440g             220   8e-70   
ref|XP_003607669.1|  Multidrug resistance protein ABC transporter...    222   8e-70   
gb|AAN31845.1|  putative polyubiquitin (UBQ10)                          221   8e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003607667.1|  Multidrug resistance protein ABC transporter...    221   8e-70   
gb|AIZ74335.1|  polyubiquitin 3                                         220   8e-70   Pinus massoniana [Chinese red pine]
ref|XP_009618235.1|  PREDICTED: polyubiquitin-like isoform X1           220   8e-70   Nicotiana tomentosiformis
ref|XP_002872109.1|  predicted protein                                  220   9e-70   
gb|ACA58351.1|  ubiquitin-like protein                                  220   9e-70   Sandersonia aurantiaca [Chinese-lantern lily]
ref|XP_010493589.1|  PREDICTED: polyubiquitin-like                      220   9e-70   Camelina sativa [gold-of-pleasure]
ref|XP_010451655.1|  PREDICTED: polyubiquitin 4-like                    220   9e-70   Camelina sativa [gold-of-pleasure]
ref|XP_007211606.1|  hypothetical protein PRUPE_ppa005503mg             220   9e-70   
gb|ABH06365.1|  ubiquitin                                               220   9e-70   Sorbus aucuparia [European mountain ash]
emb|CAA54603.1|  pentameric polyubiquitin                               220   9e-70   Nicotiana tabacum [American tobacco]
gb|EMS65864.1|  Polyubiquitin                                           220   9e-70   Triticum urartu
gb|AGV54749.1|  ubiquitin 11                                            221   9e-70   Phaseolus vulgaris [French bean]
ref|XP_002452705.1|  hypothetical protein SORBIDRAFT_04g031060          220   9e-70   Sorghum bicolor [broomcorn]
ref|XP_004956019.1|  PREDICTED: polyubiquitin 4-like                    220   9e-70   Setaria italica
gb|AAZ32851.1|  pentameric polyubiquitin                                220   9e-70   Medicago sativa [alfalfa]
ref|XP_010324326.1|  PREDICTED: polyubiquitin isoform X1                220   9e-70   
ref|XP_004953565.1|  PREDICTED: polyubiquitin-like                      220   9e-70   Setaria italica
gb|EYU33607.1|  hypothetical protein MIMGU_mgv1a004315mg                220   9e-70   Erythranthe guttata [common monkey flower]
ref|XP_008224782.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    220   9e-70   
gb|KJB14874.1|  hypothetical protein B456_002G147600                    220   1e-69   Gossypium raimondii
gb|EYU33611.1|  hypothetical protein MIMGU_mgv1a004315mg                220   1e-69   Erythranthe guttata [common monkey flower]
ref|XP_003607668.1|  Multidrug resistance protein ABC transporter...    222   1e-69   
gb|KJB13590.1|  hypothetical protein B456_002G083000                    220   1e-69   Gossypium raimondii
ref|NP_001174480.1|  Os05g0504766                                       220   1e-69   
gb|KDP39203.1|  hypothetical protein JCGZ_00960                         220   1e-69   Jatropha curcas
ref|XP_009114489.1|  PREDICTED: polyubiquitin-like                      220   1e-69   Brassica rapa
ref|XP_009784908.1|  PREDICTED: polyubiquitin-like isoform X2           220   1e-69   Nicotiana sylvestris
gb|EYU33608.1|  hypothetical protein MIMGU_mgv1a004315mg                220   1e-69   Erythranthe guttata [common monkey flower]
ref|XP_010324327.1|  PREDICTED: polyubiquitin isoform X2                220   1e-69   
ref|XP_010934961.1|  PREDICTED: polyubiquitin-A isoform X1              220   1e-69   
gb|AGT38457.1|  polyubiquitin                                           220   1e-69   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006396612.1|  hypothetical protein EUTSA_v10028730mg             220   1e-69   Eutrema salsugineum [saltwater cress]
gb|AGZ80457.1|  ubiquitin-like protein                                  219   1e-69   Phaseolus vulgaris [French bean]
emb|CDP08561.1|  unnamed protein product                                220   1e-69   Coffea canephora [robusta coffee]
ref|XP_011077812.1|  PREDICTED: polyubiquitin 3                         220   1e-69   
gb|EYU33609.1|  hypothetical protein MIMGU_mgv1a004315mg                220   1e-69   Erythranthe guttata [common monkey flower]
ref|XP_007410937.1|  hypothetical protein MELLADRAFT_87680              220   1e-69   Melampsora larici-populina 98AG31
dbj|BAK03691.1|  predicted protein                                      220   1e-69   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010934962.1|  PREDICTED: polyubiquitin-A isoform X2              220   1e-69   
gb|ABY60454.1|  putative polyubiquitin                                  220   1e-69   Adonis aestivalis var. palaestina
gb|AAC49013.1|  polyubiquitin containing 7 ubiquitin monomers           220   1e-69   Zea mays [maize]
ref|XP_010558157.1|  PREDICTED: polyubiquitin-like                      220   1e-69   Tarenaya hassleriana [spider flower]
gb|KEH31009.1|  polyubiquitin 3                                         220   1e-69   Medicago truncatula
ref|XP_007014924.1|  Polyubiquitin 3                                    220   1e-69   Theobroma cacao [chocolate]
emb|CCA16073.1|  polyubiquitin putative                                 220   1e-69   Albugo laibachii Nc14
ref|XP_010262389.1|  PREDICTED: polyubiquitin                           220   1e-69   Nelumbo nucifera [Indian lotus]
ref|XP_010911599.1|  PREDICTED: polyubiquitin 4                         220   1e-69   Elaeis guineensis
ref|XP_002456845.1|  hypothetical protein SORBIDRAFT_03g043940          220   1e-69   Sorghum bicolor [broomcorn]
ref|XP_008645269.1|  PREDICTED: polyubiquitin                           220   1e-69   
emb|CAA66667.1|  polyubiquitin                                          220   1e-69   Pinus sylvestris [Scotch pine]
gb|EYU18101.1|  hypothetical protein MIMGU_mgv1a004289mg                220   1e-69   Erythranthe guttata [common monkey flower]
emb|CAA51679.1|  ubiquitin                                              220   1e-69   Solanum lycopersicum
ref|NP_001105376.1|  polyubiquitin                                      220   1e-69   
gb|KJB69254.1|  hypothetical protein B456_011G016600                    220   1e-69   Gossypium raimondii
gb|ADD52202.1|  ubiquitin                                               220   1e-69   Catharanthus roseus [chatas]
ref|XP_006654612.1|  PREDICTED: polyubiquitin-like                      220   1e-69   Oryza brachyantha
ref|XP_003627152.1|  Ubiquitin                                          220   1e-69   
gb|ABI84246.1|  polyubiquitin 10                                        220   1e-69   Arachis hypogaea [goober]
ref|XP_006396611.1|  hypothetical protein EUTSA_v10028730mg             220   1e-69   
ref|XP_011094688.1|  PREDICTED: polyubiquitin-like                      220   1e-69   Sesamum indicum [beniseed]
ref|XP_008243903.1|  PREDICTED: uncharacterized protein LOC103342...    220   1e-69   
gb|AES89866.2|  polyubiquitin 3                                         220   1e-69   Medicago truncatula
ref|XP_006593991.1|  PREDICTED: polyubiquitin 10-like isoform X3        220   1e-69   
ref|XP_003331105.1|  polyubiquitin-A                                    220   1e-69   Puccinia graminis f. sp. tritici CRL 75-36-700-3
ref|XP_011468094.1|  PREDICTED: polyubiquitin                           220   1e-69   Fragaria vesca subsp. vesca
ref|XP_010046742.1|  PREDICTED: polyubiquitin-like                      220   1e-69   
ref|NP_001045980.1|  Os02g0161900                                       220   1e-69   
ref|XP_006288300.1|  hypothetical protein CARUB_v10001544mg             220   1e-69   Capsella rubella
ref|XP_004249885.1|  PREDICTED: polyubiquitin-like                      220   1e-69   
ref|XP_010454368.1|  PREDICTED: polyubiquitin 4-like                    220   1e-69   Camelina sativa [gold-of-pleasure]
ref|XP_002874006.1|  hypothetical protein ARALYDRAFT_488966             220   1e-69   
ref|XP_007211609.1|  hypothetical protein PRUPE_ppa005507mg             220   1e-69   Prunus persica
gb|ACS68205.1|  ubiquitin 10.2                                          220   1e-69   Brassica napus [oilseed rape]
ref|XP_007154495.1|  hypothetical protein PHAVU_003G1236001g            220   1e-69   Phaseolus vulgaris [French bean]
gb|KJB36627.1|  hypothetical protein B456_006G167800                    220   1e-69   Gossypium raimondii
ref|XP_004505453.1|  PREDICTED: polyubiquitin-A-like                    220   1e-69   
gb|AAB95251.1|  ubiquitin                                               220   1e-69   Arabidopsis thaliana [mouse-ear cress]
gb|EYU18102.1|  hypothetical protein MIMGU_mgv1a008166mg                220   1e-69   Erythranthe guttata [common monkey flower]
ref|XP_006428821.1|  hypothetical protein CICLE_v10012292mg             220   1e-69   Citrus clementina [clementine]
emb|CAA40324.1|  hexaubiquitin protein                                  220   1e-69   Helianthus annuus
gb|ACX46987.1|  ubiquitin                                               220   1e-69   Guzmania wittmackii x Guzmania lingulata
gb|AFP44113.1|  ubiquitin                                               220   1e-69   Lycoris longituba
ref|XP_007154496.1|  hypothetical protein PHAVU_003G1236001g            220   1e-69   Phaseolus vulgaris [French bean]
dbj|BAJ85978.1|  predicted protein                                      220   1e-69   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KDP42860.1|  hypothetical protein JCGZ_23802                         220   1e-69   Jatropha curcas
dbj|BAJ91912.1|  predicted protein                                      220   1e-69   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB13592.1|  hypothetical protein B456_002G083000                    220   1e-69   Gossypium raimondii
ref|NP_568397.1|  ubiquitin 4                                           220   1e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004497490.1|  PREDICTED: polyubiquitin 4-like                    220   1e-69   Cicer arietinum [garbanzo]
gb|ABK94002.1|  unknown                                                 220   1e-69   Populus trichocarpa [western balsam poplar]
ref|XP_002872746.1|  hypothetical protein ARALYDRAFT_911794             220   1e-69   
ref|XP_004968120.1|  PREDICTED: polyubiquitin-like                      220   1e-69   Setaria italica
gb|AFW66442.1|  putative ubiquitin family protein                       220   1e-69   
dbj|BAK02501.1|  predicted protein                                      220   1e-69   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010270791.1|  PREDICTED: polyubiquitin-like                      220   1e-69   Nelumbo nucifera [Indian lotus]
ref|XP_009112898.1|  PREDICTED: polyubiquitin                           220   1e-69   Brassica rapa
gb|KIK16797.1|  hypothetical protein PISMIDRAFT_686019                  219   1e-69   Pisolithus microcarpus 441
ref|XP_003607670.1|  Ubiquitin                                          220   1e-69   
gb|ABD32351.2|  Ubiquitin                                               220   1e-69   Medicago truncatula
ref|XP_009358096.1|  PREDICTED: polyubiquitin isoform X1                220   1e-69   Pyrus x bretschneideri [bai li]
ref|NP_001148453.1|  LOC100282068                                       220   1e-69   Zea mays [maize]
sp|Q58G87.2|UBQ3_ORYSJ  RecName: Full=Polyubiquitin 3; Contains: ...    220   1e-69   Oryza sativa Japonica Group [Japonica rice]
gb|ABU40645.1|  polyubiquitin                                           220   1e-69   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006377830.1|  hypothetical protein POPTR_0011s13770g             220   1e-69   
gb|AET06143.1|  ubiquitin                                               220   1e-69   Papaver somniferum
ref|XP_008244357.1|  PREDICTED: polyubiquitin isoform X1                220   1e-69   Prunus mume [ume]
ref|XP_010423744.1|  PREDICTED: polyubiquitin                           220   1e-69   Camelina sativa [gold-of-pleasure]
gb|ACN40936.1|  unknown                                                 220   1e-69   Picea sitchensis
ref|XP_006428816.1|  hypothetical protein CICLE_v10011684mg             220   1e-69   
gb|AAQ07453.1|  ubiquitin                                               220   1e-69   Musa acuminata AAA Group [Cavendish banana]
ref|XP_010490793.1|  PREDICTED: polyubiquitin 11-like                   220   1e-69   Camelina sativa [gold-of-pleasure]
ref|XP_002508175.1|  ubiquitin                                          220   1e-69   Micromonas commoda
ref|XP_002873083.1|  hypothetical protein ARALYDRAFT_487095             220   1e-69   
gb|EYU33610.1|  hypothetical protein MIMGU_mgv1a004315mg                220   1e-69   Erythranthe guttata [common monkey flower]
dbj|BAC57955.1|  polyubiquitin                                          220   1e-69   Tripolium pannonicum [sea starwort]
ref|XP_010553005.1|  PREDICTED: polyubiquitin-like                      220   1e-69   Tarenaya hassleriana [spider flower]
ref|XP_006350990.1|  PREDICTED: polyubiquitin-A-like                    220   1e-69   Solanum tuberosum [potatoes]
ref|XP_006428820.1|  hypothetical protein CICLE_v10012290mg             220   1e-69   Citrus clementina [clementine]
gb|KHN45015.1|  Polyubiquitin-A                                         220   1e-69   Glycine soja [wild soybean]
ref|XP_009620669.1|  PREDICTED: polyubiquitin-like                      220   1e-69   Nicotiana tomentosiformis
ref|XP_011094250.1|  PREDICTED: polyubiquitin-like                      220   1e-69   Sesamum indicum [beniseed]
ref|XP_011094650.1|  PREDICTED: polyubiquitin                           220   1e-69   Sesamum indicum [beniseed]
gb|AAC16012.1|  polyubiquitin                                           220   1e-69   Elaeagnus umbellata [aki-gumi]
gb|AAX40652.1|  polyubiquitin                                           220   1e-69   Oryza sativa Japonica Group [Japonica rice]
sp|P69315.2|UBIQP_LINUS  RecName: Full=Polyubiquitin; Contains: R...    220   1e-69   Linum usitatissimum
ref|XP_004505084.1|  PREDICTED: polyubiquitin-A-like                    220   1e-69   
ref|XP_006495477.1|  PREDICTED: polyubiquitin 3-like                    220   1e-69   Citrus sinensis [apfelsine]
gb|AAO43307.1|  putative polyubiquitin                                  220   1e-69   Arabidopsis thaliana [mouse-ear cress]
gb|ACJ85618.1|  unknown                                                 220   1e-69   Medicago truncatula
ref|XP_006480631.1|  PREDICTED: polyubiquitin-like                      220   1e-69   Citrus sinensis [apfelsine]
ref|XP_010931017.1|  PREDICTED: polyubiquitin 11 isoform X1             220   1e-69   Elaeis guineensis
ref|XP_007049060.1|  Polyubiquitin 10                                   220   1e-69   
ref|XP_007154494.1|  hypothetical protein PHAVU_003G1236001g            219   1e-69   Phaseolus vulgaris [French bean]
ref|NP_851029.1|  polyubiquitin 3                                       220   1e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010696408.1|  PREDICTED: polyubiquitin 4                         220   1e-69   Beta vulgaris subsp. vulgaris [field beet]
gb|AAL09741.1|  AT4g05320/C17L7_240                                     220   1e-69   Arabidopsis thaliana [mouse-ear cress]
sp|P0CG84.1|UBI4P_NICSY  RecName: Full=Polyubiquitin; Contains: R...    220   1e-69   Nicotiana sylvestris
emb|CAH59740.1|  polyubiquitin                                          220   1e-69   Plantago major [cart-track plant]
ref|XP_003608276.1|  Ubiquitin                                          220   1e-69   Medicago truncatula
ref|XP_002888365.1|  polyubiquitin                                      220   1e-69   Arabidopsis lyrata subsp. lyrata
gb|AAD03343.1|  ubiquitin                                               219   1e-69   Pisum sativum [garden pea]
ref|XP_009591312.1|  PREDICTED: polyubiquitin 4                         220   1e-69   Nicotiana tomentosiformis
ref|XP_009596689.1|  PREDICTED: polyubiquitin-like                      220   1e-69   Nicotiana tomentosiformis
ref|XP_006352490.1|  PREDICTED: polyubiquitin-A-like isoform X1         220   1e-69   Solanum tuberosum [potatoes]
ref|XP_002438839.1|  hypothetical protein SORBIDRAFT_10g027030          220   1e-69   Sorghum bicolor [broomcorn]
ref|XP_006480550.1|  PREDICTED: polyubiquitin-A-like                    220   1e-69   
ref|XP_002266370.1|  PREDICTED: polyubiquitin 4-like                    220   1e-69   Vitis vinifera
ref|XP_006302388.1|  hypothetical protein CARUB_v10020456mg             220   1e-69   Capsella rubella
ref|XP_006302387.1|  hypothetical protein CARUB_v10020456mg             220   1e-69   
ref|XP_003627151.1|  Ubiquitin                                          220   1e-69   Medicago truncatula
ref|XP_002888394.1|  hexaubiquitin protein                              220   1e-69   
ref|XP_006428817.1|  hypothetical protein CICLE_v10011684mg             220   1e-69   
ref|XP_010275241.1|  PREDICTED: polyubiquitin-like                      220   1e-69   Nelumbo nucifera [Indian lotus]
ref|XP_010240921.1|  PREDICTED: polyubiquitin-like                      220   1e-69   Nelumbo nucifera [Indian lotus]
ref|XP_006593989.1|  PREDICTED: polyubiquitin 10-like isoform X1        220   1e-69   
emb|CBY46746.1|  polyubiquitin 10 protein                               220   1e-69   Lepidium campestre [bastard cress]
ref|XP_006428925.1|  hypothetical protein CICLE_v10012291mg             220   1e-69   Citrus clementina [clementine]
gb|KJB81823.1|  hypothetical protein B456_013G163500                    220   1e-69   Gossypium raimondii
gb|ABF06579.2|  polyubiquitin                                           220   1e-69   Gladiolus grandiflorus
ref|XP_006288299.1|  hypothetical protein CARUB_v10001544mg             220   1e-69   
gb|KJB81824.1|  hypothetical protein B456_013G163500                    220   1e-69   Gossypium raimondii
ref|XP_010931828.1|  PREDICTED: polyubiquitin                           220   1e-69   
ref|XP_009150698.1|  PREDICTED: polyubiquitin                           219   1e-69   Brassica rapa
ref|XP_008345409.1|  PREDICTED: polyubiquitin-like                      219   1e-69   
gb|KJB81827.1|  hypothetical protein B456_013G163500                    219   1e-69   Gossypium raimondii
ref|XP_009784905.1|  PREDICTED: polyubiquitin-like isoform X1           219   1e-69   Nicotiana sylvestris
ref|XP_007205620.1|  hypothetical protein PRUPE_ppa009116mg             220   1e-69   
gb|AAY86773.1|  polyubiquitin                                           220   1e-69   Noccaea caerulescens
ref|XP_010421267.1|  PREDICTED: polyubiquitin 4-like                    219   1e-69   Camelina sativa [gold-of-pleasure]
emb|CDP05795.1|  unnamed protein product                                219   1e-69   Coffea canephora [robusta coffee]
ref|XP_003537278.1|  PREDICTED: polyubiquitin-like                      220   1e-69   Glycine max [soybeans]
ref|NP_849292.1|  polyubiquitin 14                                      220   1e-69   Arabidopsis thaliana [mouse-ear cress]
gb|ELU42015.1|  polyubiquitin                                           221   1e-69   Rhizoctonia solani AG-1 IA
gb|EYU38681.1|  hypothetical protein MIMGU_mgv1a004304mg                219   1e-69   Erythranthe guttata [common monkey flower]
ref|NP_849299.4|  polyubiquitin 10                                      219   1e-69   Arabidopsis thaliana [mouse-ear cress]
gb|AAB68045.1|  polyubiquitin                                           219   1e-69   Fragaria x ananassa
ref|XP_003542728.1|  PREDICTED: polyubiquitin-A-like isoform 1          219   1e-69   
gb|KDP38838.1|  hypothetical protein JCGZ_04995                         220   1e-69   Jatropha curcas
ref|XP_010258950.1|  PREDICTED: polyubiquitin                           219   1e-69   Nelumbo nucifera [Indian lotus]
gb|KDO51109.1|  hypothetical protein CISIN_1g026973mg                   220   1e-69   Citrus sinensis [apfelsine]
ref|XP_002317213.1|  polyubiquitin family protein                       219   1e-69   Populus trichocarpa [western balsam poplar]
ref|XP_010431529.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    219   1e-69   Camelina sativa [gold-of-pleasure]
gb|KJB69253.1|  hypothetical protein B456_011G016600                    220   1e-69   Gossypium raimondii
ref|NP_567286.1|  ubiquitin 11                                          220   1e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008350368.1|  PREDICTED: polyubiquitin                           219   1e-69   
ref|XP_002891806.1|  predicted protein                                  219   1e-69   
gb|KJB81825.1|  hypothetical protein B456_013G163500                    219   1e-69   Gossypium raimondii
ref|XP_009763135.1|  PREDICTED: polyubiquitin-like                      219   1e-69   Nicotiana sylvestris
ref|XP_001420612.1|  predicted protein                                  219   1e-69   Ostreococcus lucimarinus CCE9901
ref|XP_008246113.1|  PREDICTED: polyubiquitin                           220   1e-69   Prunus mume [ume]
ref|XP_004976899.1|  PREDICTED: polyubiquitin 3-like                    220   1e-69   Setaria italica
emb|CDP08569.1|  unnamed protein product                                219   1e-69   Coffea canephora [robusta coffee]
ref|XP_006428822.1|  hypothetical protein CICLE_v10012652mg             220   1e-69   Citrus clementina [clementine]
gb|KEH31155.1|  polyubiquitin 3                                         219   1e-69   Medicago truncatula
ref|NP_849300.4|  polyubiquitin 10                                      219   1e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004501591.1|  PREDICTED: polyubiquitin 4-like                    220   1e-69   Cicer arietinum [garbanzo]
gb|AAP31578.1|  ubiquitin                                               220   1e-69   Hevea brasiliensis [jebe]
ref|XP_002267017.1|  PREDICTED: polyubiquitin-like                      220   1e-69   
ref|XP_003542730.1|  PREDICTED: polyubiquitin 10-like                   219   1e-69   
gb|AFW66439.1|  putative ubiquitin family protein                       219   1e-69   
ref|XP_007205619.1|  hypothetical protein PRUPE_ppa009116mg             219   1e-69   
ref|NP_001053957.1|  Os04g0628100                                       219   1e-69   
ref|XP_008441422.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    219   2e-69   Cucumis melo [Oriental melon]
gb|KDP23292.1|  hypothetical protein JCGZ_23125                         219   2e-69   Jatropha curcas
gb|AAO42469.1|  putative polyubiquitin                                  220   2e-69   Arabidopsis lyrata [lyrate rockcress]
ref|XP_009758989.1|  PREDICTED: polyubiquitin                           220   2e-69   Nicotiana sylvestris
tpg|DAA44273.1|  TPA: Ubiquitin fusion protein                          221   2e-69   
ref|XP_006428779.1|  hypothetical protein CICLE_v10012654mg             219   2e-69   Citrus clementina [clementine]
gb|AGV54228.1|  polyubiquitin-like protein                              219   2e-69   Phaseolus vulgaris [French bean]
gb|AAC35858.1|  polyubiquitin                                           220   2e-69   Capsicum chinense [bonnet pepper]
gb|KDO51955.1|  hypothetical protein CISIN_1g026932mg                   219   2e-69   Citrus sinensis [apfelsine]
gb|AAZ82816.1|  ubiquitin monomer protein                               219   2e-69   Morus mongolica [Mongolian mulberry]
ref|XP_008243904.1|  PREDICTED: uncharacterized protein LOC103342...    219   2e-69   
ref|XP_010227188.1|  PREDICTED: polyubiquitin isoform X1                220   2e-69   
gb|AAB95252.1|  ubiquitin                                               219   2e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008243907.1|  PREDICTED: uncharacterized protein LOC103342...    219   2e-69   
emb|CAA48140.1|  ubiquitin                                              219   2e-69   Antirrhinum majus [garden snapdragon]
emb|CAH59739.1|  polyubiquitin                                          219   2e-69   Plantago major [cart-track plant]
emb|CEF99839.1|  Ubiquitin conserved site                               219   2e-69   Ostreococcus tauri
ref|XP_008243908.1|  PREDICTED: uncharacterized protein LOC103342...    219   2e-69   
emb|CAN71997.1|  hypothetical protein VITISV_004025                     219   2e-69   Vitis vinifera
gb|AHI85710.1|  stress-induced protein 5                                220   2e-69   Capsicum annuum
emb|CBY46745.1|  polyubiquitin 10 protein                               219   2e-69   Lepidium appelianum [hairy whitetop]
ref|XP_008243906.1|  PREDICTED: uncharacterized protein LOC103342...    219   2e-69   
gb|ACD31680.1|  ubiquitin                                               219   2e-69   Gossypium hirsutum [American cotton]
ref|NP_001190681.1|  ubiquitin 11                                       219   2e-69   Arabidopsis thaliana [mouse-ear cress]
gb|AFK41706.1|  unknown                                                 219   2e-69   Medicago truncatula
sp|P0CG83.1|UBIQP_HORVU  RecName: Full=Polyubiquitin; Contains: R...    220   2e-69   Hordeum vulgare [barley]
gb|AFJ04519.1|  ubiquitin                                               220   2e-69   Vernicia fordii [tung oil tree]
gb|AIY27743.1|  polyubiquitin Ubi10                                     219   2e-69   Betula luminifera [liang ye hua]
gb|ABD96088.1|  polyubiquitin                                           219   2e-69   Malus domestica [apple tree]
ref|XP_008243909.1|  PREDICTED: uncharacterized protein LOC103342...    219   2e-69   
ref|XP_007693173.1|  hypothetical protein COCMIDRAFT_109160             220   2e-69   Bipolaris oryzae ATCC 44560
ref|XP_003619701.1|  Ubiquitin-like protein                             219   2e-69   
ref|XP_003570150.1|  PREDICTED: polyubiquitin 11 isoform X2             220   2e-69   Brachypodium distachyon [annual false brome]
ref|XP_010235843.1|  PREDICTED: polyubiquitin 11 isoform X1             220   2e-69   Brachypodium distachyon [annual false brome]
gb|AAR32784.1|  polyubiquitin                                           219   2e-69   Clusia minor [cupey de monte]
gb|EMS60894.1|  Polyubiquitin                                           221   2e-69   Triticum urartu
prf||1604470A  poly-ubiquitin                                           219   2e-69
gb|AIY85428.1|  ubiquitin                                               219   2e-69   Elaeagnus umbellata [aki-gumi]
ref|XP_010938693.1|  PREDICTED: polyubiquitin                           219   2e-69   Elaeis guineensis
gb|AES89865.2|  polyubiquitin 3                                         219   2e-69   Medicago truncatula
gb|AAK68824.1|  Unknown protein                                         219   2e-69   Arabidopsis thaliana [mouse-ear cress]
gb|AAB95250.1|  ubiquitin                                               219   2e-69   Arabidopsis thaliana [mouse-ear cress]
gb|EPS72031.1|  polyubiquitin                                           219   3e-69   
gb|AFK46460.1|  unknown                                                 219   3e-69   
ref|XP_009631616.1|  PREDICTED: polyubiquitin-like                      219   3e-69   
ref|XP_008243905.1|  PREDICTED: polyubiquitin-A-like isoform X4         219   3e-69   
gb|KJB62483.1|  hypothetical protein B456_009G418900                    219   3e-69   
ref|XP_009420214.1|  PREDICTED: polyubiquitin                           219   3e-69   
gb|KJB62487.1|  hypothetical protein B456_009G418900                    219   3e-69   
gb|KDB11907.1|  ubiquitin                                               219   3e-69   
ref|XP_008243902.1|  PREDICTED: polyubiquitin-like isoform X1           219   3e-69   
gb|KIL68862.1|  hypothetical protein M378DRAFT_157997                   220   3e-69   
gb|KJB62484.1|  hypothetical protein B456_009G418900                    219   3e-69   
gb|AEG78310.1|  ubiquitin                                               219   3e-69   
emb|CAD27944.1|  polyubiquitin-like                                     218   3e-69   
gb|AAB86858.1|  polyubiquitin                                           218   3e-69   
gb|ABR25718.1|  polyubiquitin containing 7 ubiquitin monomers           220   3e-69   
ref|XP_010453358.1|  PREDICTED: polyubiquitin-like                      218   3e-69   
gb|EMS54972.1|  Polyubiquitin-A                                         221   3e-69   
gb|ACT82769.1|  polyubiquitin                                           218   3e-69   
ref|XP_011048569.1|  PREDICTED: polyubiquitin 3-like                    220   3e-69   
pir||PS0380  ubiquitin precursor - rice (fragment)                      220   3e-69
ref|XP_001764949.1|  predicted protein                                  218   3e-69   
dbj|GAC77607.1|  ubiquitin and ubiquitin-like proteins                  221   3e-69   
ref|XP_009108753.1|  PREDICTED: polyubiquitin 11-like                   217   3e-69   
gb|EGO00904.1|  hypothetical protein SERLA73DRAFT_178893                219   4e-69   
gb|AGZ15412.1|  fiber polyubiquitin                                     219   4e-69   
ref|XP_001731772.1|  hypothetical protein MGL_1040                      219   4e-69   
emb|CAC94926.1|  putative ubiquitin                                     219   4e-69   
dbj|GAC94856.1|  ubiquitin                                              221   4e-69   
emb|CCL99875.1|  predicted protein                                      219   4e-69   
ref|XP_008796945.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    218   4e-69   
gb|KIJ26545.1|  hypothetical protein M422DRAFT_216245                   219   4e-69   
gb|ACJ85643.1|  unknown                                                 218   4e-69   
gb|AAC67552.1|  polyubiquitin                                           218   5e-69   
ref|XP_009388149.1|  PREDICTED: polyubiquitin-like                      218   5e-69   
ref|XP_006381473.1|  polyubiquitin family protein                       218   5e-69   
ref|XP_011390959.1|  putative polyubiquitin                             221   5e-69   
ref|XP_008784557.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    218   5e-69   
ref|XP_008034069.1|  ubiquitin 10.1                                     219   5e-69   
gb|AHC00631.1|  polyubiquitin                                           219   5e-69   
gb|AFK43392.1|  unknown                                                 218   5e-69   
ref|XP_002389222.1|  hypothetical protein MPER_11681                    218   5e-69   
ref|XP_010492041.1|  PREDICTED: polyubiquitin-like                      220   5e-69   
gb|KIM67150.1|  hypothetical protein SCLCIDRAFT_1210637                 219   5e-69   
ref|XP_003196661.1|  ATP-dependent protein binding protein              219   5e-69   
ref|XP_567862.1|  ATP-dependent protein binding protein                 219   5e-69   
gb|KIR63773.1|  polyubiquitin                                           219   6e-69   
gb|KIY53974.1|  polyubiquitin                                           219   6e-69   
gb|EJU00136.1|  ubiquitin                                               219   6e-69   
ref|XP_007861169.1|  polyubiquitin                                      219   6e-69   
gb|AAF21992.1|  polyubiquitin                                           218   6e-69   
tpd|FAA00319.1|  TPA: polyubiquitin                                     219   6e-69   
gb|EUC59758.1|  polyubiquitin                                           219   6e-69   
ref|XP_007154492.1|  hypothetical protein PHAVU_003G123400g             217   6e-69   
gb|KIR29996.1|  polyubiquitin                                           219   6e-69   
gb|KIY45417.1|  ubiquitin                                               219   6e-69   
gb|KIJ45725.1|  hypothetical protein M422DRAFT_106821                   219   6e-69   
emb|CCO30833.1|  Polyubiquitin                                          219   6e-69   
gb|KIK17147.1|  hypothetical protein PISMIDRAFT_685607                  219   6e-69   
gb|KII92029.1|  hypothetical protein PLICRDRAFT_172184                  219   6e-69   
gb|KJB62486.1|  hypothetical protein B456_009G418900                    218   6e-69   
ref|XP_011388891.1|  putative ubiquitin                                 219   6e-69   
gb|AFR98116.1|  polyubiquitin                                           218   6e-69   
gb|EGO00841.1|  hypothetical protein SERLA73DRAFT_121253                218   6e-69   
gb|KII93501.1|  hypothetical protein PLICRDRAFT_694663                  219   6e-69   
emb|CAI51312.2|  polyubiquitin                                          218   6e-69   
ref|XP_007307433.1|  polyubiquitin                                      218   6e-69   
ref|XP_010938173.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    221   6e-69   
gb|KDR85168.1|  hypothetical protein GALMADRAFT_131895                  218   6e-69   
ref|XP_001555417.1|  polyubiquitin                                      219   6e-69   
gb|KDQ63803.1|  hypothetical protein JAAARDRAFT_29850                   218   6e-69   
gb|AAA82978.1|  polyubiquitin                                           218   6e-69   
gb|KJB62482.1|  hypothetical protein B456_009G418900                    217   6e-69   
ref|XP_008020911.1|  hypothetical protein SETTUDRAFT_162442             217   6e-69   
gb|AFY06654.1|  polyubiquitin                                           218   7e-69   
ref|XP_007316637.1|  hypothetical protein SERLADRAFT_368035             219   7e-69   
gb|EMS24129.1|  ubiquitin C                                             219   7e-69   
gb|KIM78981.1|  hypothetical protein PILCRDRAFT_10644                   219   7e-69   
gb|KDQ30621.1|  hypothetical protein PLEOSDRAFT_1088454                 218   7e-69   
gb|KJB62485.1|  hypothetical protein B456_009G418900                    217   7e-69   
gb|KIM40192.1|  hypothetical protein M413DRAFT_73842                    218   7e-69   
ref|XP_001828882.1|  ubiquitin C                                        219   7e-69   
gb|KIK28767.1|  hypothetical protein PISMIDRAFT_672939                  219   7e-69   
ref|XP_007763327.1|  polyubiquitin                                      219   7e-69   
gb|KDQ20365.1|  hypothetical protein BOTBODRAFT_123907                  218   7e-69   
ref|XP_011110054.1|  hypothetical protein H072_4094                     218   7e-69   
gb|KIJ68260.1|  hypothetical protein HYDPIDRAFT_173033                  219   7e-69   
ref|XP_001880135.1|  ubiquitin                                          218   7e-69   
ref|XP_003030030.1|  polyubiquitin                                      218   7e-69   
gb|KIM48035.1|  hypothetical protein M413DRAFT_16078                    218   7e-69   
ref|XP_001598085.1|  polyubiquitin                                      218   7e-69   
gb|ABH10622.2|  ubiquitin                                               218   7e-69   
ref|XP_007864655.1|  ubiquitin                                          218   7e-69   
ref|XP_005848904.1|  hypothetical protein CHLNCDRAFT_51574              218   7e-69   
ref|XP_007339454.1|  ubiquitin                                          218   7e-69   
gb|KIM78989.1|  hypothetical protein PILCRDRAFT_573034                  218   7e-69   
ref|XP_010069740.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    221   7e-69   
gb|AAQ84316.1|  fiber polyubiquitin                                     218   7e-69   
gb|KJA26171.1|  hypothetical protein HYPSUDRAFT_354705                  218   8e-69   
ref|XP_003607659.1|  Ubiquitin                                          219   8e-69   
ref|XP_008809849.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    218   8e-69   
gb|EJU04700.1|  polyubiquitin UbiD/Ubi4                                 218   8e-69   
gb|EEC81189.1|  hypothetical protein OsI_24195                          220   8e-69   
emb|CEL52635.1|  Polyubiquitin OS=Petroselinum crispum GN=PCUBI4-...    219   8e-69   
ref|XP_009605659.1|  PREDICTED: polyubiquitin                           220   8e-69   
ref|XP_007366816.1|  polyubiquitin                                      218   8e-69   
dbj|GAK65396.1|  ubiquitin                                              219   8e-69   
ref|XP_006685644.1|  ubiquitin                                          217   8e-69   
emb|CAA52290.1|  polyubiquitin                                          217   9e-69   
ref|XP_002953480.1|  polyubiquitin                                      217   9e-69   
gb|AAM78180.1|  putative polyubiquitin                                  219   9e-69   
emb|CDR41572.1|  RHTO0S06e03070g1_1                                     219   9e-69   
gb|AAM64530.1|  ubiquitin homolog                                       217   9e-69   
gb|AIS71924.1|  polyubiquitin                                           218   1e-68   
gb|AAB36546.1|  polyubiquitin                                           220   1e-68   
gb|AAO43308.1|  putative polyubiquitin                                  217   1e-68   
emb|CCT70325.1|  UBI4-Ubiquitin                                         218   1e-68   
gb|ACZ69386.1|  polyubiquitin UBQ14                                     219   1e-68   
gb|KGU26596.1|  polyubiquitin                                           216   1e-68   
ref|XP_010452435.1|  PREDICTED: polyubiquitin-like                      217   1e-68   
gb|ABH08754.1|  ubiquitin                                               220   1e-68   
gb|AAY33920.2|  polyubiquitin                                           216   1e-68   
gb|AAF31707.1|AF221858_1  polyubiquitin                                 220   1e-68   
ref|XP_010669246.1|  PREDICTED: polyubiquitin-like                      216   1e-68   
gb|KFY10578.1|  hypothetical protein V492_04946                         218   1e-68   
gb|AAL25813.1|  polyubiquitin                                           218   1e-68   
gb|ABR25697.1|  polyubiquitin containing 7 ubiquitin monomers           219   1e-68   
gb|ABH08753.1|  ubiquitin                                               219   1e-68   
gb|EGA85719.1|  Ubi4p                                                   216   1e-68   
gb|AES89856.2|  polyubiquitin 3                                         218   1e-68   
ref|XP_003052575.1|  predicted protein                                  218   1e-68   
ref|XP_002447145.1|  hypothetical protein SORBIDRAFT_06g029360          217   1e-68   
ref|XP_002992907.1|  hypothetical protein SELMODRAFT_162680             216   1e-68   
gb|ABH08755.1|  ubiquitin                                               219   1e-68   
ref|XP_002973843.1|  hypothetical protein SELMODRAFT_173723             216   1e-68   
gb|EWZ40370.1|  ubiquitin C                                             216   2e-68   
ref|XP_001755307.1|  predicted protein                                  216   2e-68   
ref|XP_002980153.1|  hypothetical protein SELMODRAFT_271419             216   2e-68   
ref|XP_003843815.1|  hypothetical protein LEMA_P014660.1                218   2e-68   
ref|XP_002976481.1|  hypothetical protein SELMODRAFT_271198             216   2e-68   
ref|XP_011037020.1|  PREDICTED: polyubiquitin-like                      217   2e-68   
emb|CEL61766.1|  Polyubiquitin 10 OS=Arabidopsis thaliana GN=UBQ1...    218   2e-68   
ref|XP_002961670.1|  hypothetical protein SELMODRAFT_227280             216   2e-68   
ref|XP_002964737.1|  hypothetical protein SELMODRAFT_270468             216   2e-68   
gb|AAM63271.1|  unknown                                                 217   2e-68   
gb|KIK92093.1|  hypothetical protein PAXRUDRAFT_830299                  217   2e-68   
ref|XP_001774326.1|  predicted protein                                  216   2e-68   
gb|AAO43306.1|  putative polyubiquitin                                  216   2e-68   
gb|EMS22298.1|  polyubiquitin                                           219   2e-68   
ref|XP_001783045.1|  predicted protein                                  216   2e-68   
ref|XP_001761027.1|  predicted protein                                  216   2e-68   
ref|XP_002992988.1|  hypothetical protein SELMODRAFT_187148             216   2e-68   
gb|KFY47659.1|  hypothetical protein V496_10504                         219   2e-68   
gb|AFJ93197.1|  ubiquitin                                               216   2e-68   
dbj|BAK19068.1|  ubiquitin                                              216   2e-68   
dbj|BAL61084.1|  polyubiqutin                                           216   2e-68   
ref|XP_001777816.1|  predicted protein                                  216   2e-68   
dbj|BAL61087.1|  polyubiquitin                                          216   2e-68   
emb|CCO30213.1|  Polyubiquitin 3                                        219   2e-68   
ref|XP_006372519.1|  polyubiquitin family protein                       216   2e-68   
ref|XP_001755431.1|  predicted protein                                  216   2e-68   
ref|XP_002957068.1|  polyubiquitin                                      217   2e-68   
gb|KIY97324.1|  ubiquitin C                                             215   2e-68   
gb|EGA57707.1|  Ubi4p                                                   216   2e-68   
ref|XP_001701379.1|  bi-ubiquitin, major isoform                        217   2e-68   
emb|CCA40372.1|  Ubiquitin cross-reactive protein                       216   3e-68   
gb|AAO43309.1|  putative polyubiquitin                                  216   3e-68   
gb|AAF04147.1|  ubiquitin precursor                                     217   3e-68   
ref|XP_002870459.1|  polyubiquitin                                      218   3e-68   
ref|XP_460488.1|  DEHA2F02816p                                          216   3e-68   
gb|ABI53721.1|  polyubiquitin                                           216   3e-68   
ref|XP_003675939.1|  hypothetical protein NCAS_0C05850                  216   3e-68   
gb|ABI53722.1|  polyubiquitin                                           216   3e-68   
ref|XP_002498336.1|  ZYRO0G07854p                                       216   3e-68   
ref|XP_453980.1|  hypothetical protein                                  216   3e-68   
gb|ELR08709.1|  polyubiquitin                                           216   3e-68   
gb|EEH20847.2|  polyubiquitin                                           216   3e-68   
ref|XP_001486573.1|  ubiquitin                                          216   3e-68   
ref|XP_011275993.1|  ubiquitin C                                        216   3e-68   
ref|XP_002494205.1|  Ubiquitin                                          216   3e-68   
gb|KIR83632.1|  polyubiquitin                                           219   3e-68   
ref|XP_003670049.1|  hypothetical protein NDAI_0D04930                  216   3e-68   
tpd|FAA00316.1|  TPA: polyubiquitin                                     216   3e-68   
ref|XP_001830230.1|  ubiquitin                                          216   3e-68   
gb|AAV65292.1|  polyubiquitin                                           216   3e-68   
ref|XP_006285847.1|  hypothetical protein CARUB_v10007326mg             218   3e-68   
dbj|BAO38900.1|  ubiquitin                                              216   3e-68   
ref|NP_013061.1|  ubiquitin                                             216   3e-68   
ref|XP_007808982.1|  ubiquitin                                          216   3e-68   
gb|EKV13151.1|  hypothetical protein PDIG_39650                         216   3e-68   
gb|AAC64787.1|  polyubiquitin                                           216   3e-68   
ref|NP_983342.1|  ACL062Cp                                              216   3e-68   
ref|XP_002839703.1|  hypothetical protein                               216   3e-68   
gb|KIW56414.1|  polyubiquitin                                           216   3e-68   
emb|CDH13606.1|  Polyubiquitin-C                                        216   3e-68   
gb|KEZ40313.1|  Polyubiquitin                                           216   3e-68   
gb|EEH07231.1|  ubiquitin                                               216   3e-68   
ref|XP_445631.1|  hypothetical protein                                  216   3e-68   
ref|XP_010756991.1|  polyubiquitin                                      216   3e-68   
ref|XP_001643983.1|  hypothetical protein Kpol_1070p6                   216   3e-68   
ref|XP_001227036.1|  polyubiquitin                                      216   3e-68   
ref|XP_001210780.1|  ubiquitin                                          216   3e-68   
dbj|BAP70433.1|  Ubiquitin                                              216   3e-68   
gb|AEZ66647.1|  putative beta-1,6-glucanase                             216   3e-68   
gb|EPS29015.1|  hypothetical protein PDE_03961                          216   4e-68   
ref|XP_002171731.1|  ubiquitin                                          216   4e-68   
gb|ESW96372.1|  Polyubiquitin-A                                         216   4e-68   
ref|NP_595409.1|  ubiquitin                                             216   4e-68   
emb|CDH08450.1|  ubiquitin and ubiquitin-like proteins                  216   4e-68   
ref|XP_001266981.1|  polyubiquitin (UbiD), putative                     216   4e-68   
emb|CCF48657.1|  probable polyubiquitin                                 219   4e-68   
ref|XP_002551324.1|  ubiquitin                                          216   4e-68   
ref|XP_002419618.1|  ubiquitin, putative                                216   4e-68   
ref|XP_002627625.1|  ubiquitin                                          216   4e-68   
ref|XP_659604.1|  hypothetical protein AN2000.2                         216   4e-68   
gb|EEQ88150.1|  ubiquitin                                               216   4e-68   
ref|XP_001931824.1|  ubiquitin                                          216   4e-68   
gb|EAX04506.1|  ubiquitin B, isoform CRA_e                              216   4e-68   
ref|XP_007924320.1|  hypothetical protein MYCFIDRAFT_60610              216   4e-68   
gb|KFY77115.1|  hypothetical protein V499_03430                         216   4e-68   
emb|CEP60563.1|  LALA0S01e13784g1_1                                     216   4e-68   
gb|EPX74297.1|  ubiquitin                                               216   4e-68   



