BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002E18

Length=526
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_007215964.1|  hypothetical protein PRUPE_ppa011439mg             223   5e-70   
ref|XP_008387435.1|  PREDICTED: hexokinase-2-like                       224   2e-69   
ref|XP_009338735.1|  PREDICTED: hexokinase-1-like isoform X2            226   5e-69   Pyrus x bretschneideri [bai li]
ref|XP_009338734.1|  PREDICTED: hexokinase-1-like isoform X1            227   2e-68   Pyrus x bretschneideri [bai li]
ref|XP_008228416.1|  PREDICTED: hexokinase-1-like                       226   7e-68   Prunus mume [ume]
gb|ACJ04704.1|  hexokinase 1                                            225   2e-67   Cucumis melo [Oriental melon]
ref|XP_008458873.1|  PREDICTED: hexokinase-1-like isoform X3            225   2e-67   Cucumis melo [Oriental melon]
ref|XP_008387327.1|  PREDICTED: hexokinase-1-like                       224   2e-67   
ref|XP_008458856.1|  PREDICTED: hexokinase-1-like isoform X2            225   2e-67   
ref|XP_004141023.1|  PREDICTED: hexokinase-1-like                       224   5e-67   
ref|XP_008458849.1|  PREDICTED: hexokinase-1-like isoform X1            225   7e-67   Cucumis melo [Oriental melon]
gb|KCW82327.1|  hypothetical protein EUGRSUZ_C03728                     218   2e-66   Eucalyptus grandis [rose gum]
ref|XP_002283608.1|  PREDICTED: hexokinase-1-like                       222   2e-66   Vitis vinifera
gb|KCW82328.1|  hypothetical protein EUGRSUZ_C03728                     218   2e-66   Eucalyptus grandis [rose gum]
emb|CAN83149.1|  hypothetical protein VITISV_024177                     222   3e-66   Vitis vinifera
ref|XP_009352555.1|  PREDICTED: hexokinase-1                            221   3e-66   Pyrus x bretschneideri [bai li]
ref|XP_010915190.1|  PREDICTED: hexokinase-2-like                       221   5e-66   Elaeis guineensis
ref|XP_008242483.1|  PREDICTED: hexokinase-1                            221   6e-66   Prunus mume [ume]
gb|KDO66593.1|  hypothetical protein CISIN_1g010895mg                   215   7e-66   Citrus sinensis [apfelsine]
gb|AFO84084.1|  hexokinase                                              221   8e-66   Actinidia deliciosa [Chinese gooseberry]
gb|ADZ96378.1|  hexokinase 1                                            220   1e-65   Eriobotrya japonica [loquat]
gb|KCW82326.1|  hypothetical protein EUGRSUZ_C03728                     218   1e-65   Eucalyptus grandis [rose gum]
ref|XP_008380854.1|  PREDICTED: hexokinase-1-like isoform X2            217   2e-65   Malus domestica [apple tree]
ref|XP_007203872.1|  hypothetical protein PRUPE_ppa004637mg             219   3e-65   Prunus persica
gb|AID50967.1|  hexokinase 1                                            219   3e-65   Malus domestica [apple tree]
ref|XP_008337603.1|  PREDICTED: hexokinase-1-like                       219   4e-65   
ref|XP_006451308.1|  hypothetical protein CICLE_v10008086mg             214   4e-65   
ref|XP_010049611.1|  PREDICTED: hexokinase-1-like                       219   5e-65   Eucalyptus grandis [rose gum]
gb|KDO66588.1|  hypothetical protein CISIN_1g010895mg                   214   8e-65   Citrus sinensis [apfelsine]
ref|XP_007013021.1|  Hexokinase 1 isoform 2                             218   9e-65   Theobroma cacao [chocolate]
ref|XP_003516735.1|  PREDICTED: hexokinase-1-like                       218   1e-64   Glycine max [soybeans]
gb|AEJ95926.1|  HXK1                                                    217   1e-64   Vitis vinifera
ref|XP_010249484.1|  PREDICTED: hexokinase-1                            217   1e-64   Nelumbo nucifera [Indian lotus]
gb|KHN40379.1|  Hexokinase-2                                            217   1e-64   Glycine soja [wild soybean]
ref|XP_003516783.1|  PREDICTED: hexokinase-1-like                       217   2e-64   Glycine max [soybeans]
gb|KDP33801.1|  hypothetical protein JCGZ_07372                         217   2e-64   Jatropha curcas
emb|CDP03250.1|  unnamed protein product                                217   2e-64   Coffea canephora [robusta coffee]
ref|NP_001280783.1|  uncharacterized protein LOC103443741               216   3e-64   Malus domestica [apple tree]
ref|XP_006451309.1|  hypothetical protein CICLE_v10008086mg             214   3e-64   
gb|KDO66582.1|  hypothetical protein CISIN_1g010895mg                   215   5e-64   Citrus sinensis [apfelsine]
gb|KDO66587.1|  hypothetical protein CISIN_1g010895mg                   214   5e-64   Citrus sinensis [apfelsine]
ref|XP_007152969.1|  hypothetical protein PHAVU_004G175500g             215   8e-64   Phaseolus vulgaris [French bean]
gb|AHY84731.1|  hexokinase                                              215   9e-64   Manihot esculenta [manioc]
ref|XP_002514221.1|  hexokinase, putative                               215   1e-63   Ricinus communis
ref|NP_001275786.1|  hexokinase                                         215   1e-63   Citrus sinensis [apfelsine]
ref|XP_011093636.1|  PREDICTED: hexokinase-1                            214   2e-63   Sesamum indicum [beniseed]
gb|AAS60194.1|  hexokinase 3                                            214   2e-63   Nicotiana tabacum [American tobacco]
ref|XP_009777315.1|  PREDICTED: hexokinase-2                            214   3e-63   Nicotiana sylvestris
ref|XP_009406171.1|  PREDICTED: hexokinase-2-like                       214   3e-63   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN40378.1|  Hexokinase-1                                            213   3e-63   Glycine soja [wild soybean]
ref|XP_010110881.1|  hypothetical protein L484_006996                   210   5e-63   Morus notabilis
ref|XP_010098150.1|  hypothetical protein L484_026284                   213   6e-63   Morus notabilis
ref|XP_010267128.1|  PREDICTED: hexokinase-1-like                       213   8e-63   Nelumbo nucifera [Indian lotus]
ref|XP_009392524.1|  PREDICTED: hexokinase-2-like                       213   9e-63   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004302852.1|  PREDICTED: hexokinase-1-like                       212   1e-62   Fragaria vesca subsp. vesca
ref|XP_011008120.1|  PREDICTED: hexokinase-1-like                       212   1e-62   Populus euphratica
ref|XP_010688341.1|  PREDICTED: hexokinase-1                            212   1e-62   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002325031.1|  Hexokinase 1 family protein                        212   1e-62   Populus trichocarpa [western balsam poplar]
ref|XP_004287480.1|  PREDICTED: hexokinase-1                            212   2e-62   Fragaria vesca subsp. vesca
gb|AAT77511.1|  hexokinase                                              209   2e-62   Nicotiana sylvestris
ref|XP_009622660.1|  PREDICTED: hexokinase-2                            212   2e-62   Nicotiana tomentosiformis
gb|KJB83118.1|  hypothetical protein B456_013G230400                    208   2e-62   Gossypium raimondii
ref|XP_011014418.1|  PREDICTED: hexokinase-1-like                       211   2e-62   Populus euphratica
ref|XP_009795017.1|  PREDICTED: hexokinase-2-like                       211   4e-62   Nicotiana sylvestris
ref|XP_008795842.1|  PREDICTED: hexokinase-2-like isoform X2            211   4e-62   Phoenix dactylifera
ref|XP_009415191.1|  PREDICTED: hexokinase-2-like                       211   4e-62   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAS60195.1|  hexokinase 4a                                           211   4e-62   Nicotiana tabacum [American tobacco]
ref|XP_008795834.1|  PREDICTED: hexokinase-2-like isoform X1            211   4e-62   Phoenix dactylifera
ref|XP_009601881.1|  PREDICTED: hexokinase-2-like                       211   5e-62   Nicotiana tomentosiformis
gb|AHG98487.1|  hexokinase                                              210   6e-62   Dimocarpus longan [longan]
gb|AAS60196.1|  hexokinase 4b                                           210   8e-62   Nicotiana tabacum [American tobacco]
ref|XP_003529000.1|  PREDICTED: hexokinase-1-like                       210   1e-61   Glycine max [soybeans]
ref|XP_011000949.1|  PREDICTED: hexokinase-1-like                       209   2e-61   Populus euphratica
ref|XP_004503491.1|  PREDICTED: hexokinase-1-like isoform X2            209   2e-61   Cicer arietinum [garbanzo]
ref|XP_002299739.1|  hypothetical protein POPTR_0001s19130g             209   2e-61   Populus trichocarpa [western balsam poplar]
gb|KHG25517.1|  Hexokinase-1 -like protein                              209   2e-61   Gossypium arboreum [tree cotton]
ref|XP_009803252.1|  PREDICTED: hexokinase-1                            209   2e-61   Nicotiana sylvestris
gb|KJB83117.1|  hypothetical protein B456_013G230400                    209   2e-61   Gossypium raimondii
ref|XP_009606563.1|  PREDICTED: hexokinase-1                            209   2e-61   Nicotiana tomentosiformis
sp|Q9SEK2.1|HXK1_TOBAC  RecName: Full=Hexokinase-1; AltName: Full...    209   2e-61   Nicotiana tabacum [American tobacco]
gb|EYU45835.1|  hypothetical protein MIMGU_mgv1a005054mg                209   3e-61   Erythranthe guttata [common monkey flower]
gb|AHB32106.1|  hexokinase                                              209   3e-61   Camellia sinensis [black tea]
gb|AHD25654.1|  hexokinase 1                                            208   3e-61   Camellia sinensis [black tea]
gb|KEH21333.1|  hexokinase                                              205   3e-61   Medicago truncatula
gb|KHG22031.1|  Hexokinase-1                                            209   5e-61   Gossypium arboreum [tree cotton]
ref|XP_010924444.1|  PREDICTED: hexokinase-2-like isoform X2            208   5e-61   Elaeis guineensis
gb|KJB65034.1|  hypothetical protein B456_010G077400                    207   7e-61   Gossypium raimondii
ref|XP_010924442.1|  PREDICTED: hexokinase-2-like isoform X1            208   9e-61   Elaeis guineensis
emb|CDO97969.1|  unnamed protein product                                207   1e-60   Coffea canephora [robusta coffee]
ref|XP_003525287.1|  PREDICTED: hexokinase-1-like                       207   1e-60   Glycine max [soybeans]
ref|XP_003530493.1|  PREDICTED: hexokinase-1-like                       207   1e-60   Glycine max [soybeans]
gb|AAT77513.1|  hexokinase 3                                            207   1e-60   Nicotiana sylvestris
gb|ABA01010.1|  hexokinase                                              207   1e-60   Solanum chacoense
ref|NP_001274841.1|  hexokinase-2                                       207   1e-60   Solanum tuberosum [potatoes]
gb|AAP40021.1|  hexokinase                                              206   2e-60   Nicotiana benthamiana
ref|XP_007024321.1|  Hexokinase 2                                       206   3e-60   
sp|Q9SEK3.1|HXK1_SPIOL  RecName: Full=Hexokinase-1; AltName: Full...    206   3e-60   Spinacia oleracea
gb|AET05183.2|  hexokinase                                              205   5e-60   Medicago truncatula
ref|XP_006353497.1|  PREDICTED: hexokinase-1-like isoform X2            204   8e-60   Solanum tuberosum [potatoes]
ref|NP_001234406.1|  hexokinase                                         205   8e-60   
ref|XP_010322313.1|  PREDICTED: hexokinase isoform X1                   204   9e-60   Solanum lycopersicum
ref|XP_007160283.1|  hypothetical protein PHAVU_002G308400g             204   1e-59   Phaseolus vulgaris [French bean]
gb|AIX02984.1|  hexokinase                                              204   1e-59   Morella rubra [Chinese arbutus]
gb|AAS60197.1|  hexokinase 5                                            204   2e-59   Nicotiana tabacum [American tobacco]
ref|XP_006353496.1|  PREDICTED: hexokinase-1-like isoform X1            204   2e-59   Solanum tuberosum [potatoes]
gb|EPS70676.1|  hexokinase 1a                                           204   2e-59   Genlisea aurea
ref|XP_007013020.1|  Hexokinase 1 isoform 1                             204   2e-59   
ref|XP_003630707.1|  Hexokinase                                         206   2e-59   
ref|XP_004510315.1|  PREDICTED: hexokinase-1-like                       203   3e-59   Cicer arietinum [garbanzo]
ref|XP_010540986.1|  PREDICTED: hexokinase-1-like                       203   4e-59   Tarenaya hassleriana [spider flower]
gb|ABI18156.1|  hexokinase                                              202   6e-59   Helianthus annuus
gb|AHY84734.1|  hexokinase                                              202   1e-58   Manihot esculenta [manioc]
gb|AFO84083.1|  hexokinase                                              201   1e-58   Actinidia chinensis
gb|AAT77514.1|  hexokinase 4                                            198   2e-58   Nicotiana sylvestris
gb|KJB56835.1|  hypothetical protein B456_009G137700                    201   2e-58   Gossypium raimondii
gb|EYU21451.1|  hypothetical protein MIMGU_mgv1a005070mg                201   2e-58   Erythranthe guttata [common monkey flower]
ref|XP_006299465.1|  hypothetical protein CARUB_v10015630mg             201   3e-58   Capsella rubella
ref|XP_006408903.1|  hypothetical protein EUTSA_v10001968mg             201   3e-58   Eutrema salsugineum [saltwater cress]
ref|XP_010526433.1|  PREDICTED: hexokinase-1                            201   3e-58   Tarenaya hassleriana [spider flower]
ref|NP_001234710.1|  hexokinase                                         201   4e-58   Solanum lycopersicum
ref|XP_002515958.1|  hexokinase, putative                               200   4e-58   Ricinus communis
ref|XP_010915379.1|  PREDICTED: hexokinase-2-like                       201   4e-58   Elaeis guineensis
gb|KJB70380.1|  hypothetical protein B456_011G070700                    200   4e-58   Gossypium raimondii
gb|KHG28915.1|  Hexokinase-1                                            200   4e-58   Gossypium arboreum [tree cotton]
ref|XP_007013022.1|  Hexokinase 2 isoform 3                             199   5e-58   
ref|XP_002867423.1|  ATHXK1                                             200   5e-58   Arabidopsis lyrata subsp. lyrata
ref|NP_194642.1|  hexokinase 1                                          200   5e-58   Arabidopsis thaliana [mouse-ear cress]
gb|KDO51805.1|  hypothetical protein CISIN_1g0115051mg                  191   6e-58   Citrus sinensis [apfelsine]
ref|XP_006285258.1|  hypothetical protein CARUB_v10006629mg             199   7e-58   Capsella rubella
ref|XP_010489125.1|  PREDICTED: hexokinase-2-like                       200   7e-58   Camelina sativa [gold-of-pleasure]
ref|XP_011072439.1|  PREDICTED: hexokinase-1-like                       200   9e-58   Sesamum indicum [beniseed]
ref|XP_010467922.1|  PREDICTED: hexokinase-2 isoform X1                 199   1e-57   Camelina sativa [gold-of-pleasure]
ref|XP_010416617.1|  PREDICTED: hexokinase-2-like                       199   1e-57   Camelina sativa [gold-of-pleasure]
ref|XP_010047252.1|  PREDICTED: hexokinase-2-like                       199   1e-57   Eucalyptus grandis [rose gum]
ref|XP_010047667.1|  PREDICTED: hexokinase-1-like                       199   2e-57   Eucalyptus grandis [rose gum]
ref|XP_010438337.1|  PREDICTED: hexokinase-1-like                       199   2e-57   Camelina sativa [gold-of-pleasure]
ref|XP_010447886.1|  PREDICTED: hexokinase-1                            198   2e-57   
ref|XP_010433133.1|  PREDICTED: hexokinase-1-like                       198   2e-57   Camelina sativa [gold-of-pleasure]
ref|XP_006585567.1|  PREDICTED: hexokinase-1-like isoform X4            195   2e-57   
gb|EYU27268.1|  hypothetical protein MIMGU_mgv1a019208mg                198   2e-57   Erythranthe guttata [common monkey flower]
ref|XP_002886018.1|  ATHXK2                                             198   3e-57   Arabidopsis lyrata subsp. lyrata
ref|XP_006343033.1|  PREDICTED: hexokinase-1-like                       198   3e-57   
ref|XP_006585566.1|  PREDICTED: hexokinase-1-like isoform X3            195   4e-57   
gb|AAT77515.1|  hexokinase 7                                            198   4e-57   Nicotiana tabacum [American tobacco]
ref|XP_006585565.1|  PREDICTED: hexokinase-1-like isoform X2            195   4e-57   
gb|AAL60584.1|AF454962_1  hexokinase                                    197   5e-57   Brassica oleracea
ref|XP_009112637.1|  PREDICTED: hexokinase-1-like                       197   7e-57   Brassica rapa
emb|CDY48733.1|  BnaA09g10080D                                          197   8e-57   Brassica napus [oilseed rape]
emb|CDY03331.1|  BnaC09g10170D                                          197   9e-57   
gb|AAL60583.1|AF454961_1  hexokinase                                    197   9e-57   Brassica oleracea
ref|XP_009102132.1|  PREDICTED: hexokinase-1                            196   1e-56   Brassica rapa
emb|CDY35895.1|  BnaA07g00920D                                          196   1e-56   Brassica napus [oilseed rape]
gb|KFK40349.1|  hypothetical protein AALP_AA3G362600                    196   1e-56   Arabis alpina [alpine rockcress]
pdb|4QS9|A  Chain A, Arabidopsis Hexokinase 1 (athxk1) Mutant S17...    196   2e-56   Arabidopsis thaliana [mouse-ear cress]
pdb|4QS7|A  Chain A, Arabidopsis Hexokinase 1 (athxk1) Structure ...    196   2e-56   Arabidopsis thaliana [mouse-ear cress]
gb|KFK29465.1|  hypothetical protein AALP_AA7G137600                    196   2e-56   Arabis alpina [alpine rockcress]
ref|NP_179576.1|  hexokinase 2                                          196   2e-56   Arabidopsis thaliana [mouse-ear cress]
gb|AAO24584.1|  At2g19860                                               196   2e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003627048.1|  Hexokinase                                         196   2e-56   Medicago truncatula
ref|NP_001233957.1|  hexokinase                                         196   3e-56   Solanum lycopersicum
sp|Q2KNB9.1|HXK2_ORYSJ  RecName: Full=Hexokinase-2; AltName: Full...    195   4e-56   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003533038.1|  PREDICTED: hexokinase-1-like isoform X1            195   4e-56   Glycine max [soybeans]
ref|XP_006853711.1|  hypothetical protein AMTR_s00056p00151260          195   6e-56   Amborella trichopoda
ref|XP_004135675.1|  PREDICTED: hexokinase-2-like                       194   9e-56   Cucumis sativus [cucumbers]
ref|XP_004503490.1|  PREDICTED: hexokinase-1-like isoform X1            194   1e-55   
ref|NP_001284452.1|  hexokinase-1-like                                  193   2e-55   Cucumis melo [Oriental melon]
gb|EAY98804.1|  hypothetical protein OsI_20748                          193   2e-55   Oryza sativa Indica Group [Indian rice]
gb|KDP40854.1|  hypothetical protein JCGZ_24853                         193   3e-55   Jatropha curcas
ref|XP_008789199.1|  PREDICTED: hexokinase-2-like                       192   4e-55   
gb|KCW79624.1|  hypothetical protein EUGRSUZ_C00983                     191   1e-54   Eucalyptus grandis [rose gum]
gb|KJB35042.1|  hypothetical protein B456_006G096800                    189   1e-54   Gossypium raimondii
ref|XP_007135629.1|  hypothetical protein PHAVU_010G144900g             191   2e-54   Phaseolus vulgaris [French bean]
gb|AAT47078.1|  unknown protein                                         196   3e-54   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ89593.1|  predicted protein                                      190   3e-54   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB35041.1|  hypothetical protein B456_006G096800                    190   4e-54   Gossypium raimondii
gb|EMT07302.1|  Hexokinase-2                                            188   7e-54   
ref|XP_006426867.1|  hypothetical protein CICLE_v10025452mg             189   8e-54   Citrus clementina [clementine]
ref|XP_010047255.1|  PREDICTED: hexokinase-2-like                       182   9e-54   
ref|XP_009394175.1|  PREDICTED: hexokinase-2-like                       188   1e-53   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006465701.1|  PREDICTED: hexokinase-1-like                       187   3e-53   Citrus sinensis [apfelsine]
gb|KCW79126.1|  hypothetical protein EUGRSUZ_C005691                    182   8e-53   Eucalyptus grandis [rose gum]
ref|XP_010232254.1|  PREDICTED: hexokinase-9-like isoform X2            185   1e-52   
ref|XP_003567061.1|  PREDICTED: hexokinase-9-like isoform X1            186   2e-52   Brachypodium distachyon [annual false brome]
ref|XP_010041948.1|  PREDICTED: hexokinase-1-like                       178   3e-52   
ref|XP_011080413.1|  PREDICTED: hexokinase-1-like                       184   3e-52   Sesamum indicum [beniseed]
ref|XP_003568034.1|  PREDICTED: hexokinase-2 isoform X1                 184   6e-52   Brachypodium distachyon [annual false brome]
ref|XP_002283574.1|  PREDICTED: hexokinase-2                            183   1e-51   Vitis vinifera
ref|XP_004513053.1|  PREDICTED: hexokinase-1-like                       182   2e-51   Cicer arietinum [garbanzo]
emb|CAN74362.1|  hypothetical protein VITISV_016381                     182   4e-51   Vitis vinifera
ref|XP_010665885.1|  PREDICTED: hexokinase-1-like isoform X1            181   1e-50   Beta vulgaris subsp. vulgaris [field beet]
dbj|BAP47497.1|  hexokinase                                             178   9e-50   Gentiana triflora
ref|XP_002988103.1|  hypothetical protein SELMODRAFT_269350             178   2e-49   Selaginella moellendorffii
ref|XP_002972691.1|  hypothetical protein SELMODRAFT_441916             177   3e-49   Selaginella moellendorffii
gb|KDO50431.1|  hypothetical protein CISIN_1g0104561mg                  169   9e-49   Citrus sinensis [apfelsine]
ref|XP_002313358.2|  hexokinase family protein                          174   3e-48   Populus trichocarpa [western balsam poplar]
gb|KEH27216.1|  hexokinase                                              174   4e-48   Medicago truncatula
ref|XP_011045448.1|  PREDICTED: hexokinase-3-like                       173   8e-48   Populus euphratica
ref|XP_010246625.1|  PREDICTED: hexokinase-3-like                       173   9e-48   Nelumbo nucifera [Indian lotus]
gb|AHY84733.1|  hexokinase                                              172   2e-47   Manihot esculenta [manioc]
ref|XP_002298298.1|  hexokinase family protein                          172   2e-47   Populus trichocarpa [western balsam poplar]
tpg|DAA57818.1|  TPA: hypothetical protein ZEAMMB73_547897              169   3e-47   
ref|XP_011032066.1|  PREDICTED: hexokinase-3 isoform X1                 171   5e-47   Populus euphratica
tpg|DAA57819.1|  TPA: hypothetical protein ZEAMMB73_547897              169   6e-47   
gb|KHN09247.1|  Hexokinase-3                                            170   6e-47   Glycine soja [wild soybean]
gb|KDP22128.1|  hypothetical protein JCGZ_25959                         170   9e-47   Jatropha curcas
ref|XP_003537744.1|  PREDICTED: hexokinase-3-like                       170   9e-47   Glycine max [soybeans]
ref|XP_010673708.1|  PREDICTED: hexokinase-3-like isoform X1            170   1e-46   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008800256.1|  PREDICTED: hexokinase-3-like isoform X2            163   1e-46   
ref|NP_001044102.1|  Os01g0722700                                       165   2e-46   
ref|XP_007015149.1|  Hexokinase-like 1                                  169   2e-46   
ref|XP_009405075.1|  PREDICTED: hexokinase-2-like                       169   3e-46   
gb|ACN29323.1|  unknown                                                 169   3e-46   Zea mays [maize]
gb|KJB83525.1|  hypothetical protein B456_013G251900                    166   3e-46   Gossypium raimondii
ref|NP_001146056.1|  hypothetical protein                               169   3e-46   Zea mays [maize]
gb|KJB83527.1|  hypothetical protein B456_013G251900                    166   4e-46   Gossypium raimondii
ref|XP_006470700.1|  PREDICTED: hexokinase-3-like                       168   5e-46   Citrus sinensis [apfelsine]
ref|XP_006446203.1|  hypothetical protein CICLE_v10014962mg             168   5e-46   Citrus clementina [clementine]
ref|XP_010273315.1|  PREDICTED: hexokinase-3-like                       168   6e-46   Nelumbo nucifera [Indian lotus]
ref|XP_008450397.1|  PREDICTED: hexokinase-3-like                       168   8e-46   Cucumis melo [Oriental melon]
ref|XP_008800255.1|  PREDICTED: hexokinase-3-like isoform X1            162   1e-45   
gb|AEB00843.1|  hexokinase 7                                            159   2e-45   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003540378.1|  PREDICTED: hexokinase-3-like                       166   3e-45   Glycine max [soybeans]
gb|KHN25630.1|  Hexokinase-3                                            164   3e-45   Glycine soja [wild soybean]
gb|KJB83523.1|  hypothetical protein B456_013G251900                    166   3e-45   Gossypium raimondii
gb|KJB83524.1|  hypothetical protein B456_013G251900                    166   4e-45   Gossypium raimondii