>ref|XP_003619702.1| Ubiquitin-like protein [Medicago truncatula]
Length=245

 Score =   223 bits (568),  Expect(2) = 1e-70, Method: Compositional matrix adjust.
 Identities = 112/115 (97%), Positives = 112/115 (97%), Gaps = 0/115 (0%)
 Frame = +1

Query  52   LKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  231
             KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  50   FKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  109

Query  232  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  110  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  164


 Score = 70.5 bits (171),  Expect(2) = 1e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  163  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  207


 Score =   221 bits (563),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  128  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  187

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  188  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  240


 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  87   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  131



>ref|XP_007154493.1| hypothetical protein PHAVU_003G123500g [Phaseolus vulgaris]
 gb|ESW26487.1| hypothetical protein PHAVU_003G123500g [Phaseolus vulgaris]
Length=429

 Score =   223 bits (568),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/115 (98%), Positives = 113/115 (98%), Gaps = 0/115 (0%)
 Frame = +1

Query  52   LKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  231
            LKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  47   LKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  106

Query  232  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  107  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  161


 Score = 69.7 bits (169),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  160  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  204


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  125  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  185  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  237


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  201  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  260

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  261  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  313


 Score = 69.7 bits (169),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  236  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  280


 Score = 69.7 bits (169),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  312  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  356


 Score =   220 bits (560),  Expect(2) = 5e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  277  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  336

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  337  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  389


 Score = 61.2 bits (147),  Expect(2) = 5e-67, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  388  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  428


 Score =   154 bits (390),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  353  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  412

Query  238  IQKESTLHLVLRLRGGM  288
            IQKESTLHLVLRLRGG 
Sbjct  413  IQKESTLHLVLRLRGGF  429


 Score = 69.7 bits (169),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  84   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  128



>gb|AEZ49160.1| polyubiquitin, partial [Wolffia australiana]
Length=281

 Score =   222 bits (566),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 112/114 (98%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = +1

Query  55   KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  234
            KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  20   KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  79

Query  235  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  80   NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  133


 Score = 70.1 bits (170),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  132  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  176


 Score =   221 bits (562),  Expect(2) = 6e-70, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  97   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  156

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  157  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  209


 Score = 70.1 bits (170),  Expect(2) = 6e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  208  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  252


 Score =   209 bits (532),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 106/109 (97%), Positives = 106/109 (97%), Gaps = 0/109 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  173  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  232

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDK  384
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE  SSDTIDNVKAKI DK
Sbjct  233  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVASSDTIDNVKAKIQDK  281


 Score = 73.6 bits (179),  Expect(2) = 7e-26, Method: Compositional matrix adjust.
 Identities = 37/42 (88%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  271  RLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            RL+  MQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  16   RLQSKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  57


 Score = 70.1 bits (170),  Expect(2) = 7e-26, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  56   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  100



>ref|XP_009412006.1| PREDICTED: polyubiquitin 11-like [Musa acuminata subsp. malaccensis]
Length=231

 Score =   221 bits (564),  Expect(2) = 3e-70, Method: Compositional matrix adjust.
 Identities = 111/115 (97%), Positives = 113/115 (98%), Gaps = 0/115 (0%)
 Frame = +1

Query  52   LKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  231
            ++MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  1    MQMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  60

Query  232  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  115


 Score = 70.1 bits (170),  Expect(2) = 3e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  114  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  158


 Score =   201 bits (510),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  79   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  138

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNV  363
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNV
Sbjct  139  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  180


 Score =   121 bits (303),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 63/76 (83%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNV             QQRLIFAGKQLEDGRTLADYN
Sbjct  155  MQIFVKTLTGKTITLEVESSDTIDNVXXXXXXXXXXXXXQQRLIFAGKQLEDGRTLADYN  214

Query  238  IQKESTLHLVLRLRGG  285
            IQKESTLHLVLRLRGG
Sbjct  215  IQKESTLHLVLRLRGG  230


 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  38   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  82


 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 28/38 (74%), Gaps = 1/38 (3%)
 Frame = +2

Query  404  QQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
            QQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  194  QQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  230



>ref|XP_003574865.1| PREDICTED: polyubiquitin-like [Brachypodium distachyon]
Length=341

 Score =   222 bits (565),  Expect(2) = 3e-70, Method: Compositional matrix adjust.
 Identities = 112/114 (98%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = +1

Query  55   KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  234
            KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  36   KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  95

Query  235  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  96   NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  149


 Score = 70.1 bits (170),  Expect(2) = 3e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  148  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  192


 Score =   220 bits (561),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  113  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  172

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  173  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  225


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  224  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  268


 Score =   220 bits (561),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  189  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  248

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  249  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  301


 Score =   154 bits (390),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 76/76 (100%), Positives = 76/76 (100%), Gaps = 0/76 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  265  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  324

Query  238  IQKESTLHLVLRLRGG  285
            IQKESTLHLVLRLRGG
Sbjct  325  IQKESTLHLVLRLRGG  340


 Score = 70.1 bits (170),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  72   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  116


 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  300  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  340



>ref|XP_006287868.1| hypothetical protein CARUB_v10001095mg, partial [Capsella rubella]
 gb|EOA20766.1| hypothetical protein CARUB_v10001095mg, partial [Capsella rubella]
Length=407

 Score =   222 bits (565),  Expect(2) = 3e-70, Method: Compositional matrix adjust.
 Identities = 112/115 (97%), Positives = 112/115 (97%), Gaps = 0/115 (0%)
 Frame = +1

Query  52   LKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  231
             KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  24   FKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  83

Query  232  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  84   YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  138


 Score = 69.7 bits (169),  Expect(2) = 3e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  137  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  181


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  102  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  161

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  162  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  214


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  178  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  290


 Score = 69.7 bits (169),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  213  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  257


 Score = 69.7 bits (169),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  289  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  333


 Score =   220 bits (560),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  254  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  313

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  314  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  366


 Score = 61.2 bits (147),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  365  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  405


 Score =   154 bits (390),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 76/76 (100%), Positives = 76/76 (100%), Gaps = 0/76 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  330  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  389

Query  238  IQKESTLHLVLRLRGG  285
            IQKESTLHLVLRLRGG
Sbjct  390  IQKESTLHLVLRLRGG  405


 Score = 69.7 bits (169),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  61   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  105



>ref|XP_007512209.1| polyubiquitin [Bathycoccus prasinos]
 emb|CCO66297.1| polyubiquitin [Bathycoccus prasinos]
Length=359

 Score =   221 bits (564),  Expect(2) = 3e-70, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  128  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  187

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  188  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  240


 Score = 70.5 bits (171),  Expect(2) = 3e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  239  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  283


 Score =   221 bits (564),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  204  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  263

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  264  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  316


 Score = 61.6 bits (148),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  315  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  355


 Score =   197 bits (502),  Expect(2) = 4e-63, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 111/164 (68%), Gaps = 51/164 (31%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG-------------------------  162
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG                         
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGTFRVKSRRLKFCLLALLDSATTIES  60

Query  163  --------------------------IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  264
                                      IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  61   SLALRSKKSSERREREKESALSRARGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  120

Query  265  VLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            VLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  121  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  164


 Score = 70.5 bits (171),  Expect(2) = 4e-63, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  163  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  207


 Score =   155 bits (392),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 76/76 (100%), Positives = 76/76 (100%), Gaps = 0/76 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  280  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  339

Query  238  IQKESTLHLVLRLRGG  285
            IQKESTLHLVLRLRGG
Sbjct  340  IQKESTLHLVLRLRGG  355


 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  87   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  131



>ref|XP_003626479.1| Ubiquitin-like protein [Medicago truncatula]
 gb|AES82697.1| polyubiquitin 3 [Medicago truncatula]
Length=277

 Score =   222 bits (566),  Expect(2) = 3e-70, Method: Compositional matrix adjust.
 Identities = 112/115 (97%), Positives = 113/115 (98%), Gaps = 0/115 (0%)
 Frame = +1

Query  52   LKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  231
            +KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  47   IKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  106

Query  232  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  107  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  161


 Score = 69.7 bits (169),  Expect(2) = 3e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  160  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  204


 Score =   220 bits (560),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  125  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  185  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  237


 Score =   154 bits (390),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  201  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  260

Query  238  IQKESTLHLVLRLRGGM  288
            IQKESTLHLVLRLRGG 
Sbjct  261  IQKESTLHLVLRLRGGF  277


 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  84   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  128


 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  236  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  276



>emb|CBI22349.3| unnamed protein product [Vitis vinifera]
Length=298

 Score =   222 bits (565),  Expect(2) = 3e-70, Method: Compositional matrix adjust.
 Identities = 112/115 (97%), Positives = 112/115 (97%), Gaps = 0/115 (0%)
 Frame = +1

Query  52   LKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  231
             KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  26   FKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  85

Query  232  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  86   YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  140


 Score = 69.7 bits (169),  Expect(2) = 3e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  139  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  183


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  104  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  163

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  164  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  216


 Score = 69.7 bits (169),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  215  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  259


 Score =   216 bits (549),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 109/112 (97%), Positives = 110/112 (98%), Gaps = 0/112 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  180  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  239

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGI  393
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEG+
Sbjct  240  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGM  291


 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  63   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  107



>gb|EGA81850.1| Ubi4p [Saccharomyces cerevisiae Lalvin QA23]
Length=123

 Score =   220 bits (561),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 111/123 (90%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIPTRPAKAD  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK+KI DKEGIP    + D
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQEVD  120

Query  418  LRR  426
            L R
Sbjct  121  LCR  123


 Score = 68.9 bits (167),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTL+ YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLH-LVLRLRGGMQIF  80



>ref|XP_010240636.1| PREDICTED: polyubiquitin isoform X1 [Brachypodium distachyon]
 ref|XP_010240784.1| PREDICTED: polyubiquitin isoform X1 [Brachypodium distachyon]
Length=383

 Score =   221 bits (564),  Expect(2) = 4e-70, Method: Compositional matrix adjust.
 Identities = 111/115 (97%), Positives = 113/115 (98%), Gaps = 0/115 (0%)
 Frame = +1

Query  52   LKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  231
            ++MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  1    MQMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  60

Query  232  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  115


 Score = 70.1 bits (170),  Expect(2) = 4e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  114  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  158


 Score =   220 bits (561),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  79   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  138

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  139  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  191


 Score =   220 bits (561),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  155  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  214

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  215  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  267


 Score = 70.1 bits (170),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  190  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  234


 Score = 70.1 bits (170),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  266  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  310


 Score =   220 bits (561),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  231  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  290

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  291  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  343


 Score = 61.6 bits (148),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  342  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  382


 Score =   154 bits (390),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/76 (100%), Positives = 76/76 (100%), Gaps = 0/76 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  307  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  366

Query  238  IQKESTLHLVLRLRGG  285
            IQKESTLHLVLRLRGG
Sbjct  367  IQKESTLHLVLRLRGG  382


 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  38   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  82



>ref|NP_001147027.1| polyubiquitin containing 7 ubiquitin monomers [Zea mays]
 gb|ACG25128.1| polyubiquitin containing 7 ubiquitin monomers [Zea mays]
Length=311

 Score =   222 bits (565),  Expect(2) = 4e-70, Method: Compositional matrix adjust.
 Identities = 112/114 (98%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = +1

Query  55   KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  234
            KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  82   KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  141

Query  235  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  142  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  195


 Score = 69.7 bits (169),  Expect(2) = 4e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  194  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  238


 Score =   220 bits (560),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  159  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  218

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  219  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  271


 Score =   166 bits (419),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 91/119 (76%), Positives = 94/119 (79%), Gaps = 6/119 (5%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL----  225
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR L    
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRNLIFSP  60

Query  226  --ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
               + +  +          R  MQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   FARNAHTARSPISDPRSPRRSKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  119


 Score = 69.7 bits (169),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  118  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  162


 Score =   154 bits (390),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 76/76 (100%), Positives = 76/76 (100%), Gaps = 0/76 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  235  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  294

Query  238  IQKESTLHLVLRLRGG  285
            IQKESTLHLVLRLRGG
Sbjct  295  IQKESTLHLVLRLRGG  310


 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  270  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  310



>ref|XP_010062974.1| PREDICTED: polyubiquitin [Eucalyptus grandis]
Length=425

 Score =   221 bits (564),  Expect(2) = 4e-70, Method: Compositional matrix adjust.
 Identities = 111/115 (97%), Positives = 113/115 (98%), Gaps = 0/115 (0%)
 Frame = +1

Query  52   LKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  231
            +KMQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  43   VKMQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  102

Query  232  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  103  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  157


 Score = 69.7 bits (169),  Expect(2) = 4e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  156  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  200


 Score =   220 bits (561),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  121  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  180

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  181  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  233


 Score = 69.7 bits (169),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  232  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  276


 Score =   219 bits (559),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  197  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  256

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDT+DNVKAKI DKEGIP
Sbjct  257  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIP  309


 Score = 69.7 bits (169),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  308  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  352


 Score =   219 bits (559),  Expect(2) = 6e-67, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  273  MQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  332

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  333  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  385


 Score = 61.2 bits (147),  Expect(2) = 6e-67, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  384  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  424


 Score =   154 bits (390),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  349  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  408

Query  238  IQKESTLHLVLRLRGGM  288
            IQKESTLHLVLRLRGG 
Sbjct  409  IQKESTLHLVLRLRGGF  425


 Score = 71.6 bits (174),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 45/59 (76%), Gaps = 6/59 (10%)
 Frame = +1

Query  220  TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
             L+ +++ K S+L      R  MQIFVKTLTGKTITLE ESSDT+DNVKAKI DKEGIP
Sbjct  29   ALSPFDLSKFSSL------RVKMQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIP  81


 Score = 69.7 bits (169),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  80   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  124



>gb|AFW66445.1| ubiquitin2 [Zea mays]
Length=535

 Score =   221 bits (563),  Expect(2) = 4e-70, Method: Compositional matrix adjust.
 Identities = 111/115 (97%), Positives = 113/115 (98%), Gaps = 0/115 (0%)
 Frame = +1

Query  52   LKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  231
            ++MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  1    MQMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  60

Query  232  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  115


 Score = 70.1 bits (170),  Expect(2) = 4e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  114  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  158


 Score =   220 bits (560),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  79   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  138

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  139  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  191


 Score =   220 bits (560),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  155  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  214

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  215  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  267


 Score =   220 bits (560),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  231  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  290

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  291  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  343


 Score =   220 bits (560),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  307  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  366

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  367  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  419


 Score = 70.1 bits (170),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  190  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  234


 Score = 70.1 bits (170),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  266  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  310


 Score = 70.1 bits (170),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  342  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  386


 Score = 70.1 bits (170),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  418  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  462


 Score =   220 bits (560),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  383  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  442

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  443  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  495


 Score = 61.6 bits (148),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  494  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  534


 Score =   154 bits (390),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 76/76 (100%), Positives = 76/76 (100%), Gaps = 0/76 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  459  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  518

Query  238  IQKESTLHLVLRLRGG  285
            IQKESTLHLVLRLRGG
Sbjct  519  IQKESTLHLVLRLRGG  534


 Score = 70.1 bits (170),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  38   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  82



>ref|XP_002872805.1| hypothetical protein ARALYDRAFT_490270 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49064.1| hypothetical protein ARALYDRAFT_490270 [Arabidopsis lyrata subsp. 
lyrata]
Length=309

 Score =   222 bits (565),  Expect(2) = 4e-70, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score =   222 bits (565),  Expect(2) = 4e-70, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score = 69.7 bits (169),  Expect(2) = 4e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score = 69.7 bits (169),  Expect(2) = 4e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score =   212 bits (540),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 107/110 (97%), Positives = 108/110 (98%), Gaps = 0/110 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKE  387
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DK+
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKK  262


 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80



>gb|AIS40894.1| polyubiquitin [Kalanchoe fedtschenkoi]
Length=470

 Score =   221 bits (564),  Expect(2) = 4e-70, Method: Compositional matrix adjust.
 Identities = 112/114 (98%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = +1

Query  55   KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  234
            KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  13   KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  72

Query  235  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  73   NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  126


 Score = 70.1 bits (170),  Expect(2) = 4e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  125  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  169


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  90   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  149

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  150  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  202


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  166  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  225

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  226  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  278


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  242  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  301

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  302  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  354


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  201  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  245


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  277  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  321


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  353  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  397


 Score =   220 bits (560),  Expect(2) = 5e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  318  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  377

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  430


 Score = 61.2 bits (147),  Expect(2) = 5e-67, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  429  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  469


 Score =   154 bits (389),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 76/76 (100%), Positives = 76/76 (100%), Gaps = 0/76 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  394  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  453

Query  238  IQKESTLHLVLRLRGG  285
            IQKESTLHLVLRLRGG
Sbjct  454  IQKESTLHLVLRLRGG  469


 Score = 70.1 bits (170),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  49   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  93



>ref|XP_006495490.1| PREDICTED: polyubiquitin 4-like, partial [Citrus sinensis]
Length=120

 Score =   220 bits (560),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score = 89.4 bits (220),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/44 (100%), Positives = 44/44 (100%), Gaps = 0/44 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  189
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120


 Score = 70.1 bits (170),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80



>ref|XP_008358804.1| PREDICTED: LOW QUALITY PROTEIN: polyubiquitin 11-like, partial 
[Malus domestica]
Length=260

 Score =   221 bits (562),  Expect(2) = 5e-70, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score =   221 bits (562),  Expect(2) = 5e-70, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score = 70.5 bits (171),  Expect(2) = 5e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score = 70.5 bits (171),  Expect(2) = 5e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score =   204 bits (520),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 104/105 (99%), Positives = 104/105 (99%), Gaps = 0/105 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAK  372
            IQKESTLHLVLRLRGGMQIFVKT TGKTITLEXESSDTIDNVKAK
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTXTGKTITLEXESSDTIDNVKAK  257


 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80



>ref|XP_003590494.1| Ubiquitin [Medicago truncatula]
Length=312

 Score =   221 bits (563),  Expect(2) = 5e-70, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score = 70.1 bits (170),  Expect(2) = 5e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score =   221 bits (563),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score =   155 bits (391),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 76/76 (100%), Positives = 76/76 (100%), Gaps = 0/76 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGG  285
            IQKESTLHLVLRLRGG
Sbjct  213  IQKESTLHLVLRLRGG  228


 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80


 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESN  484
             PPDQQRLIFAGK LEDGRTLA YNI KES 
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKEST  218



>dbj|BAJ61942.1| ubiquitin [Nymphaea hybrid cultivar]
Length=146

 Score =   221 bits (562),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score =   134 bits (336),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 67/69 (97%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHL  264
            IQKEST  L
Sbjct  137  IQKESTSTL  145


 Score = 70.1 bits (170),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80


 Score = 58.5 bits (140),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXS  490
             PPDQQRLIFAGK LEDGRTLA YNI KES  +
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTST  144



>emb|CBI22354.3| unnamed protein product [Vitis vinifera]
Length=771

 Score =   221 bits (563),  Expect(2) = 6e-70, Method: Compositional matrix adjust.
 Identities = 112/115 (97%), Positives = 112/115 (97%), Gaps = 0/115 (0%)
 Frame = +1

Query  52   LKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  231
             KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  408  FKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  467

Query  232  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  468  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  522


 Score = 69.7 bits (169),  Expect(2) = 6e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  521  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  565


 Score =   219 bits (559),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  42   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  101

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  102  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  154


 Score =   219 bits (559),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  118  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  177

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  178  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  230


 Score =   219 bits (559),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  486  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  545

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  546  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  598


 Score =   219 bits (559),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  562  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  621

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  622  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  674


 Score = 69.7 bits (169),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  153  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  197


 Score = 69.7 bits (169),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  229  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  273


 Score = 69.7 bits (169),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  597  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  641


 Score = 69.7 bits (169),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  673  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  717


 Score =   219 bits (559),  Expect(2) = 7e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  194  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  253

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  254  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  306


 Score = 61.2 bits (147),  Expect(2) = 7e-67, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  305  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  345


 Score =   183 bits (465),  Expect(2) = 6e-53, Method: Compositional matrix adjust.
 Identities = 92/92 (100%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  638  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  697

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE  333
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE
Sbjct  698  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE  729


 Score = 50.8 bits (120),  Expect(2) = 6e-53, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 28/38 (74%), Gaps = 1/38 (3%)
 Frame = +2

Query  404  QQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
            +QRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  729  EQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  765


 Score =   133 bits (334),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 76/113 (67%), Gaps = 35/113 (31%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLE                                   DGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLE-----------------------------------DGRTLADYN  25

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  26   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  78


 Score = 69.7 bits (169),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  77   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  121


 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 78/82 (95%), Positives = 79/82 (96%), Gaps = 0/82 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  270  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  329

Query  238  IQKESTLHLVLRLRGGMQIFVK  303
            IQKESTLHLVLRLRGG  + VK
Sbjct  330  IQKESTLHLVLRLRGGDPMDVK  351


 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  445  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  489



>gb|AFC36452.1| ubiquitin, partial [Anoectochilus roxburghii]
Length=214

 Score =   221 bits (562),  Expect(2) = 6e-70, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  32   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  91

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  92   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  144


 Score = 70.5 bits (171),  Expect(2) = 6e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  143  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  187


 Score =   207 bits (528),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 105/106 (99%), Positives = 105/106 (99%), Gaps = 0/106 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  108  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKI  375
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI
Sbjct  168  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI  213


 Score =   132 bits (333),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 66/68 (97%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = +1

Query  193  AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAK  372
            AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAK
Sbjct  1    AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAK  60

Query  373  IXDKEGIP  396
            I DKEGIP
Sbjct  61   IQDKEGIP  68


 Score = 70.5 bits (171),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  67   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  111


 Score = 60.1 bits (144),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 31/31 (100%), Gaps = 0/31 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQ  150
            MQIFVKTLTGKTITLEVESSDTIDNVKAKI+
Sbjct  184  MQIFVKTLTGKTITLEVESSDTIDNVKAKIR  214


 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 26/36 (72%), Gaps = 1/36 (3%)
 Frame = +2

Query  422  AGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
            AGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  1    AGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  35



>emb|CAB81074.1| polyubiquitin (ubq10) [Arabidopsis thaliana]
Length=464

 Score =   221 bits (562),  Expect(2) = 6e-70, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score =   221 bits (562),  Expect(2) = 6e-70, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score =   221 bits (562),  Expect(2) = 6e-70, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score =   221 bits (562),  Expect(2) = 6e-70, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  341


 Score = 70.1 bits (170),  Expect(2) = 6e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score = 70.1 bits (170),  Expect(2) = 6e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score = 70.1 bits (170),  Expect(2) = 6e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  308


 Score = 70.1 bits (170),  Expect(2) = 6e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  340  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  384


 Score =   213 bits (543),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 108/110 (98%), Positives = 108/110 (98%), Gaps = 0/110 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  305  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  364

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKE  387
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKE
Sbjct  365  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE  414


 Score = 70.1 bits (170),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80



>ref|XP_002267206.2| PREDICTED: polyubiquitin-C-like [Vitis vinifera]
Length=987

 Score =   221 bits (563),  Expect(2) = 6e-70, Method: Compositional matrix adjust.
 Identities = 112/115 (97%), Positives = 112/115 (97%), Gaps = 0/115 (0%)
 Frame = +1

Query  52   LKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  231
             KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  600  FKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  659

Query  232  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  660  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  714


 Score = 69.7 bits (169),  Expect(2) = 6e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  713  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  757


 Score =   219 bits (558),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score =   219 bits (558),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score =   219 bits (558),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score =   219 bits (558),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  341


 Score =   219 bits (558),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  305  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  364

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  365  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  417


 Score =   219 bits (558),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  678  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  737

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  738  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  790


 Score =   219 bits (558),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  754  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  813

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  814  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  866


 Score = 69.7 bits (169),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score = 69.7 bits (169),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score = 69.7 bits (169),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  308


 Score = 69.7 bits (169),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  340  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  384


 Score = 69.7 bits (169),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  416  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  460


 Score = 69.7 bits (169),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  789  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  833


 Score = 69.7 bits (169),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  865  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  909


 Score =   219 bits (558),  Expect(2) = 8e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  381  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  440

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  441  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  493


 Score =   219 bits (558),  Expect(2) = 8e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  830  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  889

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  890  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  942


 Score = 61.2 bits (147),  Expect(2) = 8e-67, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  492  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  532


 Score = 61.2 bits (147),  Expect(2) = 8e-67, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  941  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  981


 Score =   154 bits (389),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/76 (100%), Positives = 76/76 (100%), Gaps = 0/76 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  457  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  516

Query  238  IQKESTLHLVLRLRGG  285
            IQKESTLHLVLRLRGG
Sbjct  517  IQKESTLHLVLRLRGG  532


 Score =   154 bits (389),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/76 (100%), Positives = 76/76 (100%), Gaps = 0/76 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  906  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  965

Query  238  IQKESTLHLVLRLRGG  285
            IQKESTLHLVLRLRGG
Sbjct  966  IQKESTLHLVLRLRGG  981


 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80


 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  637  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  681



>gb|AFW70219.1| polyubiquitin-like protein [Zea mays]
Length=502

 Score =   220 bits (561),  Expect(2) = 7e-70, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score =   220 bits (561),  Expect(2) = 7e-70, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score =   220 bits (561),  Expect(2) = 7e-70, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score = 70.5 bits (171),  Expect(2) = 7e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score = 70.5 bits (171),  Expect(2) = 7e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score = 70.5 bits (171),  Expect(2) = 7e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  308


 Score =   220 bits (561),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  350  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  409

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  410  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  462


 Score = 61.6 bits (148),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  461  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  501


 Score =   207 bits (528),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 105/106 (99%), Positives = 105/106 (99%), Gaps = 0/106 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKI  375
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI  334


 Score =   155 bits (391),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 76/76 (100%), Positives = 76/76 (100%), Gaps = 0/76 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  426  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  485

Query  238  IQKESTLHLVLRLRGG  285
            IQKESTLHLVLRLRGG
Sbjct  486  IQKESTLHLVLRLRGG  501


 Score = 70.5 bits (171),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80


 Score = 70.5 bits (171),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  385  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  429



>dbj|BAF00213.1| polyubiquitin 4 UBQ4 [Arabidopsis thaliana]
Length=351

 Score =   220 bits (561),  Expect(2) = 7e-70, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score = 70.5 bits (171),  Expect(2) = 7e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score =   220 bits (561),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  198  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  257

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  258  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  310


 Score = 61.6 bits (148),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  309  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  349


 Score =   207 bits (528),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 105/106 (99%), Positives = 105/106 (99%), Gaps = 0/106 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKI  375
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI  182


 Score =   155 bits (391),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 76/76 (100%), Positives = 76/76 (100%), Gaps = 0/76 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  274  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  333

Query  238  IQKESTLHLVLRLRGG  285
            IQKESTLHLVLRLRGG
Sbjct  334  IQKESTLHLVLRLRGG  349


 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80


 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  233  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  277



>emb|CAA40323.1| polyubiquitin protein [Helianthus annuus]
Length=334

 Score =   220 bits (561),  Expect(2) = 7e-70, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score =   220 bits (561),  Expect(2) = 7e-70, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score =   220 bits (561),  Expect(2) = 7e-70, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score = 70.5 bits (171),  Expect(2) = 7e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score = 70.5 bits (171),  Expect(2) = 7e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score = 70.5 bits (171),  Expect(2) = 7e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  308


 Score =   207 bits (528),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 105/106 (99%), Positives = 105/106 (99%), Gaps = 0/106 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKI  375
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI  334


 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80



>emb|CDP08567.1| unnamed protein product [Coffea canephora]
Length=364

 Score =   222 bits (565),  Expect(2) = 7e-70, Method: Compositional matrix adjust.
 Identities = 112/114 (98%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = +1

Query  55   KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  234
            KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  53   KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  112

Query  235  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  113  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  166


 Score = 68.9 bits (167),  Expect(2) = 7e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  165  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  209


 Score =   220 bits (561),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  130  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  189

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  190  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  242


 Score = 68.9 bits (167),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  241  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  285


 Score =   220 bits (561),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  206  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  265

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  266  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  318


 Score =   125 bits (313),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/61 (100%), Positives = 61/61 (100%), Gaps = 0/61 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  282  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  341

Query  238  I  240
            I
Sbjct  342  I  342


 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  89   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  133


 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/26 (88%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNI  469
             PPDQQRLIFAGK LEDGRTLA YNI
Sbjct  317  IPPDQQRLIFAGKQLEDGRTLADYNI  342



>gb|AFW66438.1| putative ubiquitin family protein, partial [Zea mays]
 gb|AFW66447.1| ubiquitin2, partial [Zea mays]
Length=349

 Score =   220 bits (561),  Expect(2) = 7e-70, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score = 70.5 bits (171),  Expect(2) = 7e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score =   220 bits (561),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  198  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  257

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  258  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  310


 Score = 61.6 bits (148),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  309  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  349


 Score =   207 bits (528),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 105/106 (99%), Positives = 105/106 (99%), Gaps = 0/106 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKI  375
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI  182


 Score =   154 bits (390),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 76/76 (100%), Positives = 76/76 (100%), Gaps = 0/76 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  274  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  333

Query  238  IQKESTLHLVLRLRGG  285
            IQKESTLHLVLRLRGG
Sbjct  334  IQKESTLHLVLRLRGG  349


 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80


 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  233  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  277



>gb|AAB36545.1| ubiquitin-like protein [Phaseolus vulgaris]
Length=407

 Score =   221 bits (562),  Expect(2) = 8e-70, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  103  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  162

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  163  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  215


 Score =   221 bits (562),  Expect(2) = 8e-70, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  179  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  238

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  239  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  291


 Score = 70.1 bits (170),  Expect(2) = 8e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  214  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV-LRLRGGMQIF  258


 Score = 70.1 bits (170),  Expect(2) = 8e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  290  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV-LRLRGGMQIF  334


 Score =   221 bits (562),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  255  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  314

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  315  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  367


 Score = 61.2 bits (147),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  366  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV-LRLRGG  406


 Score =   129 bits (324),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 78/98 (80%), Gaps = 3/98 (3%)
 Frame = +1

Query  103  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  282
            +V  S  ++ V A++ D +      Q   FA KQLEDGRTLADYNIQKESTLHLVLRLRG
Sbjct  45   QVFVSHMVEGVDARLLDVQKGHKGAQ--CFA-KQLEDGRTLADYNIQKESTLHLVLRLRG  101

Query  283  GMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            GMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  102  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  139


 Score = 70.1 bits (170),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  138  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV-LRLRGGMQIF  182


 Score =   155 bits (391),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  331  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  390

Query  238  IQKESTLHLVLRLRGGM  288
            IQKESTLHLVLRLRGG 
Sbjct  391  IQKESTLHLVLRLRGGF  407



>ref|XP_010436682.1| PREDICTED: polyubiquitin 4-like [Camelina sativa]
Length=462

 Score =   220 bits (561),  Expect(2) = 8e-70, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  157  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  216

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  217  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  269


 Score =   220 bits (561),  Expect(2) = 8e-70, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  233  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  292

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  293  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  345


 Score = 70.1 bits (170),  Expect(2) = 8e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  268  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  312


 Score = 70.1 bits (170),  Expect(2) = 8e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  344  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  388


 Score =   218 bits (556),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            +QIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  81   IQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  140

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  141  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  193


 Score = 70.1 bits (170),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  192  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  236


 Score =   220 bits (561),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  309  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  368

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  369  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  421


 Score = 61.6 bits (148),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  420  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  460


 Score =   186 bits (472),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 95/113 (84%), Positives = 103/113 (91%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQI  KTLT KTITL+V+SSDTI+NVKA+IQD+EGIP DQQRLIF+GK L+DG TLADYN
Sbjct  5    MQIHAKTLTEKTITLDVKSSDTINNVKAQIQDREGIPLDQQRLIFSGKLLDDGLTLADYN  64

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKES LHL LRLRGG+QIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  65   IQKESILHLALRLRGGIQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  117


 Score = 70.1 bits (170),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  116  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  160


 Score =   154 bits (390),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 76/76 (100%), Positives = 76/76 (100%), Gaps = 0/76 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  385  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  444

Query  238  IQKESTLHLVLRLRGG  285
            IQKESTLHLVLRLRGG
Sbjct  445  IQKESTLHLVLRLRGG  460


 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 33/46 (72%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             P DQQRLIF+GK L+DG TLA YNI KES      LRL GG+QIF
Sbjct  40   IPLDQQRLIFSGKLLDDGLTLADYNIQKESILH-LALRLRGGIQIF  84



>gb|AEW46688.1| polyubiquitin, partial [Ulva linza]
Length=226

 Score =   220 bits (561),  Expect(2) = 8e-70, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score = 70.1 bits (170),  Expect(2) = 8e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score =   220 bits (561),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score =   150 bits (378),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 74/74 (100%), Positives = 74/74 (100%), Gaps = 0/74 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLR  279
            IQKESTLHLVLRLR
Sbjct  213  IQKESTLHLVLRLR  226


 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80


 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESN  484
             PPDQQRLIFAGK LEDGRTLA YNI KES 
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKEST  218



>ref|XP_006370634.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 gb|ERP67203.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
Length=261

 Score =   220 bits (561),  Expect(2) = 8e-70, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score =   220 bits (561),  Expect(2) = 8e-70, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score = 70.1 bits (170),  Expect(2) = 8e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score = 70.1 bits (170),  Expect(2) = 8e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score =   199 bits (506),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 100/101 (99%), Positives = 100/101 (99%), Gaps = 0/101 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDN  360
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDN
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDN  253


 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80



>ref|XP_003607669.1| Multidrug resistance protein ABC transporter family [Medicago 
truncatula]
Length=448

 Score =   222 bits (566),  Expect(2) = 8e-70, Method: Compositional matrix adjust.
 Identities = 112/115 (97%), Positives = 112/115 (97%), Gaps = 0/115 (0%)
 Frame = +1

Query  52   LKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  231
             KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  218  FKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  277

Query  232  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  278  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  332


 Score = 68.6 bits (166),  Expect(2) = 8e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  331  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV-LRLRGGMQIF  375


 Score =   220 bits (560),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  296  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  355

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  356  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  408


 Score = 60.1 bits (144),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  407  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV-LRLRGG  447


 Score =   154 bits (390),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 76/76 (100%), Positives = 76/76 (100%), Gaps = 0/76 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  372  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  431

Query  238  IQKESTLHLVLRLRGG  285
            IQKESTLHLVLRLRGG
Sbjct  432  IQKESTLHLVLRLRGG  447


 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  255  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV-LRLRGGMQIF  299



>gb|AAN31845.1| putative polyubiquitin (UBQ10) [Arabidopsis thaliana]
Length=464

 Score =   221 bits (562),  Expect(2) = 8e-70, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score =   221 bits (562),  Expect(2) = 8e-70, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score =   221 bits (562),  Expect(2) = 8e-70, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score =   221 bits (562),  Expect(2) = 8e-70, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  341


 Score = 69.7 bits (169),  Expect(2) = 8e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score = 69.7 bits (169),  Expect(2) = 8e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score = 69.7 bits (169),  Expect(2) = 8e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  308


 Score = 69.7 bits (169),  Expect(2) = 8e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  340  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  384


 Score =   221 bits (562),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  305  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  364

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  365  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  417


 Score = 82.4 bits (202),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 40/40 (100%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  177
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ
Sbjct  381  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  420


 Score = 69.7 bits (169),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80



>ref|XP_003607667.1| Multidrug resistance protein ABC transporter family [Medicago 
truncatula]
Length=752

 Score =   221 bits (564),  Expect(2) = 8e-70, Method: Compositional matrix adjust.
 Identities = 112/115 (97%), Positives = 112/115 (97%), Gaps = 0/115 (0%)
 Frame = +1

Query  52   LKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  231
             KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  218  FKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  277

Query  232  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  278  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  332


 Score = 68.9 bits (167),  Expect(2) = 8e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  331  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  375


 Score =   219 bits (559),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  296  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  355

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  356  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  408


 Score =   219 bits (559),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  372  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  431

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  432  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  484


 Score =   219 bits (559),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  448  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  507

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  508  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  560


 Score =   219 bits (559),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  524  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  583

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  584  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  636


 Score = 68.9 bits (167),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  407  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  451


 Score = 68.9 bits (167),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  483  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  527


 Score = 68.9 bits (167),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  559  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  603


 Score = 68.9 bits (167),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  635  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  679


 Score =   219 bits (559),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  600  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  659

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  660  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  712


 Score = 60.5 bits (145),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  711  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  751


 Score =   154 bits (389),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 76/76 (100%), Positives = 76/76 (100%), Gaps = 0/76 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  676  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  735

Query  238  IQKESTLHLVLRLRGG  285
            IQKESTLHLVLRLRGG
Sbjct  736  IQKESTLHLVLRLRGG  751


 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  255  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  299



>gb|AIZ74335.1| polyubiquitin 3, partial [Pinus massoniana]
Length=244

 Score =   220 bits (560),  Expect(2) = 8e-70, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  66   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  125

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  126  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  178


 Score = 70.5 bits (171),  Expect(2) = 8e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  177  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  221


 Score =   198 bits (503),  Expect(2) = 4e-63, Method: Compositional matrix adjust.
 Identities = 99/102 (97%), Positives = 100/102 (98%), Gaps = 0/102 (0%)
 Frame = +1

Query  91   TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  270
            TITLE+ESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL
Sbjct  1    TITLELESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  60

Query  271  RLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            RLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  102


 Score = 70.5 bits (171),  Expect(2) = 4e-63, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  101  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  145