gb|EYU46224.1|  hypothetical protein MIMGU_mgv1a004779mg                166   5e-45   Erythranthe guttata [common monkey flower]
gb|AHY84732.1|  hexokinase                                              166   5e-45   Manihot esculenta [manioc]
ref|XP_004139044.1|  PREDICTED: hexokinase-3-like                       166   6e-45   Cucumis sativus [cucumbers]
ref|XP_009366073.1|  PREDICTED: hexokinase-3                            166   6e-45   Pyrus x bretschneideri [bai li]
ref|XP_004154641.1|  PREDICTED: hexokinase-3-like                       166   6e-45   
sp|Q2KNB7.1|HXK9_ORYSJ  RecName: Full=Hexokinase-9; AltName: Full...    165   6e-45   Oryza sativa Japonica Group [Japonica rice]
gb|AAL16967.1|AF367451_1  hexokinase                                    159   7e-45   Prunus persica
ref|XP_010921910.1|  PREDICTED: hexokinase-3-like isoform X1            164   1e-44   Elaeis guineensis
gb|KHG14450.1|  hypothetical protein F383_08688                         164   1e-44   Gossypium arboreum [tree cotton]
gb|EAY75659.1|  hypothetical protein OsI_03566                          164   2e-44   Oryza sativa Indica Group [Indian rice]
gb|EMT15586.1|  Hexokinase-7                                            162   3e-44   
ref|XP_009414963.1|  PREDICTED: hexokinase-3-like                       163   4e-44   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001754148.1|  hexokinase protein HXK7                            163   5e-44   
emb|CDM84160.1|  unnamed protein product                                160   6e-44   Triticum aestivum [Canadian hard winter wheat]
ref|XP_003610965.1|  Hexokinase                                         162   6e-44   Medicago truncatula
emb|CDP09609.1|  unnamed protein product                                162   6e-44   Coffea canephora [robusta coffee]
gb|EMT31348.1|  Hexokinase-9                                            164   7e-44   
ref|XP_004511503.1|  PREDICTED: hexokinase-3-like                       162   9e-44   Cicer arietinum [garbanzo]
gb|ABR18277.1|  unknown                                                 162   9e-44   Picea sitchensis
ref|XP_006362320.1|  PREDICTED: hexokinase-3-like                       162   1e-43   Solanum tuberosum [potatoes]
gb|KHN35090.1|  Hexokinase-3                                            158   2e-43   Glycine soja [wild soybean]
ref|XP_004251354.1|  PREDICTED: hexokinase-3-like                       161   2e-43   Solanum lycopersicum
ref|XP_008775016.1|  PREDICTED: hexokinase-3-like isoform X1            161   2e-43   Phoenix dactylifera
ref|XP_008775017.1|  PREDICTED: hexokinase-3-like isoform X2            161   2e-43   Phoenix dactylifera
ref|XP_001752229.1|  hexokinase protein HXK8                            161   2e-43   
gb|AAL16968.1|AF367452_1  hexokinase                                    155   2e-43   Prunus persica
ref|XP_002513538.1|  hexokinase, putative                               161   3e-43   Ricinus communis
ref|XP_004969912.1|  PREDICTED: hexokinase-6-like                       160   3e-43   Setaria italica
ref|XP_009780796.1|  PREDICTED: hexokinase-2, chloroplastic             160   3e-43   Nicotiana sylvestris
ref|XP_008449690.1|  PREDICTED: hexokinase-3                            160   3e-43   Cucumis melo [Oriental melon]
emb|CBI27996.3|  unnamed protein product                                159   4e-43   Vitis vinifera
ref|XP_008363245.1|  PREDICTED: hexokinase-3                            160   4e-43   
ref|XP_002974995.1|  hypothetical protein SELMODRAFT_150326             160   5e-43   
ref|XP_008385759.1|  PREDICTED: hexokinase-3-like                       160   5e-43   
ref|XP_002977412.1|  hypothetical protein SELMODRAFT_232972             160   6e-43   
ref|XP_001784334.1|  hexokinase protein HXK3                            160   7e-43   
gb|KGN48114.1|  hypothetical protein Csa_6G434340                       160   7e-43   Cucumis sativus [cucumbers]
ref|XP_002458467.1|  hypothetical protein SORBIDRAFT_03g034230          159   8e-43   Sorghum bicolor [broomcorn]
ref|XP_006643859.1|  PREDICTED: hexokinase-8-like                       159   1e-42   Oryza brachyantha
ref|XP_008466487.1|  PREDICTED: hexokinase-2, chloroplastic             159   1e-42   Cucumis melo [Oriental melon]
ref|XP_007131563.1|  hypothetical protein PHAVU_011G023700g             159   1e-42   Phaseolus vulgaris [French bean]
gb|AIT55904.1|  hexokinase                                              159   1e-42   Ipomoea batatas [batate]
ref|XP_006843448.1|  hypothetical protein AMTR_s00053p00173580          159   1e-42   Amborella trichopoda
sp|Q6Q8A5.1|HXK2_TOBAC  RecName: Full=Hexokinase-2, chloroplastic...    159   1e-42   Nicotiana tabacum [American tobacco]
ref|XP_009626314.1|  PREDICTED: hexokinase-2, chloroplastic             159   2e-42   Nicotiana tomentosiformis
ref|XP_006646274.1|  PREDICTED: LOW QUALITY PROTEIN: hexokinase-9...    158   2e-42   
ref|XP_006646311.1|  PREDICTED: hexokinase-6-like                       159   2e-42   
gb|EMT13168.1|  Hexokinase-8                                            157   2e-42   
ref|XP_003517518.1|  PREDICTED: hexokinase-3-like                       158   3e-42   Glycine max [soybeans]
ref|XP_008675068.1|  PREDICTED: hexokinase-6                            158   3e-42   Zea mays [maize]
ref|XP_004968460.1|  PREDICTED: hexokinase-8-like                       157   3e-42   Setaria italica
gb|KDP36930.1|  hypothetical protein JCGZ_08221                         158   3e-42   Jatropha curcas
ref|XP_003564653.1|  PREDICTED: hexokinase-8-like                       157   3e-42   Brachypodium distachyon [annual false brome]
ref|XP_006590474.1|  PREDICTED: hexokinase-3-like                       157   4e-42   Glycine max [soybeans]
gb|KGN60032.1|  hypothetical protein Csa_3G872140                       157   5e-42   
ref|XP_004961448.1|  PREDICTED: hexokinase-5-like                       157   5e-42   
ref|XP_006393149.1|  hypothetical protein EUTSA_v10011415mg             157   5e-42   
ref|XP_009622479.1|  PREDICTED: hexokinase-3-like                       157   6e-42   
ref|XP_002510526.1|  hexokinase, putative                               157   6e-42   
ref|XP_006383739.1|  hypothetical protein POPTR_0005s25980g             154   6e-42   
gb|AAS60198.1|  hexokinase 6                                            157   6e-42   
ref|XP_004136385.1|  PREDICTED: hexokinase-2, chloroplastic-like        157   6e-42   
gb|AFW82531.1|  hypothetical protein ZEAMMB73_000101                    153   6e-42   
ref|XP_002440104.1|  hypothetical protein SORBIDRAFT_09g026080          157   8e-42   
ref|XP_002891576.1|  hypothetical protein ARALYDRAFT_474175             156   1e-41   
gb|EPS60819.1|  hexokinase                                              155   1e-41   
sp|O64390.1|HXK1_SOLTU  RecName: Full=Hexokinase-1; AltName: Full...    156   1e-41   
ref|XP_002456268.1|  hypothetical protein SORBIDRAFT_03g033200          154   1e-41   
ref|XP_002306924.2|  hypothetical protein POPTR_0005s25980g             154   1e-41   
ref|XP_002984124.1|  hypothetical protein SELMODRAFT_234446             155   1e-41   
ref|XP_009337028.1|  PREDICTED: hexokinase-3-like                       156   2e-41   
gb|KHN41674.1|  Hexokinase-1                                            155   2e-41   
ref|XP_001784630.1|  hexokinase protein HXK2                            155   2e-41   
ref|XP_010031757.1|  PREDICTED: hexokinase-3 isoform X3                 155   2e-41   
gb|AHY84730.1|  hexokinase                                              155   2e-41   
ref|XP_007156986.1|  hypothetical protein PHAVU_002G034000g             155   3e-41   
ref|XP_010031755.1|  PREDICTED: hexokinase-3 isoform X1                 155   3e-41   
gb|AFO84085.1|  hexokinase                                              155   3e-41   
ref|XP_007017793.1|  Hexokinase 3                                       155   3e-41   
ref|XP_009343799.1|  PREDICTED: hexokinase-3-like                       155   4e-41   
ref|XP_009798645.1|  PREDICTED: hexokinase-3-like                       155   4e-41   
ref|XP_011045105.1|  PREDICTED: hexokinase-2, chloroplastic             154   5e-41   
ref|NP_001234717.1|  plastidic hexokinase                               154   5e-41   
dbj|BAJ93240.1|  predicted protein                                      154   5e-41   
ref|XP_002972212.1|  hypothetical protein SELMODRAFT_231902             154   5e-41   
ref|NP_001044214.1|  Os01g0742500                                       154   6e-41   
gb|KHN27811.1|  Hexokinase-1                                            153   7e-41   
ref|XP_010695425.1|  PREDICTED: hexokinase-2, chloroplastic             154   7e-41   
ref|XP_002274759.1|  PREDICTED: hexokinase-3 isoform X1                 154   7e-41   
ref|XP_009382579.1|  PREDICTED: hexokinase-3-like isoform X2            154   8e-41   
emb|CBI36049.3|  unnamed protein product                                153   8e-41   
ref|XP_009382578.1|  PREDICTED: hexokinase-3-like isoform X1            154   9e-41   
ref|XP_002894073.1|  hypothetical protein ARALYDRAFT_314227             154   9e-41   
gb|KJB63530.1|  hypothetical protein B456_010G004700                    151   9e-41   
emb|CDP07402.1|  unnamed protein product                                154   9e-41   
ref|XP_011090147.1|  PREDICTED: hexokinase-3-like                       154   1e-40   
ref|XP_006307314.1|  hypothetical protein CARUB_v10008936mg             154   1e-40   
gb|AIU64847.1|  hexokinase-3                                            154   1e-40   
ref|XP_008227191.1|  PREDICTED: hexokinase-3 isoform X1                 154   1e-40   
ref|XP_007211826.1|  hypothetical protein PRUPE_ppa004471mg             154   1e-40   
ref|NP_175463.1|  hexokinase-like 1                                     153   1e-40   
ref|XP_009405453.1|  PREDICTED: hexokinase-3-like                       153   1e-40   
ref|XP_010938649.1|  PREDICTED: hexokinase-3-like                       153   1e-40   
gb|KHG14299.1|  Hexokinase-2, chloroplastic                             153   1e-40   
ref|NP_001275315.1|  hexokinase-related protein 1                       153   2e-40   
ref|XP_011080375.1|  PREDICTED: hexokinase-3 isoform X1                 153   2e-40   
ref|XP_010487967.1|  PREDICTED: hexokinase-4                            153   2e-40   
ref|XP_010461577.1|  PREDICTED: hexokinase-like 1 protein isoform X2    151   2e-40   
ref|NP_001123599.1|  hexokinase2                                        153   2e-40   
gb|ADN33926.1|  hexokinase                                              153   2e-40   
gb|AFW78822.1|  hexokinase-2                                            153   2e-40   
ref|XP_006297494.1|  hypothetical protein CARUB_v10013513mg             152   3e-40   
gb|ACG44289.1|  hexokinase-2                                            152   3e-40   
gb|KJB63531.1|  hypothetical protein B456_010G004700                    151   3e-40   
ref|XP_010461576.1|  PREDICTED: hexokinase-like 1 protein isoform X1    151   3e-40   
ref|XP_003568072.1|  PREDICTED: LOW QUALITY PROTEIN: hexokinase-5...    152   3e-40   
gb|AFW82530.1|  hexokinase                                              152   3e-40   
ref|XP_008387945.1|  PREDICTED: hexokinase-2, chloroplastic             152   3e-40   
ref|XP_009335085.1|  PREDICTED: hexokinase-2, chloroplastic             152   5e-40   
ref|XP_011080376.1|  PREDICTED: hexokinase-3 isoform X2                 152   5e-40   
ref|XP_010508397.1|  PREDICTED: hexokinase-4-like                       152   5e-40   
ref|XP_004140206.1|  PREDICTED: hexokinase-3-like                       152   5e-40   
gb|KJB63529.1|  hypothetical protein B456_010G004700                    151   6e-40   
gb|AAA60333.1|  hexokinase                                              150   6e-40   
ref|NP_001105529.1|  LOC542510                                          151   7e-40   
ref|NP_001056082.1|  Os05g0522500                                       151   8e-40   
ref|XP_010461899.1|  PREDICTED: hexokinase-3-like                       151   9e-40   
gb|AHD25655.1|  hexokinase 2                                            151   1e-39   
ref|NP_001054835.1|  Os05g0187100                                       149   1e-39   
emb|CDY07303.1|  BnaC05g26650D                                          150   1e-39   
ref|XP_003568782.1|  PREDICTED: hexokinase-7                            150   1e-39   
gb|KFK35941.1|  hypothetical protein AALP_AA4G057200                    150   1e-39   
gb|EPS64171.1|  hypothetical protein M569_10608                         150   2e-39   
gb|ACG43712.1|  hexokinase-1                                            150   2e-39   
ref|NP_001130970.1|  uncharacterized protein LOC100192075               150   2e-39   
gb|EMT04435.1|  Hexokinase-6                                            150   2e-39   
ref|XP_008672063.1|  PREDICTED: uncharacterized protein LOC100192...    150   3e-39   
ref|XP_010443879.1|  PREDICTED: hexokinase-3-like isoform X2            147   3e-39   
gb|AAZ93624.1|  hexokinase 7                                            149   3e-39   
ref|XP_010443756.1|  PREDICTED: hexokinase-3-like isoform X1            147   4e-39   
gb|EEC78650.1|  hypothetical protein OsI_18744                          149   4e-39   
ref|XP_002455027.1|  hypothetical protein SORBIDRAFT_03g003190          149   4e-39   
sp|Q1WM16.2|HXK7_ORYSJ  RecName: Full=Hexokinase-7; AltName: Full...    149   4e-39   
dbj|BAD93730.1|  hexokinase                                             149   4e-39   
ref|XP_006473649.1|  PREDICTED: hexokinase-2, chloroplastic-like        149   4e-39   
ref|NP_188639.2|  hexokinase-4                                          149   5e-39   
ref|XP_010479187.1|  PREDICTED: hexokinase-like 1 protein isoform X1    149   5e-39   
ref|XP_006303965.1|  hypothetical protein CARUB_v10008846mg             149   6e-39   
gb|AEB00842.1|  hexokinase 6                                            145   7e-39   
ref|XP_002883225.1|  hexokinase                                         148   9e-39   
gb|ACG47843.1|  hexokinase-1                                            148   1e-38   
ref|XP_010268380.1|  PREDICTED: hexokinase-2, chloroplastic             148   1e-38   
ref|XP_010479505.1|  PREDICTED: hexokinase-3 isoform X1                 147   2e-38   
ref|XP_010500300.1|  PREDICTED: hexokinase-like 1 protein               147   2e-38   
ref|XP_003569773.1|  PREDICTED: hexokinase-6                            147   2e-38   
gb|KDO84849.1|  hypothetical protein CISIN_1g011283mg                   147   3e-38   
ref|XP_009144955.1|  PREDICTED: hexokinase-3-like                       147   3e-38   
emb|CDM84036.1|  unnamed protein product                                147   4e-38   
ref|XP_006393517.1|  hypothetical protein EUTSA_v10011426mg             146   7e-38   
gb|EAY77169.1|  hypothetical protein OsI_05139                          146   7e-38   
sp|Q2KNB4.1|HXK3_ORYSJ  RecName: Full=Hexokinase-3; AltName: Full...    145   8e-38   
ref|XP_006435174.1|  hypothetical protein CICLE_v10000939mg             145   9e-38   
ref|XP_010061051.1|  PREDICTED: hexokinase-2, chloroplastic             145   1e-37   
ref|XP_006829458.1|  hypothetical protein AMTR_s00254p00018780          145   1e-37   
gb|EEE55981.1|  hypothetical protein OsJ_04720                          146   2e-37   
gb|AEB00838.1|  hexokinase 2                                            144   2e-37   
emb|CDY03607.1|  BnaC03g68660D                                          145   2e-37   
dbj|BAK06520.1|  predicted protein                                      145   2e-37   
emb|CDY22797.1|  BnaA06g02800D                                          145   2e-37   
ref|XP_009107216.1|  PREDICTED: hexokinase-3-like                       144   2e-37   
ref|XP_009147837.1|  PREDICTED: hexokinase-3                            144   3e-37   
ref|XP_008807594.1|  PREDICTED: hexokinase-4, chloroplastic-like ...    140   3e-37   
ref|XP_008807592.1|  PREDICTED: hexokinase-4, chloroplastic-like ...    140   4e-37   
emb|CDY06724.1|  BnaA10g05030D                                          144   4e-37   
ref|XP_008807593.1|  PREDICTED: hexokinase-4, chloroplastic-like ...    140   4e-37   
ref|NP_175220.2|  hexokinase 3                                          144   4e-37   
dbj|BAJ85932.1|  predicted protein                                      144   5e-37   
gb|AFW83996.1|  hypothetical protein ZEAMMB73_545591                    142   6e-37   
ref|XP_010466178.1|  PREDICTED: hexokinase-4-like                       143   7e-37   
ref|XP_009118944.1|  PREDICTED: hexokinase-like 1 protein               143   9e-37   
gb|KFK39985.1|  hypothetical protein AALP_AA3G314900                    142   1e-36   
ref|XP_004960890.1|  PREDICTED: hexokinase-7-like isoform X1            142   1e-36   
ref|XP_008656880.1|  PREDICTED: hexokinase-3-like                       142   1e-36   
emb|CDY20902.1|  BnaC06g01220D                                          142   1e-36   
ref|XP_001772444.1|  hexokinase protein HXK1                            142   2e-36   
gb|EAY98739.1|  hypothetical protein OsI_20669                          142   2e-36   
ref|XP_002440735.1|  hypothetical protein SORBIDRAFT_09g005840          142   2e-36   
ref|XP_008674565.1|  PREDICTED: hexokinase-3                            142   2e-36   
gb|EEC70091.1|  hypothetical protein OsI_00720                          141   2e-36   
ref|XP_010941986.1|  PREDICTED: hexokinase-2-like                       141   2e-36   
ref|XP_004971218.1|  PREDICTED: hexokinase-3-like                       142   2e-36   
ref|XP_010920252.1|  PREDICTED: hexokinase-2, chloroplastic             142   2e-36   
dbj|BAK01318.1|  predicted protein                                      141   3e-36   
gb|AAF99786.1|AC012463_3  T2E6.5                                        144   3e-36   
ref|XP_004291365.1|  PREDICTED: hexokinase-2, chloroplastic             141   3e-36   
emb|CDY45062.1|  BnaA08g02130D                                          141   3e-36   
ref|XP_001766433.1|  hexokinase protein HXK5                            140   6e-36   
ref|XP_008221267.1|  PREDICTED: hexokinase-2, chloroplastic             140   7e-36   
gb|KFK39984.1|  hypothetical protein AALP_AA3G314800                    140   8e-36   
ref|NP_001059124.1|  Os07g0197100                                       140   1e-35   
gb|AAQ72424.1|  hexokinase PpHxk1                                       140   1e-35   
ref|NP_001267834.1|  hexokinase                                         140   1e-35   
gb|AEJ95927.1|  HXK2                                                    139   1e-35   
gb|EEE54030.1|  hypothetical protein OsJ_00699                          139   1e-35   
ref|XP_009382581.1|  PREDICTED: hexokinase-3-like isoform X4            139   1e-35   
sp|Q1WM15.2|HXK8_ORYSJ  RecName: Full=Hexokinase-8; AltName: Full...    139   1e-35   
ref|XP_006601348.1|  PREDICTED: hexokinase-2, chloroplastic-like ...    137   2e-35   
ref|XP_001776765.1|  hexokinase protein HXK10                           139   2e-35   
ref|NP_001042264.1|  Os01g0190400                                       139   2e-35   
ref|XP_009382580.1|  PREDICTED: hexokinase-3-like isoform X3            138   2e-35   
ref|XP_007222248.1|  hypothetical protein PRUPE_ppa004715mg             139   3e-35   
ref|XP_002459072.1|  hypothetical protein SORBIDRAFT_03g045420          139   3e-35   
gb|KEH40228.1|  hexokinase                                              137   3e-35   
gb|EAZ03118.1|  hypothetical protein OsI_25263                          138   4e-35   
ref|XP_003565048.1|  PREDICTED: hexokinase-3                            138   5e-35   
ref|XP_006661182.1|  PREDICTED: hexokinase-1-like                       137   6e-35   
ref|XP_010031756.1|  PREDICTED: hexokinase-3 isoform X2                 137   7e-35   
ref|XP_004960891.1|  PREDICTED: hexokinase-7-like isoform X2            137   7e-35   
gb|KFK39983.1|  hypothetical protein AALP_AA3G314700                    137   8e-35   
gb|AFK45195.1|  unknown                                                 137   8e-35   
sp|Q2KNB5.1|HXK10_ORYSJ  RecName: Full=Hexokinase-10; AltName: Fu...    137   9e-35   
ref|XP_004499271.1|  PREDICTED: LOW QUALITY PROTEIN: hexokinase-2...    137   1e-34   
ref|XP_003589478.1|  Hexokinase I                                       137   1e-34   
ref|XP_002983299.1|  hypothetical protein SELMODRAFT_117919             136   2e-34   
ref|XP_001770177.1|  hexokinase protein HXK9                            136   2e-34   
dbj|BAD87613.1|  putative hexokinase                                    136   2e-34   
ref|XP_003550424.1|  PREDICTED: hexokinase-2, chloroplastic-like ...    136   3e-34   
ref|XP_006406425.1|  hypothetical protein EUTSA_v10020562mg             136   3e-34   
ref|XP_011083536.1|  PREDICTED: hexokinase-2, chloroplastic             135   4e-34   
gb|ABG36927.1|  hexokinase 3                                            129   4e-34   
emb|CDY24565.1|  BnaC05g32490D                                          135   4e-34   
gb|AAZ93625.1|  hexokinase 8                                            135   5e-34   
ref|XP_008787361.1|  PREDICTED: hexokinase-2-like                       135   5e-34   
ref|XP_003580531.1|  PREDICTED: hexokinase-4, chloroplastic             135   6e-34   
ref|NP_001150106.1|  hexokinase-1                                       134   8e-34   
ref|XP_010104447.1|  Hexokinase-2                                       134   1e-33   
ref|XP_009145689.1|  PREDICTED: hexokinase-4                            134   1e-33   
emb|CDY25373.1|  BnaA05g19110D                                          134   1e-33   
ref|XP_001762951.1|  hexokinase protein HXK6                            134   2e-33   
gb|ACN25682.1|  unknown                                                 133   2e-33   
gb|ACN35115.1|  unknown                                                 132   3e-33   
ref|XP_010271549.1|  PREDICTED: probable hexokinase-like 2 protein      132   4e-33   
gb|EMT08969.1|  Hexokinase-5                                            132   5e-33   
gb|EMS52197.1|  Hexokinase-8                                            131   5e-33   
ref|XP_002987642.1|  hypothetical protein SELMODRAFT_269299             132   7e-33   
gb|ABG36926.1|  hexokinase 2                                            125   1e-32   
ref|XP_007160669.1|  hypothetical protein PHAVU_001G007000g             131   2e-32   
gb|AAT01343.1|  putative hexokinase                                     130   3e-32   
ref|NP_001152293.1|  hexokinase-1                                       130   3e-32   
ref|XP_001779478.1|  hexokinase protein HXK11                           130   4e-32   
ref|XP_002441001.1|  hypothetical protein SORBIDRAFT_09g018720          129   8e-32   
gb|KHN39258.1|  Hexokinase-1                                            127   8e-32   
ref|XP_006654666.1|  PREDICTED: hexokinase-5-like                       128   9e-32   
gb|EPS65982.1|  hypothetical protein M569_08795                         127   9e-32   
gb|EMS55979.1|  Hexokinase-5                                            127   1e-31   
ref|XP_003545034.1|  PREDICTED: hexokinase-2, chloroplastic-like        128   2e-31   
ref|XP_004962258.1|  PREDICTED: hexokinase-10-like                      127   2e-31   
gb|KHN05494.1|  Hexokinase-3                                            126   6e-31   
ref|XP_006657535.1|  PREDICTED: hexokinase-4, chloroplastic-like        124   2e-30   
gb|AAX84838.1|  hexokinase                                              120   2e-30   
ref|XP_003635485.1|  PREDICTED: probable hexokinase-like 2 protein      124   3e-30   
emb|CBI23516.3|  unnamed protein product                                124   3e-30   
ref|XP_010921911.1|  PREDICTED: hexokinase-3-like isoform X2            124   4e-30   
ref|XP_001760948.1|  hexokinase protein HXK4                            124   4e-30   
gb|ABG36925.1|  hexokinase 1                                            118   8e-30   
gb|AHZ34665.1|  hexokinase 3 (chloroplast)                              121   4e-29   
gb|EMT24694.1|  Hexokinase-10                                           120   8e-29   
ref|XP_009375879.1|  PREDICTED: probable hexokinase-like 2 protein      119   3e-28   
ref|XP_009354634.1|  PREDICTED: probable hexokinase-like 2 protein      118   6e-28   
ref|XP_008365574.1|  PREDICTED: probable hexokinase-like 2 protein      117   2e-27   
ref|XP_006466389.1|  PREDICTED: probable hexokinase-like 2 protei...    115   4e-27   
ref|XP_008342598.1|  PREDICTED: probable hexokinase-like 2 protein      115   8e-27   
ref|XP_010536107.1|  PREDICTED: hexokinase-4-like isoform X1            114   1e-26   
ref|XP_007208760.1|  hypothetical protein PRUPE_ppa025661mg             115   1e-26   
ref|XP_010536108.1|  PREDICTED: hexokinase-4-like isoform X2            114   1e-26   



>ref|XP_007215964.1| hypothetical protein PRUPE_ppa011439mg [Prunus persica]
 gb|EMJ17163.1| hypothetical protein PRUPE_ppa011439mg [Prunus persica]
Length=210

 Score =   223 bits (567),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            RH +RSSGRWA+  A++KELEEKCGTP GKLRQVADAMAVEMHAGLASEGGSKLKM+ISY
Sbjct  24   RHRIRSSGRWARATAIIKELEEKCGTPIGKLRQVADAMAVEMHAGLASEGGSKLKMIISY  83

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLP+G E+GLFYALDLGGTNFRV+RVQLGGK +G++++E  EVSIP +LMVG+S+ALF
Sbjct  84   VDNLPTGTEKGLFYALDLGGTNFRVLRVQLGGKGRGIISQEFTEVSIPENLMVGTSDALF  143

Query  489  DFIAHELAMFV  521
            D+IA ELA FV
Sbjct  144  DYIAAELAKFV  154



>ref|XP_008387435.1| PREDICTED: hexokinase-2-like [Malus domestica]
Length=291

 Score =   224 bits (571),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            RH MRSSGRWA+  A++KELEEKCGTP GKLRQVADAMAVEMHAGLASEGGSKLKM+ISY
Sbjct  24   RHRMRSSGRWARASAIIKELEEKCGTPTGKLRQVADAMAVEMHAGLASEGGSKLKMIISY  83

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLP+G+E+GLFYALDLGGTNFRV+RVQLGGK +G++++E  EVSIP +LMVG+S+ALF
Sbjct  84   VDNLPTGNEKGLFYALDLGGTNFRVLRVQLGGKGRGIISQEFTEVSIPENLMVGTSDALF  143

Query  489  DFIAHELAMFV  521
            D+IA ELA FV
Sbjct  144  DYIAAELAKFV  154



>ref|XP_009338735.1| PREDICTED: hexokinase-1-like isoform X2 [Pyrus x bretschneideri]
Length=398

 Score =   226 bits (576),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            RHHMR+SGRWA+  A++KELEEKCGTP GKLRQVADAMAVEMHAGLASEGGSKLKM+ISY
Sbjct  24   RHHMRNSGRWARASAIIKELEEKCGTPTGKLRQVADAMAVEMHAGLASEGGSKLKMIISY  83

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLP+G+E+GLFYALDLGGTNFRVMRVQLGGK +G++++E  EVSIP +LMVG+S+ALF
Sbjct  84   VDNLPTGNEKGLFYALDLGGTNFRVMRVQLGGKGRGIISQEFTEVSIPENLMVGTSDALF  143

Query  489  DFIAHELAMFV  521
            D+IA ELA FV
Sbjct  144  DYIAAELAKFV  154



>ref|XP_009338734.1| PREDICTED: hexokinase-1-like isoform X1 [Pyrus x bretschneideri]
Length=497

 Score =   227 bits (579),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            RHHMR+SGRWA+  A++KELEEKCGTP GKLRQVADAMAVEMHAGLASEGGSKLKM+ISY
Sbjct  24   RHHMRNSGRWARASAIIKELEEKCGTPTGKLRQVADAMAVEMHAGLASEGGSKLKMIISY  83

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLP+G+E+GLFYALDLGGTNFRVMRVQLGGK +G++++E  EVSIP +LMVG+S+ALF
Sbjct  84   VDNLPTGNEKGLFYALDLGGTNFRVMRVQLGGKGRGIISQEFTEVSIPENLMVGTSDALF  143

Query  489  DFIAHELAMFV  521
            D+IA ELA FV
Sbjct  144  DYIAAELAKFV  154



>ref|XP_008228416.1| PREDICTED: hexokinase-1-like [Prunus mume]
Length=497

 Score =   226 bits (575),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            RHHMRSSGRWA+  A++KELEEKCGTP GKLRQVADAMAVEMHAGLASEGGSKLKM+ISY
Sbjct  24   RHHMRSSGRWARATAIVKELEEKCGTPIGKLRQVADAMAVEMHAGLASEGGSKLKMIISY  83

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLP+G E+GLFYALDLGGTNFRV+RVQLGGK +G++++E  EVSIP +LMVG+S+ALF
Sbjct  84   VDNLPTGTEKGLFYALDLGGTNFRVLRVQLGGKGRGIISQEFTEVSIPENLMVGTSDALF  143

Query  489  DFIAHELAMFV  521
            D+IA ELA FV
Sbjct  144  DYIAAELAKFV  154



>gb|ACJ04704.1| hexokinase 1 [Cucumis melo]
Length=498

 Score =   225 bits (573),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 107/131 (82%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            RH MR+SG+WA+ +A+L+E EEKCGTP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RHRMRNSGKWARAMAILREFEEKCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLP+GDE+GLFYALDLGGTNFRV+RVQLGGKE  VV +E +EVSIP HLMVGSSEALF
Sbjct  85   VDNLPTGDEKGLFYALDLGGTNFRVLRVQLGGKENRVVKQEFEEVSIPPHLMVGSSEALF  144

Query  489  DFIAHELAMFV  521
            DFIA  LA FV
Sbjct  145  DFIAQALAKFV  155



>ref|XP_008458873.1| PREDICTED: hexokinase-1-like isoform X3 [Cucumis melo]
 ref|XP_008458879.1| PREDICTED: hexokinase-1-like isoform X3 [Cucumis melo]
 ref|XP_008458886.1| PREDICTED: hexokinase-1-like isoform X3 [Cucumis melo]
 ref|XP_008458893.1| PREDICTED: hexokinase-1-like isoform X3 [Cucumis melo]
 ref|XP_008458902.1| PREDICTED: hexokinase-1-like isoform X3 [Cucumis melo]
 ref|XP_008458909.1| PREDICTED: hexokinase-1-like isoform X3 [Cucumis melo]
 ref|XP_008458916.1| PREDICTED: hexokinase-1-like isoform X3 [Cucumis melo]
 ref|XP_008458922.1| PREDICTED: hexokinase-1-like isoform X3 [Cucumis melo]
 ref|XP_008458929.1| PREDICTED: hexokinase-1-like isoform X3 [Cucumis melo]
 ref|XP_008458934.1| PREDICTED: hexokinase-1-like isoform X3 [Cucumis melo]
 ref|XP_008458936.1| PREDICTED: hexokinase-1-like isoform X3 [Cucumis melo]
 ref|XP_008458939.1| PREDICTED: hexokinase-1-like isoform X3 [Cucumis melo]
Length=498

 Score =   225 bits (573),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 107/131 (82%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            RH MR+SG+WA+ +A+L+E EEKCGTP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RHRMRNSGKWARAMAILREFEEKCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLP+GDE+GLFYALDLGGTNFRV+RVQLGGKE  VV +E +EVSIP HLMVGSSEALF
Sbjct  85   VDNLPTGDEKGLFYALDLGGTNFRVLRVQLGGKENRVVKQEFEEVSIPPHLMVGSSEALF  144

Query  489  DFIAHELAMFV  521
            DFIA  LA FV
Sbjct  145  DFIAQALAKFV  155



>ref|XP_008387327.1| PREDICTED: hexokinase-1-like [Malus domestica]
Length=498

 Score =   224 bits (572),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 117/131 (89%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            RH M+SSGRWA+ +A+LKE E+KCGTP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RHRMKSSGRWARAMAILKEFEDKCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLP+GDE+GLFYALDLGGTNFRV+RVQLGGK+K VV +ES+EVSIP HLM G+SE LF
Sbjct  85   VDNLPTGDEKGLFYALDLGGTNFRVLRVQLGGKDKHVVKQESEEVSIPPHLMTGTSEGLF  144

Query  489  DFIAHELAMFV  521
            DFIA   A FV
Sbjct  145  DFIAETJAKFV  155



>ref|XP_008458856.1| PREDICTED: hexokinase-1-like isoform X2 [Cucumis melo]
 ref|XP_008458864.1| PREDICTED: hexokinase-1-like isoform X2 [Cucumis melo]
Length=502

 Score =   225 bits (573),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 107/131 (82%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            RH MR+SG+WA+ +A+L+E EEKCGTP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  29   RHRMRNSGKWARAMAILREFEEKCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  88

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLP+GDE+GLFYALDLGGTNFRV+RVQLGGKE  VV +E +EVSIP HLMVGSSEALF
Sbjct  89   VDNLPTGDEKGLFYALDLGGTNFRVLRVQLGGKENRVVKQEFEEVSIPPHLMVGSSEALF  148

Query  489  DFIAHELAMFV  521
            DFIA  LA FV
Sbjct  149  DFIAQALAKFV  159



>ref|XP_004141023.1| PREDICTED: hexokinase-1-like [Cucumis sativus]
 ref|XP_004157890.1| PREDICTED: hexokinase-1-like [Cucumis sativus]
 gb|KGN60576.1| hypothetical protein Csa_2G000830 [Cucumis sativus]
Length=498

 Score =   224 bits (570),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            RH MR+SG+WA+ +A+L+E E+KCGTP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RHRMRNSGKWARAMAILREFEDKCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLP+GDE+GLFYALDLGGTNFRV+RVQLGGKE  VV +E +EVSIP HLMVGSSEALF
Sbjct  85   VDNLPTGDEKGLFYALDLGGTNFRVLRVQLGGKENRVVKQEFEEVSIPPHLMVGSSEALF  144

Query  489  DFIAHELAMFV  521
            DFIA  LA FV
Sbjct  145  DFIAQALAKFV  155



>ref|XP_008458849.1| PREDICTED: hexokinase-1-like isoform X1 [Cucumis melo]
Length=583

 Score =   225 bits (574),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 107/131 (82%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            RH MR+SG+WA+ +A+L+E EEKCGTP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  110  RHRMRNSGKWARAMAILREFEEKCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  169

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLP+GDE+GLFYALDLGGTNFRV+RVQLGGKE  VV +E +EVSIP HLMVGSSEALF
Sbjct  170  VDNLPTGDEKGLFYALDLGGTNFRVLRVQLGGKENRVVKQEFEEVSIPPHLMVGSSEALF  229

Query  489  DFIAHELAMFV  521
            DFIA  LA FV
Sbjct  230  DFIAQALAKFV  240



>gb|KCW82327.1| hypothetical protein EUGRSUZ_C03728 [Eucalyptus grandis]
Length=357

 Score =   218 bits (556),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/131 (78%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            R  M+ SG+WA+ +A+LKE E+KCGTP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  26   RRQMKRSGKWARAMAILKEFEDKCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  85

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLP+G+E+GLFYALDLGGTNFRV+RVQLGGKEKGVV++E +EVSIP +LM+GSSEALF
Sbjct  86   VDNLPTGNEQGLFYALDLGGTNFRVLRVQLGGKEKGVVSQEFEEVSIPPYLMIGSSEALF  145

Query  489  DFIAHELAMFV  521
            ++IA  LA FV
Sbjct  146  NYIAEALAKFV  156



>ref|XP_002283608.1| PREDICTED: hexokinase-1-like [Vitis vinifera]
Length=497

 Score =   222 bits (565),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            RH MRSSGRWA+ +A+L+E EEKCGTP  KLRQVADAM VEMHAGLASEGGSKLKM+ISY
Sbjct  25   RHRMRSSGRWARAMAILREFEEKCGTPIAKLRQVADAMTVEMHAGLASEGGSKLKMIISY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLP+GDE+GLFYALDLGGTNFRV+RVQLGGK+K VV +E +EVSIP HLMVGSS+ALF
Sbjct  85   VDNLPTGDEKGLFYALDLGGTNFRVLRVQLGGKDKRVVKQEFEEVSIPPHLMVGSSDALF  144

Query  489  DFIAHELAMFV  521
            D+IA  LA FV
Sbjct  145  DYIAAALAKFV  155



>gb|KCW82328.1| hypothetical protein EUGRSUZ_C03728 [Eucalyptus grandis]
Length=354

 Score =   218 bits (555),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/131 (78%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            R  M+ SG+WA+ +A+LKE E+KCGTP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  26   RRQMKRSGKWARAMAILKEFEDKCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  85

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLP+G+E+GLFYALDLGGTNFRV+RVQLGGKEKGVV++E +EVSIP +LM+GSSEALF
Sbjct  86   VDNLPTGNEQGLFYALDLGGTNFRVLRVQLGGKEKGVVSQEFEEVSIPPYLMIGSSEALF  145

Query  489  DFIAHELAMFV  521
            ++IA  LA FV
Sbjct  146  NYIAEALAKFV  156



>emb|CAN83149.1| hypothetical protein VITISV_024177 [Vitis vinifera]
Length=498

 Score =   222 bits (565),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            RH MRSSGRWA+ +A+L+E EEKCGTP  KLRQVADAM VEMHAGLASEGGSKLKM+ISY
Sbjct  25   RHRMRSSGRWARAMAILREFEEKCGTPIAKLRQVADAMTVEMHAGLASEGGSKLKMIISY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLP+GDE+GLFYALDLGGTNFRV+RVQLGGK+K VV +E +EVSIP HLMVGSS+ALF
Sbjct  85   VDNLPTGDEKGLFYALDLGGTNFRVLRVQLGGKDKRVVKQEFEEVSIPPHLMVGSSDALF  144

Query  489  DFIAHELAMFV  521
            D+IA  LA FV
Sbjct  145  DYIAAALAKFV  155



>ref|XP_009352555.1| PREDICTED: hexokinase-1 [Pyrus x bretschneideri]
Length=498

 Score =   221 bits (564),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            RH M+SSGRWA+ +A+L+ELE+KCGTP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RHRMKSSGRWARAMAILRELEDKCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLP+GDE GLFYALDLGGTNFRV+RVQLGGKEK VV  E  EVSIP HLM G+SE LF
Sbjct  85   VDNLPTGDENGLFYALDLGGTNFRVLRVQLGGKEKHVVKHEFDEVSIPPHLMTGTSEGLF  144

Query  489  DFIAHELAMFV  521
            DFIA  LA FV
Sbjct  145  DFIAEALAKFV  155



>ref|XP_010915190.1| PREDICTED: hexokinase-2-like [Elaeis guineensis]
Length=500

 Score =   221 bits (563),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 108/131 (82%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            RH MRSSGRWA+ VA+LKELEEKC TP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RHRMRSSGRWARAVAILKELEEKCATPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLP+GDE GLFYALDLGGTNFRV+RVQLGGKE  VV +E +EVSIP +LMVG S  LF
Sbjct  85   VDNLPTGDETGLFYALDLGGTNFRVLRVQLGGKEGHVVKQEFEEVSIPPNLMVGRSSELF  144

Query  489  DFIAHELAMFV  521
            DFIA ELA FV
Sbjct  145  DFIAAELAKFV  155



>ref|XP_008242483.1| PREDICTED: hexokinase-1 [Prunus mume]
Length=498

 Score =   221 bits (562),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 117/131 (89%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            RH M+SSGRWA+ +A+L+E E+KCGTP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RHRMKSSGRWARAMAILREFEDKCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLP+GDE+GLFYALDLGGTNFRV+RVQLGGKEK VV +E  EVSIP +LM G+SEALF
Sbjct  85   VDNLPTGDEQGLFYALDLGGTNFRVIRVQLGGKEKRVVKQEFDEVSIPPNLMTGTSEALF  144

Query  489  DFIAHELAMFV  521
            DFIA  LA FV
Sbjct  145  DFIAEALAKFV  155



>gb|KDO66593.1| hypothetical protein CISIN_1g010895mg [Citrus sinensis]
Length=289

 Score =   215 bits (547),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            R  M+S+GRWA+ VA+LKE+EEKCGTP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RRRMKSTGRWARAVAILKEMEEKCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLP+GDE+GLFYALDLGGTNFRV+RVQLGG+E  VV +E +EVSIP HLM GSS  LF
Sbjct  85   VDNLPTGDEKGLFYALDLGGTNFRVLRVQLGGREGRVVKQEFEEVSIPPHLMTGSSHELF  144

Query  489  DFIAHELAMFV  521
            D+IA  LA FV
Sbjct  145  DYIAAALAKFV  155



>gb|AFO84084.1| hexokinase [Actinidia deliciosa]
Length=497

 Score =   221 bits (562),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 117/131 (89%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            RH MRSSGRWAK  A++KELEEKCGTP GKLRQVADAMAVEMHAGLASEGGSKLKM+IS+
Sbjct  25   RHRMRSSGRWAKAAAIVKELEEKCGTPIGKLRQVADAMAVEMHAGLASEGGSKLKMIISF  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLP+GDE+GLFYALDLGGTNFRV+RVQLGGK+  V  +E +EVSIP HLMVG+S+ALF
Sbjct  85   VDNLPTGDEKGLFYALDLGGTNFRVLRVQLGGKDNRVAKQEFEEVSIPPHLMVGTSDALF  144

Query  489  DFIAHELAMFV  521
            DFIA  L  FV
Sbjct  145  DFIAAALKKFV  155



>gb|ADZ96378.1| hexokinase 1 [Eriobotrya japonica]
Length=497

 Score =   220 bits (560),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            R  MRSSGRWA+  A++KELEEKCGTP GKLRQVADAMAVEMHAGLASEGGSKLKM+ISY
Sbjct  24   RRRMRSSGRWARASAIIKELEEKCGTPTGKLRQVADAMAVEMHAGLASEGGSKLKMIISY  83

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLP+G+E+GLFYALDLGGTNFRV+RVQLGGK +G++++E  EVSIP +LMVG+S+ALF
Sbjct  84   VDNLPTGNEKGLFYALDLGGTNFRVLRVQLGGKGRGIISQEFIEVSIPENLMVGTSDALF  143

Query  489  DFIAHELAMFV  521
            D+IA ELA FV
Sbjct  144  DYIAAELAKFV  154



>gb|KCW82326.1| hypothetical protein EUGRSUZ_C03728 [Eucalyptus grandis]
Length=417

 Score =   218 bits (554),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 102/131 (78%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            R  M+ SG+WA+ +A+LKE E+KCGTP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  26   RRQMKRSGKWARAMAILKEFEDKCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  85

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLP+G+E+GLFYALDLGGTNFRV+RVQLGGKEKGVV++E +EVSIP +LM+GSSEALF
Sbjct  86   VDNLPTGNEQGLFYALDLGGTNFRVLRVQLGGKEKGVVSQEFEEVSIPPYLMIGSSEALF  145

Query  489  DFIAHELAMFV  521
            ++IA  LA FV
Sbjct  146  NYIAEALAKFV  156



>ref|XP_008380854.1| PREDICTED: hexokinase-1-like isoform X2 [Malus domestica]
Length=398

 Score =   217 bits (553),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            RH MRSSGRWA+  A++KELEEKCGTP  KLRQVADAMAVEMHAGLASEGGSKLKM+ISY
Sbjct  24   RHRMRSSGRWARASAIIKELEEKCGTPTEKLRQVADAMAVEMHAGLASEGGSKLKMIISY  83

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLP+G+E+GLFYALDLGGTNFRV+RV LGGK +G+V++E  EVSIP +LMVG+S+ALF
Sbjct  84   VDNLPTGNEKGLFYALDLGGTNFRVLRVHLGGKGRGIVSQEFIEVSIPENLMVGTSDALF  143

Query  489  DFIAHELAMFV  521
            D+IA ELA FV
Sbjct  144  DYIAAELAKFV  154



>ref|XP_007203872.1| hypothetical protein PRUPE_ppa004637mg [Prunus persica]
 gb|EMJ05071.1| hypothetical protein PRUPE_ppa004637mg [Prunus persica]
Length=498

 Score =   219 bits (558),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 116/131 (89%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            RH M+ SGRWA+ +A+L+E E+KCGTP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RHRMKCSGRWARAMAILREFEDKCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLP+GDE+GLFYALDLGGTNFRV+RVQLGGKEK VV +E  EVSIP +LM G+SEALF
Sbjct  85   VDNLPTGDEQGLFYALDLGGTNFRVIRVQLGGKEKRVVKQEFDEVSIPPNLMTGTSEALF  144

Query  489  DFIAHELAMFV  521
            DFIA  LA FV
Sbjct  145  DFIAEALAKFV  155



>gb|AID50967.1| hexokinase 1 [Malus domestica]
Length=498

 Score =   219 bits (557),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            RH M+SSGRWA+ +A+L+ELE+KCGTP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RHRMKSSGRWARAMAILRELEDKCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLP+GDE GLFYALDLGGTNFRV+RV+LGG EK VV +E  EVSIP HLM G+SE LF
Sbjct  85   VDNLPTGDENGLFYALDLGGTNFRVLRVRLGGNEKRVVKQEFDEVSIPPHLMTGTSEGLF  144

Query  489  DFIAHELAMFV  521
            DFIA  LA FV
Sbjct  145  DFIAEALAKFV  155



>ref|XP_008337603.1| PREDICTED: hexokinase-1-like [Malus domestica]
Length=498

 Score =   219 bits (557),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            RH M+SSGRWA+ +A+L+ELE+KCGTP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RHRMKSSGRWARAMAILRELEDKCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLP+GDE GLFYALDLGGTNFRV+RV+LGG EK VV +E  EVSIP HLM G+SE LF
Sbjct  85   VDNLPTGDENGLFYALDLGGTNFRVLRVRLGGNEKRVVKQEFDEVSIPPHLMTGTSEGLF  144

Query  489  DFIAHELAMFV  521
            DFIA  LA FV
Sbjct  145  DFIAEALAKFV  155



>ref|XP_006451308.1| hypothetical protein CICLE_v10008086mg [Citrus clementina]
 ref|XP_006451311.1| hypothetical protein CICLE_v10008086mg [Citrus clementina]
 gb|ESR64548.1| hypothetical protein CICLE_v10008086mg [Citrus clementina]
 gb|ESR64551.1| hypothetical protein CICLE_v10008086mg [Citrus clementina]
 gb|KDO66590.1| hypothetical protein CISIN_1g010895mg [Citrus sinensis]
 gb|KDO66591.1| hypothetical protein CISIN_1g010895mg [Citrus sinensis]
 gb|KDO66592.1| hypothetical protein CISIN_1g010895mg [Citrus sinensis]
Length=343

 Score =   214 bits (546),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            R  M+S+GRWA+ VA+LKE+EEKCGTP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RRRMKSTGRWARAVAILKEMEEKCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLP+GDE+GLFYALDLGGTNFRV+RVQLGG+E  VV +E +EVSIP HLM GSS  LF
Sbjct  85   VDNLPTGDEKGLFYALDLGGTNFRVLRVQLGGREGRVVKQEFEEVSIPPHLMTGSSHELF  144

Query  489  DFIAHELAMFV  521
            D+IA  LA FV
Sbjct  145  DYIAAALAKFV  155



>ref|XP_010049611.1| PREDICTED: hexokinase-1-like [Eucalyptus grandis]
 gb|KCW82325.1| hypothetical protein EUGRSUZ_C03728 [Eucalyptus grandis]
Length=500

 Score =   219 bits (557),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 102/131 (78%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            R  M+ SG+WA+ +A+LKE E+KCGTP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  26   RRQMKRSGKWARAMAILKEFEDKCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  85

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLP+G+E+GLFYALDLGGTNFRV+RVQLGGKEKGVV++E +EVSIP +LM+GSSEALF
Sbjct  86   VDNLPTGNEQGLFYALDLGGTNFRVLRVQLGGKEKGVVSQEFEEVSIPPYLMIGSSEALF  145

Query  489  DFIAHELAMFV  521
            ++IA  LA FV
Sbjct  146  NYIAEALAKFV  156



>gb|KDO66588.1| hypothetical protein CISIN_1g010895mg [Citrus sinensis]
Length=356

 Score =   214 bits (545),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            R  M+S+GRWA+ VA+LKE+EEKCGTP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RRRMKSTGRWARAVAILKEMEEKCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLP+GDE+GLFYALDLGGTNFRV+RVQLGG+E  VV +E +EVSIP HLM GSS  LF
Sbjct  85   VDNLPTGDEKGLFYALDLGGTNFRVLRVQLGGREGRVVKQEFEEVSIPPHLMTGSSHELF  144