 Score =   201 bits (511),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 101/103 (98%), Positives = 102/103 (99%), Gaps = 0/103 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  142  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  201

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVK  366
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE E+SDTIDNVK
Sbjct  202  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVENSDTIDNVK  244


 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  25   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  69



>ref|XP_009618235.1| PREDICTED: polyubiquitin-like isoform X1 [Nicotiana tomentosiformis]
Length=552

 Score =   220 bits (561),  Expect(2) = 8e-70, Method: Compositional matrix adjust.
 Identities = 111/115 (97%), Positives = 113/115 (98%), Gaps = 0/115 (0%)
 Frame = +1

Query  52   LKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  231
            ++MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  18   VQMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  77

Query  232  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  78   YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  132


 Score = 70.1 bits (170),  Expect(2) = 8e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  131  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  175


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  96   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  155

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  156  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  208


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  172  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  231

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  232  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  284


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  248  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  307

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  308  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  360


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  324  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  383

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  384  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  436


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  207  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  251


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  283  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  327


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  359  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  403


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  435  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  479


 Score =   220 bits (560),  Expect(2) = 5e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  400  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  459

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  460  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  512


 Score = 61.2 bits (147),  Expect(2) = 5e-67, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  511  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  551


 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  476  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  535

Query  238  IQKESTLHLVLRLRGGM  288
            IQKESTLHLVLRLRGG 
Sbjct  536  IQKESTLHLVLRLRGGF  552


 Score = 70.1 bits (170),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  55   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  99



>ref|XP_002872109.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48368.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=383

 Score =   220 bits (561),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  78   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  137

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  138  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  190


 Score =   220 bits (561),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  154  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  213

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  214  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  266


 Score = 70.1 bits (170),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  189  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  233


 Score = 70.1 bits (170),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  265  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  309


 Score =   216 bits (549),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP DQQRLIFAGKQLEDGRTLADYN
Sbjct  2    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPLDQQRLIFAGKQLEDGRTLADYN  61

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  62   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  114


 Score = 70.1 bits (170),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  113  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  157


 Score =   219 bits (559),  Expect(2) = 5e-67, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  230  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  289

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEG+P
Sbjct  290  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGVP  342


 Score = 61.2 bits (147),  Expect(2) = 5e-67, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  341  VPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  381


 Score =   154 bits (389),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 75/76 (99%), Positives = 76/76 (100%), Gaps = 0/76 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG+PPDQQRLIFAGKQLEDGRTLADYN
Sbjct  306  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGVPPDQQRLIFAGKQLEDGRTLADYN  365

Query  238  IQKESTLHLVLRLRGG  285
            IQKESTLHLVLRLRGG
Sbjct  366  IQKESTLHLVLRLRGG  381


 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 34/46 (74%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             P DQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  37   IPLDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  81



>gb|ACA58351.1| ubiquitin-like protein [Sandersonia aurantiaca]
Length=189

 Score =   220 bits (560),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score = 70.1 bits (170),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score =   220 bits (560),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score = 70.1 bits (170),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80



>ref|XP_010493589.1| PREDICTED: polyubiquitin-like [Camelina sativa]
Length=430

 Score =   220 bits (561),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  200  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  259

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  260  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  312


 Score = 70.1 bits (170),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  311  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  355


 Score =   222 bits (566),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 112/115 (97%), Positives = 112/115 (97%), Gaps = 0/115 (0%)
 Frame = +1

Query  52   LKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  231
             KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  46   FKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  105

Query  232  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  106  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  160


 Score = 67.8 bits (164),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 34/46 (74%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDG TLA YNI KES      LRL GGMQIF
Sbjct  159  IPPDQQRLIFAGKQLEDGHTLADYNIQKESTLH-LVLRLRGGMQIF  203


 Score =   218 bits (556),  Expect(2) = 4e-69, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG TLADYN
Sbjct  124  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGHTLADYN  183

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  184  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  236


 Score = 70.1 bits (170),  Expect(2) = 4e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  235  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  279


 Score =   220 bits (561),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  276  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  335

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  336  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  388


 Score = 61.6 bits (148),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  387  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  427


 Score =   155 bits (391),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 76/76 (100%), Positives = 76/76 (100%), Gaps = 0/76 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  352  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  411

Query  238  IQKESTLHLVLRLRGG  285
            IQKESTLHLVLRLRGG
Sbjct  412  IQKESTLHLVLRLRGG  427


 Score = 70.1 bits (170),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  83   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  127



>ref|XP_010451655.1| PREDICTED: polyubiquitin 4-like [Camelina sativa]
Length=534

 Score =   220 bits (560),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score =   220 bits (560),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  341


 Score =   220 bits (560),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  305  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  364

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  365  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  417


 Score = 70.5 bits (171),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  308


 Score = 70.5 bits (171),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  340  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  384


 Score = 70.5 bits (171),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  416  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  460


 Score =   220 bits (560),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  381  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  440

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  441  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  493


 Score = 61.6 bits (148),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  492  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  532


 Score =   192 bits (488),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/113 (87%), Positives = 105/113 (93%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLT KTITL+V+SSDTI+NVKA+IQD+EGIP DQQRLIF+GK L+DG TLADYN
Sbjct  77   MQIFVKTLTEKTITLDVKSSDTINNVKAQIQDREGIPLDQQRLIFSGKLLDDGLTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKES LHL LRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESILHLALRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score = 70.5 bits (171),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score =   177 bits (449),  Expect(2) = 6e-54, Method: Compositional matrix adjust.
 Identities = 90/113 (80%), Positives = 102/113 (90%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQI  KTLT KTITL+V+SSDTI+NVKA+IQD+EGIP DQQRLIF+GK L+DG TLADYN
Sbjct  1    MQIHAKTLTEKTITLDVKSSDTINNVKAQIQDREGIPLDQQRLIFSGKLLDDGLTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKES LHL LRLRGGMQIFVKTLT KTITL+ +SSDTI+NVKA+I D+EGIP
Sbjct  61   IQKESILHLALRLRGGMQIFVKTLTEKTITLDVKSSDTINNVKAQIQDREGIP  113


 Score = 60.1 bits (144),  Expect(2) = 6e-54, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 33/46 (72%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             P DQQRLIF+GK L+DG TLA YNI KES      LRL GGMQIF
Sbjct  112  IPLDQQRLIFSGKLLDDGLTLADYNIQKESILH-LALRLRGGMQIF  156


 Score =   154 bits (390),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 76/76 (100%), Positives = 76/76 (100%), Gaps = 0/76 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  457  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  516

Query  238  IQKESTLHLVLRLRGG  285
            IQKESTLHLVLRLRGG
Sbjct  517  IQKESTLHLVLRLRGG  532


 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 33/46 (72%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             P DQQRLIF+GK L+DG TLA YNI KES      LRL GGMQIF
Sbjct  36   IPLDQQRLIFSGKLLDDGLTLADYNIQKESILH-LALRLRGGMQIF  80



>ref|XP_007211606.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|EMJ12805.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
Length=309

 Score =   220 bits (561),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score =   220 bits (561),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score = 70.1 bits (170),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score = 70.1 bits (170),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score =   220 bits (561),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score =   152 bits (384),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 75/75 (100%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRG  282
            IQKESTLHLVLRLRG
Sbjct  289  IQKESTLHLVLRLRG  303


 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80


 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 30/41 (73%), Gaps = 1/41 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXG  514
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL G
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRG  303



>gb|ABH06365.1| ubiquitin [Sorbus aucuparia]
Length=141

 Score =   220 bits (560),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  19   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  78

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  79   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  131


 Score =   107 bits (266),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 53/55 (96%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = +1

Query  232  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  1    YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  55


 Score = 69.7 bits (169),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  54   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  98


 Score = 97.1 bits (240),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 47/47 (100%), Positives = 47/47 (100%), Gaps = 0/47 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  198
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  95   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  141



>emb|CAA54603.1| pentameric polyubiquitin [Nicotiana tabacum]
Length=346

 Score =   220 bits (560),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score =   220 bits (560),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score =   220 bits (560),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score = 70.1 bits (170),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score = 70.1 bits (170),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score = 70.1 bits (170),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  308


 Score =   220 bits (560),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  341


 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80



>gb|EMS65864.1| Polyubiquitin [Triticum urartu]
Length=405

 Score =   220 bits (561),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score =   220 bits (561),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score =   220 bits (561),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score = 70.1 bits (170),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score = 70.1 bits (170),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score = 70.1 bits (170),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  308


 Score =   220 bits (561),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  341


 Score = 61.6 bits (148),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  340  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  380


 Score =   155 bits (392),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 78/87 (90%), Positives = 81/87 (93%), Gaps = 2/87 (2%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  305  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  364

Query  238  IQKESTLHLVLRLRGG--MQIFVKTLT  312
            IQKESTLHLVLRLRGG  M  +V+  +
Sbjct  365  IQKESTLHLVLRLRGGHVMHRYVRLFS  391


 Score = 70.1 bits (170),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80



>gb|AGV54749.1| ubiquitin 11 [Phaseolus vulgaris]
Length=269

 Score =   221 bits (564),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 112/115 (97%), Positives = 112/115 (97%), Gaps = 0/115 (0%)
 Frame = +1

Query  52   LKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  231
             KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  39   FKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  98

Query  232  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  99   YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  153


 Score = 68.9 bits (167),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  152  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  196


 Score =   219 bits (558),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  117  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  176

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  177  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  229


 Score =   154 bits (389),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  193  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252

Query  238  IQKESTLHLVLRLRGGM  288
            IQKESTLHLVLRLRGG 
Sbjct  253  IQKESTLHLVLRLRGGF  269


 Score = 68.9 bits (167),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  76   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  120


 Score = 60.5 bits (145),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  228  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  268



>ref|XP_002452705.1| hypothetical protein SORBIDRAFT_04g031060 [Sorghum bicolor]
 gb|EES05681.1| hypothetical protein SORBIDRAFT_04g031060 [Sorghum bicolor]
Length=459

 Score =   220 bits (560),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score =   220 bits (560),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score =   220 bits (560),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score =   220 bits (560),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  341


 Score = 70.1 bits (170),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score = 70.1 bits (170),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score = 70.1 bits (170),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  308


 Score = 70.1 bits (170),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  340  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  384


 Score =   220 bits (560),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  305  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  364

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  365  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  417


 Score = 61.6 bits (148),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  416  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  456


 Score =   154 bits (390),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 76/76 (100%), Positives = 76/76 (100%), Gaps = 0/76 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  381  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  440

Query  238  IQKESTLHLVLRLRGG  285
            IQKESTLHLVLRLRGG
Sbjct  441  IQKESTLHLVLRLRGG  456


 Score = 70.1 bits (170),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80



>ref|XP_004956019.1| PREDICTED: polyubiquitin 4-like [Setaria italica]
Length=381

 Score =   220 bits (561),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score = 70.1 bits (170),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score =   218 bits (556),  Expect(2) = 4e-69, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTID+VKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDHVKAKIQDKEGIP  189


 Score =   218 bits (556),  Expect(2) = 4e-69, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTID+VKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDHVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score = 70.1 bits (170),  Expect(2) = 4e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score = 70.1 bits (170),  Expect(2) = 4e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  308


 Score =   220 bits (561),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  341


 Score = 61.6 bits (148),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  340  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  380


 Score =   154 bits (390),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/76 (100%), Positives = 76/76 (100%), Gaps = 0/76 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  305  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  364

Query  238  IQKESTLHLVLRLRGG  285
            IQKESTLHLVLRLRGG
Sbjct  365  IQKESTLHLVLRLRGG  380


 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80



>gb|AAZ32851.1| pentameric polyubiquitin [Medicago sativa]
Length=189

 Score =   220 bits (561),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  23   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  82

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  83   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  135


 Score = 70.1 bits (170),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  134  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  178


 Score =   182 bits (461),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 91/91 (100%), Positives = 91/91 (100%), Gaps = 0/91 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  99   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  158

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITL  330
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITL
Sbjct  159  IQKESTLHLVLRLRGGMQIFVKTLTGKTITL  189


 Score =   114 bits (285),  Expect(2) = 5e-38, Method: Compositional matrix adjust.
 Identities = 57/59 (97%), Positives = 57/59 (97%), Gaps = 0/59 (0%)
 Frame = +1

Query  220  TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  1    TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  59


 Score = 70.1 bits (170),  Expect(2) = 5e-38, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  58   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  102



>ref|XP_010324326.1| PREDICTED: polyubiquitin isoform X1 [Solanum lycopersicum]
Length=457

 Score =   220 bits (561),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score =   220 bits (561),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score = 70.1 bits (170),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score = 70.1 bits (170),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score =   221 bits (562),  Expect(2) = 6e-69, Method: Compositional matrix adjust.
 Identities = 111/114 (97%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIPT  399
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP+
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPS  266


 Score = 67.0 bits (162),  Expect(2) = 6e-69, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 34/46 (74%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             P DQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  264  IPSDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  308


 Score =   216 bits (551),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP DQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPSDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  341


 Score = 70.1 bits (170),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  340  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  384


 Score =   220 bits (561),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  305  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  364

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  365  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  417


 Score = 61.6 bits (148),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  416  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  456


 Score =   155 bits (391),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  381  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  440

Query  238  IQKESTLHLVLRLRGGM  288
            IQKESTLHLVLRLRGG 
Sbjct  441  IQKESTLHLVLRLRGGF  457


 Score = 70.1 bits (170),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80



>ref|XP_004953565.1| PREDICTED: polyubiquitin-like [Setaria italica]
Length=459

 Score =   220 bits (560),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score =   220 bits (560),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score =   220 bits (560),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score =   220 bits (560),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  341


 Score = 70.1 bits (170),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score = 70.1 bits (170),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score = 70.1 bits (170),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  308


 Score = 70.1 bits (170),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  340  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  384


 Score =   220 bits (560),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  305  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  364

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  365  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  417


 Score = 62.4 bits (150),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 32/43 (74%), Gaps = 1/43 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGM  520
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG+
Sbjct  416  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGL  457


 Score =   155 bits (392),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  381  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  440

Query  238  IQKESTLHLVLRLRGGM  288
            IQKESTLHLVLRLRGG+
Sbjct  441  IQKESTLHLVLRLRGGL  457


 Score = 70.1 bits (170),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80



>gb|EYU33607.1| hypothetical protein MIMGU_mgv1a004315mg [Erythranthe guttata]
Length=457

 Score =   220 bits (560),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score =   220 bits (560),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score =   220 bits (560),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score =   220 bits (560),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  341


 Score = 70.1 bits (170),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score = 70.1 bits (170),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score = 70.1 bits (170),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  308


 Score = 70.1 bits (170),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  340  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  384


 Score =   220 bits (560),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  305  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  364

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  365  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  417


 Score = 62.0 bits (149),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 32/43 (74%), Gaps = 1/43 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGM  520
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG+
Sbjct  416  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGV  457


 Score =   155 bits (391),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  381  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  440

Query  238  IQKESTLHLVLRLRGGM  288
            IQKESTLHLVLRLRGG+
Sbjct  441  IQKESTLHLVLRLRGGV  457


 Score = 70.1 bits (170),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80



>ref|XP_008224782.1| PREDICTED: LOW QUALITY PROTEIN: polyubiquitin-A-like [Prunus 
mume]
Length=1194

 Score =   220 bits (560),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score =   220 bits (560),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score =   220 bits (560),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score =   220 bits (560),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  341


 Score =   220 bits (560),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  305  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  364

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  365  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  417


 Score =   220 bits (560),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  381  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  440

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  441  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  493


 Score =   220 bits (560),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  457  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  516

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  517  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  569


 Score =   220 bits (560),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  533  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  592

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  593  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  645


 Score =   220 bits (560),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  609  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  668

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  669  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  721


 Score =   220 bits (560),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  685  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  744

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  745  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  797


 Score =   220 bits (560),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
             MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  890   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  949

Query  238   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
             IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  950   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  1002


 Score =   220 bits (560),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
             MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  966   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  1025

Query  238   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
             IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  1026  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  1078


 Score = 70.1 bits (170),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score = 70.1 bits (170),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score = 70.1 bits (170),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  308


 Score = 70.1 bits (170),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  340  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  384


 Score = 70.1 bits (170),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  416  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  460


 Score = 70.1 bits (170),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  492  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  536


 Score = 70.1 bits (170),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  568  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  612


 Score = 70.1 bits (170),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  644  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  688


 Score = 70.1 bits (170),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  720  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  764


 Score = 70.1 bits (170),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  796  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  840


 Score = 70.1 bits (170),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392   FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
              PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  1001  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  1045


 Score = 70.1 bits (170),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392   FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
              PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  1077  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  1121


 Score =   220 bits (560),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
             MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1042  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  1101

Query  238   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
             IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  1102  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  1154


 Score = 61.6 bits (148),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392   FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
              PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  1153  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  1193


 Score =   220 bits (560),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  761  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  820

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  821  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  873


 Score =   154 bits (390),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  58    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
             MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1118  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  1177

Query  238   IQKESTLHLVLRLRGGM  288
             IQKESTLHLVLRLRGG 
Sbjct  1178  IQKESTLHLVLRLRGGF  1194


 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80


 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  925  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  969



>gb|KJB14874.1| hypothetical protein B456_002G147600, partial [Gossypium raimondii]
Length=344

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  42   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  101

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  102  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  154


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  118  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  177

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  178  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  230


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  153  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  197


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  229  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  273


 Score =   220 bits (560),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  194  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  253

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  254  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  306


 Score =   132 bits (333),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 76/113 (67%), Gaps = 35/113 (31%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLE                                   DGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLE-----------------------------------DGRTLADYN  25

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  26   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  78


 Score = 70.1 bits (170),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  77   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  121


 Score =   152 bits (384),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 75/75 (100%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  270  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  329

Query  238  IQKESTLHLVLRLRG  282
            IQKESTLHLVLRLRG
Sbjct  330  IQKESTLHLVLRLRG  344


 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 30/41 (73%), Gaps = 1/41 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXG  514
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL G
Sbjct  305  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRG  344



>gb|EYU33611.1| hypothetical protein MIMGU_mgv1a004315mg [Erythranthe guttata]
Length=533

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  341


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  305  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  364

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  365  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  417


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  308


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  340  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  384


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  416  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  460


 Score =   220 bits (560),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  381  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  440

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  441  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  493


 Score = 62.0 bits (149),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 32/43 (74%), Gaps = 1/43 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGM  520
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG+
Sbjct  492  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGV  533


 Score =   155 bits (391),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  457  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  516

Query  238  IQKESTLHLVLRLRGGM  288
            IQKESTLHLVLRLRGG+
Sbjct  517  IQKESTLHLVLRLRGGV  533


 Score = 70.1 bits (170),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80



>ref|XP_003607668.1| Multidrug resistance protein ABC transporter family [Medicago 
truncatula]
Length=497

 Score =   222 bits (565),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 112/115 (97%), Positives = 112/115 (97%), Gaps = 0/115 (0%)
 Frame = +1

Query  52   LKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  231
             KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  218  FKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  277

Query  232  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  278  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  332


 Score = 68.2 bits (165),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  331  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV-LRLRGGMQIF  375


 Score =   220 bits (560),  Expect(2) = 4e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  296  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  355

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  356  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  408


 Score = 68.2 bits (165),  Expect(2) = 4e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  407  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV-LRLRGGMQIF  451


 Score =   184 bits (466),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 92/92 (100%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  372  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  431

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE  333
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE
Sbjct  432  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE  463


 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  255  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV-LRLRGGMQIF  299



>gb|KJB13590.1| hypothetical protein B456_002G083000 [Gossypium raimondii]
 gb|KJB13591.1| hypothetical protein B456_002G083000 [Gossypium raimondii]
Length=461

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  341


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  308


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  340  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  384


 Score =   220 bits (560),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  305  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  364

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  365  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  417


 Score = 62.0 bits (149),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 33/46 (72%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG ++ 
Sbjct  416  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGFRMV  460


 Score =   155 bits (392),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 76/79 (96%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  381  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  440

Query  238  IQKESTLHLVLRLRGGMQI  294
            IQKESTLHLVLRLRGG ++
Sbjct  441  IQKESTLHLVLRLRGGFRM  459


 Score = 70.1 bits (170),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80



>ref|NP_001174480.1| Os05g0504766 [Oryza sativa Japonica Group]
 ref|XP_002438904.1| hypothetical protein SORBIDRAFT_10g028020 [Sorghum bicolor]
 ref|XP_006656385.1| PREDICTED: polyubiquitin-like [Oryza brachyantha]
 ref|XP_007027294.1| Ubiquitin 4 [Theobroma cacao]
 ref|XP_010240640.1| PREDICTED: polyubiquitin isoform X2 [Brachypodium distachyon]
 ref|XP_010240789.1| PREDICTED: polyubiquitin isoform X2 [Brachypodium distachyon]
 gb|AAD30173.1|AF148448_1 polyubiquitin [Sporobolus stapfianus]
 gb|AAW56906.1| polyubiquitin [Oryza sativa Japonica Group]
 gb|EAY98614.1| hypothetical protein OsI_20535 [Oryza sativa Indica Group]
 gb|EEE64284.1| hypothetical protein OsJ_19121 [Oryza sativa Japonica Group]
 gb|EER90271.1| hypothetical protein SORBIDRAFT_10g028020 [Sorghum bicolor]
 dbj|BAH93208.1| Os05g0504766 [Oryza sativa Japonica Group]
 dbj|BAJ91806.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK04112.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|AFH53939.1| polyubiquitin 4 [Brachypodium distachyon]
 gb|AFH53940.1| polyubiquitin 10 [Brachypodium distachyon]
 gb|EOY07796.1| Ubiquitin 4 [Theobroma cacao]
 gb|AGT16803.1| polyubiquitin [Saccharum hybrid cultivar R570]
Length=381

 Score =   220 bits (561),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score =   220 bits (561),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score =   220 bits (561),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  308


 Score =   220 bits (561),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  341


 Score = 61.6 bits (148),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  340  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  380


 Score =   154 bits (390),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/76 (100%), Positives = 76/76 (100%), Gaps = 0/76 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  305  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  364

Query  238  IQKESTLHLVLRLRGG  285
            IQKESTLHLVLRLRGG
Sbjct  365  IQKESTLHLVLRLRGG  380


 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80



>gb|KDP39203.1| hypothetical protein JCGZ_00960 [Jatropha curcas]
Length=317

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 35/47 (74%), Gaps = 1/47 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIFG  532
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQI G
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQILG  309


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score =   160 bits (406),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIF  297
            IQKESTLHLVLRLRGGMQI 
Sbjct  289  IQKESTLHLVLRLRGGMQIL  308


 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80



>ref|XP_009114489.1| PREDICTED: polyubiquitin-like [Brassica rapa]
Length=305

 Score =   220 bits (561),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score =   216 bits (551),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP DQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPQDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score = 70.1 bits (170),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score =   220 bits (561),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score =   154 bits (390),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGM  288
            IQKESTLHLVLRLRGG 
Sbjct  289  IQKESTLHLVLRLRGGF  305


 Score = 66.6 bits (161),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 34/46 (74%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             P DQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPQDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80


 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  304



>ref|XP_009784908.1| PREDICTED: polyubiquitin-like isoform X2 [Nicotiana sylvestris]
Length=449

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  341


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  340  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  384


 Score =   218 bits (555),  Expect(2) = 4e-69, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK KI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIP  189


 Score =   218 bits (555),  Expect(2) = 4e-69, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score = 70.1 bits (170),  Expect(2) = 4e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score = 70.1 bits (170),  Expect(2) = 4e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  308


 Score =   220 bits (560),  Expect(2) = 4e-66, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  305  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  364

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  365  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  417


 Score = 58.2 bits (139),  Expect(2) = 4e-66, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESN  484
             PPDQQRLIFAGK LEDGRTLA YNI KES 
Sbjct  416  IPPDQQRLIFAGKQLEDGRTLADYNIQKEST  446


 Score =   140 bits (353),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 69/69 (100%), Positives = 69/69 (100%), Gaps = 0/69 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  381  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  440

Query  238  IQKESTLHL  264
            IQKESTLHL
Sbjct  441  IQKESTLHL  449


 Score = 70.1 bits (170),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80



>gb|EYU33608.1| hypothetical protein MIMGU_mgv1a004315mg [Erythranthe guttata]
Length=381

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  308


 Score =   220 bits (560),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  341


 Score = 62.0 bits (149),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 32/43 (74%), Gaps = 1/43 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGM  520
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG+
Sbjct  340  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGV  381


 Score =   155 bits (391),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  305  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  364

Query  238  IQKESTLHLVLRLRGGM  288
            IQKESTLHLVLRLRGG+
Sbjct  365  IQKESTLHLVLRLRGGV  381


 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80



>ref|XP_010324327.1| PREDICTED: polyubiquitin isoform X2 [Solanum lycopersicum]
Length=381

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score =   221 bits (562),  Expect(2) = 6e-69, Method: Compositional matrix adjust.
 Identities = 111/114 (97%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIPT  399
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP+
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPS  190


 Score = 67.0 bits (162),  Expect(2) = 6e-69, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 34/46 (74%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             P DQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPSDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score =   216 bits (551),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP DQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPSDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score = 70.1 bits (170),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  308


 Score =   220 bits (560),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  341


 Score = 61.6 bits (148),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  340  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  380


 Score =   154 bits (390),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  305  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  364

Query  238  IQKESTLHLVLRLRGGM  288
            IQKESTLHLVLRLRGG 
Sbjct  365  IQKESTLHLVLRLRGGF  381


 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80



>ref|XP_010934961.1| PREDICTED: polyubiquitin-A isoform X1 [Elaeis guineensis]
Length=840

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  341


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  305  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  364

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  365  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  417


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  381  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  440

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  441  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  493


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  457  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  516

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  517  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  569


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  533  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  592

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  593  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  645


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  609  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  668

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  669  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  721


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  308


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  340  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  384


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  416  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  460


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  492  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  536


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  568  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  612


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  644  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  688


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  720  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  764


 Score =   220 bits (560),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  685  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  744

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  745  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  797


 Score = 61.6 bits (148),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  796  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  836


 Score =   154 bits (390),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 76/76 (100%), Positives = 76/76 (100%), Gaps = 0/76 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  761  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  820

Query  238  IQKESTLHLVLRLRGG  285
            IQKESTLHLVLRLRGG
Sbjct  821  IQKESTLHLVLRLRGG  836


 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80



>gb|AGT38457.1| polyubiquitin [Oryza sativa Japonica Group]
Length=482

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  341


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  305  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  364

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  365  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  417


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  308


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  340  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  384


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  416  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  460


 Score =   197 bits (500),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 99/101 (98%), Positives = 100/101 (99%), Gaps = 0/101 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  381  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  440

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDN  360
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTID+
Sbjct  441  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDH  481


 Score = 70.1 bits (170),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80



>ref|XP_006396612.1| hypothetical protein EUTSA_v10028730mg [Eutrema salsugineum]
 ref|XP_010537979.1| PREDICTED: polyubiquitin [Tarenaya hassleriana]
 emb|CAJ86369.1| OSIGBa0117N13.13 [Oryza sativa Indica Group]
 emb|CAJ86419.1| H0303G06.8 [Oryza sativa Indica Group]
 gb|EAY95663.1| hypothetical protein OsI_17529 [Oryza sativa Indica Group]
 gb|ESQ38065.1| hypothetical protein EUTSA_v10028730mg [Eutrema salsugineum]
Length=381

 Score =   220 bits (561),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score =   220 bits (561),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score =   220 bits (561),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  308


 Score =   220 bits (561),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  341


 Score = 62.4 bits (150),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 32/43 (74%), Gaps = 1/43 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGM  520
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG+
Sbjct  340  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGL  381


 Score =   155 bits (392),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  305  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  364

Query  238  IQKESTLHLVLRLRGGM  288
            IQKESTLHLVLRLRGG+
Sbjct  365  IQKESTLHLVLRLRGGL  381


 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80



>gb|AGZ80457.1| ubiquitin-like protein, partial [Phaseolus vulgaris]
 gb|AGZ80458.1| ubiquitin-like protein, partial [Phaseolus vulgaris]
 gb|AGZ80459.1| ubiquitin-like protein, partial [Phaseolus vulgaris]
 gb|AGZ80460.1| ubiquitin-like protein, partial [Phaseolus vulgaris]
 gb|AGZ80461.1| ubiquitin-like protein, partial [Phaseolus vulgaris]
 gb|AGZ80462.1| ubiquitin-like protein, partial [Phaseolus vulgaris]
 gb|AGZ80463.1| ubiquitin-like protein, partial [Phaseolus vulgaris]
 gb|AGZ80464.1| ubiquitin-like protein, partial [Phaseolus vulgaris]
 gb|AGZ80465.1| ubiquitin-like protein, partial [Phaseolus vulgaris]
 gb|AGZ80466.1| ubiquitin-like protein, partial [Phaseolus vulgaris]
 gb|AGZ80467.1| ubiquitin-like protein, partial [Phaseolus vulgaris]
 gb|AGZ80468.1| ubiquitin-like protein, partial [Phaseolus vulgaris]
 gb|AGZ80469.1| ubiquitin-like protein, partial [Phaseolus vulgaris]
 gb|AGZ80470.1| ubiquitin-like protein, partial [Phaseolus vulgaris]
 gb|AGZ80471.1| ubiquitin-like protein, partial [Phaseolus vulgaris]
 gb|AGZ80472.1| ubiquitin-like protein, partial [Phaseolus vulgaris]
 gb|AGZ80473.1| ubiquitin-like protein, partial [Phaseolus vulgaris]
 gb|AGZ80474.1| ubiquitin-like protein, partial [Phaseolus vulgaris]
 gb|AGZ80475.1| ubiquitin-like protein, partial [Phaseolus vulgaris]
 gb|AGZ80476.1| ubiquitin-like protein, partial [Phaseolus vulgaris]
 gb|AGZ80477.1| ubiquitin-like protein, partial [Phaseolus vulgaris]
Length=132

 Score =   219 bits (559),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  10   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  69

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  70   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  122


 Score = 89.7 bits (221),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 44/46 (96%), Positives = 44/46 (96%), Gaps = 0/46 (0%)
 Frame = +1

Query  259  HLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            HLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  1    HLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  46


 Score = 69.7 bits (169),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  45   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  89


 Score = 96.7 bits (239),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 47/47 (100%), Positives = 47/47 (100%), Gaps = 0/47 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  198
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  86   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  132



>emb|CDP08561.1| unnamed protein product [Coffea canephora]
Length=641

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  360  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  419

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  420  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  472


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 36/48 (75%), Gaps = 1/48 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIFGE  535
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF +
Sbjct  471  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIFAK  517


 Score =   220 bits (560),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  132  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  191

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  192  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  244


 Score =   220 bits (560),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  208  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  267

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  268  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  320


 Score =   220 bits (560),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  284  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  343

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  344  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  396


 Score = 69.3 bits (168),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  243  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  287


 Score = 69.3 bits (168),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  319  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  363


 Score = 69.3 bits (168),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  395  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  439


 Score =   195 bits (496),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 111/166 (67%), Positives = 111/166 (67%), Gaps = 53/166 (32%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG-------------------------  162
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG                         
Sbjct  436  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  495

Query  163  ----------------------------IPPDQQRLIFAGKQLEDGRTLADYNIQKESTL  258
                                        IPPDQQRLIFAGKQLEDGRTLADYNIQKESTL
Sbjct  496  IQKESTLHLVLRLRGGMQIFAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTL  555

Query  259  HLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            HLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  556  HLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  601


 Score = 60.8 bits (146),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  600  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  640


 Score =   135 bits (341),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 78/114 (68%), Positives = 78/114 (68%), Gaps = 34/114 (30%)
 Frame = +1

Query  55   KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  234
            KMQIFVKTLTGKTITLEVESSDT                                  ADY
Sbjct  89   KMQIFVKTLTGKTITLEVESSDT----------------------------------ADY  114

Query  235  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  115  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  168


 Score = 69.3 bits (168),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  167  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  211


 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  565  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  624

Query  238  IQKESTLHLVLRLRGGM  288
            IQKESTLHLVLRLRGG 
Sbjct  625  IQKESTLHLVLRLRGGF  641


 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  524  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  568



>ref|XP_011077812.1| PREDICTED: polyubiquitin 3 [Sesamum indicum]
 ref|XP_011077813.1| PREDICTED: polyubiquitin 3 [Sesamum indicum]
Length=334

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  29   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  88

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  89   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  141


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  105  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  164

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  165  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  217


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  140  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  184


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  216  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  260


 Score =   220 bits (560),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  181  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  240

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  241  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  293


 Score =   154 bits (390),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 76/76 (100%), Positives = 76/76 (100%), Gaps = 0/76 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  257  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  316

Query  238  IQKESTLHLVLRLRGG  285
            IQKESTLHLVLRLRGG
Sbjct  317  IQKESTLHLVLRLRGG  332


 Score = 99.8 bits (247),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 50/52 (96%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = +1

Query  241  QKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            QKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  14   QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  65


 Score = 70.1 bits (170),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  64   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  108


 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  292  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  332



>gb|EYU33609.1| hypothetical protein MIMGU_mgv1a004315mg [Erythranthe guttata]
 gb|EYU33612.1| hypothetical protein MIMGU_mgv1a004315mg [Erythranthe guttata]
Length=305

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score =   220 bits (560),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score =   155 bits (391),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGM  288
            IQKESTLHLVLRLRGG+
Sbjct  289  IQKESTLHLVLRLRGGV  305


 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80


 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 32/43 (74%), Gaps = 1/43 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGM  520
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG+
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGV  305



>ref|XP_007410937.1| hypothetical protein MELLADRAFT_87680 [Melampsora larici-populina 
98AG31]
 gb|EGG05881.1| hypothetical protein MELLADRAFT_87680 [Melampsora larici-populina 
98AG31]
Length=535

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  308


 Score =   218 bits (555),  Expect(2) = 4e-69, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK KI DKEGIP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIP  341


 Score =   218 bits (555),  Expect(2) = 4e-69, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  305  MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  364

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  365  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  417


 Score = 70.1 bits (170),  Expect(2) = 4e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  340  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  384


 Score = 70.1 bits (170),  Expect(2) = 4e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  416  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  460


 Score =   220 bits (560),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  381  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  440

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  441  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  493


 Score = 61.6 bits (148),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  492  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  532


 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 76/76 (100%), Positives = 76/76 (100%), Gaps = 0/76 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  457  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  516

Query  238  IQKESTLHLVLRLRGG  285
            IQKESTLHLVLRLRGG
Sbjct  517  IQKESTLHLVLRLRGG  532


 Score = 70.1 bits (170),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80



>dbj|BAK03691.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=457

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  341


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  340  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  384


 Score =   219 bits (559),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAK+ DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKVQDKEGIP  189


 Score =   219 bits (559),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAK+QDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKVQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  308


 Score =   220 bits (560),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  305  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  364

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  365  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  417


 Score = 61.6 bits (148),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  416  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  456


 Score =   154 bits (390),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 76/76 (100%), Positives = 76/76 (100%), Gaps = 0/76 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  381  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  440

Query  238  IQKESTLHLVLRLRGG  285
            IQKESTLHLVLRLRGG
Sbjct  441  IQKESTLHLVLRLRGG  456


 Score = 70.1 bits (170),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80



>ref|XP_010934962.1| PREDICTED: polyubiquitin-A isoform X2 [Elaeis guineensis]
Length=840

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  341


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  305  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  364

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  365  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  417


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  381  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  440

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  441  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  493


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  457  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  516

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  517  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  569


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  533  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  592

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  593  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  645


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  609  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  668

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  669  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  721


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  308


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  340  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  384


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  416  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  460


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  492  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  536


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  568  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  612


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  644  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  688


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  720  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  764


 Score =   220 bits (560),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  685  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  744

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  745  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  797


 Score = 61.6 bits (148),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  796  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  836


 Score =   154 bits (390),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 76/76 (100%), Positives = 76/76 (100%), Gaps = 0/76 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  761  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  820

Query  238  IQKESTLHLVLRLRGG  285
            IQKESTLHLVLRLRGG
Sbjct  821  IQKESTLHLVLRLRGG  836


 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80



>gb|ABY60454.1| putative polyubiquitin [Adonis aestivalis var. palaestina]
Length=281

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  12   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  71

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  72   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  124


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  88   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  147

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  148  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  200


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  123  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  167


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  199  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  243


 Score =   220 bits (560),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  164  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  223

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  224  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  276


 Score = 92.8 bits (229),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 46/48 (96%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  253  TLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            TLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  1    TLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  48


 Score = 70.1 bits (170),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  47   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  91


 Score = 85.9 bits (211),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 42/42 (100%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  183
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  240  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  281



>gb|AAC49013.1| polyubiquitin containing 7 ubiquitin monomers [Zea mays]
Length=533

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  308


 Score =   220 bits (560),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  341


 Score = 68.9 bits (167),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      +RL GGMQIF
Sbjct  340  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVVRLRGGMQIF  384


 Score =   219 bits (557),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  305  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  364

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLV+RLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  365  IQKESTLHLVVRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  417


 Score = 70.1 bits (170),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  416  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  460


 Score =   220 bits (560),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  381  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  440

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  441  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  493


 Score = 61.6 bits (148),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  492  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  532


 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 76/76 (100%), Positives = 76/76 (100%), Gaps = 0/76 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  457  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  516

Query  238  IQKESTLHLVLRLRGG  285
            IQKESTLHLVLRLRGG
Sbjct  517  IQKESTLHLVLRLRGG  532


 Score = 70.1 bits (170),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80



>ref|XP_010558157.1| PREDICTED: polyubiquitin-like [Tarenaya hassleriana]
Length=382

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  308


 Score =   220 bits (560),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  341


 Score = 61.6 bits (148),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  340  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  380


 Score =   154 bits (390),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/76 (100%), Positives = 76/76 (100%), Gaps = 0/76 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  305  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  364

Query  238  IQKESTLHLVLRLRGG  285
            IQKESTLHLVLRLRGG
Sbjct  365  IQKESTLHLVLRLRGG  380


 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80



>gb|KEH31009.1| polyubiquitin 3 [Medicago truncatula]
Length=837

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  341


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  305  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  364

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  365  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  417


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  381  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  440

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  441  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  493


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  457  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  516

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  517  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  569


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  533  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  592

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  593  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  645


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  609  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  668

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  669  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  721


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  308


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  340  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  384


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  416  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  460


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  492  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  536


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  568  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  612


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  644  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  688


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  720  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  764


 Score =   216 bits (551),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED RTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDRRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score = 70.1 bits (170),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score =   220 bits (560),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  685  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  744

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  745  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  797


 Score = 61.6 bits (148),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  796  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  836


 Score =   154 bits (390),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  761  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  820

Query  238  IQKESTLHLVLRLRGGM  288
            IQKESTLHLVLRLRGG 
Sbjct  821  IQKESTLHLVLRLRGGF  837


 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 34/46 (74%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LED RTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDRRTLADYNIQKESTLH-LVLRLRGGMQIF  80



>ref|XP_007014924.1| Polyubiquitin 3 [Theobroma cacao]
 gb|EOY32543.1| Polyubiquitin 3 [Theobroma cacao]
Length=305

 Score =   220 bits (561),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score =   220 bits (561),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score =   220 bits (561),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score =   154 bits (390),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 76/76 (100%), Positives = 76/76 (100%), Gaps = 0/76 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGG  285
            IQKESTLHLVLRLRGG
Sbjct  289  IQKESTLHLVLRLRGG  304


 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80


 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  304



>emb|CCA16073.1| polyubiquitin putative [Albugo laibachii Nc14]
Length=538

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  341


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  308


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  340  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  384


 Score =   219 bits (557),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  305  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  364

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE E+SDTIDNVKAKI DKEGIP
Sbjct  365  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIDNVKAKIQDKEGIP  417


 Score = 70.1 bits (170),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  416  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  460


 Score =   218 bits (554),  Expect(2) = 9e-67, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVE+SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  381  MQIFVKTLTGKTITLEVEASDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  440

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE E+SDTIDNVKAKI DKEGIP
Sbjct  441  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIDNVKAKIQDKEGIP  493


 Score = 62.4 bits (150),  Expect(2) = 9e-67, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 32/46 (70%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG  I 
Sbjct  492  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGSNIV  536


 Score =   155 bits (393),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 77/81 (95%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVE+SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  457  MQIFVKTLTGKTITLEVEASDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  516

Query  238  IQKESTLHLVLRLRGGMQIFV  300
            IQKESTLHLVLRLRGG  I V
Sbjct  517  IQKESTLHLVLRLRGGSNIVV  537


 Score = 70.1 bits (170),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80



>ref|XP_010262389.1| PREDICTED: polyubiquitin [Nelumbo nucifera]
Length=461

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  341


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  308


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  340  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  384


 Score =   220 bits (560),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  305  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  364

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  365  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  417


 Score = 62.4 bits (150),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 32/43 (74%), Gaps = 1/43 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGM  520
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG+
Sbjct  416  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGL  457


 Score =   155 bits (392),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  381  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  440

Query  238  IQKESTLHLVLRLRGGM  288
            IQKESTLHLVLRLRGG+
Sbjct  441  IQKESTLHLVLRLRGGL  457


 Score = 70.1 bits (170),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80



>ref|XP_010911599.1| PREDICTED: polyubiquitin 4 [Elaeis guineensis]
Length=384

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  308


 Score =   220 bits (560),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  341


 Score = 61.6 bits (148),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  340  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  380


 Score =   154 bits (390),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/76 (100%), Positives = 76/76 (100%), Gaps = 0/76 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  305  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  364

Query  238  IQKESTLHLVLRLRGG  285
            IQKESTLHLVLRLRGG
Sbjct  365  IQKESTLHLVLRLRGG  380


 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80



>ref|XP_002456845.1| hypothetical protein SORBIDRAFT_03g043940 [Sorghum bicolor]
 ref|XP_002453347.1| hypothetical protein SORBIDRAFT_04g004280 [Sorghum bicolor]
 ref|XP_003574869.1| PREDICTED: polyubiquitin [Brachypodium distachyon]
 ref|XP_007695807.1| hypothetical protein COCSADRAFT_108224 [Bipolaris sorokiniana 
ND90Pr]
 ref|XP_009412665.1| PREDICTED: polyubiquitin isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009412666.1| PREDICTED: polyubiquitin isoform X2 [Musa acuminata subsp. malaccensis]
 ref|XP_010227192.1| PREDICTED: polyubiquitin isoform X2 [Brachypodium distachyon]
 sp|P69309.2|UBIQP_AVEFA RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Avena fatua]
 pir||S28426 polyubiquitin 4 - wild oat
 emb|CAA49200.1| tetraubiquitin [Avena fatua]
 gb|AAC37466.1| polyubiquitin [Saccharum hybrid cultivar H65-7052]
 gb|AAM28291.1| tetrameric ubiquitin [Ananas comosus]
 gb|EES01965.1| hypothetical protein SORBIDRAFT_03g043940 [Sorghum bicolor]
 gb|EES06323.1| hypothetical protein SORBIDRAFT_04g004280 [Sorghum bicolor]
 gb|AEE65379.1| ubiquitin 1 [Panicum virgatum]
 gb|EMD68114.1| hypothetical protein COCSADRAFT_108224 [Bipolaris sorokiniana 
ND90Pr]
 gb|EMD93446.1| hypothetical protein COCHEDRAFT_1202381 [Bipolaris maydis C5]
 gb|EMS58836.1| Polyubiquitin [Triticum urartu]
 gb|ENI07106.1| hypothetical protein COCC4DRAFT_70576 [Bipolaris maydis ATCC 
48331]
 gb|AGT16802.1| polyubiquitin-like protein [Saccharum hybrid cultivar R570]
 gb|EUN28034.1| hypothetical protein COCVIDRAFT_96666 [Bipolaris victoriae FI3]
Length=305

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score =   220 bits (560),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score =   154 bits (390),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 76/76 (100%), Positives = 76/76 (100%), Gaps = 0/76 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGG  285
            IQKESTLHLVLRLRGG
Sbjct  289  IQKESTLHLVLRLRGG  304


 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80


 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  304



>ref|XP_008645269.1| PREDICTED: polyubiquitin [Zea mays]
 gb|AAB21993.1| polyubiquitin [Zea mays]
 gb|AAB21994.1| polyubiquitin [Zea mays]
 gb|AAQ07454.1| ubiquitin [Musa acuminata]
 dbj|BAD45891.1| polyubiquitin [Oryza sativa Japonica Group]
 gb|EEC81187.1| hypothetical protein OsI_24193 [Oryza sativa Indica Group]
 gb|EEE66229.1| hypothetical protein OsJ_22384 [Oryza sativa Japonica Group]
 gb|AFW66448.1| ubiquitin2 [Zea mays]
 gb|AFW70218.1| clone MubG1 ubiquitin [Zea mays]
Length=533

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  341


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  305  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  364

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  365  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  417


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  308


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  340  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  384


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  416  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  460


 Score =   220 bits (560),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  381  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  440

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  441  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  493


 Score = 61.6 bits (148),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  492  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  532


 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 76/76 (100%), Positives = 76/76 (100%), Gaps = 0/76 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  457  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  516

Query  238  IQKESTLHLVLRLRGG  285
            IQKESTLHLVLRLRGG
Sbjct  517  IQKESTLHLVLRLRGG  532


 Score = 70.1 bits (170),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80



>emb|CAA66667.1| polyubiquitin [Pinus sylvestris]
Length=761

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  381  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  440

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  441  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  493


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  457  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  516

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  517  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  569


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  533  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  592

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  593  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  645


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  308


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  492  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  536


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  568  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  612


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  644  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  688


 Score =   219 bits (557),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK+KI DKEGIP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIP  341


 Score =   219 bits (557),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  305  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  364

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  365  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  417


 Score = 70.1 bits (170),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  340  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  384


 Score = 70.1 bits (170),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  416  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  460


 Score =   217 bits (553),  Expect(2) = 6e-69, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE E+SDTIDNVK+KI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVENSDTIDNVKSKIQDKEGIP  113


 Score =   217 bits (553),  Expect(2) = 6e-69, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVE+SDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVENSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score = 70.1 bits (170),  Expect(2) = 6e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score = 70.1 bits (170),  Expect(2) = 6e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score =   218 bits (554),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  609  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  668

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLT KTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  669  IQKESTLHLVLRLRGGMQIFVKTLTAKTITLEVESSDTIDNVKAKIQDKEGIP  721


 Score = 62.4 bits (150),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 32/43 (74%), Gaps = 1/43 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGM  520
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG+
Sbjct  720  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGL  761


 Score =   153 bits (386),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLT KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  685  MQIFVKTLTAKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  744

Query  238  IQKESTLHLVLRLRGGM  288
            IQKESTLHLVLRLRGG+
Sbjct  745  IQKESTLHLVLRLRGGL  761


 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80



>gb|EYU18101.1| hypothetical protein MIMGU_mgv1a004289mg [Erythranthe guttata]
Length=535

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  341


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  305  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  364

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  365  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  417


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  308


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  340  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  384


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  416  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  460


 Score =   220 bits (560),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  381  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  440

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  441  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  493


 Score = 61.6 bits (148),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  492  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  532


 Score =   155 bits (391),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 76/79 (96%), Positives = 77/79 (97%), Gaps = 0/79 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  457  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  516

Query  238  IQKESTLHLVLRLRGGMQI  294
            IQKESTLHLVLRLRGG  +
Sbjct  517  IQKESTLHLVLRLRGGGHV  535


 Score = 70.1 bits (170),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80



>emb|CAA51679.1| ubiquitin [Solanum lycopersicum]
Length=534

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  305  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  364

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  365  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  417


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  416  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  460


 Score =   216 bits (551),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLT KTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTRKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score =   216 bits (551),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLT KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTRKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  341


 Score = 70.1 bits (170),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  308


 Score = 70.1 bits (170),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  340  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  384


 Score =   220 bits (560),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  381  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  440

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  441  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  493


 Score = 61.6 bits (148),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  492  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  532


 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 76/76 (100%), Positives = 76/76 (100%), Gaps = 0/76 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  457  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  516

Query  238  IQKESTLHLVLRLRGG  285
            IQKESTLHLVLRLRGG
Sbjct  517  IQKESTLHLVLRLRGG  532


 Score = 70.1 bits (170),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80



>ref|NP_001105376.1| polyubiquitin [Zea mays]
 gb|AAC49025.1| polyubiquitin [Zea mays]
Length=381

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score =   220 bits (560),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score = 68.9 bits (167),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      +RL GGMQIF
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVVRLRGGMQIF  308


 Score =   219 bits (557),  Expect(2) = 9e-67, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLV+RLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  289  IQKESTLHLVVRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  341


 Score = 61.6 bits (148),  Expect(2) = 9e-67, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  340  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  380


 Score =   154 bits (390),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/76 (100%), Positives = 76/76 (100%), Gaps = 0/76 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  305  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  364

Query  238  IQKESTLHLVLRLRGG  285
            IQKESTLHLVLRLRGG
Sbjct  365  IQKESTLHLVLRLRGG  380


 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80



>gb|KJB69254.1| hypothetical protein B456_011G016600 [Gossypium raimondii]
Length=162

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score =   168 bits (425),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 83/83 (100%), Positives = 83/83 (100%), Gaps = 0/83 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKT  306
            IQKESTLHLVLRLRGGMQIFVKT
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKT  159


 Score = 70.1 bits (170),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80



>gb|ADD52202.1| ubiquitin [Catharanthus roseus]
 gb|AEK98798.1| ubiquitin [Carthamus tinctorius]
Length=381

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  308


 Score =   214 bits (546),  Expect(2) = 4e-68, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 109/113 (96%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDT DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD N
Sbjct  77   MQIFVKTLTGKTITLEVESSDTTDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADCN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score = 70.1 bits (170),  Expect(2) = 4e-68, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score =   216 bits (550),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 109/113 (96%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAK QDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKTQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDT DNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTTDNVKAKIQDKEGIP  113


 Score = 66.6 bits (161),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 34/46 (74%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA  NI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADCNIQKESTLH-LVLRLRGGMQIF  156


 Score =   220 bits (560),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  341


 Score =   152 bits (384),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI AGKQLEDGRTLADYN
Sbjct  305  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLILAGKQLEDGRTLADYN  364

Query  238  IQKESTLHLVLRLRGGM  288
            IQKESTLHLVLRLRGG 
Sbjct  365  IQKESTLHLVLRLRGGF  381


 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80


 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 30/42 (71%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLI AGK LEDGRTLA YNI KES      LRL GG
Sbjct  340  IPPDQQRLILAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  380



>ref|XP_006654612.1| PREDICTED: polyubiquitin-like [Oryza brachyantha]
Length=305

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score =   220 bits (560),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score =   153 bits (386),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/76 (99%), Positives = 76/76 (100%), Gaps = 0/76 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQL+DGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLDDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGG  285
            IQKESTLHLVLRLRGG
Sbjct  289  IQKESTLHLVLRLRGG  304


 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80


 Score = 60.1 bits (144),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK L+DGRTLA YNI KES      LRL GG
Sbjct  264  IPPDQQRLIFAGKQLDDGRTLADYNIQKESTLH-LVLRLRGG  304



>ref|XP_003627152.1| Ubiquitin [Medicago truncatula]
 gb|KEH18411.1| polyubiquitin 3 [Medicago truncatula]
Length=270

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score =   184 bits (466),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 92/92 (100%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE  333
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE  244


 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80



>gb|ABI84246.1| polyubiquitin 10 [Arachis hypogaea]
Length=192

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score =   220 bits (560),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score = 82.0 bits (201),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 40/40 (100%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  177
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  192


 Score = 70.1 bits (170),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80



>ref|XP_006396611.1| hypothetical protein EUTSA_v10028730mg [Eutrema salsugineum]
 gb|AAL27563.1|AF429429_1 polyubiquitin OUB1 [Olea europaea]
 gb|ESQ38064.1| hypothetical protein EUTSA_v10028730mg [Eutrema salsugineum]
Length=305

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score =   220 bits (560),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score =   155 bits (392),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGM  288
            IQKESTLHLVLRLRGG+
Sbjct  289  IQKESTLHLVLRLRGGL  305


 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80


 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 32/43 (74%), Gaps = 1/43 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGM  520
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG+
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGL  305



>ref|XP_011094688.1| PREDICTED: polyubiquitin-like [Sesamum indicum]
Length=627

 Score =   220 bits (561),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score =   220 bits (561),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score =   220 bits (561),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score =   220 bits (561),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  341


 Score =   220 bits (561),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  305  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  364

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  365  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  417


 Score = 69.7 bits (169),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score = 69.7 bits (169),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score = 69.7 bits (169),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  308


 Score = 69.7 bits (169),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  340  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  384


 Score = 69.7 bits (169),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  416  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  460


 Score =   219 bits (557),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  381  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  440

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE E+SDTIDNVKAKI DKEGIP
Sbjct  441  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVETSDTIDNVKAKIQDKEGIP  493


 Score = 61.2 bits (147),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  492  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  532


 Score =   153 bits (387),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 75/76 (99%), Positives = 76/76 (100%), Gaps = 0/76 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVE+SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  457  MQIFVKTLTGKTITLEVETSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  516

Query  238  IQKESTLHLVLRLRGG  285
            IQKESTLHLVLRLRGG
Sbjct  517  IQKESTLHLVLRLRGG  532


 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80



>ref|XP_008243903.1| PREDICTED: uncharacterized protein LOC103342112 isoform X2 [Prunus 
mume]
Length=6462

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
             MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  6081  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  6140

Query  238   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
             IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  6141  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  6193


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
             MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  6157  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  6216

Query  238   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
             IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  6217  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  6269


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
             MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  6233  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  6292

Query  238   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
             IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  6293  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  6345


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392   FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
              PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  6192  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  6236


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392   FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
              PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  6268  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  6312


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392   FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
              PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  6344  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  6388


 Score =   219 bits (559),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKT+TLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIP  189


 Score =   219 bits (559),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  305  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  364

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKT+TLE ESSDTIDNVKAKI DKEGIP
Sbjct  365  IQKESTLHLVLRLRGGMQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIP  417


 Score =   219 bits (559),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  533  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  592

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKT+TLE ESSDTIDNVKAKI DKEGIP
Sbjct  593  IQKESTLHLVLRLRGGMQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIP  645


 Score =   219 bits (559),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  761  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  820

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKT+TLE ESSDTIDNVKAKI DKEGIP
Sbjct  821  IQKESTLHLVLRLRGGMQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIP  873


 Score =   219 bits (559),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
             MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  989   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  1048

Query  238   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
             IQKESTLHLVLRLRGGMQIFVKTLTGKT+TLE ESSDTIDNVKAKI DKEGIP
Sbjct  1049  IQKESTLHLVLRLRGGMQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIP  1101


 Score =   219 bits (559),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
             MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1217  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  1276

Query  238   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
             IQKESTLHLVLRLRGGMQIFVKTLTGKT+TLE ESSDTIDNVKAKI DKEGIP
Sbjct  1277  IQKESTLHLVLRLRGGMQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIP  1329


 Score =   219 bits (559),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
             MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1445  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  1504

Query  238   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
             IQKESTLHLVLRLRGGMQIFVKTLTGKT+TLE ESSDTIDNVKAKI DKEGIP
Sbjct  1505  IQKESTLHLVLRLRGGMQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIP  1557