Query  489  DFIAHELAMFV  521
            D+IA  LA FV
Sbjct  145  DYIAAALAKFV  155



>ref|XP_007013021.1| Hexokinase 1 isoform 2 [Theobroma cacao]
 gb|EOY30640.1| Hexokinase 1 isoform 2 [Theobroma cacao]
Length=498

 Score =   218 bits (554),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 102/131 (78%), Positives = 117/131 (89%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            RH ++SSG+WA+T+A+LKE EEKCGTP  KL+QVADAM VEMHAGLASEGGSKLKM+ISY
Sbjct  25   RHRIKSSGKWARTLAILKEFEEKCGTPISKLKQVADAMTVEMHAGLASEGGSKLKMIISY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLP+GDE+GLFYALDLGGTNFRV+RVQLGGKE  VV +E +EVSIP HLM GSS+ALF
Sbjct  85   VDNLPTGDEKGLFYALDLGGTNFRVLRVQLGGKESRVVKQEFEEVSIPPHLMTGSSDALF  144

Query  489  DFIAHELAMFV  521
            D+IA  LA FV
Sbjct  145  DYIASALAKFV  155



>ref|XP_003516735.1| PREDICTED: hexokinase-1-like [Glycine max]
Length=496

 Score =   218 bits (554),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 114/131 (87%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            RH MRSSG+W + VA++KE EE+C TP GKLRQVADAM VEMHAGLASEGGSKLKMLI+Y
Sbjct  25   RHRMRSSGKWGRVVAIVKEFEEQCRTPIGKLRQVADAMDVEMHAGLASEGGSKLKMLITY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLPSGDE+GLFYALDLGGTNFR +RV LGGKEKGVV  ES EVSIP HLM GSS+ LF
Sbjct  85   VDNLPSGDEKGLFYALDLGGTNFRTLRVHLGGKEKGVVKIESDEVSIPPHLMTGSSQELF  144

Query  489  DFIAHELAMFV  521
            DFIA +LA FV
Sbjct  145  DFIASKLAKFV  155



>gb|AEJ95926.1| HXK1 [Vitis vinifera]
Length=470

 Score =   217 bits (552),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 103/128 (80%), Positives = 116/128 (91%), Gaps = 0/128 (0%)
 Frame = +3

Query  138  MRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDN  317
            MRSSGRWA+ +A+L+E EEKCGTP  KLRQVADAM VEMHAGLASEGGSKLKM+ISYVDN
Sbjct  1    MRSSGRWARAMAILREFEEKCGTPIAKLRQVADAMTVEMHAGLASEGGSKLKMIISYVDN  60

Query  318  LPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFI  497
            LP+GDE+GLFYALDLGGTNFRV+RVQLGGK+K VV +E +EVSIP HLMVGSS+ALFD+I
Sbjct  61   LPTGDEKGLFYALDLGGTNFRVLRVQLGGKDKRVVKQEFEEVSIPPHLMVGSSDALFDYI  120

Query  498  AHELAMFV  521
            A  LA FV
Sbjct  121  AAALAKFV  128



>ref|XP_010249484.1| PREDICTED: hexokinase-1 [Nelumbo nucifera]
Length=498

 Score =   217 bits (553),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 104/132 (79%), Positives = 114/132 (86%), Gaps = 0/132 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            RH MR SGRWA+ +A+L+E EEKC TP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RHRMRCSGRWARAMAILREFEEKCATPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLP+G+E GLFYALDLGGTNFRV+RVQLGGK+  VVN+E  EVSIP HLM G SE LF
Sbjct  85   VDNLPTGNERGLFYALDLGGTNFRVLRVQLGGKDGRVVNQEFAEVSIPPHLMTGGSEELF  144

Query  489  DFIAHELAMFVK  524
            D+IA ELA FVK
Sbjct  145  DYIAAELAKFVK  156



>gb|KHN40379.1| Hexokinase-2 [Glycine soja]
Length=503

 Score =   217 bits (553),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 102/131 (78%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            RH MRSSG+W + VA++KE EE+CGTP GKLRQVADAM VEMH GLASEGGSKLKMLI+Y
Sbjct  23   RHRMRSSGKWGRAVAIVKEFEEQCGTPIGKLRQVADAMNVEMHEGLASEGGSKLKMLITY  82

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLPSGDE+G+FYALDLGGTNFR +RV LGGKEKGVVN ES++VSIP HLM GSS  LF
Sbjct  83   VDNLPSGDEKGVFYALDLGGTNFRTLRVHLGGKEKGVVNLESEKVSIPPHLMTGSSHELF  142

Query  489  DFIAHELAMFV  521
            DF+A +LA FV
Sbjct  143  DFVAAKLAKFV  153



>ref|XP_003516783.1| PREDICTED: hexokinase-1-like [Glycine max]
Length=496

 Score =   217 bits (553),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 102/131 (78%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            RH MRSSG+W + VA++KE EE+CGTP GKLRQVADAM VEMH GLASEGGSKLKMLI+Y
Sbjct  23   RHRMRSSGKWGRAVAIVKEFEEQCGTPIGKLRQVADAMNVEMHEGLASEGGSKLKMLITY  82

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLPSGDE+G+FYALDLGGTNFR +RV LGGKEKGVVN ES++VSIP HLM GSS  LF
Sbjct  83   VDNLPSGDEKGVFYALDLGGTNFRTLRVHLGGKEKGVVNLESEKVSIPPHLMTGSSHELF  142

Query  489  DFIAHELAMFV  521
            DF+A +LA FV
Sbjct  143  DFVAAKLAKFV  153



>gb|KDP33801.1| hypothetical protein JCGZ_07372 [Jatropha curcas]
Length=498

 Score =   217 bits (552),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 116/131 (89%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            RH M+SSGRWA+ +A+L+E EEKCGTP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RHRMQSSGRWARAMAILREFEEKCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLP+GDE+GLFYALDLGGTNFRV+RV LGG+E  VV +E +EVSIP HLM GSS+ALF
Sbjct  85   VDNLPTGDEKGLFYALDLGGTNFRVIRVLLGGREDRVVKQEFEEVSIPPHLMTGSSDALF  144

Query  489  DFIAHELAMFV  521
            D+IA  LA FV
Sbjct  145  DYIAEALAKFV  155



>emb|CDP03250.1| unnamed protein product [Coffea canephora]
Length=497

 Score =   217 bits (552),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            R+ M+S G+WAK +A+LKE EE+CGTP  KLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RNRMKSLGKWAKVMAILKEFEEECGTPTAKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLP+GDE GLFYALDLGGTNFRV+RVQLGG EK VV RE QEVSIP HLMVGS+EALF
Sbjct  85   VDNLPTGDERGLFYALDLGGTNFRVLRVQLGGHEKRVVKREFQEVSIPPHLMVGSTEALF  144

Query  489  DFIAHELAMFV  521
            D+IA  LA FV
Sbjct  145  DYIAGALARFV  155



>ref|NP_001280783.1| uncharacterized protein LOC103443741 [Malus domestica]
 gb|AFU56883.1| hexokinase [Malus domestica]
Length=497

 Score =   216 bits (551),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 102/131 (78%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            RH MRSSGRWA+  A++KELEEKCGTP  KLRQVADAMAVEMHAGLASEGGSKLK++ISY
Sbjct  24   RHRMRSSGRWARASAIIKELEEKCGTPTEKLRQVADAMAVEMHAGLASEGGSKLKVIISY  83

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLP+G+E+GLFYALDLGGTNFRV+RV+LGGK +G+V++E  EVSIP +LMVG+S+ALF
Sbjct  84   VDNLPTGNEKGLFYALDLGGTNFRVLRVRLGGKGRGIVSQEFIEVSIPENLMVGTSDALF  143

Query  489  DFIAHELAMFV  521
            D+IA ELA FV
Sbjct  144  DYIAAELAKFV  154



>ref|XP_006451309.1| hypothetical protein CICLE_v10008086mg [Citrus clementina]
 gb|ESR64549.1| hypothetical protein CICLE_v10008086mg [Citrus clementina]
 gb|KDO66589.1| hypothetical protein CISIN_1g010895mg [Citrus sinensis]
Length=402

 Score =   214 bits (544),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            R  M+S+GRWA+ VA+LKE+EEKCGTP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RRRMKSTGRWARAVAILKEMEEKCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLP+GDE+GLFYALDLGGTNFRV+RVQLGG+E  VV +E +EVSIP HLM GSS  LF
Sbjct  85   VDNLPTGDEKGLFYALDLGGTNFRVLRVQLGGREGRVVKQEFEEVSIPPHLMTGSSHELF  144

Query  489  DFIAHELAMFV  521
            D+IA  LA FV
Sbjct  145  DYIAAALAKFV  155



>gb|KDO66582.1| hypothetical protein CISIN_1g010895mg [Citrus sinensis]
Length=465

 Score =   215 bits (547),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            R  M+S+GRWA+ VA+LKE+EEKCGTP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RRRMKSTGRWARAVAILKEMEEKCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLP+GDE+GLFYALDLGGTNFRV+RVQLGG+E  VV +E +EVSIP HLM GSS  LF
Sbjct  85   VDNLPTGDEKGLFYALDLGGTNFRVLRVQLGGREGRVVKQEFEEVSIPPHLMTGSSHELF  144

Query  489  DFIAHELAMFV  521
            D+IA  LA FV
Sbjct  145  DYIAAALAKFV  155



>gb|KDO66587.1| hypothetical protein CISIN_1g010895mg [Citrus sinensis]
Length=424

 Score =   214 bits (545),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            R  M+S+GRWA+ VA+LKE+EEKCGTP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RRRMKSTGRWARAVAILKEMEEKCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLP+GDE+GLFYALDLGGTNFRV+RVQLGG+E  VV +E +EVSIP HLM GSS  LF
Sbjct  85   VDNLPTGDEKGLFYALDLGGTNFRVLRVQLGGREGRVVKQEFEEVSIPPHLMTGSSHELF  144

Query  489  DFIAHELAMFV  521
            D+IA  LA FV
Sbjct  145  DYIAAALAKFV  155



>ref|XP_007152969.1| hypothetical protein PHAVU_004G175500g [Phaseolus vulgaris]
 gb|ESW24963.1| hypothetical protein PHAVU_004G175500g [Phaseolus vulgaris]
Length=500

 Score =   215 bits (548),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            RHHMRSSG+W + VA+++E E++CGTP  KLR VADA+ VEMHAGLASEGGSKLKMLI++
Sbjct  25   RHHMRSSGKWGRAVAIVREFEKQCGTPIAKLRLVADAIDVEMHAGLASEGGSKLKMLITF  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLPSGDE+GLFYALDLGGTNFR +RVQLGGKEKGVVN ES+EVSIP HLM G S  LF
Sbjct  85   VDNLPSGDEKGLFYALDLGGTNFRTLRVQLGGKEKGVVNLESEEVSIPPHLMTGCSHELF  144

Query  489  DFIAHELAMFV  521
            DFIA +LA FV
Sbjct  145  DFIAAKLAKFV  155



>gb|AHY84731.1| hexokinase [Manihot esculenta]
Length=498

 Score =   215 bits (548),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 116/131 (89%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            RH MR SGRWA+ +A+L+E E+KCGTP GKLRQVADAM VEMHAGLASEGGSKLKML+SY
Sbjct  25   RHRMRCSGRWARAMAILREFEDKCGTPLGKLRQVADAMTVEMHAGLASEGGSKLKMLLSY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLP+GDE+GLFYALDLGGTNFRV+RV LGGK+  VV +E +EVSIP HLM+GSS+ALF
Sbjct  85   VDNLPTGDEKGLFYALDLGGTNFRVIRVVLGGKDDRVVKQEFEEVSIPPHLMIGSSDALF  144

Query  489  DFIAHELAMFV  521
            D+IA  LA FV
Sbjct  145  DYIAEALAKFV  155



>ref|XP_002514221.1| hexokinase, putative [Ricinus communis]
 gb|EEF48175.1| hexokinase, putative [Ricinus communis]
Length=498

 Score =   215 bits (547),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 102/131 (78%), Positives = 114/131 (87%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            RH M+SSGRW + +A+L E EEKCGTP GKLRQVADAM VEMHAGLASEGGSKLKM+ISY
Sbjct  25   RHRMKSSGRWTRAMAILGEFEEKCGTPVGKLRQVADAMTVEMHAGLASEGGSKLKMIISY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLP+GDE+GLFYALDLGGTNFRV+RV LGGKE  VV +E +EVSIP HLM+GSS+ALF
Sbjct  85   VDNLPTGDEKGLFYALDLGGTNFRVLRVLLGGKEDRVVKQEFEEVSIPPHLMIGSSDALF  144

Query  489  DFIAHELAMFV  521
            DFIA  L  FV
Sbjct  145  DFIADALKKFV  155



>ref|NP_001275786.1| hexokinase [Citrus sinensis]
 ref|XP_006451310.1| hypothetical protein CICLE_v10008086mg [Citrus clementina]
 gb|AAG28503.1|AF196966_1 hexokinase [Citrus sinensis]
 gb|ESR64550.1| hypothetical protein CICLE_v10008086mg [Citrus clementina]
 gb|KDO66583.1| hypothetical protein CISIN_1g010895mg [Citrus sinensis]
Length=498

 Score =   215 bits (547),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            R  M+S+GRWA+ VA+LKE+EEKCGTP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RRRMKSTGRWARAVAILKEMEEKCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLP+GDE+GLFYALDLGGTNFRV+RVQLGG+E  VV +E +EVSIP HLM GSS  LF
Sbjct  85   VDNLPTGDEKGLFYALDLGGTNFRVLRVQLGGREGRVVKQEFEEVSIPPHLMTGSSHELF  144

Query  489  DFIAHELAMFV  521
            D+IA  LA FV
Sbjct  145  DYIAAALAKFV  155



>ref|XP_011093636.1| PREDICTED: hexokinase-1 [Sesamum indicum]
Length=496

 Score =   214 bits (545),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 115/131 (88%), Gaps = 1/131 (1%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            R  M+SSGRWAK  A+L+ELEEKCGTP  KLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RRQMKSSGRWAKAEAILRELEEKCGTPTAKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLP+GDE+GLFYALDLGGTNFRVMRVQLGGK+ G++ +E +EVSIP HLMVGSS  LF
Sbjct  85   VDNLPTGDEKGLFYALDLGGTNFRVMRVQLGGKD-GIMKQEFEEVSIPPHLMVGSSHELF  143

Query  489  DFIAHELAMFV  521
            DFIA  LA FV
Sbjct  144  DFIAAALAKFV  154



>gb|AAS60194.1| hexokinase 3 [Nicotiana tabacum]
Length=497

 Score =   214 bits (545),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            RH MR S +WA+  A+LKE EEKCGTP  KL+QVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RHRMRKSSKWARARAILKEFEEKCGTPDAKLKQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLP+GDEEG+FYALDLGGTNFRV+RVQLGGK+ G+V++E  E SIP +LMVG+SEALF
Sbjct  85   VDNLPTGDEEGVFYALDLGGTNFRVLRVQLGGKDGGIVHQEFTEASIPPNLMVGTSEALF  144

Query  489  DFIAHELAMFV  521
            D+IA ELA FV
Sbjct  145  DYIAAELAKFV  155



>ref|XP_009777315.1| PREDICTED: hexokinase-2 [Nicotiana sylvestris]
Length=497

 Score =   214 bits (544),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            RH MR S +WA+  A+LKE EEKCGTP  KL+QVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RHRMRKSSKWARARAILKEFEEKCGTPDAKLKQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLP+GDEEG+FYALDLGGTNFRV+RVQLGGK+ G+V++E  E SIP +LMVG+SEALF
Sbjct  85   VDNLPTGDEEGVFYALDLGGTNFRVLRVQLGGKDGGIVHQEFTEASIPPNLMVGTSEALF  144

Query  489  DFIAHELAMFV  521
            D+IA ELA FV
Sbjct  145  DYIAAELAKFV  155



>ref|XP_009406171.1| PREDICTED: hexokinase-2-like [Musa acuminata subsp. malaccensis]
Length=500

 Score =   214 bits (544),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 113/131 (86%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            RH MRSSGR A+  ALLKELEE+C TP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RHRMRSSGRCARAAALLKELEERCATPLGKLRQVADAMMVEMHAGLASEGGSKLKMLISY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VD LP+GDE GLFYALDLGGTNFRV+RVQLGGKE+ VV +E +EVSIP HLMVG S+ LF
Sbjct  85   VDKLPTGDETGLFYALDLGGTNFRVLRVQLGGKEQRVVKKEPKEVSIPPHLMVGGSDELF  144

Query  489  DFIAHELAMFV  521
            DFIA  LA FV
Sbjct  145  DFIASALAEFV  155



>gb|KHN40378.1| Hexokinase-1 [Glycine soja]
Length=482

 Score =   213 bits (543),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 102/130 (78%), Positives = 113/130 (87%), Gaps = 0/130 (0%)
 Frame = +3

Query  132  HHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYV  311
            + MRSSG+W + VA++KE EE+C TP GKLRQVADAM VEMHAGLASEGGSKLKMLI+YV
Sbjct  12   YRMRSSGKWGRVVAIVKEFEEQCRTPIGKLRQVADAMDVEMHAGLASEGGSKLKMLITYV  71

Query  312  DNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFD  491
            DNLPSGDE+GLFYALDLGGTNFR +RV LGGKEKGVV  ES EVSIP HLM GSS+ LFD
Sbjct  72   DNLPSGDEKGLFYALDLGGTNFRTLRVHLGGKEKGVVKIESDEVSIPPHLMTGSSQELFD  131

Query  492  FIAHELAMFV  521
            FIA +LA FV
Sbjct  132  FIASKLAKFV  141



>ref|XP_010110881.1| hypothetical protein L484_006996 [Morus notabilis]
 gb|EXC28700.1| hypothetical protein L484_006996 [Morus notabilis]
Length=386

 Score =   210 bits (535),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 114/131 (87%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            RH M+SSG+WA+ +A+LKE EEK  TP GKLRQVADAMAVEMHAGLASEGGSKLKMLISY
Sbjct  26   RHRMKSSGKWARAMAILKEFEEKGATPIGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  85

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLP+GDE+GL+YALDLGGTNFRV+RVQLGGKE  V  +E  EVSIP HLM GSS+ALF
Sbjct  86   VDNLPTGDEKGLYYALDLGGTNFRVLRVQLGGKEGRVDKQEFDEVSIPPHLMTGSSDALF  145

Query  489  DFIAHELAMFV  521
            DFIA  LA FV
Sbjct  146  DFIAGALAKFV  156



>ref|XP_010098150.1| hypothetical protein L484_026284 [Morus notabilis]
 gb|EXB74587.1| hypothetical protein L484_026284 [Morus notabilis]
Length=499

 Score =   213 bits (542),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 99/131 (76%), Positives = 116/131 (89%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            RH MRSS RW + +A++ +L+E+CGTP  KLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RHRMRSSARWVRAMAIVADLDERCGTPLAKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLP+G+E+GLFYALDLGGTNFRV+RVQLGGK+ G+VN+E  EVSIP+ LMVGSS+ LF
Sbjct  85   VDNLPTGNEKGLFYALDLGGTNFRVLRVQLGGKDGGIVNQEFAEVSIPQDLMVGSSDTLF  144

Query  489  DFIAHELAMFV  521
            D+IA ELA FV
Sbjct  145  DYIAAELAKFV  155



>ref|XP_010267128.1| PREDICTED: hexokinase-1-like [Nelumbo nucifera]
Length=500

 Score =   213 bits (541),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 112/131 (85%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            RH MR SGRWA+ +A+LKE EEKC TP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  27   RHRMRCSGRWARAMAILKEFEEKCATPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  86

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLP+GDE+GLFYALDLGGTNFRV+RVQLGG +  V+ +E  EVSIP HLM G S+ LF
Sbjct  87   VDNLPTGDEKGLFYALDLGGTNFRVLRVQLGGNDGQVLKQEFTEVSIPPHLMTGGSDELF  146

Query  489  DFIAHELAMFV  521
            D+IA ELA FV
Sbjct  147  DYIASELAKFV  157



>ref|XP_009392524.1| PREDICTED: hexokinase-2-like [Musa acuminata subsp. malaccensis]
Length=500

 Score =   213 bits (541),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            R+ MRSSGRWA+  ALLKELEE+C TP GKLRQVADAMAVEMHAGLASEGGSKLKMLISY
Sbjct  25   RYRMRSSGRWARVAALLKELEERCATPVGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            V+NLP+G+E GLFYALDLGGTNFRV+RVQLGGKE+ V+ +E +EVSIP  LMVG S+ LF
Sbjct  85   VNNLPTGEETGLFYALDLGGTNFRVLRVQLGGKERHVLKQEFEEVSIPPLLMVGGSDELF  144

Query  489  DFIAHELAMFV  521
            DFIA  LA FV
Sbjct  145  DFIASALAKFV  155



>ref|XP_004302852.1| PREDICTED: hexokinase-1-like [Fragaria vesca subsp. vesca]
Length=498

 Score =   212 bits (540),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 100/131 (76%), Positives = 113/131 (86%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            R  MR  G W+K  A++KELEEKCGTP  KLRQVADAM VEMHAGLASEGGSKLKM+ISY
Sbjct  24   RQRMRCCGEWSKATAIVKELEEKCGTPIAKLRQVADAMTVEMHAGLASEGGSKLKMIISY  83

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLP+G+E+GLFYALDLGGTNFRV+RVQLGGK +G+VN+E  EVSIP  LMVG++E LF
Sbjct  84   VDNLPTGNEKGLFYALDLGGTNFRVLRVQLGGKGRGLVNQEFTEVSIPEGLMVGTTETLF  143

Query  489  DFIAHELAMFV  521
            DFIA ELA FV
Sbjct  144  DFIATELAKFV  154



>ref|XP_011008120.1| PREDICTED: hexokinase-1-like [Populus euphratica]
Length=498

 Score =   212 bits (540),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 102/131 (78%), Positives = 113/131 (86%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            RH MR SGRWA+ +A+L+E EE CGTP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RHRMRCSGRWARAMAILREFEENCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLPSG+E GLFYALDLGGTNFRV+RV LGG++ GVV +E +EVSIP HLM GSS+ALF
Sbjct  85   VDNLPSGEENGLFYALDLGGTNFRVIRVLLGGRDGGVVKQEFEEVSIPPHLMTGSSDALF  144

Query  489  DFIAHELAMFV  521
             FIA  LA FV
Sbjct  145  GFIATALANFV  155



>ref|XP_010688341.1| PREDICTED: hexokinase-1 [Beta vulgaris subsp. vulgaris]
Length=498

 Score =   212 bits (540),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 102/131 (78%), Positives = 114/131 (87%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            R  M+SS +WA+ +A+LKEL+EKC TP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RQRMKSSSKWARAMAILKELDEKCETPLGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLP+GDE GLFYALDLGGTNFRV+RV+LGGKEKGVV +E  EVSIP  LMVG+SE LF
Sbjct  85   VDNLPTGDEHGLFYALDLGGTNFRVLRVKLGGKEKGVVQQEFDEVSIPPELMVGTSEELF  144

Query  489  DFIAHELAMFV  521
            D+IA  LA FV
Sbjct  145  DYIAAALAKFV  155



>ref|XP_002325031.1| Hexokinase 1 family protein [Populus trichocarpa]
 gb|EEF03596.1| Hexokinase 1 family protein [Populus trichocarpa]
Length=498

 Score =   212 bits (540),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 102/131 (78%), Positives = 113/131 (86%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            RH MR SGRWA+ +A+L+E EE CGTP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RHRMRCSGRWARAMAILREFEENCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLPSG+E GLFYALDLGGTNFRV+RV LGG++ GVV +E +EVSIP HLM GSS+ALF
Sbjct  85   VDNLPSGEENGLFYALDLGGTNFRVIRVLLGGRDGGVVKQEFEEVSIPPHLMTGSSDALF  144

Query  489  DFIAHELAMFV  521
             FIA  LA FV
Sbjct  145  GFIATALANFV  155



>ref|XP_004287480.1| PREDICTED: hexokinase-1 [Fragaria vesca subsp. vesca]
Length=498

 Score =   212 bits (539),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 102/131 (78%), Positives = 113/131 (86%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            R  ++SS RWA+ +A+LKE EEKC TP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RRRLKSSRRWARAMAILKEFEEKCDTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLP+GDE+GLFYALDLGGTNFRV+RVQLGGKEK V+ +E  EVSIP HLM G+SE LF
Sbjct  85   VDNLPTGDEKGLFYALDLGGTNFRVLRVQLGGKEKRVIKQEFDEVSIPPHLMTGTSEGLF  144

Query  489  DFIAHELAMFV  521
            DFIA  LA FV
Sbjct  145  DFIAEALAKFV  155



>gb|AAT77511.1| hexokinase [Nicotiana sylvestris]
Length=383

 Score =   209 bits (531),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 114/131 (87%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
             H MR S +WA+ +A+L+E EEKCGTP  KL+QVADAM VEMHAGLASEGGSKLKMLI+Y
Sbjct  25   NHRMRKSSKWARAMAILREFEEKCGTPDAKLKQVADAMTVEMHAGLASEGGSKLKMLITY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLP+GDE G+FYALDLGGTNFRV+RVQLGGK+ G+V++E  E SIP +LMVG+SEALF
Sbjct  85   VDNLPTGDEAGVFYALDLGGTNFRVLRVQLGGKDGGIVHQEFAEASIPPNLMVGTSEALF  144