 Score =   219 bits (559),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
             MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1673  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  1732

Query  238   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
             IQKESTLHLVLRLRGGMQIFVKTLTGKT+TLE ESSDTIDNVKAKI DKEGIP
Sbjct  1733  IQKESTLHLVLRLRGGMQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIP  1785


 Score =   219 bits (559),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
             MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1901  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  1960

Query  238   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
             IQKESTLHLVLRLRGGMQIFVKTLTGKT+TLE ESSDTIDNVKAKI DKEGIP
Sbjct  1961  IQKESTLHLVLRLRGGMQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIP  2013


 Score =   219 bits (559),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
             MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  2129  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  2188

Query  238   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
             IQKESTLHLVLRLRGGMQIFVKTLTGKT+TLE ESSDTIDNVKAKI DKEGIP
Sbjct  2189  IQKESTLHLVLRLRGGMQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIP  2241


 Score =   219 bits (559),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
             MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  2357  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  2416

Query  238   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
             IQKESTLHLVLRLRGGMQIFVKTLTGKT+TLE ESSDTIDNVKAKI DKEGIP
Sbjct  2417  IQKESTLHLVLRLRGGMQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIP  2469


 Score =   219 bits (559),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
             MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  2585  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  2644

Query  238   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
             IQKESTLHLVLRLRGGMQIFVKTLTGKT+TLE ESSDTIDNVKAKI DKEGIP
Sbjct  2645  IQKESTLHLVLRLRGGMQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIP  2697


 Score =   219 bits (559),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
             MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  2813  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  2872

Query  238   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
             IQKESTLHLVLRLRGGMQIFVKTLTGKT+TLE ESSDTIDNVKAKI DKEGIP
Sbjct  2873  IQKESTLHLVLRLRGGMQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIP  2925


 Score =   219 bits (559),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
             MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  3041  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  3100

Query  238   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
             IQKESTLHLVLRLRGGMQIFVKTLTGKT+TLE ESSDTIDNVKAKI DKEGIP
Sbjct  3101  IQKESTLHLVLRLRGGMQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIP  3153


 Score =   219 bits (559),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
             MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  3269  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  3328

Query  238   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
             IQKESTLHLVLRLRGGMQIFVKTLTGKT+TLE ESSDTIDNVKAKI DKEGIP
Sbjct  3329  IQKESTLHLVLRLRGGMQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIP  3381


 Score =   219 bits (559),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
             MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  3497  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  3556

Query  238   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
             IQKESTLHLVLRLRGGMQIFVKTLTGKT+TLE ESSDTIDNVKAKI DKEGIP
Sbjct  3557  IQKESTLHLVLRLRGGMQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIP  3609


 Score =   219 bits (559),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
             MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  3725  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  3784

Query  238   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
             IQKESTLHLVLRLRGGMQIFVKTLTGKT+TLE ESSDTIDNVKAKI DKEGIP
Sbjct  3785  IQKESTLHLVLRLRGGMQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIP  3837


 Score =   219 bits (559),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
             MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  3953  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  4012

Query  238   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
             IQKESTLHLVLRLRGGMQIFVKTLTGKT+TLE ESSDTIDNVKAKI DKEGIP
Sbjct  4013  IQKESTLHLVLRLRGGMQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIP  4065


 Score =   219 bits (559),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
             MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  4181  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  4240

Query  238   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
             IQKESTLHLVLRLRGGMQIFVKTLTGKT+TLE ESSDTIDNVKAKI DKEGIP
Sbjct  4241  IQKESTLHLVLRLRGGMQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIP  4293


 Score =   219 bits (559),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
             MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  4409  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  4468

Query  238   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
             IQKESTLHLVLRLRGGMQIFVKTLTGKT+TLE ESSDTIDNVKAKI DKEGIP
Sbjct  4469  IQKESTLHLVLRLRGGMQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIP  4521


 Score =   219 bits (559),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
             MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  4637  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  4696

Query  238   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
             IQKESTLHLVLRLRGGMQIFVKTLTGKT+TLE ESSDTIDNVKAKI DKEGIP
Sbjct  4697  IQKESTLHLVLRLRGGMQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIP  4749


 Score =   219 bits (559),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
             MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  4865  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  4924

Query  238   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
             IQKESTLHLVLRLRGGMQIFVKTLTGKT+TLE ESSDTIDNVKAKI DKEGIP
Sbjct  4925  IQKESTLHLVLRLRGGMQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIP  4977


 Score =   219 bits (559),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
             MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  5093  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  5152

Query  238   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
             IQKESTLHLVLRLRGGMQIFVKTLTGKT+TLE ESSDTIDNVKAKI DKEGIP
Sbjct  5153  IQKESTLHLVLRLRGGMQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIP  5205


 Score =   219 bits (559),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
             MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  5321  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  5380

Query  238   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
             IQKESTLHLVLRLRGGMQIFVKTLTGKT+TLE ESSDTIDNVKAKI DKEGIP
Sbjct  5381  IQKESTLHLVLRLRGGMQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIP  5433


 Score =   219 bits (559),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
             MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  5549  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  5608

Query  238   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
             IQKESTLHLVLRLRGGMQIFVKTLTGKT+TLE ESSDTIDNVKAKI DKEGIP
Sbjct  5609  IQKESTLHLVLRLRGGMQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIP  5661


 Score =   219 bits (559),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
             MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  5777  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  5836

Query  238   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
             IQKESTLHLVLRLRGGMQIFVKTLTGKT+TLE ESSDTIDNVKAKI DKEGIP
Sbjct  5837  IQKESTLHLVLRLRGGMQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIP  5889


 Score = 70.1 bits (170),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score = 70.1 bits (170),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  416  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  460


 Score = 70.1 bits (170),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  644  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  688


 Score = 70.1 bits (170),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  872  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  916


 Score = 70.1 bits (170),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392   FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
              PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  1100  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  1144


 Score = 70.1 bits (170),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392   FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
              PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  1328  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  1372


 Score = 70.1 bits (170),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392   FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
              PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  1556  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  1600


 Score = 70.1 bits (170),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392   FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
              PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  1784  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  1828


 Score = 70.1 bits (170),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392   FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
              PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  2012  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  2056


 Score = 70.1 bits (170),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392   FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
              PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  2240  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  2284


 Score = 70.1 bits (170),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392   FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
              PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  2468  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  2512


 Score = 70.1 bits (170),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392   FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
              PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  2696  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  2740


 Score = 70.1 bits (170),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392   FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
              PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  2924  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  2968


 Score = 70.1 bits (170),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392   FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
              PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  3152  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  3196


 Score = 70.1 bits (170),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392   FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
              PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  3380  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  3424


 Score = 70.1 bits (170),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392   FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
              PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  3608  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  3652


 Score = 70.1 bits (170),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392   FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
              PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  3836  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  3880


 Score = 70.1 bits (170),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392   FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
              PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  4064  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  4108


 Score = 70.1 bits (170),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392   FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
              PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  4292  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  4336


 Score = 70.1 bits (170),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392   FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
              PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  4520  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  4564


 Score = 70.1 bits (170),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392   FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
              PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  4748  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  4792


 Score = 70.1 bits (170),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392   FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
              PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  4976  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  5020


 Score = 70.1 bits (170),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392   FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
              PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  5204  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  5248


 Score = 70.1 bits (170),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392   FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
              PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  5432  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  5476


 Score = 70.1 bits (170),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392   FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
              PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  5660  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  5704


 Score = 70.1 bits (170),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392   FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
              PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  5888  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  5932


 Score =   218 bits (556),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL DYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLGDYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  341


 Score = 70.1 bits (170),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  340  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  384


 Score =   218 bits (554),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQ+FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL DYN
Sbjct  1    MQVFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLGDYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score =   218 bits (554),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKT+TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL DYN
Sbjct  457  MQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLGDYN  516

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  517  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  569


 Score =   218 bits (554),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKT+TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL DYN
Sbjct  685  MQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLGDYN  744

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  745  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  797


 Score =   218 bits (554),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = +1

Query  58    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
             MQIFVKTLTGKT+TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL DYN
Sbjct  913   MQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLGDYN  972

Query  238   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
             IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  973   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  1025


 Score =   218 bits (554),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = +1

Query  58    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
             MQIFVKTLTGKT+TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL DYN
Sbjct  1141  MQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLGDYN  1200

Query  238   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
             IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  1201  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  1253


 Score =   218 bits (554),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = +1

Query  58    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
             MQIFVKTLTGKT+TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL DYN
Sbjct  1369  MQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLGDYN  1428

Query  238   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
             IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  1429  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  1481


 Score =   218 bits (554),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = +1

Query  58    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
             MQIFVKTLTGKT+TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL DYN
Sbjct  1597  MQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLGDYN  1656

Query  238   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
             IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  1657  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  1709


 Score =   218 bits (554),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = +1

Query  58    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
             MQIFVKTLTGKT+TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL DYN
Sbjct  1825  MQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLGDYN  1884

Query  238   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
             IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  1885  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  1937


 Score =   218 bits (554),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = +1

Query  58    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
             MQIFVKTLTGKT+TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL DYN
Sbjct  2053  MQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLGDYN  2112

Query  238   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
             IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  2113  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  2165


 Score =   218 bits (554),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = +1

Query  58    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
             MQIFVKTLTGKT+TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL DYN
Sbjct  2281  MQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLGDYN  2340

Query  238   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
             IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  2341  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  2393


 Score =   218 bits (554),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = +1

Query  58    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
             MQIFVKTLTGKT+TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL DYN
Sbjct  2509  MQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLGDYN  2568

Query  238   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
             IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  2569  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  2621


 Score =   218 bits (554),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = +1

Query  58    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
             MQIFVKTLTGKT+TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL DYN
Sbjct  2737  MQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLGDYN  2796

Query  238   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
             IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  2797  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  2849


 Score =   218 bits (554),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = +1

Query  58    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
             MQIFVKTLTGKT+TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL DYN
Sbjct  2965  MQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLGDYN  3024

Query  238   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
             IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  3025  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  3077


 Score =   218 bits (554),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = +1

Query  58    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
             MQIFVKTLTGKT+TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL DYN
Sbjct  3193  MQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLGDYN  3252

Query  238   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
             IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  3253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  3305


 Score =   218 bits (554),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = +1

Query  58    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
             MQIFVKTLTGKT+TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL DYN
Sbjct  3421  MQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLGDYN  3480

Query  238   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
             IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  3481  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  3533


 Score =   218 bits (554),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = +1

Query  58    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
             MQIFVKTLTGKT+TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL DYN
Sbjct  3649  MQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLGDYN  3708

Query  238   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
             IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  3709  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  3761


 Score =   218 bits (554),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = +1

Query  58    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
             MQIFVKTLTGKT+TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL DYN
Sbjct  3877  MQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLGDYN  3936

Query  238   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
             IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  3937  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  3989


 Score =   218 bits (554),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = +1

Query  58    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
             MQIFVKTLTGKT+TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL DYN
Sbjct  4105  MQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLGDYN  4164

Query  238   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
             IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  4165  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  4217


 Score =   218 bits (554),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = +1

Query  58    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
             MQIFVKTLTGKT+TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL DYN
Sbjct  4333  MQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLGDYN  4392

Query  238   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
             IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  4393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  4445


 Score =   218 bits (554),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = +1

Query  58    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
             MQIFVKTLTGKT+TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL DYN
Sbjct  4561  MQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLGDYN  4620

Query  238   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
             IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  4621  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  4673


 Score =   218 bits (554),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = +1

Query  58    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
             MQIFVKTLTGKT+TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL DYN
Sbjct  4789  MQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLGDYN  4848

Query  238   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
             IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  4849  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  4901


 Score =   218 bits (554),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = +1

Query  58    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
             MQIFVKTLTGKT+TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL DYN
Sbjct  5017  MQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLGDYN  5076

Query  238   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
             IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  5077  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  5129


 Score =   218 bits (554),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = +1

Query  58    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
             MQIFVKTLTGKT+TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL DYN
Sbjct  5245  MQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLGDYN  5304

Query  238   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
             IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  5305  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  5357


 Score =   218 bits (554),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = +1

Query  58    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
             MQIFVKTLTGKT+TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL DYN
Sbjct  5473  MQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLGDYN  5532

Query  238   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
             IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  5533  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  5585


 Score =   218 bits (554),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = +1

Query  58    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
             MQIFVKTLTGKT+TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL DYN
Sbjct  5701  MQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLGDYN  5760

Query  238   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
             IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  5761  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  5813


 Score = 70.1 bits (170),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score = 70.1 bits (170),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  568  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  612


 Score = 70.1 bits (170),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  796  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  840


 Score = 70.1 bits (170),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392   FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
              PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  1024  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  1068


 Score = 70.1 bits (170),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392   FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
              PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  1252  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  1296


 Score = 70.1 bits (170),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392   FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
              PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  1480  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  1524


 Score = 70.1 bits (170),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392   FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
              PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  1708  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  1752


 Score = 70.1 bits (170),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392   FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
              PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  1936  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  1980


 Score = 70.1 bits (170),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392   FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
              PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  2164  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  2208


 Score = 70.1 bits (170),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392   FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
              PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  2392  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  2436


 Score = 70.1 bits (170),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392   FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
              PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  2620  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  2664


 Score = 70.1 bits (170),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392   FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
              PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  2848  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  2892


 Score = 70.1 bits (170),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392   FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
              PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  3076  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  3120


 Score = 70.1 bits (170),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392   FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
              PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  3304  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  3348


 Score = 70.1 bits (170),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392   FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
              PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  3532  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  3576


 Score = 70.1 bits (170),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392   FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
              PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  3760  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  3804


 Score = 70.1 bits (170),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392   FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
              PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  3988  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  4032


 Score = 70.1 bits (170),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392   FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
              PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  4216  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  4260


 Score = 70.1 bits (170),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392   FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
              PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  4444  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  4488


 Score = 70.1 bits (170),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392   FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
              PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  4672  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  4716


 Score = 70.1 bits (170),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392   FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
              PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  4900  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  4944


 Score = 70.1 bits (170),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392   FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
              PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  5128  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  5172


 Score = 70.1 bits (170),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392   FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
              PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  5356  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  5400


 Score = 70.1 bits (170),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392   FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
              PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  5584  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  5628


 Score = 70.1 bits (170),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392   FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
              PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  5812  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  5856


 Score =   219 bits (559),  Expect(2) = 6e-69, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKT+TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score = 68.2 bits (165),  Expect(2) = 6e-69, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 34/46 (74%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTL  YNI KES      LRL GGMQIF
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLGDYNIQKESTLH-LVLRLRGGMQIF  308


 Score =   219 bits (557),  Expect(2) = 9e-69, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKT+TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  381  MQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  440

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKT+TLE ESSDTIDNVKAKI DKEGIP
Sbjct  441  IQKESTLHLVLRLRGGMQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIP  493


 Score =   219 bits (557),  Expect(2) = 9e-69, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKT+TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  609  MQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  668

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKT+TLE ESSDTIDNVKAKI DKEGIP
Sbjct  669  IQKESTLHLVLRLRGGMQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIP  721


 Score =   219 bits (557),  Expect(2) = 9e-69, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKT+TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  837  MQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  896

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKT+TLE ESSDTIDNVKAKI DKEGIP
Sbjct  897  IQKESTLHLVLRLRGGMQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIP  949


 Score =   219 bits (557),  Expect(2) = 9e-69, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
             MQIFVKTLTGKT+TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1065  MQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  1124

Query  238   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
             IQKESTLHLVLRLRGGMQIFVKTLTGKT+TLE ESSDTIDNVKAKI DKEGIP
Sbjct  1125  IQKESTLHLVLRLRGGMQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIP  1177


 Score =   219 bits (557),  Expect(2) = 9e-69, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
             MQIFVKTLTGKT+TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1293  MQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  1352

Query  238   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
             IQKESTLHLVLRLRGGMQIFVKTLTGKT+TLE ESSDTIDNVKAKI DKEGIP
Sbjct  1353  IQKESTLHLVLRLRGGMQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIP  1405


 Score =   219 bits (557),  Expect(2) = 9e-69, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
             MQIFVKTLTGKT+TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1521  MQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  1580

Query  238   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
             IQKESTLHLVLRLRGGMQIFVKTLTGKT+TLE ESSDTIDNVKAKI DKEGIP
Sbjct  1581  IQKESTLHLVLRLRGGMQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIP  1633


 Score =   219 bits (557),  Expect(2) = 9e-69, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
             MQIFVKTLTGKT+TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1749  MQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  1808

Query  238   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
             IQKESTLHLVLRLRGGMQIFVKTLTGKT+TLE ESSDTIDNVKAKI DKEGIP
Sbjct  1809  IQKESTLHLVLRLRGGMQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIP  1861


 Score =   219 bits (557),  Expect(2) = 9e-69, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
             MQIFVKTLTGKT+TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1977  MQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  2036

Query  238   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
             IQKESTLHLVLRLRGGMQIFVKTLTGKT+TLE ESSDTIDNVKAKI DKEGIP
Sbjct  2037  IQKESTLHLVLRLRGGMQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIP  2089


 Score =   219 bits (557),  Expect(2) = 9e-69, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
             MQIFVKTLTGKT+TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  2205  MQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  2264

Query  238   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
             IQKESTLHLVLRLRGGMQIFVKTLTGKT+TLE ESSDTIDNVKAKI DKEGIP
Sbjct  2265  IQKESTLHLVLRLRGGMQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIP  2317


 Score =   219 bits (557),  Expect(2) = 9e-69, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
             MQIFVKTLTGKT+TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  2433  MQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  2492

Query  238   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
             IQKESTLHLVLRLRGGMQIFVKTLTGKT+TLE ESSDTIDNVKAKI DKEGIP
Sbjct  2493  IQKESTLHLVLRLRGGMQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIP  2545


 Score =   219 bits (557),  Expect(2) = 9e-69, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
             MQIFVKTLTGKT+TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  2661  MQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  2720

Query  238   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
             IQKESTLHLVLRLRGGMQIFVKTLTGKT+TLE ESSDTIDNVKAKI DKEGIP
Sbjct  2721  IQKESTLHLVLRLRGGMQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIP  2773


 Score =   219 bits (557),  Expect(2) = 9e-69, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
             MQIFVKTLTGKT+TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  2889  MQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  2948

Query  238   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
             IQKESTLHLVLRLRGGMQIFVKTLTGKT+TLE ESSDTIDNVKAKI DKEGIP
Sbjct  2949  IQKESTLHLVLRLRGGMQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIP  3001


 Score =   219 bits (557),  Expect(2) = 9e-69, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
             MQIFVKTLTGKT+TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  3117  MQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  3176

Query  238   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
             IQKESTLHLVLRLRGGMQIFVKTLTGKT+TLE ESSDTIDNVKAKI DKEGIP
Sbjct  3177  IQKESTLHLVLRLRGGMQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIP  3229


 Score =   219 bits (557),  Expect(2) = 9e-69, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
             MQIFVKTLTGKT+TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  3345  MQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  3404

Query  238   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
             IQKESTLHLVLRLRGGMQIFVKTLTGKT+TLE ESSDTIDNVKAKI DKEGIP
Sbjct  3405  IQKESTLHLVLRLRGGMQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIP  3457


 Score =   219 bits (557),  Expect(2) = 9e-69, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
             MQIFVKTLTGKT+TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  3573  MQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  3632

Query  238   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
             IQKESTLHLVLRLRGGMQIFVKTLTGKT+TLE ESSDTIDNVKAKI DKEGIP
Sbjct  3633  IQKESTLHLVLRLRGGMQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIP  3685


 Score =   219 bits (557),  Expect(2) = 9e-69, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
             MQIFVKTLTGKT+TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  3801  MQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  3860

Query  238   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
             IQKESTLHLVLRLRGGMQIFVKTLTGKT+TLE ESSDTIDNVKAKI DKEGIP
Sbjct  3861  IQKESTLHLVLRLRGGMQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIP  3913


 Score =   219 bits (557),  Expect(2) = 9e-69, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
             MQIFVKTLTGKT+TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  4029  MQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  4088

Query  238   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
             IQKESTLHLVLRLRGGMQIFVKTLTGKT+TLE ESSDTIDNVKAKI DKEGIP
Sbjct  4089  IQKESTLHLVLRLRGGMQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIP  4141


 Score =   219 bits (557),  Expect(2) = 9e-69, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
             MQIFVKTLTGKT+TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  4257  MQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  4316

Query  238   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
             IQKESTLHLVLRLRGGMQIFVKTLTGKT+TLE ESSDTIDNVKAKI DKEGIP
Sbjct  4317  IQKESTLHLVLRLRGGMQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIP  4369


 Score =   219 bits (557),  Expect(2) = 9e-69, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
             MQIFVKTLTGKT+TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  4485  MQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  4544

Query  238   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
             IQKESTLHLVLRLRGGMQIFVKTLTGKT+TLE ESSDTIDNVKAKI DKEGIP
Sbjct  4545  IQKESTLHLVLRLRGGMQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIP  4597


 Score =   219 bits (557),  Expect(2) = 9e-69, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
             MQIFVKTLTGKT+TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  4713  MQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  4772

Query  238   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
             IQKESTLHLVLRLRGGMQIFVKTLTGKT+TLE ESSDTIDNVKAKI DKEGIP
Sbjct  4773  IQKESTLHLVLRLRGGMQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIP  4825


 Score =   219 bits (557),  Expect(2) = 9e-69, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
             MQIFVKTLTGKT+TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  4941  MQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  5000

Query  238   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
             IQKESTLHLVLRLRGGMQIFVKTLTGKT+TLE ESSDTIDNVKAKI DKEGIP
Sbjct  5001  IQKESTLHLVLRLRGGMQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIP  5053


 Score =   219 bits (557),  Expect(2) = 9e-69, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
             MQIFVKTLTGKT+TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  5169  MQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  5228

Query  238   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
             IQKESTLHLVLRLRGGMQIFVKTLTGKT+TLE ESSDTIDNVKAKI DKEGIP
Sbjct  5229  IQKESTLHLVLRLRGGMQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIP  5281


 Score =   219 bits (557),  Expect(2) = 9e-69, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
             MQIFVKTLTGKT+TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  5397  MQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  5456

Query  238   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
             IQKESTLHLVLRLRGGMQIFVKTLTGKT+TLE ESSDTIDNVKAKI DKEGIP
Sbjct  5457  IQKESTLHLVLRLRGGMQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIP  5509


 Score =   219 bits (557),  Expect(2) = 9e-69, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
             MQIFVKTLTGKT+TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  5625  MQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  5684

Query  238   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
             IQKESTLHLVLRLRGGMQIFVKTLTGKT+TLE ESSDTIDNVKAKI DKEGIP
Sbjct  5685  IQKESTLHLVLRLRGGMQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIP  5737


 Score =   219 bits (557),  Expect(2) = 9e-69, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
             MQIFVKTLTGKT+TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  5853  MQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  5912

Query  238   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
             IQKESTLHLVLRLRGGMQIFVKTLTGKT+TLE ESSDTIDNVKAKI DKEGIP
Sbjct  5913  IQKESTLHLVLRLRGGMQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIP  5965


 Score = 68.2 bits (165),  Expect(2) = 9e-69, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 34/46 (74%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTL  YNI KES      LRL GGMQIF
Sbjct  492  IPPDQQRLIFAGKQLEDGRTLGDYNIQKESTLH-LVLRLRGGMQIF  536


 Score = 68.2 bits (165),  Expect(2) = 9e-69, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 34/46 (74%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTL  YNI KES      LRL GGMQIF
Sbjct  720  IPPDQQRLIFAGKQLEDGRTLGDYNIQKESTLH-LVLRLRGGMQIF  764


 Score = 68.2 bits (165),  Expect(2) = 9e-69, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 34/46 (74%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTL  YNI KES      LRL GGMQIF
Sbjct  948  IPPDQQRLIFAGKQLEDGRTLGDYNIQKESTLH-LVLRLRGGMQIF  992


 Score = 68.2 bits (165),  Expect(2) = 9e-69, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 34/46 (74%), Gaps = 1/46 (2%)
 Frame = +2

Query  392   FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
              PPDQQRLIFAGK LEDGRTL  YNI KES      LRL GGMQIF
Sbjct  1176  IPPDQQRLIFAGKQLEDGRTLGDYNIQKESTLH-LVLRLRGGMQIF  1220


 Score = 68.2 bits (165),  Expect(2) = 9e-69, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 34/46 (74%), Gaps = 1/46 (2%)
 Frame = +2

Query  392   FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
              PPDQQRLIFAGK LEDGRTL  YNI KES      LRL GGMQIF
Sbjct  1404  IPPDQQRLIFAGKQLEDGRTLGDYNIQKESTLH-LVLRLRGGMQIF  1448


 Score = 68.2 bits (165),  Expect(2) = 9e-69, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 34/46 (74%), Gaps = 1/46 (2%)
 Frame = +2

Query  392   FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
              PPDQQRLIFAGK LEDGRTL  YNI KES      LRL GGMQIF
Sbjct  1632  IPPDQQRLIFAGKQLEDGRTLGDYNIQKESTLH-LVLRLRGGMQIF  1676


 Score = 68.2 bits (165),  Expect(2) = 9e-69, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 34/46 (74%), Gaps = 1/46 (2%)
 Frame = +2

Query  392   FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
              PPDQQRLIFAGK LEDGRTL  YNI KES      LRL GGMQIF
Sbjct  1860  IPPDQQRLIFAGKQLEDGRTLGDYNIQKESTLH-LVLRLRGGMQIF  1904


 Score = 68.2 bits (165),  Expect(2) = 9e-69, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 34/46 (74%), Gaps = 1/46 (2%)
 Frame = +2

Query  392   FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
              PPDQQRLIFAGK LEDGRTL  YNI KES      LRL GGMQIF
Sbjct  2088  IPPDQQRLIFAGKQLEDGRTLGDYNIQKESTLH-LVLRLRGGMQIF  2132


 Score = 68.2 bits (165),  Expect(2) = 9e-69, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 34/46 (74%), Gaps = 1/46 (2%)
 Frame = +2

Query  392   FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
              PPDQQRLIFAGK LEDGRTL  YNI KES      LRL GGMQIF
Sbjct  2316  IPPDQQRLIFAGKQLEDGRTLGDYNIQKESTLH-LVLRLRGGMQIF  2360


 Score = 68.2 bits (165),  Expect(2) = 9e-69, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 34/46 (74%), Gaps = 1/46 (2%)
 Frame = +2

Query  392   FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
              PPDQQRLIFAGK LEDGRTL  YNI KES      LRL GGMQIF
Sbjct  2544  IPPDQQRLIFAGKQLEDGRTLGDYNIQKESTLH-LVLRLRGGMQIF  2588


 Score = 68.2 bits (165),  Expect(2) = 9e-69, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 34/46 (74%), Gaps = 1/46 (2%)
 Frame = +2

Query  392   FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
              PPDQQRLIFAGK LEDGRTL  YNI KES      LRL GGMQIF
Sbjct  2772  IPPDQQRLIFAGKQLEDGRTLGDYNIQKESTLH-LVLRLRGGMQIF  2816


 Score = 68.2 bits (165),  Expect(2) = 9e-69, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 34/46 (74%), Gaps = 1/46 (2%)
 Frame = +2

Query  392   FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
              PPDQQRLIFAGK LEDGRTL  YNI KES      LRL GGMQIF
Sbjct  3000  IPPDQQRLIFAGKQLEDGRTLGDYNIQKESTLH-LVLRLRGGMQIF  3044