Query  489  DFIAHELAMFV  521
            D+IA ELA FV
Sbjct  145  DYIAAELAKFV  155



>ref|XP_009622660.1| PREDICTED: hexokinase-2 [Nicotiana tomentosiformis]
Length=497

 Score =   212 bits (539),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/131 (76%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            RH MR S +WA+ +A+LKE EEKC TP  KL+QVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RHRMRKSSKWARAMAILKEFEEKCRTPDAKLKQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLP+GDEEG+FYALDLGGTNFRV+RVQLGGK+ G+V++E  E SIP +LMVG+SEALF
Sbjct  85   VDNLPTGDEEGVFYALDLGGTNFRVLRVQLGGKDGGIVHQEFAEASIPPNLMVGTSEALF  144

Query  489  DFIAHELAMFV  521
            D+IA ELA FV
Sbjct  145  DYIAAELAKFV  155



>gb|KJB83118.1| hypothetical protein B456_013G230400 [Gossypium raimondii]
Length=364

 Score =   208 bits (529),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 113/130 (87%), Gaps = 0/130 (0%)
 Frame = +3

Query  132  HHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYV  311
            H M+SSG+WA+  ++LK+ EEKCGTP  KL+QVADAM VEMHAGLASEGGSKLKM+ISYV
Sbjct  26   HRMKSSGKWAQAQSILKDFEEKCGTPISKLKQVADAMTVEMHAGLASEGGSKLKMIISYV  85

Query  312  DNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFD  491
            DNLP+GDE+GLFYALDLGGTNFRV+RV LGGKE  VV +E +EVSIP HLM GSS+ALFD
Sbjct  86   DNLPTGDEKGLFYALDLGGTNFRVLRVHLGGKEHRVVKQEFEEVSIPPHLMTGSSDALFD  145

Query  492  FIAHELAMFV  521
            +IA  LA FV
Sbjct  146  YIAEALAKFV  155



>ref|XP_011014418.1| PREDICTED: hexokinase-1-like [Populus euphratica]
Length=498

 Score =   211 bits (538),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 102/131 (78%), Positives = 113/131 (86%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            RH MR SGRWA+ +A+L+E EE CGTP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RHRMRCSGRWARAMAILREFEENCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLPSG+E GLFYALDLGGTNFRV+RV LGG++ GVV +E +EVSIP HLM GSS+ALF
Sbjct  85   VDNLPSGEENGLFYALDLGGTNFRVIRVLLGGRDGGVVKQEFEEVSIPPHLMTGSSDALF  144

Query  489  DFIAHELAMFV  521
             FIA  LA FV
Sbjct  145  GFIATVLANFV  155



>ref|XP_009795017.1| PREDICTED: hexokinase-2-like [Nicotiana sylvestris]
Length=498

 Score =   211 bits (537),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 102/132 (77%), Positives = 115/132 (87%), Gaps = 1/132 (1%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            RH M++SG+WAK + +LKE EEKC TP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RHKMKNSGKWAKAMDMLKEFEEKCETPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVG-SSEAL  485
            VDNLP+GDE GLFYALDLGGTNFRVMRVQLGGKEK +V +E +EVSIP+++M G SS+AL
Sbjct  85   VDNLPTGDETGLFYALDLGGTNFRVMRVQLGGKEKRIVKQEVKEVSIPKNVMAGSSSDAL  144

Query  486  FDFIAHELAMFV  521
            FDFIA  L  FV
Sbjct  145  FDFIATTLVKFV  156



>ref|XP_008795842.1| PREDICTED: hexokinase-2-like isoform X2 [Phoenix dactylifera]
Length=500

 Score =   211 bits (537),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 113/131 (86%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            RH MRSSGRWA+ +A+LK+LEEKC TP GKLRQVADAM VEM AGLASEGGSKLKMLISY
Sbjct  25   RHRMRSSGRWARAMAILKDLEEKCATPIGKLRQVADAMTVEMLAGLASEGGSKLKMLISY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLP+GDE GLFYALDLGGTNFRV+RVQLGGK   VV +E +EVSIP +LMVGSS  LF
Sbjct  85   VDNLPTGDETGLFYALDLGGTNFRVLRVQLGGKGGYVVRQEFEEVSIPPNLMVGSSSELF  144

Query  489  DFIAHELAMFV  521
            DFIA  LA FV
Sbjct  145  DFIAAALAKFV  155



>ref|XP_009415191.1| PREDICTED: hexokinase-2-like [Musa acuminata subsp. malaccensis]
Length=498

 Score =   211 bits (537),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 102/131 (78%), Positives = 112/131 (85%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            R+ MRSSG+WA   A++KELEE+C TP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  26   RNRMRSSGKWAPVSAVVKELEERCATPVGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  85

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLP+GDE GLFYALDLGGTNFRV+RVQLGGKE  V  +E +EVSIP HLMVG S+ LF
Sbjct  86   VDNLPTGDETGLFYALDLGGTNFRVLRVQLGGKEGRVAKQEFEEVSIPPHLMVGGSDELF  145

Query  489  DFIAHELAMFV  521
            DFIA  LA FV
Sbjct  146  DFIASALAKFV  156



>gb|AAS60195.1| hexokinase 4a [Nicotiana tabacum]
Length=498

 Score =   211 bits (537),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 102/132 (77%), Positives = 115/132 (87%), Gaps = 1/132 (1%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            RH M++SG+WAK + +LKE EEKC TP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RHKMKNSGKWAKAMDILKEFEEKCETPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVG-SSEAL  485
            VDNLP+GDE GLFYALDLGGTNFRVMRVQLGGKEK +V +E +EVSIP+++M G SS+AL
Sbjct  85   VDNLPTGDETGLFYALDLGGTNFRVMRVQLGGKEKRIVKQEVKEVSIPKNVMAGSSSDAL  144

Query  486  FDFIAHELAMFV  521
            FDFIA  L  FV
Sbjct  145  FDFIATALVKFV  156



>ref|XP_008795834.1| PREDICTED: hexokinase-2-like isoform X1 [Phoenix dactylifera]
Length=526

 Score =   211 bits (538),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 113/131 (86%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            RH MRSSGRWA+ +A+LK+LEEKC TP GKLRQVADAM VEM AGLASEGGSKLKMLISY
Sbjct  25   RHRMRSSGRWARAMAILKDLEEKCATPIGKLRQVADAMTVEMLAGLASEGGSKLKMLISY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLP+GDE GLFYALDLGGTNFRV+RVQLGGK   VV +E +EVSIP +LMVGSS  LF
Sbjct  85   VDNLPTGDETGLFYALDLGGTNFRVLRVQLGGKGGYVVRQEFEEVSIPPNLMVGSSSELF  144

Query  489  DFIAHELAMFV  521
            DFIA  LA FV
Sbjct  145  DFIAAALAKFV  155



>ref|XP_009601881.1| PREDICTED: hexokinase-2-like [Nicotiana tomentosiformis]
Length=498

 Score =   211 bits (536),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 102/132 (77%), Positives = 115/132 (87%), Gaps = 1/132 (1%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            RH M++SG+WAK + +LKE EEKC TP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RHKMKNSGKWAKAMDILKEFEEKCETPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVG-SSEAL  485
            VDNLP+GDE GLFYALDLGGTNFRVMRVQLGGKEK +V +E +EVSIP+++M G SS+AL
Sbjct  85   VDNLPTGDETGLFYALDLGGTNFRVMRVQLGGKEKRIVKQEVKEVSIPKNVMAGSSSDAL  144

Query  486  FDFIAHELAMFV  521
            FDFIA  L  FV
Sbjct  145  FDFIATALVEFV  156



>gb|AHG98487.1| hexokinase [Dimocarpus longan]
Length=496

 Score =   210 bits (535),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 100/131 (76%), Positives = 117/131 (89%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            RH M+SSG+WA+ +A+LK+LE+KCGTP GKLRQ+ADAM VEMHAGLASEGGSKLKMLIS+
Sbjct  25   RHRMQSSGKWARAMAILKDLEDKCGTPIGKLRQIADAMTVEMHAGLASEGGSKLKMLISF  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLP+GDE+GLFYALDLGG+NFRV+RV LGGKE  VV +E +EVSIP+HLMVGSS  LF
Sbjct  85   VDNLPTGDEKGLFYALDLGGSNFRVLRVLLGGKEGHVVKQEFKEVSIPQHLMVGSSHELF  144

Query  489  DFIAHELAMFV  521
            +FIA  LA FV
Sbjct  145  NFIAAALAKFV  155



>gb|AAS60196.1| hexokinase 4b [Nicotiana tabacum]
Length=498

 Score =   210 bits (534),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 102/132 (77%), Positives = 114/132 (86%), Gaps = 1/132 (1%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            RH M +SG+WAK + +LKE EEKC TP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RHKMENSGKWAKAMDILKEFEEKCETPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVG-SSEAL  485
            VDNLP+GDE GLFYALDLGGTNFRVMRVQLGGKEK +V +E +EVSIP+++M G SS+AL
Sbjct  85   VDNLPTGDETGLFYALDLGGTNFRVMRVQLGGKEKRIVKQEVKEVSIPKNVMAGSSSDAL  144

Query  486  FDFIAHELAMFV  521
            FDFIA  L  FV
Sbjct  145  FDFIATTLVKFV  156



>ref|XP_003529000.1| PREDICTED: hexokinase-1-like [Glycine max]
Length=498

 Score =   210 bits (534),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 100/131 (76%), Positives = 111/131 (85%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            RH  RSSG+W +  A+ KELEE+C TP  KLRQVADA+ VEMHAGLASEGG KLKMLI+Y
Sbjct  25   RHRTRSSGKWGRATAIAKELEEQCWTPISKLRQVADALDVEMHAGLASEGGCKLKMLITY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLPSGDE+GLFYALDLGGTNFR +RV LGGKEKGVV  ES+EVSIP HLM GSS+ LF
Sbjct  85   VDNLPSGDEKGLFYALDLGGTNFRTLRVHLGGKEKGVVKIESEEVSIPPHLMTGSSQELF  144

Query  489  DFIAHELAMFV  521
            DFIA +LA FV
Sbjct  145  DFIASKLAKFV  155



>ref|XP_011000949.1| PREDICTED: hexokinase-1-like [Populus euphratica]
Length=494

 Score =   209 bits (532),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 116/131 (89%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            +  M+   RWAK + ++KE++EKCGTP GKL+QVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  26   KRKMKRDRRWAKAMEMVKEMQEKCGTPIGKLKQVADAMVVEMHAGLASEGGSKLKMLISY  85

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLPSGDE+GLFYALDLGGTNFRV+RVQLGGK+ G+VN+E  EVSIP +LM+G+S+ALF
Sbjct  86   VDNLPSGDEKGLFYALDLGGTNFRVLRVQLGGKDGGLVNQEFTEVSIPPNLMIGTSDALF  145

Query  489  DFIAHELAMFV  521
            D+IA ELA F+
Sbjct  146  DYIAAELAKFI  156



>ref|XP_004503491.1| PREDICTED: hexokinase-1-like isoform X2 [Cicer arietinum]
Length=498

 Score =   209 bits (532),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 99/132 (75%), Positives = 113/132 (86%), Gaps = 0/132 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            RH M +S +W++ ++++KE EEKCGTP GKLRQ+ DAM VEMHAGLASEGGSKL MLISY
Sbjct  25   RHRMINSRKWSRALSIVKEFEEKCGTPIGKLRQLGDAMDVEMHAGLASEGGSKLSMLISY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLP+GDEEGLFYALDLGGTNFRV+RV LGGKEKGV+ +E  EVSIP HLM GSSE LF
Sbjct  85   VDNLPTGDEEGLFYALDLGGTNFRVLRVHLGGKEKGVIGQEFDEVSIPPHLMTGSSEGLF  144

Query  489  DFIAHELAMFVK  524
            DFIA  LA FV+
Sbjct  145  DFIAAALAKFVE  156



>ref|XP_002299739.1| hypothetical protein POPTR_0001s19130g [Populus trichocarpa]
 gb|EEE84544.1| hypothetical protein POPTR_0001s19130g [Populus trichocarpa]
Length=494

 Score =   209 bits (532),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 116/131 (89%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            +  M+   RWAK + ++KE++EKCGTP GKL+QVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  26   KRKMKRDRRWAKAMEMVKEMQEKCGTPIGKLKQVADAMVVEMHAGLASEGGSKLKMLISY  85

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLPSGDE+GLFYALDLGGTNFRV+RVQLGGK+ G+VN+E  EVSIP +LM+G+S+ALF
Sbjct  86   VDNLPSGDEKGLFYALDLGGTNFRVLRVQLGGKDGGLVNQEFTEVSIPPNLMIGTSDALF  145

Query  489  DFIAHELAMFV  521
            D+IA ELA F+
Sbjct  146  DYIAAELAKFI  156



>gb|KHG25517.1| Hexokinase-1 -like protein [Gossypium arboreum]
Length=498

 Score =   209 bits (532),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 114/131 (87%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            RH ++SSG+WA+ +++L E EEKCGTP+ KL+QVADAM VEMHAGLASEGGSKLKM+ISY
Sbjct  25   RHRIKSSGKWARALSILTEFEEKCGTPSSKLKQVADAMTVEMHAGLASEGGSKLKMIISY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLP+GDE+GLFYALDLGGTNFRV+RV LGGKE  VV +E +EVSIP HLM GSS+ LF
Sbjct  85   VDNLPTGDEKGLFYALDLGGTNFRVLRVHLGGKESRVVKQEFEEVSIPPHLMTGSSDELF  144

Query  489  DFIAHELAMFV  521
            D+IA  LA FV
Sbjct  145  DYIASALAKFV  155



>ref|XP_009803252.1| PREDICTED: hexokinase-1 [Nicotiana sylvestris]
 gb|AAS60192.1| hexokinase 1a [Nicotiana tabacum]
Length=497

 Score =   209 bits (531),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = +3

Query  132  HHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYV  311
            H MR S +WA+ +A+L+E EEKCGTP  KL+QVADAM VEMHAGLASEGGSKLKMLI+YV
Sbjct  26   HRMRKSSKWARAMAILREFEEKCGTPDAKLKQVADAMTVEMHAGLASEGGSKLKMLITYV  85

Query  312  DNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFD  491
            DNLP+GDE G+FYALDLGGTNFRV+RVQLGGK+ G+V++E  E SIP +LMVG+SEALFD
Sbjct  86   DNLPTGDEAGVFYALDLGGTNFRVLRVQLGGKDGGIVHQEFAEASIPPNLMVGTSEALFD  145

Query  492  FIAHELAMFV  521
            +IA ELA FV
Sbjct  146  YIAAELAKFV  155



>gb|KJB83117.1| hypothetical protein B456_013G230400 [Gossypium raimondii]
Length=498

 Score =   209 bits (531),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 113/130 (87%), Gaps = 0/130 (0%)
 Frame = +3

Query  132  HHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYV  311
            H M+SSG+WA+  ++LK+ EEKCGTP  KL+QVADAM VEMHAGLASEGGSKLKM+ISYV
Sbjct  26   HRMKSSGKWAQAQSILKDFEEKCGTPISKLKQVADAMTVEMHAGLASEGGSKLKMIISYV  85

Query  312  DNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFD  491
            DNLP+GDE+GLFYALDLGGTNFRV+RV LGGKE  VV +E +EVSIP HLM GSS+ALFD
Sbjct  86   DNLPTGDEKGLFYALDLGGTNFRVLRVHLGGKEHRVVKQEFEEVSIPPHLMTGSSDALFD  145

Query  492  FIAHELAMFV  521
            +IA  LA FV
Sbjct  146  YIAEALAKFV  155



>ref|XP_009606563.1| PREDICTED: hexokinase-1 [Nicotiana tomentosiformis]
Length=497

 Score =   209 bits (531),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 114/132 (86%), Gaps = 0/132 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
             H MR S +WA+ +A+L+E EEKCGTP  KL+QVADAM VEMHAGLASEGGSKLKMLI+Y
Sbjct  25   NHRMRKSSKWARAMAILREFEEKCGTPDAKLKQVADAMTVEMHAGLASEGGSKLKMLITY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLP+GDE G+FYALDLGGTNFRV+RVQLGGK+ G+V++E  E SIP +LMVG+SEALF
Sbjct  85   VDNLPTGDEAGVFYALDLGGTNFRVLRVQLGGKDGGIVHQEFAEASIPPNLMVGTSEALF  144

Query  489  DFIAHELAMFVK  524
            D+IA ELA FV 
Sbjct  145  DYIAAELAKFVN  156



>sp|Q9SEK2.1|HXK1_TOBAC RecName: Full=Hexokinase-1; AltName: Full=NtHxK1 [Nicotiana tabacum]
 gb|AAF18585.1|AF118133_1 chloroplast outer envelope hexokinase 1 [Nicotiana tabacum]
Length=497

 Score =   209 bits (531),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 114/132 (86%), Gaps = 0/132 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
             H MR S +WA+ +A+L+E EEKCGTP  KL+QVADAM VEMHAGLASEGGSKLKMLI+Y
Sbjct  25   NHRMRKSSKWARAMAILREFEEKCGTPDAKLKQVADAMTVEMHAGLASEGGSKLKMLITY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLP+GDE G+FYALDLGGTNFRV+RVQLGGK+ G+V++E  E SIP +LMVG+SEALF
Sbjct  85   VDNLPTGDEAGVFYALDLGGTNFRVLRVQLGGKDGGIVHQEFAEASIPPNLMVGTSEALF  144

Query  489  DFIAHELAMFVK  524
            D+IA ELA FV 
Sbjct  145  DYIAAELAKFVN  156



>gb|EYU45835.1| hypothetical protein MIMGU_mgv1a005054mg [Erythranthe guttata]
Length=498

 Score =   209 bits (531),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 114/131 (87%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            R  M+SSGRWA+ VA++KE EEKCGTP  KL Q+ADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RQRMKSSGRWARAVAIVKEFEEKCGTPEAKLVQIADAMTVEMHAGLASEGGSKLKMLISY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLP+G+EEG+FYALDLGGTNFRV+RVQLGGKE G+V++E  E SIP  LM G+S+ALF
Sbjct  85   VDNLPTGEEEGVFYALDLGGTNFRVLRVQLGGKEGGIVHQEFAEASIPPALMCGTSDALF  144

Query  489  DFIAHELAMFV  521
            D+IA +LA FV
Sbjct  145  DYIAEKLANFV  155



>gb|AHB32106.1| hexokinase [Camellia sinensis]
Length=495

 Score =   209 bits (531),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 113/131 (86%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            RH M+ SGRW++ +A+LKE EEKCGTP  KLRQVADAM VEMHAGLASEGGSKLKM+ISY
Sbjct  25   RHRMKCSGRWSQAMAILKEFEEKCGTPLSKLRQVADAMTVEMHAGLASEGGSKLKMIISY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLP+GDE+GLFYALDLGGTNFRV+RVQLGG++  VV +E  EVSIP +LM+G+S+ LF
Sbjct  85   VDNLPTGDEKGLFYALDLGGTNFRVLRVQLGGRDNHVVKQEFDEVSIPPNLMIGTSDGLF  144

Query  489  DFIAHELAMFV  521
            DFIA  L  FV
Sbjct  145  DFIAEALKKFV  155



>gb|AHD25654.1| hexokinase 1 (chloroplast) [Camellia sinensis]
Length=495

 Score =   208 bits (530),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 113/131 (86%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            RH M+ SGRW++ +A+LKE EEKCGTP  KLRQVADAM VEMHAGLASEGGSKLKM+ISY
Sbjct  25   RHRMKCSGRWSQAMAILKEFEEKCGTPLSKLRQVADAMTVEMHAGLASEGGSKLKMIISY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLP+GDE+GLFYALDLGGTNFRV+RVQLGG++  VV +E  EVSIP +LM+G+S+ LF
Sbjct  85   VDNLPTGDEKGLFYALDLGGTNFRVLRVQLGGRDNHVVKQEFDEVSIPPNLMIGTSDGLF  144

Query  489  DFIAHELAMFV  521
            DFIA  L  FV
Sbjct  145  DFIAEALKKFV  155



>gb|KEH21333.1| hexokinase [Medicago truncatula]
Length=363

 Score =   205 bits (521),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 99/132 (75%), Positives = 112/132 (85%), Gaps = 0/132 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            RH M SS +W ++V++LKE  EKC TP GKLRQ+ADAM VEMHAGLASEGGSKL MLISY
Sbjct  25   RHRMISSRKWTRSVSILKEFGEKCETPIGKLRQLADAMDVEMHAGLASEGGSKLSMLISY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLP+GDEEGL+YALDLGGTNFRV+RV LGGKEKGV+++E  EVSIP  LM GSSE LF
Sbjct  85   VDNLPTGDEEGLYYALDLGGTNFRVLRVHLGGKEKGVISQEFDEVSIPPQLMTGSSEGLF  144

Query  489  DFIAHELAMFVK  524
            DFIA  LA FV+
Sbjct  145  DFIAAALAKFVE  156



>gb|KHG22031.1| Hexokinase-1 [Gossypium arboreum]
Length=529

 Score =   209 bits (531),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 113/130 (87%), Gaps = 0/130 (0%)
 Frame = +3

Query  132  HHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYV  311
            H M+SSG+WA+  ++LK+ EEKCGTP  KL+QVADAM VEMHAGLASEGGSKLKM+ISYV
Sbjct  57   HRMKSSGKWAQAQSILKDFEEKCGTPISKLKQVADAMTVEMHAGLASEGGSKLKMIISYV  116

Query  312  DNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFD  491
            DNLP+GDE+GLFYALDLGGTNFRV+RV LGGKE  VV +E +EVSIP HLM GSS+ALFD
Sbjct  117  DNLPTGDEKGLFYALDLGGTNFRVLRVHLGGKEHRVVKQEFEEVSIPPHLMTGSSDALFD  176

Query  492  FIAHELAMFV  521
            +IA  LA FV
Sbjct  177  YIAEALAKFV  186



>ref|XP_010924444.1| PREDICTED: hexokinase-2-like isoform X2 [Elaeis guineensis]
Length=500

 Score =   208 bits (529),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 110/131 (84%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            RH MRSSGRWA+ + +LKELEE C TP GKLRQVADAM VEM AGLASEGGSKLKMLISY
Sbjct  25   RHRMRSSGRWARAMEILKELEENCATPIGKLRQVADAMTVEMLAGLASEGGSKLKMLISY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLP GDE GLFYALDLGGTNFRV+RVQLGGK   VV +E +EVSIP +LMVGSS  LF
Sbjct  85   VDNLPKGDETGLFYALDLGGTNFRVLRVQLGGKGGRVVKQEFEEVSIPPNLMVGSSSELF  144

Query  489  DFIAHELAMFV  521
            DFIA  LA FV
Sbjct  145  DFIAAALAKFV  155



>gb|KJB65034.1| hypothetical protein B456_010G077400 [Gossypium raimondii]
 gb|KJB65035.1| hypothetical protein B456_010G077400 [Gossypium raimondii]
 gb|KJB65036.1| hypothetical protein B456_010G077400 [Gossypium raimondii]
Length=498

 Score =   207 bits (528),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 113/131 (86%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            RH M+SSG+WA+ +++LKE EEKCGTP+  L+QVADAM VEMHAGLASEGGSKLKM+ISY
Sbjct  25   RHRMKSSGKWARALSILKEFEEKCGTPSSNLKQVADAMTVEMHAGLASEGGSKLKMIISY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            V NLP+GDE+GLFYALDLGGTNFRV+RV LGGKE  VV +E +EVSIP HLM GSS+ LF
Sbjct  85   VHNLPTGDEKGLFYALDLGGTNFRVLRVHLGGKESRVVKQEFEEVSIPAHLMTGSSDELF  144

Query  489  DFIAHELAMFV  521
            D+IA  LA FV
Sbjct  145  DYIASALAKFV  155



>ref|XP_010924442.1| PREDICTED: hexokinase-2-like isoform X1 [Elaeis guineensis]
Length=526

 Score =   208 bits (529),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 110/131 (84%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            RH MRSSGRWA+ + +LKELEE C TP GKLRQVADAM VEM AGLASEGGSKLKMLISY
Sbjct  25   RHRMRSSGRWARAMEILKELEENCATPIGKLRQVADAMTVEMLAGLASEGGSKLKMLISY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLP GDE GLFYALDLGGTNFRV+RVQLGGK   VV +E +EVSIP +LMVGSS  LF
Sbjct  85   VDNLPKGDETGLFYALDLGGTNFRVLRVQLGGKGGRVVKQEFEEVSIPPNLMVGSSSELF  144

Query  489  DFIAHELAMFV  521
            DFIA  LA FV
Sbjct  145  DFIAAALAKFV  155



>emb|CDO97969.1| unnamed protein product [Coffea canephora]
Length=495

 Score =   207 bits (527),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 96/131 (73%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            RH MR S RWA+ +A+++ELEEKCG+P  KL+QVADAM VEMHAGLASEGGSKLKMLIS+
Sbjct  25   RHRMRCSSRWARAMAIVRELEEKCGSPEAKLKQVADAMTVEMHAGLASEGGSKLKMLISH  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLP+GDEEG++YALDLGGTNFRV+RV+LGGK  G+V++E  E SIP  LMVG+SEALF
Sbjct  85   VDNLPTGDEEGVYYALDLGGTNFRVLRVELGGKTGGIVSQEFAEASIPPELMVGTSEALF  144

Query  489  DFIAHELAMFV  521
            D+IA ELA F+
Sbjct  145  DYIAAELAKFI  155



>ref|XP_003525287.1| PREDICTED: hexokinase-1-like [Glycine max]
Length=498

 Score =   207 bits (526),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 99/131 (76%), Positives = 114/131 (87%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            RH M SS +W++ +A+LKE E+KCGTP  KLRQVADAM VEMHAGLASEGGSKL MLIS+
Sbjct  25   RHRMISSRKWSRAMAILKEFEDKCGTPIVKLRQVADAMDVEMHAGLASEGGSKLNMLISF  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLP+GDEEGL+YALDLGGTNFRV+RV LGGK+KGV+ +E +EVSIP +LM GSSEALF
Sbjct  85   VDNLPTGDEEGLYYALDLGGTNFRVLRVHLGGKDKGVIGQEFEEVSIPPNLMTGSSEALF  144

Query  489  DFIAHELAMFV  521
            DFIA  LA FV
Sbjct  145  DFIAAALAKFV  155



>ref|XP_003530493.1| PREDICTED: hexokinase-1-like [Glycine max]
 gb|KHN16646.1| Hexokinase-1 [Glycine soja]
Length=498

 Score =   207 bits (526),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 99/131 (76%), Positives = 114/131 (87%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            RH M SS +W++ +A+LKE EEKCGTP  KLRQVADAM VEMHAGLASEGGSKL MLIS+
Sbjct  25   RHRMISSRKWSRAMAILKEFEEKCGTPIVKLRQVADAMDVEMHAGLASEGGSKLNMLISF  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLP+GDEEGL+YALDLGGTNFRV+RV LGGK+KGV+ +E +EVSIP +LM GSS+ALF
Sbjct  85   VDNLPTGDEEGLYYALDLGGTNFRVLRVHLGGKDKGVIGQEFEEVSIPPNLMTGSSDALF  144

Query  489  DFIAHELAMFV  521
            DFIA  LA FV
Sbjct  145  DFIAAALAKFV  155



>gb|AAT77513.1| hexokinase 3 [Nicotiana sylvestris]
Length=496

 Score =   207 bits (526),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 113/131 (86%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            RH M  S +WA+  A+LKE EEKC TP GKL+QVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RHRMGKSSKWARARAILKEFEEKCATPDGKLKQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLP+GDE G+FYALDLGGTNFRV+RVQLGGK+ G++++E  E SIP +LMVG+SEALF
Sbjct  85   VDNLPTGDEGGVFYALDLGGTNFRVLRVQLGGKDGGIIHQEFAEASIPPNLMVGTSEALF  144

Query  489  DFIAHELAMFV  521
            D+IA ELA FV
Sbjct  145  DYIAAELAKFV  155



>gb|ABA01010.1| hexokinase [Solanum chacoense]
Length=496

 Score =   207 bits (526),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 113/131 (86%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            RH M  S +WA+  A+LKE EEKC TP GKL+QVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RHRMGKSSKWARARAILKEFEEKCATPDGKLKQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLP+GDE G+FYALDLGGTNFRV+RVQLGGK+ G++++E  E SIP +LMVG+SEALF
Sbjct  85   VDNLPTGDEGGVFYALDLGGTNFRVLRVQLGGKDGGIIHQEFAEASIPPNLMVGTSEALF  144

Query  489  DFIAHELAMFV  521
            D+IA ELA FV
Sbjct  145  DYIAAELAKFV  155



>ref|NP_001274841.1| hexokinase-2 [Solanum tuberosum]
 sp|Q9SQ76.1|HXK2_SOLTU RecName: Full=Hexokinase-2; AltName: Full=StHK2 [Solanum tuberosum]
 gb|AAF14186.1| hexokinase 2 [Solanum tuberosum]
Length=496

 Score =   207 bits (526),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 113/131 (86%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            RH M  S +WA+  A+LKE EEKC TP GKL+QVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RHRMGKSSKWARARAILKEFEEKCATPDGKLKQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLP+GDE G+FYALDLGGTNFRV+RVQLGGK+ G++++E  E SIP +LMVG+SEALF
Sbjct  85   VDNLPTGDEGGVFYALDLGGTNFRVLRVQLGGKDGGIIHQEFAEASIPPNLMVGTSEALF  144

Query  489  DFIAHELAMFV  521
            D+IA ELA FV
Sbjct  145  DYIAAELAKFV  155



>gb|AAP40021.1| hexokinase [Nicotiana benthamiana]
Length=497

 Score =   206 bits (525),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 95/130 (73%), Positives = 113/130 (87%), Gaps = 0/130 (0%)
 Frame = +3

Query  132  HHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYV  311
            H MR S +WA+ +A+L+E EEKCGTP  KL+QVADAM VEMHAGLASEGGSKLKMLI+YV
Sbjct  26   HRMRKSSKWARAMAILREFEEKCGTPDAKLKQVADAMTVEMHAGLASEGGSKLKMLITYV  85

Query  312  DNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFD  491
            DNLP+GDE G+FYALDLGGTNFRV+RVQLGGK+ G++++E  E SIP +LMVG+SE LFD
Sbjct  86   DNLPTGDEAGVFYALDLGGTNFRVLRVQLGGKDGGIIHQEFAEASIPPNLMVGTSEELFD  145

Query  492  FIAHELAMFV  521
            +IA ELA FV
Sbjct  146  YIAAELAKFV  155



>ref|XP_007024321.1| Hexokinase 2 [Theobroma cacao]
 gb|EOY26943.1| Hexokinase 2 [Theobroma cacao]
Length=498

 Score =   206 bits (524),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 97/128 (76%), Positives = 112/128 (88%), Gaps = 0/128 (0%)
 Frame = +3

Query  138  MRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDN  317
            M+ SGRW K + ++KE EEKCGTP  KLRQVADAM VEMHAGLASEGGSKLKMLISYVDN
Sbjct  28   MKKSGRWVKAMEIVKEFEEKCGTPIWKLRQVADAMTVEMHAGLASEGGSKLKMLISYVDN  87

Query  318  LPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFI  497
            LP+G+E+GLFYALDLGGTNFRV+RVQLGGK  G+VN++ +EVSIP  LM G+S+ALFD+I
Sbjct  88   LPTGNEKGLFYALDLGGTNFRVLRVQLGGKGSGIVNQQFKEVSIPPSLMTGTSDALFDYI  147

Query  498  AHELAMFV  521
            A ELA FV
Sbjct  148  AVELAKFV  155



>sp|Q9SEK3.1|HXK1_SPIOL RecName: Full=Hexokinase-1; AltName: Full=SoHxK1 [Spinacia oleracea]
 gb|AAF18584.1|AF118132_1 chloroplast outer envelope hexokinase 1 [Spinacia oleracea]
Length=498

 Score =   206 bits (523),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 111/131 (85%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            R  M+SS +W + +A+LKEL++ CGTP GKLRQVADAM VEMHAGLASEG SKLKMLISY
Sbjct  25   RQRMKSSSKWGRVMAILKELDDNCGTPLGKLRQVADAMTVEMHAGLASEGASKLKMLISY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLP+GDE GLFYALDLGGTNFRV+RV+LGGKEK VV +E  EVSIP  LMVG+SE LF
Sbjct  85   VDNLPTGDEHGLFYALDLGGTNFRVLRVKLGGKEKRVVEQEFDEVSIPPELMVGTSEQLF  144

Query  489  DFIAHELAMFV  521
            D+IA  LA FV
Sbjct  145  DYIAEALAKFV  155



>gb|AET05183.2| hexokinase [Medicago truncatula]
Length=498

 Score =   205 bits (522),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 99/132 (75%), Positives = 112/132 (85%), Gaps = 0/132 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            RH M SS +W ++V++LKE  EKC TP GKLRQ+ADAM VEMHAGLASEGGSKL MLISY
Sbjct  25   RHRMISSRKWTRSVSILKEFGEKCETPIGKLRQLADAMDVEMHAGLASEGGSKLSMLISY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLP+GDEEGL+YALDLGGTNFRV+RV LGGKEKGV+++E  EVSIP  LM GSSE LF
Sbjct  85   VDNLPTGDEEGLYYALDLGGTNFRVLRVHLGGKEKGVISQEFDEVSIPPQLMTGSSEGLF  144

Query  489  DFIAHELAMFVK  524
            DFIA  LA FV+
Sbjct  145  DFIAAALAKFVE  156



>ref|XP_006353497.1| PREDICTED: hexokinase-1-like isoform X2 [Solanum tuberosum]
Length=466

 Score =   204 bits (519),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 100/132 (76%), Positives = 111/132 (84%), Gaps = 1/132 (1%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            +  M++SG W K  ALLK+ EEKC TP GKL+QVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  26   KRRMKNSGEWGKVEALLKDFEEKCATPMGKLKQVADAMTVEMHAGLASEGGSKLKMLISY  85

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVG-SSEAL  485
            VDNLP+GDEEGLFYALDLGGTNFRVMRVQLGG EK +V  E +EVSIP+++M G SSE L
Sbjct  86   VDNLPTGDEEGLFYALDLGGTNFRVMRVQLGGNEKRIVKHEVKEVSIPQNVMAGSSSEVL  145

Query  486  FDFIAHELAMFV  521
            FDFIA  LA FV
Sbjct  146  FDFIATALAEFV  157



>ref|NP_001234406.1| hexokinase [Solanum lycopersicum]
 gb|AAG35735.1|AF208543_1 hexokinase [Solanum lycopersicum]
Length=496

 Score =   205 bits (521),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 112/131 (85%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            RH M  S +WA+  A+LKE EEKC TP  KL+QVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RHRMGKSSKWARARAILKEFEEKCATPDAKLKQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLP+GDE G+FYALDLGGTNFRV+RVQLGGK+ G++++E  E SIP +LMVG+SEALF
Sbjct  85   VDNLPTGDEAGVFYALDLGGTNFRVLRVQLGGKDGGIMHQEFAEASIPPNLMVGTSEALF  144

Query  489  DFIAHELAMFV  521
            D+IA ELA FV
Sbjct  145  DYIAAELAKFV  155



>ref|XP_010322313.1| PREDICTED: hexokinase isoform X1 [Solanum lycopersicum]
Length=496

 Score =   204 bits (520),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 112/131 (85%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            RH M  S +WA+  A+LKE EEKC TP  KL+QVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RHRMGKSSKWARARAILKEFEEKCATPDAKLKQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLP+GDE G+FYALDLGGTNFRV+RVQLGGK+ G++++E  E SIP +LMVG+SEALF
Sbjct  85   VDNLPTGDEAGVFYALDLGGTNFRVLRVQLGGKDGGIMHQEFAEASIPPNLMVGTSEALF  144

Query  489  DFIAHELAMFV  521
            D+IA ELA FV
Sbjct  145  DYIAAELAKFV  155



>ref|XP_007160283.1| hypothetical protein PHAVU_002G308400g [Phaseolus vulgaris]
 gb|ESW32277.1| hypothetical protein PHAVU_002G308400g [Phaseolus vulgaris]
Length=498

 Score =   204 bits (520),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 111/131 (85%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            RH M SS +W++ +A+LKE EEK GTP  KLRQVADAM VEMHAGLASEGGSKL MLIS+
Sbjct  25   RHRMISSRKWSRAIAILKEFEEKSGTPLAKLRQVADAMDVEMHAGLASEGGSKLNMLISF  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLP+GDEEGL+YALDLGGTNFRV+RV LGGK+KGV+ +E  EVSIP  LM G+SEALF
Sbjct  85   VDNLPTGDEEGLYYALDLGGTNFRVLRVHLGGKDKGVIGQEFAEVSIPPQLMTGTSEALF  144

Query  489  DFIAHELAMFV  521
            DFIA  LA FV
Sbjct  145  DFIASALAKFV  155



>gb|AIX02984.1| hexokinase [Morella rubra]
Length=497

 Score =   204 bits (519),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 111/131 (85%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            RH MRSSG+WA+   +LK+ EEKC TP GKLR VADAM VEMHAGLASEGGSKLK+LIS+
Sbjct  25   RHRMRSSGKWARVTEILKDFEEKCATPDGKLRHVADAMTVEMHAGLASEGGSKLKILISF  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLP+GDE+GLFYALDLGGTNFRV+RVQLGG ++ V+ +E QEVSIP HLM  +SEALF
Sbjct  85   VDNLPTGDEKGLFYALDLGGTNFRVLRVQLGGXDQRVIKQEFQEVSIPPHLMTETSEALF  144

Query  489  DFIAHELAMFV  521
            D IA  LA FV
Sbjct  145  DNIAKALANFV  155



>gb|AAS60197.1| hexokinase 5 [Nicotiana tabacum]
Length=499

 Score =   204 bits (519),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 100/132 (76%), Positives = 111/132 (84%), Gaps = 1/132 (1%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            +  M++SG W K  ALLK+ EEKC TP GKL+QVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  26   KRRMKNSGEWGKVEALLKDFEEKCATPMGKLKQVADAMTVEMHAGLASEGGSKLKMLISY  85

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVG-SSEAL  485
            VDNLP+GDEEGLFYALDLGGTNFRVMRVQLGG EK +V  E +EVSIP+++M G SSE L
Sbjct  86   VDNLPTGDEEGLFYALDLGGTNFRVMRVQLGGNEKRIVKHEVKEVSIPQNVMAGSSSEVL  145

Query  486  FDFIAHELAMFV  521
            FDFIA  LA FV
Sbjct  146  FDFIATALAEFV  157



>ref|XP_006353496.1| PREDICTED: hexokinase-1-like isoform X1 [Solanum tuberosum]
Length=499

 Score =   204 bits (519),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 100/132 (76%), Positives = 111/132 (84%), Gaps = 1/132 (1%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            +  M++SG W K  ALLK+ EEKC TP GKL+QVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  26   KRRMKNSGEWGKVEALLKDFEEKCATPMGKLKQVADAMTVEMHAGLASEGGSKLKMLISY  85

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVG-SSEAL  485
            VDNLP+GDEEGLFYALDLGGTNFRVMRVQLGG EK +V  E +EVSIP+++M G SSE L
Sbjct  86   VDNLPTGDEEGLFYALDLGGTNFRVMRVQLGGNEKRIVKHEVKEVSIPQNVMAGSSSEVL  145

Query  486  FDFIAHELAMFV  521
            FDFIA  LA FV
Sbjct  146  FDFIATALAEFV  157



>gb|EPS70676.1| hexokinase 1a, partial [Genlisea aurea]
Length=490

 Score =   204 bits (518),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 94/132 (71%), Positives = 113/132 (86%), Gaps = 0/132 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            R  M+SSGRWA+  ++LKE EE+C TP GKL+Q+ADAM VEMHAGL SEGGSKLKMLISY
Sbjct  25   RQRMKSSGRWARVSSILKEFEERCDTPEGKLKQIADAMTVEMHAGLVSEGGSKLKMLISY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLP+GDEEG+FYALDLGGTNFRV+RVQLGGK+ G+V++E  E SIP  LM  +S++LF
Sbjct  85   VDNLPTGDEEGVFYALDLGGTNFRVLRVQLGGKDGGIVHQEFAEASIPPPLMSATSDSLF  144

Query  489  DFIAHELAMFVK  524
            DFIA +LA FV+
Sbjct  145  DFIAEKLAKFVE  156



>ref|XP_007013020.1| Hexokinase 1 isoform 1 [Theobroma cacao]
 gb|EOY30639.1| Hexokinase 1 isoform 1 [Theobroma cacao]
Length=521

 Score =   204 bits (519),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 102/154 (66%), Positives = 117/154 (76%), Gaps = 23/154 (15%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            RH ++SSG+WA+T+A+LKE EEKCGTP  KL+QVADAM VEMHAGLASEGGSKLKM+ISY
Sbjct  25   RHRIKSSGKWARTLAILKEFEEKCGTPISKLKQVADAMTVEMHAGLASEGGSKLKMIISY  84

Query  309  VDNLPSG-----------------------DEEGLFYALDLGGTNFRVMRVQLGGKEKGV  419
            VDNLP+G                       DE+GLFYALDLGGTNFRV+RVQLGGKE  V
Sbjct  85   VDNLPTGWDVSVVEHCHILISELFVLGIKHDEKGLFYALDLGGTNFRVLRVQLGGKESRV  144

Query  420  VNRESQEVSIPRHLMVGSSEALFDFIAHELAMFV  521
            V +E +EVSIP HLM GSS+ALFD+IA  LA FV
Sbjct  145  VKQEFEEVSIPPHLMTGSSDALFDYIASALAKFV  178



>ref|XP_003630707.1| Hexokinase [Medicago truncatula]
Length=610

 Score =   206 bits (523),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 99/132 (75%), Positives = 112/132 (85%), Gaps = 0/132 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            RH M SS +W ++V++LKE  EKC TP GKLRQ+ADAM VEMHAGLASEGGSKL MLISY
Sbjct  25   RHRMISSRKWTRSVSILKEFGEKCETPIGKLRQLADAMDVEMHAGLASEGGSKLSMLISY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLP+GDEEGL+YALDLGGTNFRV+RV LGGKEKGV+++E  EVSIP  LM GSSE LF
Sbjct  85   VDNLPTGDEEGLYYALDLGGTNFRVLRVHLGGKEKGVISQEFDEVSIPPQLMTGSSEGLF  144

Query  489  DFIAHELAMFVK  524
            DFIA  LA FV+
Sbjct  145  DFIAAALAKFVE  156



>ref|XP_004510315.1| PREDICTED: hexokinase-1-like [Cicer arietinum]
Length=495

 Score =   203 bits (516),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 95/132 (72%), Positives = 113/132 (86%), Gaps = 0/132 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            + HM+ S RW K +++LKE EEKC TP  KL+QVADAM VEMHAGLASEGGSKLKMLIS+
Sbjct  25   QRHMKKSRRWGKAMSILKEFEEKCATPTWKLKQVADAMTVEMHAGLASEGGSKLKMLISF  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            V NLP+G+EEGLFYALDLGGTNFRV+R+QLGGK+ G+++RE  EVSIP +LMVG+S ALF
Sbjct  85   VHNLPTGNEEGLFYALDLGGTNFRVLRMQLGGKDGGIISREFTEVSIPPNLMVGTSTALF  144

Query  489  DFIAHELAMFVK  524
            D+IA ELA FV 
Sbjct  145  DYIAAELAKFVN  156



>ref|XP_010540986.1| PREDICTED: hexokinase-1-like [Tarenaya hassleriana]
Length=499

 Score =   203 bits (516),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 98/132 (74%), Positives = 110/132 (83%), Gaps = 0/132 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            R  MRSSG+WA+ +A+L+  EE C TP  KLRQVADA+ VEMHAGLASEGGSKLKMLISY
Sbjct  26   RRRMRSSGKWARAMAILRAFEEDCATPIAKLRQVADALTVEMHAGLASEGGSKLKMLISY  85

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLP+GDE+GLFYALDLGGTNFRVMRV LGGKE  VV +E +EVSIP HLM G S+ LF
Sbjct  86   VDNLPTGDEKGLFYALDLGGTNFRVMRVLLGGKEGRVVKQEFEEVSIPPHLMTGGSDELF  145

Query  489  DFIAHELAMFVK  524
            DFIA  LA FV+
Sbjct  146  DFIADALAKFVE  157



>gb|ABI18156.1| hexokinase [Helianthus annuus]
Length=498

 Score =   202 bits (515),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 112/131 (85%), Gaps = 2/131 (2%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            RH M++SG+WAK + +LKE E+KCGTP  KLRQVADAM VEMHAGLAS+GGSKLKMLISY
Sbjct  25   RHRMKNSGKWAKAMEILKEFEDKCGTPVSKLRQVADAMTVEMHAGLASDGGSKLKMLISY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLP+GDE G+FYALDLGGTNFRV+RV+LGG   G V +E +EVSIP +LM+G SE LF
Sbjct  85   VDNLPTGDETGIFYALDLGGTNFRVLRVKLGG--VGNVKKEFKEVSIPPNLMIGKSEDLF  142

Query  489  DFIAHELAMFV  521
            DFIA ELA FV
Sbjct  143  DFIAGELAKFV  153



>gb|AHY84734.1| hexokinase [Manihot esculenta]
Length=494

 Score =   202 bits (513),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/131 (71%), Positives = 111/131 (85%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            +  MR+  +WAK + ++K++EEKC TP GKL+Q+ADAM VEMHAGLASEGGSKLKMLISY
Sbjct  26   KRKMRTGDKWAKAIEIVKDMEEKCATPIGKLKQIADAMVVEMHAGLASEGGSKLKMLISY  85

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLP+GDE GLFYALDLGGTNFRV+RVQLGGK+  +VN+E  EV IP +LM G+SE LF
Sbjct  86   VDNLPTGDENGLFYALDLGGTNFRVLRVQLGGKDGRLVNQEFAEVPIPPNLMTGTSEVLF  145

Query  489  DFIAHELAMFV  521
            D+IA ELA FV
Sbjct  146  DYIAAELAKFV  156



>gb|AFO84083.1| hexokinase [Actinidia chinensis]
Length=497

 Score =   201 bits (512),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 97/127 (76%), Positives = 109/127 (86%), Gaps = 0/127 (0%)
 Frame = +3

Query  141  RSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNL  320
            RSSGRW K  A+L+EL++KC TP GKLRQVAD MA EMHAGLASEGGS LKM+ISYVDNL
Sbjct  29   RSSGRWDKAAAILRELKDKCRTPIGKLRQVADDMAFEMHAGLASEGGSNLKMIISYVDNL  88

Query  321  PSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIA  500
            P+GDE+GLFYALDLGGTNFRV+RVQLGGK+K V  +E +EVSIP HLMVG+S ALFDFIA
Sbjct  89   PTGDEKGLFYALDLGGTNFRVLRVQLGGKDKYVAKQEFEEVSIPPHLMVGTSVALFDFIA  148

Query  501  HELAMFV  521
              L  FV
Sbjct  149  EALKKFV  155



>gb|AAT77514.1| hexokinase 4 [Nicotiana sylvestris]
Length=355

 Score =   198 bits (503),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 92/130 (71%), Positives = 110/130 (85%), Gaps = 0/130 (0%)
 Frame = +3

Query  132  HHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYV  311
            H MR S +W + +A+L+E EEKC T   KL+QVADAM VEMHAGLASEGGSKLKMLI+YV
Sbjct  26   HRMRKSSKWGRAMAILREFEEKCKTQDAKLKQVADAMTVEMHAGLASEGGSKLKMLITYV  85

Query  312  DNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFD  491
            DNLP+GDE G+FYALDLGGTNFRV+RVQLGGK+ G++++E  E SIP  LMVG+S+ALFD
Sbjct  86   DNLPTGDEAGVFYALDLGGTNFRVLRVQLGGKDGGIIHQEFAEASIPPSLMVGTSDALFD  145

Query  492  FIAHELAMFV  521
            +IA ELA FV
Sbjct  146  YIAAELAKFV  155



>gb|KJB56835.1| hypothetical protein B456_009G137700 [Gossypium raimondii]
Length=498

 Score =   201 bits (512),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 96/127 (76%), Positives = 111/127 (87%), Gaps = 0/127 (0%)
 Frame = +3

Query  141  RSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNL  320
            + SGRW K + +LKE EEKCGTP  KL+QVADAM VEMHAGLASEGGSKLKMLISYVD+L
Sbjct  29   KKSGRWVKAMEILKEFEEKCGTPIPKLKQVADAMIVEMHAGLASEGGSKLKMLISYVDHL  88

Query  321  PSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIA  500
            P+G E+GLFYALDLGGTNFRV+RVQLGGK +G+VN++ +EVSIP  LM GSS+ALFD+IA
Sbjct  89   PTGREKGLFYALDLGGTNFRVLRVQLGGKGRGIVNQQFEEVSIPPSLMTGSSDALFDYIA  148

Query  501  HELAMFV  521
             ELA FV
Sbjct  149  AELAKFV  155



>gb|EYU21451.1| hypothetical protein MIMGU_mgv1a005070mg [Erythranthe guttata]
Length=498

 Score =   201 bits (511),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 90/131 (69%), Positives = 116/131 (89%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            R  M++SGRWA+ + ++KE EEKCGTP GKL+QVADA+ VEMHAGLASEGGSKLKMLISY
Sbjct  29   RQRMKTSGRWARAMGIVKEFEEKCGTPEGKLKQVADALTVEMHAGLASEGGSKLKMLISY  88

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VD+LP+G+E+G+FYALDLGGTNFRV+RV+LGG+E+G++++E  E SIP  LM G+S+ALF
Sbjct  89   VDSLPTGNEKGVFYALDLGGTNFRVLRVELGGREEGIIHQEFAEASIPPALMCGNSDALF  148

Query  489  DFIAHELAMFV  521
            D+IA +LA F+
Sbjct  149  DYIAEKLASFI  159



>ref|XP_006299465.1| hypothetical protein CARUB_v10015630mg [Capsella rubella]
 gb|EOA32363.1| hypothetical protein CARUB_v10015630mg [Capsella rubella]
Length=504