 Score = 68.2 bits (165),  Expect(2) = 9e-69, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 34/46 (74%), Gaps = 1/46 (2%)
 Frame = +2

Query  392   FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
              PPDQQRLIFAGK LEDGRTL  YNI KES      LRL GGMQIF
Sbjct  3228  IPPDQQRLIFAGKQLEDGRTLGDYNIQKESTLH-LVLRLRGGMQIF  3272


 Score = 68.2 bits (165),  Expect(2) = 9e-69, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 34/46 (74%), Gaps = 1/46 (2%)
 Frame = +2

Query  392   FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
              PPDQQRLIFAGK LEDGRTL  YNI KES      LRL GGMQIF
Sbjct  3456  IPPDQQRLIFAGKQLEDGRTLGDYNIQKESTLH-LVLRLRGGMQIF  3500


 Score = 68.2 bits (165),  Expect(2) = 9e-69, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 34/46 (74%), Gaps = 1/46 (2%)
 Frame = +2

Query  392   FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
              PPDQQRLIFAGK LEDGRTL  YNI KES      LRL GGMQIF
Sbjct  3684  IPPDQQRLIFAGKQLEDGRTLGDYNIQKESTLH-LVLRLRGGMQIF  3728


 Score = 68.2 bits (165),  Expect(2) = 9e-69, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 34/46 (74%), Gaps = 1/46 (2%)
 Frame = +2

Query  392   FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
              PPDQQRLIFAGK LEDGRTL  YNI KES      LRL GGMQIF
Sbjct  3912  IPPDQQRLIFAGKQLEDGRTLGDYNIQKESTLH-LVLRLRGGMQIF  3956


 Score = 68.2 bits (165),  Expect(2) = 9e-69, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 34/46 (74%), Gaps = 1/46 (2%)
 Frame = +2

Query  392   FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
              PPDQQRLIFAGK LEDGRTL  YNI KES      LRL GGMQIF
Sbjct  4140  IPPDQQRLIFAGKQLEDGRTLGDYNIQKESTLH-LVLRLRGGMQIF  4184


 Score = 68.2 bits (165),  Expect(2) = 9e-69, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 34/46 (74%), Gaps = 1/46 (2%)
 Frame = +2

Query  392   FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
              PPDQQRLIFAGK LEDGRTL  YNI KES      LRL GGMQIF
Sbjct  4368  IPPDQQRLIFAGKQLEDGRTLGDYNIQKESTLH-LVLRLRGGMQIF  4412


 Score = 68.2 bits (165),  Expect(2) = 9e-69, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 34/46 (74%), Gaps = 1/46 (2%)
 Frame = +2

Query  392   FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
              PPDQQRLIFAGK LEDGRTL  YNI KES      LRL GGMQIF
Sbjct  4596  IPPDQQRLIFAGKQLEDGRTLGDYNIQKESTLH-LVLRLRGGMQIF  4640


 Score = 68.2 bits (165),  Expect(2) = 9e-69, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 34/46 (74%), Gaps = 1/46 (2%)
 Frame = +2

Query  392   FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
              PPDQQRLIFAGK LEDGRTL  YNI KES      LRL GGMQIF
Sbjct  4824  IPPDQQRLIFAGKQLEDGRTLGDYNIQKESTLH-LVLRLRGGMQIF  4868


 Score = 68.2 bits (165),  Expect(2) = 9e-69, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 34/46 (74%), Gaps = 1/46 (2%)
 Frame = +2

Query  392   FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
              PPDQQRLIFAGK LEDGRTL  YNI KES      LRL GGMQIF
Sbjct  5052  IPPDQQRLIFAGKQLEDGRTLGDYNIQKESTLH-LVLRLRGGMQIF  5096


 Score = 68.2 bits (165),  Expect(2) = 9e-69, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 34/46 (74%), Gaps = 1/46 (2%)
 Frame = +2

Query  392   FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
              PPDQQRLIFAGK LEDGRTL  YNI KES      LRL GGMQIF
Sbjct  5280  IPPDQQRLIFAGKQLEDGRTLGDYNIQKESTLH-LVLRLRGGMQIF  5324


 Score = 68.2 bits (165),  Expect(2) = 9e-69, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 34/46 (74%), Gaps = 1/46 (2%)
 Frame = +2

Query  392   FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
              PPDQQRLIFAGK LEDGRTL  YNI KES      LRL GGMQIF
Sbjct  5508  IPPDQQRLIFAGKQLEDGRTLGDYNIQKESTLH-LVLRLRGGMQIF  5552


 Score = 68.2 bits (165),  Expect(2) = 9e-69, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 34/46 (74%), Gaps = 1/46 (2%)
 Frame = +2

Query  392   FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
              PPDQQRLIFAGK LEDGRTL  YNI KES      LRL GGMQIF
Sbjct  5736  IPPDQQRLIFAGKQLEDGRTLGDYNIQKESTLH-LVLRLRGGMQIF  5780


 Score = 68.2 bits (165),  Expect(2) = 9e-69, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 34/46 (74%), Gaps = 1/46 (2%)
 Frame = +2

Query  392   FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
              PPDQQRLIFAGK LEDGRTL  YNI KES      LRL GGMQIF
Sbjct  5964  IPPDQQRLIFAGKQLEDGRTLGDYNIQKESTLH-LVLRLRGGMQIF  6008


 Score =   216 bits (549),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 109/113 (96%), Gaps = 0/113 (0%)
 Frame = +1

Query  58    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
             MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG TL DYN
Sbjct  6005  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGSTLGDYN  6064

Query  238   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
             IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  6065  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  6117


 Score = 70.1 bits (170),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392   FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
              PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  6116  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  6160


 Score =   218 bits (554),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = +1

Query  58    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
             MQIFVKTLTGKT+TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL DYN
Sbjct  5929  MQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLGDYN  5988

Query  238   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
             IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  5989  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  6041


 Score = 65.5 bits (158),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 33/46 (72%), Gaps = 1/46 (2%)
 Frame = +2

Query  392   FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
              PPDQQRLIFAGK LEDG TL  YNI KES      LRL GGMQIF
Sbjct  6040  IPPDQQRLIFAGKQLEDGSTLGDYNIQKESTLH-LVLRLRGGMQIF  6084


 Score =   220 bits (560),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
             MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  6309  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  6368

Query  238   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
             IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  6369  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  6421


 Score = 61.6 bits (148),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392   FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
              PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  6420  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  6460


 Score =   154 bits (390),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 76/76 (100%), Positives = 76/76 (100%), Gaps = 0/76 (0%)
 Frame = +1

Query  58    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
             MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  6385  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  6444

Query  238   IQKESTLHLVLRLRGG  285
             IQKESTLHLVLRLRGG
Sbjct  6445  IQKESTLHLVLRLRGG  6460


 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 34/46 (74%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTL  YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLGDYNIQKESTLH-LVLRLRGGMQIF  80



>gb|AES89866.2| polyubiquitin 3 [Medicago truncatula]
Length=305

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score =   220 bits (560),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score =   154 bits (390),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 76/76 (100%), Positives = 76/76 (100%), Gaps = 0/76 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGG  285
            IQKESTLHLVLRLRGG
Sbjct  289  IQKESTLHLVLRLRGG  304


 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80


 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  304



>ref|XP_006593991.1| PREDICTED: polyubiquitin 10-like isoform X3 [Glycine max]
Length=685

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  341


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  305  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  364

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  365  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  417


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  381  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  440

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  441  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  493


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  457  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  516

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  517  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  569


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  308


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  340  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  384


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  416  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  460


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  492  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  536


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  568  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  612


 Score =   219 bits (559),  Expect(2) = 6e-67, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  533  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  592

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKT+TLE ESSDTIDNVKAKI DKEGIP
Sbjct  593  IQKESTLHLVLRLRGGMQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIP  645


 Score = 61.6 bits (148),  Expect(2) = 6e-67, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  644  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  684


 Score =   154 bits (389),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKT+TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  609  MQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  668

Query  238  IQKESTLHLVLRLRGGM  288
            IQKESTLHLVLRLRGG 
Sbjct  669  IQKESTLHLVLRLRGGF  685


 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80



>ref|XP_003331105.1| polyubiquitin-A [Puccinia graminis f. sp. tritici CRL 75-36-700-3]
 gb|EFP86686.1| polyubiquitin-A [Puccinia graminis f. sp. tritici CRL 75-36-700-3]
Length=609

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  341


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  305  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  364

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  365  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  417


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  381  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  440

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  441  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  493


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  308


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  340  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  384


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  416  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  460


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  492  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  536


 Score =   220 bits (560),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  457  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  516

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  517  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  569


 Score = 62.4 bits (150),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 32/43 (74%), Gaps = 1/43 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGM  520
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG+
Sbjct  568  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGI  609


 Score =   155 bits (391),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  533  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  592

Query  238  IQKESTLHLVLRLRGGM  288
            IQKESTLHLVLRLRGG+
Sbjct  593  IQKESTLHLVLRLRGGI  609


 Score = 70.1 bits (170),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80



>ref|XP_011468094.1| PREDICTED: polyubiquitin [Fragaria vesca subsp. vesca]
Length=306

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score =   219 bits (559),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score = 70.1 bits (170),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score =   220 bits (560),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score =   154 bits (390),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 76/76 (100%), Positives = 76/76 (100%), Gaps = 0/76 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGG  285
            IQKESTLHLVLRLRGG
Sbjct  289  IQKESTLHLVLRLRGG  304


 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80


 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  304



>ref|XP_010046742.1| PREDICTED: polyubiquitin-like [Eucalyptus grandis]
Length=458

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score =   219 bits (557),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK+KI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIP  189


 Score = 70.1 bits (170),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score =   218 bits (555),  Expect(2) = 4e-69, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGM IFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  289  IQKESTLHLVLRLRGGMHIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  341


 Score = 70.1 bits (170),  Expect(2) = 4e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  340  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  384


 Score =   219 bits (557),  Expect(2) = 9e-69, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score = 68.6 bits (166),  Expect(2) = 9e-69, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 34/46 (74%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGM IF
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMHIF  308


 Score =   218 bits (555),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            M IFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  305  MHIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  364

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  365  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  417


 Score = 58.5 bits (140),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 30/42 (71%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LED RTLA YNI KES      LRL GG
Sbjct  416  IPPDQQRLIFAGKQLEDERTLADYNIQKESTLH-LVLRLRGG  456


 Score =   151 bits (381),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 75/76 (99%), Positives = 75/76 (99%), Gaps = 0/76 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED RTLADYN
Sbjct  381  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDERTLADYN  440

Query  238  IQKESTLHLVLRLRGG  285
            IQKESTLHLVLRLRGG
Sbjct  441  IQKESTLHLVLRLRGG  456


 Score = 70.1 bits (170),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80



>ref|NP_001045980.1| Os02g0161900 [Oryza sativa Japonica Group]
 ref|NP_001058378.1| Os06g0681400 [Oryza sativa Japonica Group]
 ref|XP_006646911.1| PREDICTED: polyubiquitin-like [Oryza brachyantha]
 gb|AAF01315.1|AF184279_1 polyubiquitin [Oryza sativa Indica Group]
 gb|AAF01316.1|AF184280_1 polyubiquitin [Oryza sativa Indica Group]
 emb|CAA53665.1| polyubiquitin [Oryza sativa Indica Group]
 gb|AAC49806.1| polyubiquitin [Oryza sativa Indica Group]
 dbj|BAD25213.1| polyubiquitin 6 [Oryza sativa Japonica Group]
 dbj|BAF07894.1| Os02g0161900 [Oryza sativa Japonica Group]
 dbj|BAF20292.1| Os06g0681400 [Oryza sativa Japonica Group]
 dbj|BAG95117.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC72542.1| hypothetical protein OsI_05955 [Oryza sativa Indica Group]
 gb|EEE56356.1| hypothetical protein OsJ_05481 [Oryza sativa Japonica Group]
 gb|ADB84621.1| polyubiquitin [Oryza sativa Japonica Group]
 gb|ADM86852.1| polyubiquitin [Oryza sativa Japonica Group]
 dbj|BAK06683.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|AEE65380.1| ubiquitin 2 [Panicum virgatum]
 gb|AFW66449.1| ubiquitin2 [Zea mays]
Length=457

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  341


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  308


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  340  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  384


 Score =   220 bits (560),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  305  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  364

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  365  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  417


 Score = 61.6 bits (148),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  416  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  456


 Score =   154 bits (390),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 76/76 (100%), Positives = 76/76 (100%), Gaps = 0/76 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  381  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  440

Query  238  IQKESTLHLVLRLRGG  285
            IQKESTLHLVLRLRGG
Sbjct  441  IQKESTLHLVLRLRGG  456


 Score = 70.1 bits (170),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80



>ref|XP_006288300.1| hypothetical protein CARUB_v10001544mg [Capsella rubella]
 gb|EOA21198.1| hypothetical protein CARUB_v10001544mg [Capsella rubella]
Length=306

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score =   218 bits (556),  Expect(2) = 4e-69, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI +KEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQEKEGIP  189


 Score = 70.1 bits (170),  Expect(2) = 4e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score =   218 bits (556),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQ+KEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQEKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score =   154 bits (390),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 76/76 (100%), Positives = 76/76 (100%), Gaps = 0/76 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGG  285
            IQKESTLHLVLRLRGG
Sbjct  289  IQKESTLHLVLRLRGG  304


 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80


 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  304



>ref|XP_004249885.1| PREDICTED: polyubiquitin-like [Solanum lycopersicum]
Length=534

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  341


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  305  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  364

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  365  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  417


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  308


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  340  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  384


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  416  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  460


 Score =   220 bits (560),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  381  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  440

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  441  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  493


 Score = 61.6 bits (148),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  492  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  532


 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 76/76 (100%), Positives = 76/76 (100%), Gaps = 0/76 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  457  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  516

Query  238  IQKESTLHLVLRLRGG  285
            IQKESTLHLVLRLRGG
Sbjct  517  IQKESTLHLVLRLRGG  532


 Score = 70.1 bits (170),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80



>ref|XP_010454368.1| PREDICTED: polyubiquitin 4-like [Camelina sativa]
Length=382

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  308


 Score =   219 bits (559),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDT+DNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIP  113


 Score =   219 bits (559),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score = 70.1 bits (170),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score = 70.1 bits (170),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score =   220 bits (560),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  341


 Score = 61.6 bits (148),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  340  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  380


 Score =   154 bits (390),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/76 (100%), Positives = 76/76 (100%), Gaps = 0/76 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  305  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  364

Query  238  IQKESTLHLVLRLRGG  285
            IQKESTLHLVLRLRGG
Sbjct  365  IQKESTLHLVLRLRGG  380


 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80



>ref|XP_002874006.1| hypothetical protein ARALYDRAFT_488966 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50265.1| hypothetical protein ARALYDRAFT_488966 [Arabidopsis lyrata subsp. 
lyrata]
Length=382

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  308


 Score =   219 bits (559),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQ+FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQVFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score = 70.1 bits (170),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score =   220 bits (560),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  341


 Score = 61.6 bits (148),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  340  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  380


 Score =   154 bits (390),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/76 (100%), Positives = 76/76 (100%), Gaps = 0/76 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  305  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  364

Query  238  IQKESTLHLVLRLRGG  285
            IQKESTLHLVLRLRGG
Sbjct  365  IQKESTLHLVLRLRGG  380


 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80



>ref|XP_007211609.1| hypothetical protein PRUPE_ppa005507mg [Prunus persica]
 gb|AAL27564.1|AF429430_1 polyubiquitin OUB2 [Olea europaea]
 gb|EMJ12808.1| hypothetical protein PRUPE_ppa005507mg [Prunus persica]
Length=457

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  341


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  308


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  340  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  384


 Score =   220 bits (560),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  305  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  364

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  365  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  417


 Score = 62.4 bits (150),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 32/43 (74%), Gaps = 1/43 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGM  520
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG+
Sbjct  416  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGL  457


 Score =   155 bits (392),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  381  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  440

Query  238  IQKESTLHLVLRLRGGM  288
            IQKESTLHLVLRLRGG+
Sbjct  441  IQKESTLHLVLRLRGGL  457


 Score = 70.1 bits (170),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80



>gb|ACS68205.1| ubiquitin 10.2 [Brassica napus]
Length=381

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  308


 Score =   220 bits (560),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  341


 Score = 62.4 bits (150),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 32/43 (74%), Gaps = 1/43 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGM  520
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG+
Sbjct  340  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGI  381


 Score =   155 bits (391),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  305  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  364

Query  238  IQKESTLHLVLRLRGGM  288
            IQKESTLHLVLRLRGG+
Sbjct  365  IQKESTLHLVLRLRGGI  381


 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80



>ref|XP_007154495.1| hypothetical protein PHAVU_003G1236001g, partial [Phaseolus vulgaris]
 gb|ESW26489.1| hypothetical protein PHAVU_003G1236001g, partial [Phaseolus vulgaris]
Length=269

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score =   218 bits (556),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE E+SDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVENSDTIDNVKAKIQDKEGIP  189


 Score = 70.1 bits (170),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score =   218 bits (556),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVE+SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVENSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score = 84.0 bits (206),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/41 (100%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ  180
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ  269


 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80



>gb|KJB36627.1| hypothetical protein B456_006G167800 [Gossypium raimondii]
Length=229

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score =   220 bits (560),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score =   154 bits (390),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 76/76 (100%), Positives = 76/76 (100%), Gaps = 0/76 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGG  285
            IQKESTLHLVLRLRGG
Sbjct  213  IQKESTLHLVLRLRGG  228


 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80


 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  228



>ref|XP_004505453.1| PREDICTED: polyubiquitin-A-like [Cicer arietinum]
Length=533

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  341


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  305  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  364

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  365  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  417


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  308


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  340  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  384


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  416  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  460


 Score =   220 bits (560),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  381  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  440

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  441  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  493


 Score = 62.4 bits (150),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 32/43 (74%), Gaps = 1/43 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGM  520
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG+
Sbjct  492  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGL  533


 Score =   155 bits (392),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  457  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  516

Query  238  IQKESTLHLVLRLRGGM  288
            IQKESTLHLVLRLRGG+
Sbjct  517  IQKESTLHLVLRLRGGL  533


 Score = 70.1 bits (170),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80



>gb|AAB95251.1| ubiquitin [Arabidopsis thaliana]
Length=456

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  341


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  308


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  340  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  384


 Score =   220 bits (560),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  305  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  364

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  365  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  417


 Score = 61.6 bits (148),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  416  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  456


 Score =   154 bits (390),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 76/76 (100%), Positives = 76/76 (100%), Gaps = 0/76 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  381  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  440

Query  238  IQKESTLHLVLRLRGG  285
            IQKESTLHLVLRLRGG
Sbjct  441  IQKESTLHLVLRLRGG  456


 Score = 70.1 bits (170),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80



>gb|EYU18102.1| hypothetical protein MIMGU_mgv1a008166mg [Erythranthe guttata]
Length=383

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  308


 Score =   218 bits (555),  Expect(2) = 4e-69, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDT+DNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTVDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score = 70.1 bits (170),  Expect(2) = 4e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score =   220 bits (560),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  341


 Score = 61.6 bits (148),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  340  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  380


 Score =   154 bits (390),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/76 (100%), Positives = 76/76 (100%), Gaps = 0/76 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  305  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  364

Query  238  IQKESTLHLVLRLRGG  285
            IQKESTLHLVLRLRGG
Sbjct  365  IQKESTLHLVLRLRGG  380


 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80



>ref|XP_006428821.1| hypothetical protein CICLE_v10012292mg [Citrus clementina]
 ref|XP_006480633.1| PREDICTED: polyubiquitin-like [Citrus sinensis]
 gb|ESR42061.1| hypothetical protein CICLE_v10012292mg [Citrus clementina]
Length=306

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score =   220 bits (560),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score =   154 bits (390),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 76/76 (100%), Positives = 76/76 (100%), Gaps = 0/76 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGG  285
            IQKESTLHLVLRLRGG
Sbjct  289  IQKESTLHLVLRLRGG  304


 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80


 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  304



>emb|CAA40324.1| hexaubiquitin protein [Helianthus annuus]
 emb|CAA40325.1| hexaubiquitin protein [Helianthus annuus]
Length=457

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  341


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  308


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  340  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  384


 Score =   220 bits (560),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  305  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  364

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  365  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  417


 Score = 61.6 bits (148),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  416  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  456


 Score =   154 bits (390),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 76/76 (100%), Positives = 76/76 (100%), Gaps = 0/76 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  381  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  440

Query  238  IQKESTLHLVLRLRGG  285
            IQKESTLHLVLRLRGG
Sbjct  441  IQKESTLHLVLRLRGG  456


 Score = 70.1 bits (170),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80



>gb|ACX46987.1| ubiquitin [Guzmania wittmackii x Guzmania lingulata]
Length=441

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  341


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  340  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  384


 Score =   218 bits (555),  Expect(2) = 4e-69, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPEQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score = 70.1 bits (170),  Expect(2) = 4e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  308


 Score =   220 bits (560),  Expect(2) = 4e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score = 68.2 bits (165),  Expect(2) = 4e-69, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PP+QQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPEQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score =   220 bits (560),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  305  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  364

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  365  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  417


 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/53 (100%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  216
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  381  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  433


 Score = 70.1 bits (170),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80



>gb|AFP44113.1| ubiquitin, partial [Lycoris longituba]
Length=187

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  4    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  63

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  64   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  116


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  115  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  159


 Score =   207 bits (527),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 105/108 (97%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  80   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  139

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXD  381
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE E SDTIDNVKAKI D
Sbjct  140  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEGSDTIDNVKAKIQD  187


 Score = 77.0 bits (188),  Expect(2) = 7e-27, Method: Compositional matrix adjust.
 Identities = 38/40 (95%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +1

Query  277  RGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            RGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  1    RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  40


 Score = 70.1 bits (170),  Expect(2) = 7e-27, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  39   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  83



>ref|XP_007154496.1| hypothetical protein PHAVU_003G1236001g [Phaseolus vulgaris]
 gb|ESW26490.1| hypothetical protein PHAVU_003G1236001g [Phaseolus vulgaris]
Length=305

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score =   219 bits (557),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE E+SDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVENSDTIDNVKAKIQDKEGIP  189


 Score = 70.1 bits (170),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score =   219 bits (557),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVE+SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVENSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score =   155 bits (392),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGM  288
            IQKESTLHLVLRLRGG+
Sbjct  289  IQKESTLHLVLRLRGGL  305


 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 32/43 (74%), Gaps = 1/43 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGM  520
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG+
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGL  305



>dbj|BAJ85978.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91581.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=305

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score =   219 bits (557),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score = 70.1 bits (170),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score =   220 bits (560),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score =   154 bits (390),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 76/76 (100%), Positives = 76/76 (100%), Gaps = 0/76 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGG  285
            IQKESTLHLVLRLRGG
Sbjct  289  IQKESTLHLVLRLRGG  304


 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80


 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  304



>gb|KDP42860.1| hypothetical protein JCGZ_23802 [Jatropha curcas]
Length=457

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  341


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  308


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  340  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  384


 Score =   220 bits (560),  Expect(2) = 5e-66, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  305  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  364

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  365  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  417


 Score = 57.8 bits (138),  Expect(2) = 5e-66, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 30/42 (71%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PP QQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  416  IPPVQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  456


 Score =   150 bits (380),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP QQRLIFAGKQLEDGRTLADYN
Sbjct  381  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPVQQRLIFAGKQLEDGRTLADYN  440

Query  238  IQKESTLHLVLRLRGGM  288
            IQKESTLHLVLRLRGG 
Sbjct  441  IQKESTLHLVLRLRGGF  457


 Score = 70.1 bits (170),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80



>dbj|BAJ91912.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88496.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=457

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  341


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  308


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  340  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  384


 Score =   220 bits (560),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  305  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  364

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  365  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  417


 Score = 61.6 bits (148),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  416  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  456


 Score =   154 bits (390),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 76/76 (100%), Positives = 76/76 (100%), Gaps = 0/76 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  381  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  440

Query  238  IQKESTLHLVLRLRGG  285
            IQKESTLHLVLRLRGG
Sbjct  441  IQKESTLHLVLRLRGG  456


 Score = 70.1 bits (170),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80



>gb|KJB13592.1| hypothetical protein B456_002G083000 [Gossypium raimondii]
Length=385

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  308


 Score =   220 bits (560),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  341


 Score = 62.0 bits (149),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 33/46 (72%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG ++ 
Sbjct  340  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGFRMV  384


 Score =   155 bits (392),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 76/79 (96%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  305  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  364

Query  238  IQKESTLHLVLRLRGGMQI  294
            IQKESTLHLVLRLRGG ++
Sbjct  365  IQKESTLHLVLRLRGGFRM  383


 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80



>ref|NP_568397.1| ubiquitin 4 [Arabidopsis thaliana]
 ref|XP_002881273.1| hypothetical protein ARALYDRAFT_482268 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_010420904.1| PREDICTED: polyubiquitin 4 [Camelina sativa]
 ref|XP_010493166.1| PREDICTED: polyubiquitin 4 [Camelina sativa]
 sp|P0CH32.1|UBQ4_ARATH RecName: Full=Polyubiquitin 4; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Arabidopsis thaliana]
 emb|CAA31331.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAB53929.1| polyubiquitin [Arabidopsis thaliana]
 gb|EFH57532.1| hypothetical protein ARALYDRAFT_482268 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AED92867.1| ubiquitin 4 [Arabidopsis thaliana]
 prf||1515347A poly-ubiquitin
Length=382

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  308


 Score =   220 bits (560),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  341


 Score = 61.2 bits (147),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  340  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  380


 Score =   154 bits (390),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/76 (100%), Positives = 76/76 (100%), Gaps = 0/76 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  305  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  364

Query  238  IQKESTLHLVLRLRGG  285
            IQKESTLHLVLRLRGG
Sbjct  365  IQKESTLHLVLRLRGG  380


 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80



>ref|XP_004497490.1| PREDICTED: polyubiquitin 4-like [Cicer arietinum]
Length=154

 Score =   220 bits (560),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score =   154 bits (390),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 76/76 (100%), Positives = 76/76 (100%), Gaps = 0/76 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGG  285
            IQKESTLHLVLRLRGG
Sbjct  137  IQKESTLHLVLRLRGG  152


 Score = 69.7 bits (169),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80


 Score = 61.2 bits (147),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  152



>gb|ABK94002.1| unknown [Populus trichocarpa]
Length=305

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score =   216 bits (551),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD N
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADNN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score = 70.1 bits (170),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score =   220 bits (560),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score =   154 bits (390),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGM  288
            IQKESTLHLVLRLRGG 
Sbjct  289  IQKESTLHLVLRLRGGF  305


 Score = 66.2 bits (160),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 34/46 (74%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA  NI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADNNIQKESTLH-LVLRLRGGMQIF  80


 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  304



>ref|XP_002872746.1| hypothetical protein ARALYDRAFT_911794 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_002872769.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49005.1| hypothetical protein ARALYDRAFT_911794 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49028.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=229

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score =   220 bits (560),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score =   150 bits (379),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP DQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPLDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGM  288
            IQKESTLHLVLRLRGG 
Sbjct  213  IQKESTLHLVLRLRGGF  229


 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80


 Score = 57.4 bits (137),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 30/42 (71%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             P DQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  188  IPLDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  228



>ref|XP_004968120.1| PREDICTED: polyubiquitin-like [Setaria italica]
 ref|XP_009404996.1| PREDICTED: polyubiquitin 11 [Musa acuminata subsp. malaccensis]
 gb|ABS18744.1| ubiqutin ligase-like protein [Oryza sativa Japonica Group]
 dbj|BAJ88219.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=229