 Score =   201 bits (510),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 105/131 (80%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            R  M+SSG+WA+ + +LK  EE C TP  KLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RRRMQSSGKWARVIEILKAFEEDCATPIAKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLPSGDE G FYALDLGGTNFRVMRV LGGK+  VV RE +E SIP HLM G S+ LF
Sbjct  85   VDNLPSGDETGFFYALDLGGTNFRVMRVLLGGKQDRVVKREFKEESIPPHLMTGKSDELF  144

Query  489  DFIAHELAMFV  521
            DFIA  LA FV
Sbjct  145  DFIAEVLAKFV  155



>ref|XP_006408903.1| hypothetical protein EUTSA_v10001968mg [Eutrema salsugineum]
 gb|ESQ50356.1| hypothetical protein EUTSA_v10001968mg [Eutrema salsugineum]
Length=499

 Score =   201 bits (510),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 107/131 (82%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            R  M+SSG+WA+ + +LK LEE C TP  KLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RRRMQSSGKWARVIEILKVLEEDCATPIAKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLPSGDE G FYALDLGGTNFRVMRV LGGK+  VV +E +EVSIP HLM G S+ LF
Sbjct  85   VDNLPSGDEHGFFYALDLGGTNFRVMRVLLGGKQDRVVKQEFEEVSIPPHLMTGGSDELF  144

Query  489  DFIAHELAMFV  521
            +FIA  LA FV
Sbjct  145  NFIAEALAKFV  155



>ref|XP_010526433.1| PREDICTED: hexokinase-1 [Tarenaya hassleriana]
Length=499

 Score =   201 bits (510),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 108/131 (82%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            R  MRSSG+WA+ +A+L+  EE C TP  KLRQVADA+ VEMHAGLASEGGSKLKMLISY
Sbjct  26   RRRMRSSGKWARAMAILRAFEEDCATPIAKLRQVADALTVEMHAGLASEGGSKLKMLISY  85

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLP+GDE+GLFYALDLGGTNFRVMRV LGGKE  VV +E +EVSIP HLM G S+ LF
Sbjct  86   VDNLPTGDEKGLFYALDLGGTNFRVMRVLLGGKEGRVVKQEFEEVSIPPHLMTGGSDELF  145

Query  489  DFIAHELAMFV  521
             FIA  LA FV
Sbjct  146  SFIAEALAKFV  156



>ref|NP_001234710.1| hexokinase [Solanum lycopersicum]
 gb|AAY60841.1| hexokinase [Solanum lycopersicum]
Length=499

 Score =   201 bits (510),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 98/132 (74%), Positives = 111/132 (84%), Gaps = 1/132 (1%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            +H +++SG W K  ALLK+ EEKC TP  KL+QVADAM VEM AGLASEGGSKLKMLISY
Sbjct  26   KHRVKNSGEWGKVEALLKDFEEKCATPVEKLKQVADAMTVEMQAGLASEGGSKLKMLISY  85

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVG-SSEAL  485
            VDNLP+GDE+GLFYALDLGGTNFRVMRVQLGGKEK +V  E +EVSIP+++M G SSE L
Sbjct  86   VDNLPTGDEKGLFYALDLGGTNFRVMRVQLGGKEKRIVKHEVKEVSIPQNVMTGSSSEVL  145

Query  486  FDFIAHELAMFV  521
            FDFIA  LA FV
Sbjct  146  FDFIATALAEFV  157



>ref|XP_002515958.1| hexokinase, putative [Ricinus communis]
 gb|EEF46378.1| hexokinase, putative [Ricinus communis]
Length=494

 Score =   200 bits (509),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 91/131 (69%), Positives = 110/131 (84%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            R  M+  G+WA+ + ++KELEEKC TP GKL+QVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  26   RQKMKKDGKWARVMEIVKELEEKCATPIGKLKQVADAMVVEMHAGLASEGGSKLKMLISY  85

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLP+GDE G +YALDLGGTNFRV+RV LGGK+ G++N+E  EV IP +LM G+S+ALF
Sbjct  86   VDNLPTGDENGYYYALDLGGTNFRVLRVHLGGKDGGLINQEFAEVPIPPNLMTGTSDALF  145

Query  489  DFIAHELAMFV  521
            D+IA EL  F+
Sbjct  146  DYIAAELVKFI  156



>ref|XP_010915379.1| PREDICTED: hexokinase-2-like [Elaeis guineensis]
Length=507

 Score =   201 bits (510),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 113/131 (86%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            R  ++S  RWA+ V ++KELEE+C TP G L+QVA+AMA+EM AGLASEG SKLKMLISY
Sbjct  25   RRRIQSVVRWARAVEIVKELEERCATPIGLLKQVANAMAMEMQAGLASEGDSKLKMLISY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLPSGDE+GLFYALDLGGTNFRV+RVQLGGKE+ VV +ES EVSIP+HLMVGSS  LF
Sbjct  85   VDNLPSGDEKGLFYALDLGGTNFRVLRVQLGGKERHVVKQESTEVSIPQHLMVGSSAELF  144

Query  489  DFIAHELAMFV  521
            +FIA EL+ FV
Sbjct  145  EFIAAELSKFV  155



>gb|KJB70380.1| hypothetical protein B456_011G070700 [Gossypium raimondii]
Length=497

 Score =   200 bits (509),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 93/128 (73%), Positives = 111/128 (87%), Gaps = 0/128 (0%)
 Frame = +3

Query  138  MRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDN  317
            M+ SG+W K + ++KE EEKC TP  KLRQVADAM VEMHAGLASEGGSKLKMLISYVDN
Sbjct  28   MKKSGKWEKAMEIVKEFEEKCATPISKLRQVADAMLVEMHAGLASEGGSKLKMLISYVDN  87

Query  318  LPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFI  497
            LP+G+E+GLFYALDLGGTNFRV+R+ LGGK +G+V+++ +EVSIPR LM G+S+ALFDFI
Sbjct  88   LPTGNEKGLFYALDLGGTNFRVLRLHLGGKGRGIVSKQFEEVSIPRSLMTGTSDALFDFI  147

Query  498  AHELAMFV  521
              ELA FV
Sbjct  148  VAELAKFV  155



>gb|KHG28915.1| Hexokinase-1 [Gossypium arboreum]
Length=497

 Score =   200 bits (509),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 93/128 (73%), Positives = 111/128 (87%), Gaps = 0/128 (0%)
 Frame = +3

Query  138  MRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDN  317
            M+ SG+W K + ++KE EEKC TP  KLRQVADAM VEMHAGLASEGGSKLKMLISYVDN
Sbjct  28   MKKSGKWEKAMEIVKEFEEKCATPISKLRQVADAMLVEMHAGLASEGGSKLKMLISYVDN  87

Query  318  LPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFI  497
            LP+G+E+GLFYALDLGGTNFRV+R+ LGGK +G+V+++ +EVSIPR LM G+S+ALFDFI
Sbjct  88   LPTGNEKGLFYALDLGGTNFRVLRLHLGGKGRGIVSKQFEEVSIPRSLMTGTSDALFDFI  147

Query  498  AHELAMFV  521
              ELA FV
Sbjct  148  VAELAKFV  155



>ref|XP_007013022.1| Hexokinase 2 isoform 3 [Theobroma cacao]
 gb|EOY30641.1| Hexokinase 2 isoform 3 [Theobroma cacao]
Length=437

 Score =   199 bits (505),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            RH ++SSG+WA+T+A+LKE EEKCGTP  KL+QVADAM VEMHAGLASEGGSKLKM+ISY
Sbjct  25   RHRIKSSGKWARTLAILKEFEEKCGTPISKLKQVADAMTVEMHAGLASEGGSKLKMIISY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLP+GDE+GLFYALDLGGTNFRV+RVQLGGKE  VV +E +EVSIP HLM GSS+   
Sbjct  85   VDNLPTGDEKGLFYALDLGGTNFRVLRVQLGGKESRVVKQEFEEVSIPPHLMTGSSDVGQ  144

Query  489  DFI  497
            D +
Sbjct  145  DVV  147



>ref|XP_002867423.1| ATHXK1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43682.1| ATHXK1 [Arabidopsis lyrata subsp. lyrata]
Length=496

 Score =   200 bits (509),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 96/131 (73%), Positives = 109/131 (83%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            R  M+SSG+W + +A+LK  EE C TP  KLRQVADAM VEMHAGLAS+GGSKLKMLISY
Sbjct  25   RRRMQSSGKWGRVLAILKAFEEDCATPISKLRQVADAMTVEMHAGLASDGGSKLKMLISY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLPSGDE+GLFYALDLGGTNFRVMRV LGGK++ VV +E +EVSIP HLM G S+ LF
Sbjct  85   VDNLPSGDEKGLFYALDLGGTNFRVMRVLLGGKQERVVKQEFEEVSIPPHLMTGGSDELF  144

Query  489  DFIAHELAMFV  521
            +FIA  LA FV
Sbjct  145  NFIAEALAKFV  155



>ref|NP_194642.1| hexokinase 1 [Arabidopsis thaliana]
 sp|Q42525.2|HXK1_ARATH RecName: Full=Hexokinase-1; AltName: Full=Protein GLUCOSE INSENSITIVE 
2 [Arabidopsis thaliana]
 gb|AAB49908.1| hexokinase 1 [Arabidopsis thaliana]
 emb|CAB43927.1| hexokinase [Arabidopsis thaliana]
 emb|CAB79671.1| hexokinase [Arabidopsis thaliana]
 gb|AAL77665.1| AT4g29130/F19B15_160 [Arabidopsis thaliana]
 gb|AAM70518.1| AT4g29130/F19B15_160 [Arabidopsis thaliana]
 dbj|BAF02067.1| hexokinase [Arabidopsis thaliana]
 gb|AEE85590.1| hexokinase 1 [Arabidopsis thaliana]
Length=496

 Score =   200 bits (508),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 96/131 (73%), Positives = 109/131 (83%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            R  M+SSG+W + +A+LK  EE C TP  KLRQVADAM VEMHAGLAS+GGSKLKMLISY
Sbjct  25   RRRMQSSGKWGRVLAILKAFEEDCATPISKLRQVADAMTVEMHAGLASDGGSKLKMLISY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLPSGDE+GLFYALDLGGTNFRVMRV LGGK++ VV +E +EVSIP HLM G S+ LF
Sbjct  85   VDNLPSGDEKGLFYALDLGGTNFRVMRVLLGGKQERVVKQEFEEVSIPPHLMTGGSDELF  144

Query  489  DFIAHELAMFV  521
            +FIA  LA FV
Sbjct  145  NFIAEALAKFV  155



>gb|KDO51805.1| hypothetical protein CISIN_1g0115051mg, partial [Citrus sinensis]
Length=190

 Score =   191 bits (485),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 90/128 (70%), Positives = 107/128 (84%), Gaps = 0/128 (0%)
 Frame = +3

Query  138  MRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDN  317
            ++  G+  K   ++KE EEKC TPA KL+QVADAM VEMHAGLASEGGSKLKM+ISYVDN
Sbjct  28   VKRGGKCGKANGIMKEFEEKCRTPAAKLKQVADAMTVEMHAGLASEGGSKLKMIISYVDN  87

Query  318  LPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFI  497
            LP+GDE+G +YALDLGGTNFRV+RV LGGK  G++N+E  EVSIP HLM G+S+ALFD+I
Sbjct  88   LPTGDEKGTYYALDLGGTNFRVLRVHLGGKGVGLINQEFAEVSIPPHLMTGTSDALFDYI  147

Query  498  AHELAMFV  521
            A ELA FV
Sbjct  148  AAELAKFV  155



>ref|XP_006285258.1| hypothetical protein CARUB_v10006629mg [Capsella rubella]
 gb|EOA18156.1| hypothetical protein CARUB_v10006629mg [Capsella rubella]
Length=496

 Score =   199 bits (507),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 96/131 (73%), Positives = 108/131 (82%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            R  M+SSG+W + +A+LK  EE C TP  KLRQVADAM VEMHAGLAS+GGSKLKMLISY
Sbjct  25   RRRMQSSGKWGRVLAILKAFEEDCATPISKLRQVADAMTVEMHAGLASDGGSKLKMLISY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLPSGDE+GLFYALDLGGTNFRVMRV LGGKE+ V  +E +EVSIP HLM G S+ LF
Sbjct  85   VDNLPSGDEKGLFYALDLGGTNFRVMRVLLGGKEERVAKQEFEEVSIPPHLMTGGSDELF  144

Query  489  DFIAHELAMFV  521
            +FIA  LA FV
Sbjct  145  NFIAEALAKFV  155



>ref|XP_010489125.1| PREDICTED: hexokinase-2-like [Camelina sativa]
Length=502

 Score =   200 bits (508),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 96/131 (73%), Positives = 104/131 (79%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            R  M+SSG+WA+ + +LK  EE C TP  KLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RRRMQSSGKWARVIEILKAFEEDCATPVAKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLPSGDE G FYALDLGGTNFRVMRV LGGK+  VV RE +E SIP HLM G S+ LF
Sbjct  85   VDNLPSGDETGFFYALDLGGTNFRVMRVLLGGKQDRVVKREFKEESIPPHLMTGKSDELF  144

Query  489  DFIAHELAMFV  521
            DFI   LA FV
Sbjct  145  DFIVEVLAKFV  155



>ref|XP_011072439.1| PREDICTED: hexokinase-1-like [Sesamum indicum]
Length=514

 Score =   200 bits (508),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 94/131 (72%), Positives = 110/131 (84%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            R  M++S RWA+ +A+LKE EEKC TP  KLRQVADA+ VEMHAGLASEGGSKLKMLISY
Sbjct  29   RQRMKNSSRWARAMAILKEFEEKCATPEAKLRQVADALTVEMHAGLASEGGSKLKMLISY  88

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VD+LP+G+EEG FYALDLGGTNFRV+RVQLGGK  G+V++E  EVSIP  LM G+S+ALF
Sbjct  89   VDSLPTGNEEGAFYALDLGGTNFRVLRVQLGGKTGGIVHQEFAEVSIPPALMSGTSDALF  148

Query  489  DFIAHELAMFV  521
            D+I   LA FV
Sbjct  149  DYIVENLASFV  159



>ref|XP_010467922.1| PREDICTED: hexokinase-2 isoform X1 [Camelina sativa]
Length=502

 Score =   199 bits (507),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 96/131 (73%), Positives = 104/131 (79%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            R  M+SSG+WA+ + +LK  EE C TP  KLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RRRMQSSGKWARVIEILKAFEEDCATPVAKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLPSGDE G FYALDLGGTNFRVMRV LGGK+  VV RE +E SIP HLM G S+ LF
Sbjct  85   VDNLPSGDETGFFYALDLGGTNFRVMRVLLGGKQDRVVKREFKEESIPPHLMTGKSDELF  144

Query  489  DFIAHELAMFV  521
            DFI   LA FV
Sbjct  145  DFIVEVLAKFV  155



>ref|XP_010416617.1| PREDICTED: hexokinase-2-like [Camelina sativa]
Length=502

 Score =   199 bits (506),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 96/131 (73%), Positives = 104/131 (79%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            R  M+SSG+WA+ + +LK  EE C TP  KLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RRRMQSSGKWARVIEILKAFEEDCATPVAKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLPSGDE G FYALDLGGTNFRVMRV LGGK+  VV RE +E SIP HLM G S+ LF
Sbjct  85   VDNLPSGDETGFFYALDLGGTNFRVMRVLLGGKQDRVVKREFKEESIPPHLMTGKSDELF  144

Query  489  DFIAHELAMFV  521
            DFI   LA FV
Sbjct  145  DFIVEVLAKFV  155



>ref|XP_010047252.1| PREDICTED: hexokinase-2-like [Eucalyptus grandis]
 gb|KCW79118.1| hypothetical protein EUGRSUZ_C00559 [Eucalyptus grandis]
Length=508

 Score =   199 bits (506),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 108/126 (86%), Gaps = 0/126 (0%)
 Frame = +3

Query  144  SSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLP  323
            S G+W +   ++KELEEKCGTP  KLRQVA+AM VEMHAGLAS+GGSKLKMLISYVD+LP
Sbjct  43   SDGKWERAAEMVKELEEKCGTPVWKLRQVAEAMVVEMHAGLASDGGSKLKMLISYVDSLP  102

Query  324  SGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIAH  503
            +GDE+GL+YALDLGGTNFR++RV LGGKEKG++ RE +EVSIP HLM GSS  LFDFIA 
Sbjct  103  TGDEKGLYYALDLGGTNFRILRVHLGGKEKGIIKREYEEVSIPPHLMTGSSNELFDFIAM  162

Query  504  ELAMFV  521
             LA FV
Sbjct  163  ALAKFV  168



>ref|XP_010047667.1| PREDICTED: hexokinase-1-like [Eucalyptus grandis]
Length=510

 Score =   199 bits (505),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 108/126 (86%), Gaps = 0/126 (0%)
 Frame = +3

Query  144  SSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLP  323
            S G+W +   ++KELEEKCGTP  KLRQVA+AM VEMHAGLAS+GGSKLKMLISYVD+LP
Sbjct  45   SDGKWERAAEMVKELEEKCGTPVWKLRQVAEAMVVEMHAGLASDGGSKLKMLISYVDSLP  104

Query  324  SGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIAH  503
            +GDE+GL+YALDLGGTNFR++RV LGGKEKG++ RE +EVSIP HLM GSS  LFDFIA 
Sbjct  105  TGDEKGLYYALDLGGTNFRILRVHLGGKEKGIIKREYEEVSIPPHLMTGSSNELFDFIAM  164

Query  504  ELAMFV  521
             LA FV
Sbjct  165  ALAKFV  170



>ref|XP_010438337.1| PREDICTED: hexokinase-1-like [Camelina sativa]
Length=499

 Score =   199 bits (505),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 96/131 (73%), Positives = 107/131 (82%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            R  M+SSG+W +  A+LK  EE C TP  KLRQVADAMAVEMHAGLAS+GGSKLKMLISY
Sbjct  25   RRRMQSSGKWGRVSAILKAFEEDCATPISKLRQVADAMAVEMHAGLASDGGSKLKMLISY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLPSGDE+GLFYALDLGGTNFRVMRV LGGK+  V  +E +EVSIP HLM G S+ LF
Sbjct  85   VDNLPSGDEKGLFYALDLGGTNFRVMRVLLGGKQDRVAKQEFEEVSIPPHLMTGGSDELF  144

Query  489  DFIAHELAMFV  521
            +FIA  LA FV
Sbjct  145  NFIAEALAKFV  155



>ref|XP_010447886.1| PREDICTED: hexokinase-1 [Camelina sativa]
 ref|XP_010447887.1| PREDICTED: hexokinase-1 [Camelina sativa]
 ref|XP_010447888.1| PREDICTED: hexokinase-1 [Camelina sativa]
Length=496

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 96/131 (73%), Positives = 107/131 (82%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            R  M+SSG+W +  A+LK  EE C TP  KLRQVADAMAVEMHAGLAS+GGSKLKMLISY
Sbjct  25   RRRMQSSGKWGRVSAILKAFEEDCATPISKLRQVADAMAVEMHAGLASDGGSKLKMLISY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLPSGDE+GLFYALDLGGTNFRVMRV LGGK+  V  +E +EVSIP HLM G S+ LF
Sbjct  85   VDNLPSGDEKGLFYALDLGGTNFRVMRVLLGGKQDRVAKQEFEEVSIPPHLMTGGSDELF  144

Query  489  DFIAHELAMFV  521
            +FIA  LA FV
Sbjct  145  NFIAEALAKFV  155



>ref|XP_010433133.1| PREDICTED: hexokinase-1-like [Camelina sativa]
 ref|XP_010433134.1| PREDICTED: hexokinase-1-like [Camelina sativa]
Length=499

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 96/131 (73%), Positives = 107/131 (82%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            R  M+SSG+W +  A+LK  EE C TP  KLRQVADAMAVEMHAGLAS+GGSKLKMLISY
Sbjct  25   RRRMQSSGKWGRVSAILKAFEEDCATPISKLRQVADAMAVEMHAGLASDGGSKLKMLISY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLPSGDE+GLFYALDLGGTNFRVMRV LGGK+  V  +E +EVSIP HLM G S+ LF
Sbjct  85   VDNLPSGDEKGLFYALDLGGTNFRVMRVLLGGKQDRVAKQEFEEVSIPPHLMTGGSDELF  144

Query  489  DFIAHELAMFV  521
            +FIA  LA FV
Sbjct  145  NFIAEALAKFV  155



>ref|XP_006585567.1| PREDICTED: hexokinase-1-like isoform X4 [Glycine max]
Length=360

 Score =   195 bits (495),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/130 (71%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = +3

Query  132  HHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYV  311
             + R   RWAK + +LKELEEKC TP  KL+ VADAM VEMHAGLASEGGSKLKMLI+YV
Sbjct  23   RYARKCRRWAKAIEILKELEEKCATPTWKLKLVADAMNVEMHAGLASEGGSKLKMLITYV  82

Query  312  DNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFD  491
            D LP+G+EEGL+YALDLGGTNFRV+RVQLGGK  G++++E  EVSIP +LMVG+S+ LFD
Sbjct  83   DKLPTGNEEGLYYALDLGGTNFRVLRVQLGGKYGGIISQEFTEVSIPPNLMVGTSDELFD  142

Query  492  FIAHELAMFV  521
            +IA ELA FV
Sbjct  143  YIAAELAKFV  152



>gb|EYU27268.1| hypothetical protein MIMGU_mgv1a019208mg [Erythranthe guttata]
Length=489

 Score =   198 bits (503),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 109/131 (83%), Gaps = 4/131 (3%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            R  M+SSG WAK  A+ +ELE+KCGTP  KLRQVADAMAVEMHAG+AS+GGSKLKMLIS+
Sbjct  25   RRQMKSSGEWAKAEAIFRELEDKCGTPTAKLRQVADAMAVEMHAGVASDGGSKLKMLISF  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLP+GDE+GLFYALDLGGTNFRVMRVQLG    G + +E ++VSIP H MVGSS  LF
Sbjct  85   VDNLPTGDEKGLFYALDLGGTNFRVMRVQLG----GTIKQECEQVSIPPHFMVGSSHELF  140

Query  489  DFIAHELAMFV  521
            DFIA  +A FV
Sbjct  141  DFIAGVVAKFV  151



>ref|XP_002886018.1| ATHXK2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62277.1| ATHXK2 [Arabidopsis lyrata subsp. lyrata]
Length=502

 Score =   198 bits (504),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 96/131 (73%), Positives = 103/131 (79%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            R  M+SSG+WA+ + +LK  EE C TP  KLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RRRMKSSGKWARVIEILKAFEEDCATPIAKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLPSGDE G FYALDLGGTNFRVMRV LGGK+  VV RE +E SIP HLM G S  LF
Sbjct  85   VDNLPSGDETGFFYALDLGGTNFRVMRVLLGGKQDRVVKREFKEESIPPHLMTGKSHELF  144

Query  489  DFIAHELAMFV  521
            DFI   LA FV
Sbjct  145  DFIVDVLAKFV  155



>ref|XP_006343033.1| PREDICTED: hexokinase-1-like [Solanum tuberosum]
Length=497

 Score =   198 bits (503),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/130 (71%), Positives = 110/130 (85%), Gaps = 0/130 (0%)
 Frame = +3

Query  132  HHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYV  311
            H MR S +W + +A+L+E EEKC T   KL+QVADAM VEMHAGLASEGGSKLKMLI+YV
Sbjct  26   HRMRKSSKWGRAMAILREFEEKCKTQDAKLKQVADAMTVEMHAGLASEGGSKLKMLITYV  85

Query  312  DNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFD  491
            DNLP+GDE G+FYALDLGGTNFRV+RVQLGGK+ G++++E  E SIP  LMVG+S+ALFD
Sbjct  86   DNLPTGDEAGVFYALDLGGTNFRVLRVQLGGKDGGIIHQEFAEASIPPSLMVGTSDALFD  145

Query  492  FIAHELAMFV  521
            +IA ELA FV
Sbjct  146  YIAAELAKFV  155



>ref|XP_006585566.1| PREDICTED: hexokinase-1-like isoform X3 [Glycine max]
Length=375

 Score =   195 bits (495),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 109/129 (84%), Gaps = 0/129 (0%)
 Frame = +3

Query  135  HMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVD  314
            + R   RWAK + +LKELEEKC TP  KL+ VADAM VEMHAGLASEGGSKLKMLI+YVD
Sbjct  24   YARKCRRWAKAIEILKELEEKCATPTWKLKLVADAMNVEMHAGLASEGGSKLKMLITYVD  83

Query  315  NLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDF  494
             LP+G+EEGL+YALDLGGTNFRV+RVQLGGK  G++++E  EVSIP +LMVG+S+ LFD+
Sbjct  84   KLPTGNEEGLYYALDLGGTNFRVLRVQLGGKYGGIISQEFTEVSIPPNLMVGTSDELFDY  143

Query  495  IAHELAMFV  521
            IA ELA FV
Sbjct  144  IAAELAKFV  152



>gb|AAT77515.1| hexokinase 7 [Nicotiana tabacum]
Length=497

 Score =   198 bits (503),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 92/130 (71%), Positives = 110/130 (85%), Gaps = 0/130 (0%)
 Frame = +3

Query  132  HHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYV  311
            H MR S +W + +A+L+E EEKC T   KL+QVADAM VEMHAGLASEGGSKLKMLI+YV
Sbjct  26   HRMRKSSKWGRAMAILREFEEKCKTQDAKLKQVADAMTVEMHAGLASEGGSKLKMLITYV  85