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score =   220 bits (560),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score =   154 bits (390),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 76/76 (100%), Positives = 76/76 (100%), Gaps = 0/76 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGG  285
            IQKESTLHLVLRLRGG
Sbjct  213  IQKESTLHLVLRLRGG  228


 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80


 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  228



>gb|AFW66442.1| putative ubiquitin family protein, partial [Zea mays]
Length=216

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score =   220 bits (560),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score =   130 bits (326),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKE  249
            IQKE
Sbjct  213  IQKE  216


 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80


 Score = 56.2 bits (134),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKE  478
             PPDQQRLIFAGK LEDGRTLA YNI KE
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKE  216



>dbj|BAK02501.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=457

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  341


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  308


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  340  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  384


 Score =   218 bits (556),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKA+IQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAEIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score = 70.1 bits (170),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score =   220 bits (560),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  305  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  364

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  365  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  417


 Score = 61.6 bits (148),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  416  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  456


 Score =   154 bits (390),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 76/76 (100%), Positives = 76/76 (100%), Gaps = 0/76 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  381  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  440

Query  238  IQKESTLHLVLRLRGG  285
            IQKESTLHLVLRLRGG
Sbjct  441  IQKESTLHLVLRLRGG  456


 Score = 70.1 bits (170),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80



>ref|XP_010270791.1| PREDICTED: polyubiquitin-like [Nelumbo nucifera]
Length=382

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score =   219 bits (558),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKT+TLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIP  265


 Score = 70.1 bits (170),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  308


 Score =   219 bits (558),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKT+TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  341


 Score = 62.0 bits (149),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 32/43 (74%), Gaps = 1/43 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGM  520
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG+
Sbjct  340  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGI  381


 Score =   155 bits (391),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  305  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  364

Query  238  IQKESTLHLVLRLRGGM  288
            IQKESTLHLVLRLRGG+
Sbjct  365  IQKESTLHLVLRLRGGI  381


 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80



>ref|XP_009112898.1| PREDICTED: polyubiquitin [Brassica rapa]
Length=305

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score =   220 bits (560),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score =   155 bits (391),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGM  288
            IQKESTLHLVLRLRGG+
Sbjct  289  IQKESTLHLVLRLRGGI  305


 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80


 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 32/43 (74%), Gaps = 1/43 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGM  520
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG+
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGI  305



>gb|KIK16797.1| hypothetical protein PISMIDRAFT_686019, partial [Pisolithus microcarpus 
441]
Length=124

 Score =   219 bits (558),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEAESSDTIDNVKAKIQDKEGIP  113


 Score = 96.7 bits (239),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 47/48 (98%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  201
            MQIFVKTLTGKTITLE ESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  77   MQIFVKTLTGKTITLEAESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  124


 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTL+ YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLH-LVLRLRGGMQIF  80



>ref|XP_003607670.1| Ubiquitin [Medicago truncatula]
 gb|AES89867.1| polyubiquitin 3 [Medicago truncatula]
Length=533

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  341


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  305  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  364

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  365  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  417


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  308


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  340  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  384


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  416  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  460


 Score =   220 bits (560),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  381  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  440

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  441  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  493


 Score = 61.6 bits (148),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  492  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  532


 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 76/76 (100%), Positives = 76/76 (100%), Gaps = 0/76 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  457  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  516

Query  238  IQKESTLHLVLRLRGG  285
            IQKESTLHLVLRLRGG
Sbjct  517  IQKESTLHLVLRLRGG  532


 Score = 70.1 bits (170),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80



>gb|ABD32351.2| Ubiquitin [Medicago truncatula]
Length=538

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  6    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  65

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  66   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  118


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  82   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  141

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  142  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  194


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  158  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  217

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  218  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  270


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  117  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  161


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  193  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  237


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  269  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  313


 Score =   219 bits (559),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  234  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  293

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  294  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKILDKEGIP  346


 Score = 68.9 bits (167),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTL+ YNI KES      LRL GGMQIF
Sbjct  345  IPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLH-LVLRLRGGMQIF  389


 Score =   215 bits (548),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  310  MQIFVKTLTGKTITLEVESSDTIDNVKAKILDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  369

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  422


 Score = 70.1 bits (170),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  421  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  465


 Score =   220 bits (560),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  386  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  445

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  446  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  498


 Score = 61.6 bits (148),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  497  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  537


 Score =   154 bits (390),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  462  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  521

Query  238  IQKESTLHLVLRLRGGM  288
            IQKESTLHLVLRLRGG 
Sbjct  522  IQKESTLHLVLRLRGGF  538


 Score = 70.1 bits (170),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  41   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  85



>ref|XP_009358096.1| PREDICTED: polyubiquitin isoform X1 [Pyrus x bretschneideri]
 ref|XP_009343084.1| PREDICTED: polyubiquitin isoform X1 [Pyrus x bretschneideri]
Length=401

 Score =   220 bits (561),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  21   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  80

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  81   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  133


 Score =   220 bits (561),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  97   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  156

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  157  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  209


 Score =   220 bits (561),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  173  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  232

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  233  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  285


 Score = 69.7 bits (169),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  132  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  176


 Score = 69.7 bits (169),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  208  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  252


 Score = 69.7 bits (169),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  284  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  328


 Score =   220 bits (561),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  249  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  308

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  309  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  361


 Score = 61.2 bits (147),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  360  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  400


 Score =   155 bits (391),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  325  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  384

Query  238  IQKESTLHLVLRLRGGM  288
            IQKESTLHLVLRLRGG 
Sbjct  385  IQKESTLHLVLRLRGGF  401


 Score = 69.7 bits (169),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  56   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  100



>ref|NP_001148453.1| LOC100282068 [Zea mays]
 ref|XP_002299930.1| UBIQUITIN 11 family protein [Populus trichocarpa]
 ref|XP_003607671.1| Ubiquitin [Medicago truncatula]
 gb|AAC49014.1| ubiquitin [Zea mays]
 gb|ACG31521.1| polyubiquitin containing 7 ubiquitin monomers [Zea mays]
 gb|EEE84735.1| UBIQUITIN 11 family protein [Populus trichocarpa]
 gb|ACR37911.1| unknown [Zea mays]
 gb|AES89868.1| polyubiquitin 3 [Medicago truncatula]
 gb|AFW66440.1| putative ubiquitin family protein isoform 1 [Zea mays]
 gb|AFW66441.1| putative ubiquitin family protein isoform 2 [Zea mays]
Length=381

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  308


 Score =   220 bits (560),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  341


 Score = 61.6 bits (148),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  340  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  380


 Score =   154 bits (390),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/76 (100%), Positives = 76/76 (100%), Gaps = 0/76 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  305  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  364

Query  238  IQKESTLHLVLRLRGG  285
            IQKESTLHLVLRLRGG
Sbjct  365  IQKESTLHLVLRLRGG  380


 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80



>sp|Q58G87.2|UBQ3_ORYSJ RecName: Full=Polyubiquitin 3; Contains: RecName: Full=Ubiquitin-related; 
Contains: RecName: Full=Ubiquitin; Flags: Precursor 
[Oryza sativa Japonica Group]
 emb|CAE04243.3| OSJNBa0089N06.4 [Oryza sativa Japonica Group]
 gb|EAZ32071.1| hypothetical protein OsJ_16259 [Oryza sativa Japonica Group]
Length=381

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  308


 Score =   217 bits (553),  Expect(2) = 7e-69, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVE SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVEFSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score = 70.1 bits (170),  Expect(2) = 7e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score =   220 bits (560),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  341


 Score = 62.4 bits (150),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 32/43 (74%), Gaps = 1/43 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGM  520
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG+
Sbjct  340  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGL  381


 Score =   155 bits (392),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  305  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  364

Query  238  IQKESTLHLVLRLRGGM  288
            IQKESTLHLVLRLRGG+
Sbjct  365  IQKESTLHLVLRLRGGL  381


 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80



>gb|ABU40645.1| polyubiquitin [Triticum aestivum]
Length=380

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  308


 Score =   220 bits (560),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  341


 Score = 61.6 bits (148),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  340  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  380


 Score =   154 bits (390),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/76 (100%), Positives = 76/76 (100%), Gaps = 0/76 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  305  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  364

Query  238  IQKESTLHLVLRLRGG  285
            IQKESTLHLVLRLRGG
Sbjct  365  IQKESTLHLVLRLRGG  380


 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80



>ref|XP_006377830.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|ERP55627.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
Length=297

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score =   220 bits (560),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score =   130 bits (328),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 64/66 (97%), Positives = 65/66 (98%), Gaps = 0/66 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKEST  255
            IQKE+ 
Sbjct  289  IQKENA  294


 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80


 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/30 (83%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKES  481
             PPDQQRLIFAGK LEDGRTLA YNI KE+
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKEN  293



>gb|AET06143.1| ubiquitin [Papaver somniferum]
Length=229

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score =   220 bits (560),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score =   154 bits (390),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 76/76 (100%), Positives = 76/76 (100%), Gaps = 0/76 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGG  285
            IQKESTLHLVLRLRGG
Sbjct  213  IQKESTLHLVLRLRGG  228


 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80


 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  228



>ref|XP_008244357.1| PREDICTED: polyubiquitin isoform X1 [Prunus mume]
 ref|XP_008244358.1| PREDICTED: polyubiquitin isoform X1 [Prunus mume]
 ref|XP_008244359.1| PREDICTED: polyubiquitin isoform X1 [Prunus mume]
Length=466

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  238  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  297

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  298  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  350


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  349  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  393


 Score =   216 bits (549),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLV RLRGG+QIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVRRLRGGLQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score = 69.3 bits (168),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 36/49 (73%), Gaps = 1/49 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIFGEN  538
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG+QIF E 
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGVQIFEET  159


 Score =   220 bits (560),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  314  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  373

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  374  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  426


 Score = 61.6 bits (148),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  425  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  465


 Score =   211 bits (536),  Expect(2) = 6e-67, Method: Compositional matrix adjust.
 Identities = 107/114 (94%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = +1

Query  55   KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  234
            + QIF KT TG TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  161  QTQIFEKTHTGNTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  220

Query  235  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  221  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  274


 Score = 70.1 bits (170),  Expect(2) = 6e-67, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  273  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  317


 Score =   202 bits (513),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 106/122 (87%), Positives = 108/122 (89%), Gaps = 9/122 (7%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            +QIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   LQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGM---------QIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEG  390
            IQKESTLHLVLRLRGG+         QIF KT TG TITLE ESSDTIDNVKAKI DKEG
Sbjct  137  IQKESTLHLVLRLRGGVQIFEETHQTQIFEKTHTGNTITLEVESSDTIDNVKAKIQDKEG  196

Query  391  IP  396
            IP
Sbjct  197  IP  198


 Score = 70.1 bits (170),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  197  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  241


 Score =   154 bits (390),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  390  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  449

Query  238  IQKESTLHLVLRLRGGM  288
            IQKESTLHLVLRLRGG 
Sbjct  450  IQKESTLHLVLRLRGGF  466


 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 34/46 (74%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES       RL GG+QIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVR-RLRGGLQIF  80



>ref|XP_010423744.1| PREDICTED: polyubiquitin [Camelina sativa]
Length=458

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  341


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  308


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  340  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  384


 Score =   220 bits (560),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  305  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  364

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  365  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  417


 Score = 61.6 bits (148),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  416  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  456


 Score =   154 bits (390),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 76/76 (100%), Positives = 76/76 (100%), Gaps = 0/76 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  381  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  440

Query  238  IQKESTLHLVLRLRGG  285
            IQKESTLHLVLRLRGG
Sbjct  441  IQKESTLHLVLRLRGG  456


 Score = 70.1 bits (170),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80



>gb|ACN40936.1| unknown [Picea sitchensis]
Length=458

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  341


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  308


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  340  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  384


 Score =   218 bits (555),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score = 70.1 bits (170),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score =   220 bits (560),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  305  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  364

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  365  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  417


 Score = 61.6 bits (148),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  416  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  456


 Score =   154 bits (390),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 76/76 (100%), Positives = 76/76 (100%), Gaps = 0/76 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  381  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  440

Query  238  IQKESTLHLVLRLRGG  285
            IQKESTLHLVLRLRGG
Sbjct  441  IQKESTLHLVLRLRGG  456


 Score = 70.1 bits (170),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80



>ref|XP_006428816.1| hypothetical protein CICLE_v10011684mg [Citrus clementina]
 gb|ESR42056.1| hypothetical protein CICLE_v10011684mg [Citrus clementina]
Length=382

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  308


 Score =   220 bits (560),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  341


 Score = 61.6 bits (148),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  340  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  380


 Score =   154 bits (390),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/76 (100%), Positives = 76/76 (100%), Gaps = 0/76 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  305  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  364

Query  238  IQKESTLHLVLRLRGG  285
            IQKESTLHLVLRLRGG
Sbjct  365  IQKESTLHLVLRLRGG  380


 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80



>gb|AAQ07453.1| ubiquitin [Musa acuminata AAA Group]
Length=381

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score =   218 bits (555),  Expect(2) = 4e-69, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITL+ ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLKVESSDTIDNVKAKIQDKEGIP  265


 Score = 70.1 bits (170),  Expect(2) = 4e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  308


 Score =   218 bits (555),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITL+VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLKVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  341


 Score = 61.6 bits (148),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  340  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  380


 Score =   154 bits (390),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 76/76 (100%), Positives = 76/76 (100%), Gaps = 0/76 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  305  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  364

Query  238  IQKESTLHLVLRLRGG  285
            IQKESTLHLVLRLRGG
Sbjct  365  IQKESTLHLVLRLRGG  380


 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80



>ref|XP_010490793.1| PREDICTED: polyubiquitin 11-like [Camelina sativa]
Length=230

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score =   220 bits (560),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score =   154 bits (390),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 76/76 (100%), Positives = 76/76 (100%), Gaps = 0/76 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGG  285
            IQKESTLHLVLRLRGG
Sbjct  213  IQKESTLHLVLRLRGG  228


 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80


 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  228



>ref|XP_002508175.1| ubiquitin [Micromonas sp. RCC299]
 ref|XP_003061956.1| ubiquitin [Micromonas pusilla CCMP1545]
 gb|EEH53668.1| ubiquitin [Micromonas pusilla CCMP1545]
 gb|ACO69433.1| ubiquitin [Micromonas sp. RCC299]
 gb|KEH20642.1| polyubiquitin 3 [Medicago truncatula]
Length=381

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  308


 Score =   220 bits (560),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  341


 Score = 61.6 bits (148),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  340  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  380


 Score =   154 bits (390),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 76/76 (100%), Positives = 76/76 (100%), Gaps = 0/76 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  305  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  364

Query  238  IQKESTLHLVLRLRGG  285
            IQKESTLHLVLRLRGG
Sbjct  365  IQKESTLHLVLRLRGG  380


 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80



>ref|XP_002873083.1| hypothetical protein ARALYDRAFT_487095 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49342.1| hypothetical protein ARALYDRAFT_487095 [Arabidopsis lyrata subsp. 
lyrata]
Length=306

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score =   218 bits (555),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLTDYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score = 70.1 bits (170),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score =   220 bits (560),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score =   154 bits (390),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 76/76 (100%), Positives = 76/76 (100%), Gaps = 0/76 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGG  285
            IQKESTLHLVLRLRGG
Sbjct  289  IQKESTLHLVLRLRGG  304


 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 34/46 (74%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTL  YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLTDYNIQKESTLH-LVLRLRGGMQIF  80


 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  304



>gb|EYU33610.1| hypothetical protein MIMGU_mgv1a004315mg [Erythranthe guttata]
Length=229

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score =   220 bits (560),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score =   154 bits (390),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGM  288
            IQKESTLHLVLRLRGG+
Sbjct  213  IQKESTLHLVLRLRGGV  229


 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80


 Score = 62.0 bits (149),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 32/43 (74%), Gaps = 1/43 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGM  520
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG+
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGV  229



>dbj|BAC57955.1| polyubiquitin [Aster tripolium]
Length=229

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score =   220 bits (560),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score =   155 bits (392),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGM  288
            IQKESTLHLVLRLRGG+
Sbjct  213  IQKESTLHLVLRLRGGL  229


 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80


 Score = 62.4 bits (150),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 32/43 (74%), Gaps = 1/43 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGM  520
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG+
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGL  229



>ref|XP_010553005.1| PREDICTED: polyubiquitin-like [Tarenaya hassleriana]
Length=534

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  341


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  305  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  364

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  365  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  417


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  308


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  340  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  384


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  416  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  460


 Score =   220 bits (560),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  381  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  440

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  441  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  493


 Score = 61.6 bits (148),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  492  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  532


 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 76/76 (100%), Positives = 76/76 (100%), Gaps = 0/76 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  457  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  516

Query  238  IQKESTLHLVLRLRGG  285
            IQKESTLHLVLRLRGG
Sbjct  517  IQKESTLHLVLRLRGG  532


 Score = 70.1 bits (170),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80



>ref|XP_006350990.1| PREDICTED: polyubiquitin-A-like [Solanum tuberosum]
Length=534

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  341


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  305  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  364

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  365  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  417


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  308


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  340  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  384


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  416  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  460


 Score =   220 bits (560),  Expect(2) = 5e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  381  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  440

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  441  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  493


 Score = 61.6 bits (148),  Expect(2) = 5e-67, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  492  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  532


 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 76/76 (100%), Positives = 76/76 (100%), Gaps = 0/76 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  457  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  516

Query  238  IQKESTLHLVLRLRGG  285
            IQKESTLHLVLRLRGG
Sbjct  517  IQKESTLHLVLRLRGG  532


 Score = 70.1 bits (170),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80



>ref|XP_006428820.1| hypothetical protein CICLE_v10012290mg [Citrus clementina]
 gb|ESR42060.1| hypothetical protein CICLE_v10012290mg [Citrus clementina]
Length=306

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score =   217 bits (553),  Expect(2) = 7e-69, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQ KEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQHKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score = 70.1 bits (170),  Expect(2) = 7e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score =   220 bits (560),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score =   154 bits (390),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 76/76 (100%), Positives = 76/76 (100%), Gaps = 0/76 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGG  285
            IQKESTLHLVLRLRGG
Sbjct  289  IQKESTLHLVLRLRGG  304


 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80


 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  304



>gb|KHN45015.1| Polyubiquitin-A [Glycine soja]
Length=611

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  307  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  366

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  367  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  419


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  383  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  442

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  443  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  495


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  418  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  462


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  494  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  538


 Score =   216 bits (549),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 109/115 (95%), Positives = 112/115 (97%), Gaps = 0/115 (0%)
 Frame = +1

Query  52   LKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  231
            +++ IFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  229  MQIFIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  288

Query  232  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  289  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  343


 Score = 70.1 bits (170),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  342  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  386


 Score =   215 bits (547),  Expect(2) = 4e-68, Method: Compositional matrix adjust.
 Identities = 111/115 (97%), Positives = 111/115 (97%), Gaps = 2/115 (2%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQ--IFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQ  IFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  267


 Score = 70.1 bits (170),  Expect(2) = 4e-68, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  266  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  310


 Score =   220 bits (560),  Expect(2) = 5e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  459  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  518

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  519  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  571


 Score = 61.6 bits (148),  Expect(2) = 5e-67, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  570  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  610


 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  594

Query  238  IQKESTLHLVLRLRGGM  288
            IQKESTLHLVLRLRGG 
Sbjct  595  IQKESTLHLVLRLRGGF  611


 Score = 70.1 bits (170),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80



>ref|XP_009620669.1| PREDICTED: polyubiquitin-like [Nicotiana tomentosiformis]
 ref|XP_010419864.1| PREDICTED: polyubiquitin-like [Camelina sativa]
 gb|EYU33613.1| hypothetical protein MIMGU_mgv1a003085mg [Erythranthe guttata]
 dbj|BAP28175.1| polyubiquitin 10 [Fagus crenata]
Length=609

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  341


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  305  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  364

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  365  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  417


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  381  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  440

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  441  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  493


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  308


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  340  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  384


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  416  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  460


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  492  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  536


 Score =   220 bits (560),  Expect(2) = 5e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  457  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  516

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  517  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  569


 Score = 61.6 bits (148),  Expect(2) = 5e-67, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  568  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  608


 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  533  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  592

Query  238  IQKESTLHLVLRLRGGM  288
            IQKESTLHLVLRLRGG 
Sbjct  593  IQKESTLHLVLRLRGGF  609


 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80



>ref|XP_011094250.1| PREDICTED: polyubiquitin-like [Sesamum indicum]
Length=458

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  341


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  308


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  340  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  384


 Score =   220 bits (560),  Expect(2) = 5e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  305  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  364

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  365  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  417


 Score = 61.6 bits (148),  Expect(2) = 5e-67, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  416  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  456


 Score =   154 bits (390),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 76/76 (100%), Positives = 76/76 (100%), Gaps = 0/76 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  381  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  440

Query  238  IQKESTLHLVLRLRGG  285
            IQKESTLHLVLRLRGG
Sbjct  441  IQKESTLHLVLRLRGG  456


 Score = 70.1 bits (170),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80



>ref|XP_011094650.1| PREDICTED: polyubiquitin [Sesamum indicum]
 sp|P0CH04.1|UBI1P_PETCR RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Petroselinum crispum]
 sp|P0CH05.1|UBI2P_PETCR RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Petroselinum crispum]
 emb|CAA45621.1| polyubiquitin [Petroselinum crispum]
 emb|CAA45622.1| polyubiquitin [Petroselinum crispum]
Length=458

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  341


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  308


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  340  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  384


 Score =   220 bits (560),  Expect(2) = 5e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  305  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  364

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  365  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  417


 Score = 61.6 bits (148),  Expect(2) = 5e-67, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  416  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  456


 Score =   154 bits (390),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 76/76 (100%), Positives = 76/76 (100%), Gaps = 0/76 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  381  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  440

Query  238  IQKESTLHLVLRLRGG  285
            IQKESTLHLVLRLRGG
Sbjct  441  IQKESTLHLVLRLRGG  456


 Score = 70.1 bits (170),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80



>gb|AAC16012.1| polyubiquitin [Elaeagnus umbellata]
Length=458

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  308


 Score =   216 bits (549),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ES DTIDNVKA+I DKEGIP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESLDTIDNVKAQIQDKEGIP  341


 Score = 70.1 bits (170),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  340  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  384


 Score =   216 bits (549),  Expect(2) = 8e-66, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVES DTIDNVKA+IQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  305  MQIFVKTLTGKTITLEVESLDTIDNVKAQIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  364

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  365  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  417


 Score = 61.6 bits (148),  Expect(2) = 8e-66, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  416  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  456


 Score =   154 bits (390),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 76/76 (100%), Positives = 76/76 (100%), Gaps = 0/76 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  381  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  440

Query  238  IQKESTLHLVLRLRGG  285
            IQKESTLHLVLRLRGG
Sbjct  441  IQKESTLHLVLRLRGG  456


 Score = 70.1 bits (170),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80



>gb|AAX40652.1| polyubiquitin [Oryza sativa Japonica Group]
Length=381

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score =   220 bits (560),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score = 69.3 bits (168),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRL+FAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  264  IPPDQQRLVFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  308


 Score =   217 bits (553),  Expect(2) = 8e-69, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVE SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVEFSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score = 70.1 bits (170),  Expect(2) = 8e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score =   219 bits (559),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL+FAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLVFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  341


 Score = 62.4 bits (150),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 32/43 (74%), Gaps = 1/43 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGM  520
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG+
Sbjct  340  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGL  381


 Score =   155 bits (392),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  305  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  364

Query  238  IQKESTLHLVLRLRGGM  288
            IQKESTLHLVLRLRGG+
Sbjct  365  IQKESTLHLVLRLRGGL  381


 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80



>sp|P69315.2|UBIQP_LINUS RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Contains: RecName: Full=Ubiquitin-related; Flags: Precursor, 
partial [Linum usitatissimum]
 gb|AAA33401.1| ubiquitin, partial [Linum usitatissimum]
Length=305

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  118  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  177

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  178  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  230


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  229  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  273


 Score =   218 bits (556),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIF+KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  42   MQIFLKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  101

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  102  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  154


 Score = 70.1 bits (170),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  153  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  197


 Score =   216 bits (551),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 110/112 (98%), Positives = 110/112 (98%), Gaps = 0/112 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  194  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  253

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGI  393
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGI
Sbjct  254  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  305


 Score =   154 bits (388),  Expect(2) = 8e-50, Method: Compositional matrix adjust.
 Identities = 75/78 (96%), Positives = 76/78 (97%), Gaps = 0/78 (0%)
 Frame = +1

Query  163  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXES  342
            IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF+KTLTGKTITLE ES
Sbjct  1    IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFLKTLTGKTITLEVES  60

Query  343  SDTIDNVKAKIXDKEGIP  396
            SDTIDNVKAKI DKEGIP
Sbjct  61   SDTIDNVKAKIQDKEGIP  78


 Score = 70.1 bits (170),  Expect(2) = 8e-50, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  77   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  121


 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  1    IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  45



>ref|XP_004505084.1| PREDICTED: polyubiquitin-A-like [Cicer arietinum]
Length=692

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  265


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  341


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  305  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  364

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  365  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  417


 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  464  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  523

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  524  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  576


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  232


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  308


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  340  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  384


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  423  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  467


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  575  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  619


 Score =   213 bits (542),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 111/120 (93%), Gaps = 7/120 (6%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ-------RLIFAGKQLEDG  216
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ       RLIFAGKQLEDG
Sbjct  381  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQSIPPDQQRLIFAGKQLEDG  440

Query  217  RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  441  RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  500


 Score = 70.1 bits (170),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  499  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  543


 Score =   220 bits (560),  Expect(2) = 5e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  540  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  599

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  600  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  652


 Score = 61.6 bits (148),  Expect(2) = 5e-67, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  651  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  691


 Score =   154 bits (390),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  616  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  675

Query  238  IQKESTLHLVLRLRGGM  288
            IQKESTLHLVLRLRGG 
Sbjct  676  IQKESTLHLVLRLRGGF  692


 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80



>ref|XP_006495477.1| PREDICTED: polyubiquitin 3-like, partial [Citrus sinensis]
Length=164

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score =   177 bits (448),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/88 (100%), Positives = 88/88 (100%), Gaps = 0/88 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKT  321
            IQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKT  164


 Score = 70.1 bits (170),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  80



>gb|AAO43307.1| putative polyubiquitin [Arabidopsis thaliana]
Length=250

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  21   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  80

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  81   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  133


 Score = 69.7 bits (169),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  132  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  176


 Score =   220 bits (560),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  97   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  156

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  157  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  209


 Score =   154 bits (390),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 76/76 (100%), Positives = 76/76 (100%), Gaps = 0/76 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  173  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  232

Query  238  IQKESTLHLVLRLRGG  285
            IQKESTLHLVLRLRGG
Sbjct  233  IQKESTLHLVLRLRGG  248


 Score =   111 bits (277),  Expect(2) = 5e-37, Method: Compositional matrix adjust.
 Identities = 55/57 (96%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +1

Query  226  ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  1    ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  57


 Score = 69.7 bits (169),  Expect(2) = 5e-37, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  56   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  100


 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGG  517
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GG
Sbjct  208  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGG  248



>gb|ACJ85618.1| unknown [Medicago truncatula]
Length=229

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEXESSDTIDNVKAKIXDKEGIP  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVKAKI DKEGIP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  113


 Score = 70.1 bits (170),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  FPPDQQRLIFAGKXLEDGRTLAXYNIXKESNXSTWGLRLXGGMQIF  529
             PPDQQRLIFAGK LEDGRTLA YNI KES      LRL GGMQIF
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH-LVLRLRGGMQIF  156


 Score =   220 bits (560),  Expect = 1e-68, Method: Compositional matrix adjust.