Query  312  DNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFD  491
            DNLP+GDE G+FYALDLGGTNFRV+RVQLGGK+ G++++E  E SIP  LMVG+S+ALFD
Sbjct  86   DNLPTGDEAGVFYALDLGGTNFRVLRVQLGGKDGGIIHQEFAEASIPPSLMVGTSDALFD  145

Query  492  FIAHELAMFV  521
            +IA ELA FV
Sbjct  146  YIAAELAKFV  155



>ref|XP_006585565.1| PREDICTED: hexokinase-1-like isoform X2 [Glycine max]
Length=381

 Score =   195 bits (495),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 109/129 (84%), Gaps = 0/129 (0%)
 Frame = +3

Query  135  HMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVD  314
            + R   RWAK + +LKELEEKC TP  KL+ VADAM VEMHAGLASEGGSKLKMLI+YVD
Sbjct  24   YARKCRRWAKAIEILKELEEKCATPTWKLKLVADAMNVEMHAGLASEGGSKLKMLITYVD  83

Query  315  NLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDF  494
             LP+G+EEGL+YALDLGGTNFRV+RVQLGGK  G++++E  EVSIP +LMVG+S+ LFD+
Sbjct  84   KLPTGNEEGLYYALDLGGTNFRVLRVQLGGKYGGIISQEFTEVSIPPNLMVGTSDELFDY  143

Query  495  IAHELAMFV  521
            IA ELA FV
Sbjct  144  IAAELAKFV  152



>gb|AAL60584.1|AF454962_1 hexokinase [Brassica oleracea]
 emb|CDX82746.1| BnaC07g01200D [Brassica napus]
Length=499

 Score =   197 bits (502),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 108/131 (82%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            R  M+SSG+WA+ + +L+ LEE C TP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RRRMQSSGKWARVIEILRVLEEDCATPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLPSG+E G FYALDLGGTNFRVMRV LGGK+  VV +E++EVSIP HLM   S+ LF
Sbjct  85   VDNLPSGEEHGFFYALDLGGTNFRVMRVLLGGKQGRVVKQEAKEVSIPPHLMTSGSDELF  144

Query  489  DFIAHELAMFV  521
            +FIA  LA FV
Sbjct  145  NFIAEALANFV  155



>ref|XP_009112637.1| PREDICTED: hexokinase-1-like [Brassica rapa]
Length=499

 Score =   197 bits (501),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 94/131 (72%), Positives = 106/131 (81%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            R  M+S G+W + + +LK  EE C TP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RRRMKSCGKWGRVIEILKVFEEDCATPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLPSGDE+G FYALDLGGTNFRVMRV LGGK+  VV +E +EVSIP  LM G+S+ LF
Sbjct  85   VDNLPSGDEQGFFYALDLGGTNFRVMRVLLGGKQDRVVKQEFEEVSIPPPLMTGASDELF  144

Query  489  DFIAHELAMFV  521
            +FIA  LA FV
Sbjct  145  NFIAEALAKFV  155



>emb|CDY48733.1| BnaA09g10080D [Brassica napus]
Length=499

 Score =   197 bits (500),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 94/131 (72%), Positives = 106/131 (81%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            R  M+S G+W + + +LK  EE C TP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RRRMKSCGKWGRVIEILKVFEEDCATPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLPSGDE+G FYALDLGGTNFRVMRV LGGK+  VV +E +EVSIP  LM G+S+ LF
Sbjct  85   VDNLPSGDEQGFFYALDLGGTNFRVMRVLLGGKQDRVVKQEFEEVSIPPPLMTGASDELF  144

Query  489  DFIAHELAMFV  521
            +FIA  LA FV
Sbjct  145  NFIAEALAKFV  155



>emb|CDY03331.1| BnaC09g10170D [Brassica napus]
Length=499

 Score =   197 bits (500),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 94/131 (72%), Positives = 106/131 (81%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            R  M+S G+W + + +LK  EE C TP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RRRMKSCGKWGRVIEILKVFEEDCATPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLPSGDE+G FYALDLGGTNFRVMRV LGGK+  VV +E +EVSIP  LM G+S+ LF
Sbjct  85   VDNLPSGDEQGFFYALDLGGTNFRVMRVLLGGKQDRVVKQEFEEVSIPPPLMTGASDELF  144

Query  489  DFIAHELAMFV  521
            +FIA  LA FV
Sbjct  145  NFIAEALARFV  155



>gb|AAL60583.1|AF454961_1 hexokinase [Brassica oleracea]
Length=499

 Score =   197 bits (500),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 94/131 (72%), Positives = 106/131 (81%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            R  M+S G+W + + +LK  EE C TP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RRRMKSCGKWGRVIEILKVFEEDCATPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLPSGDE+G FYALDLGGTNFRVMRV LGGK+  VV +E +EVSIP  LM G+S+ LF
Sbjct  85   VDNLPSGDEQGFFYALDLGGTNFRVMRVLLGGKQDRVVKQEFEEVSIPPPLMTGASDELF  144

Query  489  DFIAHELAMFV  521
            +FIA  LA FV
Sbjct  145  NFIAEALAKFV  155



>ref|XP_009102132.1| PREDICTED: hexokinase-1 [Brassica rapa]
Length=500

 Score =   196 bits (499),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 107/131 (82%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            R  M+SSG+WA+ + +L+ LEE C TP  KLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RRRMQSSGKWARVIEILRVLEEDCATPIAKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLPSG+E G FYALDLGGTNFRVMRV LGGKE  VV +E++EVSIP HLM   S+ LF
Sbjct  85   VDNLPSGEEHGFFYALDLGGTNFRVMRVLLGGKEGRVVKQEAKEVSIPPHLMTSGSDELF  144

Query  489  DFIAHELAMFV  521
            +FIA  LA FV
Sbjct  145  NFIAEALANFV  155



>emb|CDY35895.1| BnaA07g00920D [Brassica napus]
Length=500

 Score =   196 bits (499),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 107/131 (82%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            R  M+SSG+WA+ + +L+ LEE C TP  KLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RRRMQSSGKWARVIEILRVLEEDCATPIAKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLPSG+E G FYALDLGGTNFRVMRV LGGKE  VV +E++EVSIP HLM   S+ LF
Sbjct  85   VDNLPSGEEHGFFYALDLGGTNFRVMRVLLGGKEGRVVKQEAKEVSIPPHLMTSGSDELF  144

Query  489  DFIAHELAMFV  521
            +FIA  LA FV
Sbjct  145  NFIAEALANFV  155



>gb|KFK40349.1| hypothetical protein AALP_AA3G362600 [Arabis alpina]
Length=500

 Score =   196 bits (499),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 94/131 (72%), Positives = 106/131 (81%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            R  M S+G+W + + +LK LEE C TP GKLRQVADAM VEMHAGLASEGGSKLKMLIS+
Sbjct  25   RRRMHSTGKWGRVIEILKVLEEDCATPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISF  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLPSG E+G FYALDLGGTNFRVMRV LGGK+  VV +E +EVSIP HLM G S+ LF
Sbjct  85   VDNLPSGHEKGFFYALDLGGTNFRVMRVLLGGKQDRVVKQEFEEVSIPPHLMTGGSDELF  144

Query  489  DFIAHELAMFV  521
            DFIA  LA F+
Sbjct  145  DFIAEALAKFI  155



>pdb|4QS9|A Chain A, Arabidopsis Hexokinase 1 (athxk1) Mutant S177a Structure 
In Glucose- Bound Form
Length=474

 Score =   196 bits (497),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/126 (75%), Positives = 106/126 (84%), Gaps = 0/126 (0%)
 Frame = +3

Query  144  SSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLP  323
            SSG+W + +A+LK  EE C TP  KLRQVADAM VEMHAGLAS+GGSKLKMLISYVDNLP
Sbjct  8    SSGKWGRVLAILKAFEEDCATPISKLRQVADAMTVEMHAGLASDGGSKLKMLISYVDNLP  67

Query  324  SGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIAH  503
            SGDE+GLFYALDLGGTNFRVMRV LGGK++ VV +E +EVSIP HLM G S+ LF+FIA 
Sbjct  68   SGDEKGLFYALDLGGTNFRVMRVLLGGKQERVVKQEFEEVSIPPHLMTGGSDELFNFIAE  127

Query  504  ELAMFV  521
             LA FV
Sbjct  128  ALAKFV  133



>pdb|4QS7|A Chain A, Arabidopsis Hexokinase 1 (athxk1) Structure In Glucose-bound 
Form
 pdb|4QS8|A Chain A, Arabidopsis Hexokinase 1 (athxk1) Structure In Ligand-free 
Form
Length=474

 Score =   196 bits (497),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/126 (75%), Positives = 106/126 (84%), Gaps = 0/126 (0%)
 Frame = +3

Query  144  SSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLP  323
            SSG+W + +A+LK  EE C TP  KLRQVADAM VEMHAGLAS+GGSKLKMLISYVDNLP
Sbjct  8    SSGKWGRVLAILKAFEEDCATPISKLRQVADAMTVEMHAGLASDGGSKLKMLISYVDNLP  67

Query  324  SGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIAH  503
            SGDE+GLFYALDLGGTNFRVMRV LGGK++ VV +E +EVSIP HLM G S+ LF+FIA 
Sbjct  68   SGDEKGLFYALDLGGTNFRVMRVLLGGKQERVVKQEFEEVSIPPHLMTGGSDELFNFIAE  127

Query  504  ELAMFV  521
             LA FV
Sbjct  128  ALAKFV  133



>gb|KFK29465.1| hypothetical protein AALP_AA7G137600 [Arabis alpina]
Length=498

 Score =   196 bits (498),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/131 (72%), Positives = 107/131 (82%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            R  M+SSG+W + +A+LK  EE C TP  KL+QVADAM VEMHAGLAS+GGSKLKMLISY
Sbjct  25   RRRMQSSGKWGRVLAILKAFEEDCATPISKLKQVADAMTVEMHAGLASDGGSKLKMLISY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLPSGDE+GLFYALDLGGTNFRVMRV LGGK+  VV +E +EVSIP HLM   S+ LF
Sbjct  85   VDNLPSGDEKGLFYALDLGGTNFRVMRVLLGGKQDRVVKQEFEEVSIPPHLMTSGSDELF  144

Query  489  DFIAHELAMFV  521
            +FIA  LA FV
Sbjct  145  NFIAEALAKFV  155



>ref|NP_179576.1| hexokinase 2 [Arabidopsis thaliana]
 sp|P93834.1|HXK2_ARATH RecName: Full=Hexokinase-2 [Arabidopsis thaliana]
 gb|AAB49911.1| hexokinase 2 [Arabidopsis thaliana]
 gb|AAC62130.1| hexokinase (ATHXK2) [Arabidopsis thaliana]
 gb|AEC06934.1| hexokinase 2 [Arabidopsis thaliana]
Length=502

 Score =   196 bits (498),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 102/131 (78%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            R  M+S+G+WA+ + +LK  EE C TP  KLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RRRMKSAGKWARVIEILKAFEEDCATPIAKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLPSGDE G FYALDLGGTNFRVMRV LGGK   VV RE +E SIP HLM G S  LF
Sbjct  85   VDNLPSGDETGFFYALDLGGTNFRVMRVLLGGKHDRVVKREFKEESIPPHLMTGKSHELF  144

Query  489  DFIAHELAMFV  521
            DFI   LA FV
Sbjct  145  DFIVDVLAKFV  155



>gb|AAO24584.1| At2g19860 [Arabidopsis thaliana]
 dbj|BAE99655.1| hexokinase [Arabidopsis thaliana]
Length=502

 Score =   196 bits (498),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 102/131 (78%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            R  M+S+G+WA+ + +LK  EE C TP  KLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RRRMKSAGKWARVIEILKAFEEDCATPIAKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLPSGDE G FYALDLGGTNFRVMRV LGGK   VV RE +E SIP HLM G S  LF
Sbjct  85   VDNLPSGDETGFFYALDLGGTNFRVMRVLLGGKHDRVVKREFKEESIPPHLMTGKSHELF  144

Query  489  DFIAHELAMFV  521
            DFI   LA FV
Sbjct  145  DFIVDVLAKFV  155



>ref|XP_003627048.1| Hexokinase [Medicago truncatula]
 gb|AET01524.1| hexokinase [Medicago truncatula]
Length=494

 Score =   196 bits (497),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 111/130 (85%), Gaps = 1/130 (1%)
 Frame = +3

Query  135  HMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVD  314
            +++ S RW K +A+LKE EEKC TP  KL+QVADAM VEMHAGLAS+GGSKLKMLIS+VD
Sbjct  27   YVKKSKRWGKAIAILKEFEEKCATPTLKLKQVADAMTVEMHAGLASDGGSKLKMLISFVD  86

Query  315  NLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDF  494
            NLP+G+EEGLFYALDLGGTNFRV+RVQLGGK+ GVV +E  EVSIP +LMVG+S  LFD+
Sbjct  87   NLPTGNEEGLFYALDLGGTNFRVLRVQLGGKD-GVVGQEFTEVSIPPNLMVGTSHELFDY  145

Query  495  IAHELAMFVK  524
            IA EL+ FV 
Sbjct  146  IAAELSKFVN  155



>ref|NP_001233957.1| hexokinase [Solanum lycopersicum]
 emb|CAC81350.1| hexokinase [Solanum lycopersicum]
Length=498

 Score =   196 bits (497),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/130 (70%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = +3

Query  132  HHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYV  311
            H MR S +W + +A+L+E EEKC T   KL+QVADAM VEMHAGLASEGGSKLKMLI+YV
Sbjct  26   HRMRKSSKWGRAMAILREFEEKCKTQDAKLKQVADAMTVEMHAGLASEGGSKLKMLITYV  85

Query  312  DNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFD  491
            DNLP+GDE G+FYALDLGGTNFRV+RVQLGGK+ G++++E  E SIP  LMVG+S+ LFD
Sbjct  86   DNLPTGDEAGVFYALDLGGTNFRVLRVQLGGKDGGIIHQEFAEASIPPSLMVGTSDELFD  145

Query  492  FIAHELAMFV  521
            +IA ELA FV
Sbjct  146  YIAAELAKFV  155



>sp|Q2KNB9.1|HXK2_ORYSJ RecName: Full=Hexokinase-2; AltName: Full=Hexokinase-3 [Oryza 
sativa Japonica Group]
 gb|AAX68419.1| hexokinase 3 [Oryza sativa Japonica Group]
 gb|AAZ93619.1| hexokinase 2 [Oryza sativa Japonica Group]
 gb|EEE64471.1| hypothetical protein OsJ_19321 [Oryza sativa Japonica Group]
Length=494

 Score =   195 bits (495),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 92/131 (70%), Positives = 107/131 (82%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            R  +R + RW +  A+L+ELEE+C  P G+LRQVADAMAVEMHAGLASEGGSKLKM+ISY
Sbjct  22   RRQLREAKRWGRADAVLRELEERCAAPPGRLRQVADAMAVEMHAGLASEGGSKLKMIISY  81

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VD LPSG+E+G+FYALDLGGTNFRV+RVQLGGKE  V+ +E  E+SIP HLM G S  LF
Sbjct  82   VDALPSGEEKGVFYALDLGGTNFRVLRVQLGGKEGRVIKQEHDEISIPPHLMTGGSNELF  141

Query  489  DFIAHELAMFV  521
            DFIA  LA FV
Sbjct  142  DFIASSLAKFV  152



>ref|XP_003533038.1| PREDICTED: hexokinase-1-like isoform X1 [Glycine max]
 gb|KHN05328.1| Hexokinase-1 [Glycine soja]
Length=492

 Score =   195 bits (495),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 109/129 (84%), Gaps = 0/129 (0%)
 Frame = +3

Query  135  HMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVD  314
            + R   RWAK + +LKELEEKC TP  KL+ VADAM VEMHAGLASEGGSKLKMLI+YVD
Sbjct  24   YARKCRRWAKAIEILKELEEKCATPTWKLKLVADAMNVEMHAGLASEGGSKLKMLITYVD  83

Query  315  NLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDF  494
             LP+G+EEGL+YALDLGGTNFRV+RVQLGGK  G++++E  EVSIP +LMVG+S+ LFD+
Sbjct  84   KLPTGNEEGLYYALDLGGTNFRVLRVQLGGKYGGIISQEFTEVSIPPNLMVGTSDELFDY  143

Query  495  IAHELAMFV  521
            IA ELA FV
Sbjct  144  IAAELAKFV  152



>ref|XP_006853711.1| hypothetical protein AMTR_s00056p00151260 [Amborella trichopoda]
 gb|ERN15178.1| hypothetical protein AMTR_s00056p00151260 [Amborella trichopoda]
Length=500

 Score =   195 bits (495),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 93/131 (71%), Positives = 110/131 (84%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            RH ++SS +W +  A+LKE E++C TP  KLRQVADAM VEMHAGLASEGGSKLKM++SY
Sbjct  25   RHRLKSSRQWGRVSAILKETEDQCATPIQKLRQVADAMHVEMHAGLASEGGSKLKMILSY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLP+G+E+GLFYALDLGGTNFRV+RVQLGGKE  V  +E  EVSIP +LMVG+S  LF
Sbjct  85   VDNLPTGNEKGLFYALDLGGTNFRVLRVQLGGKEGRVAKQEFTEVSIPPNLMVGTSYELF  144

Query  489  DFIAHELAMFV  521
            D+IA ELA FV
Sbjct  145  DYIAAELAKFV  155



>ref|XP_004135675.1| PREDICTED: hexokinase-2-like [Cucumis sativus]
 ref|XP_004157285.1| PREDICTED: hexokinase-2-like [Cucumis sativus]
 gb|KGN66181.1| hypothetical protein Csa_1G574970 [Cucumis sativus]
Length=498

 Score =   194 bits (493),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 93/132 (70%), Positives = 110/132 (83%), Gaps = 0/132 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            RH M++ G+W+K + +LKE E+KC T   K++Q+A+AMAVEMHAGLASEGGSKLKMLISY
Sbjct  25   RHRMKNCGKWSKAMGILKEFEDKCRTSTEKMKQLAEAMAVEMHAGLASEGGSKLKMLISY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLP+GDE+GLFYALDLGGTNFRV+RVQLGGK+  V  +E  EVSIP HLM GSSE LF
Sbjct  85   VDNLPTGDEKGLFYALDLGGTNFRVLRVQLGGKDDRVARQEFVEVSIPPHLMTGSSEDLF  144

Query  489  DFIAHELAMFVK  524
             FIA  LA FV+
Sbjct  145  GFIAEALAKFVE  156



>ref|XP_004503490.1| PREDICTED: hexokinase-1-like isoform X1 [Cicer arietinum]
Length=526

 Score =   194 bits (494),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 99/160 (62%), Positives = 113/160 (71%), Gaps = 28/160 (18%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            RH M +S +W++ ++++KE EEKCGTP GKLRQ+ DAM VEMHAGLASEGGSKL MLISY
Sbjct  25   RHRMINSRKWSRALSIVKEFEEKCGTPIGKLRQLGDAMDVEMHAGLASEGGSKLSMLISY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEA--  482
            VDNLP+GDEEGLFYALDLGGTNFRV+RV LGGKEKGV+ +E  EVSIP HLM GSSE   
Sbjct  85   VDNLPTGDEEGLFYALDLGGTNFRVLRVHLGGKEKGVIGQEFDEVSIPPHLMTGSSEVSV  144

Query  483  --------------------------LFDFIAHELAMFVK  524
                                      LFDFIA  LA FV+
Sbjct  145  LRENHYRAIESANTLIYKLFQCLLQGLFDFIAAALAKFVE  184



>ref|NP_001284452.1| hexokinase-1-like [Cucumis melo]
 ref|XP_008450786.1| PREDICTED: hexokinase-1-like [Cucumis melo]
 gb|ACJ04705.1| hexokinase 2 [Cucumis melo]
Length=498

 Score =   193 bits (491),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/132 (70%), Positives = 110/132 (83%), Gaps = 0/132 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            RH M++ G+W+K + +LKE EEKC T   K++Q+A+AMAVEMHAGLASEGGSKLKMLISY
Sbjct  25   RHRMKNCGKWSKAMGILKEFEEKCRTSTEKMKQLAEAMAVEMHAGLASEGGSKLKMLISY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLP+GDE+GLFYALDLGGTNFRV+RVQLGGK+  V  +E  EVSIP H+M G+SE LF
Sbjct  85   VDNLPTGDEKGLFYALDLGGTNFRVLRVQLGGKDDRVARQEFVEVSIPPHVMTGTSEELF  144

Query  489  DFIAHELAMFVK  524
             FIA  LA FV+
Sbjct  145  GFIAEALAKFVE  156



>gb|EAY98804.1| hypothetical protein OsI_20748 [Oryza sativa Indica Group]
Length=494

 Score =   193 bits (490),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/131 (69%), Positives = 106/131 (81%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            R  +R + RW +  A+L+ELEE+C  P  +LRQVADAMAVEMHAGLASEGGSKLKM+ISY
Sbjct  22   RRQLREAKRWGRADAVLRELEERCAAPPARLRQVADAMAVEMHAGLASEGGSKLKMIISY  81

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VD LPSG+E+G+FYALDLGGTNFRV+RVQLGGKE  V+ +E  E+SIP HLM G S  LF
Sbjct  82   VDALPSGEEKGVFYALDLGGTNFRVLRVQLGGKEGRVIKQEHDEISIPPHLMTGGSNELF  141

Query  489  DFIAHELAMFV  521
            DFIA  LA FV
Sbjct  142  DFIASSLAKFV  152



>gb|KDP40854.1| hypothetical protein JCGZ_24853 [Jatropha curcas]
Length=501

 Score =   193 bits (490),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 92/131 (70%), Positives = 108/131 (82%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            R  MR  G+ AK + ++KEL+E+C TP  KL+QV DAM VEMHAGLASEGGSKLKMLISY
Sbjct  26   RRKMRRDGKLAKAMEIVKELKEQCATPIAKLKQVGDAMVVEMHAGLASEGGSKLKMLISY  85

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLP+GDE GLFYALDLGGTNFRV+RV LGGK+  +VN+E  EV IP +LM G+S+ALF
Sbjct  86   VDNLPTGDENGLFYALDLGGTNFRVLRVHLGGKDGRLVNQEFAEVPIPPNLMTGTSDALF  145

Query  489  DFIAHELAMFV  521
            D+IA ELA FV
Sbjct  146  DYIAAELAKFV  156



>ref|XP_008789199.1| PREDICTED: hexokinase-2-like [Phoenix dactylifera]
Length=493

 Score =   192 bits (488),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 94/131 (72%), Positives = 111/131 (85%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            R  +RS  R A+ V +++ELEE+C TP G L++VA+AMA+EM AGLASEG SKLKML+SY
Sbjct  21   RRRLRSVARSARAVEMVRELEERCATPIGLLKEVANAMAMEMQAGLASEGDSKLKMLLSY  80

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VD+LPSGDE+GLFYALDLGGTNFRV+RVQLGGKE+ VV RES EVSIP HLMVG+S  LF
Sbjct  81   VDSLPSGDEKGLFYALDLGGTNFRVLRVQLGGKERHVVKRESTEVSIPPHLMVGNSAELF  140

Query  489  DFIAHELAMFV  521
            +FIA ELA FV
Sbjct  141  EFIAAELAKFV  151



>gb|KCW79624.1| hypothetical protein EUGRSUZ_C00983 [Eucalyptus grandis]
Length=456

 Score =   191 bits (484),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = +3

Query  174  LLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLPSGDEEGLFYA  353
            ++KELEEKCGTP  KLRQVA+AM VEMHAGLAS+GGSKLKMLISYVD+LP+GDE+GL+YA
Sbjct  1    MVKELEEKCGTPVWKLRQVAEAMVVEMHAGLASDGGSKLKMLISYVDSLPTGDEKGLYYA  60

Query  354  LDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIAHELAMFV  521
            LDLGGTNFR++RV LGGKEKG++ RE +EVSIP HLM GSS  LFDFIA  LA FV
Sbjct  61   LDLGGTNFRILRVHLGGKEKGIIKREYEEVSIPPHLMTGSSNELFDFIAMALAKFV  116



>gb|KJB35042.1| hypothetical protein B456_006G096800 [Gossypium raimondii]
Length=430

 Score =   189 bits (481),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/128 (70%), Positives = 108/128 (84%), Gaps = 0/128 (0%)
 Frame = +3

Query  138  MRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDN  317
            M+ SG+W K + ++KE EE C TP  KL+QVADAM VEMHAGLASEGGSKLKMLI+YVD+
Sbjct  28   MKKSGKWVKAMEIVKEFEESCRTPISKLKQVADAMTVEMHAGLASEGGSKLKMLITYVDS  87

Query  318  LPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFI  497
            LP+GDE+GLFYALDLGGTNFRV+RV LGGK+ G++ ++ +EVSIP + M GSS ALFD+I
Sbjct  88   LPTGDEKGLFYALDLGGTNFRVLRVLLGGKDGGILKQQFKEVSIPPNKMTGSSAALFDYI  147

Query  498  AHELAMFV  521
            A ELA FV
Sbjct  148  AAELAKFV  155



>ref|XP_007135629.1| hypothetical protein PHAVU_010G144900g [Phaseolus vulgaris]
 gb|ESW07623.1| hypothetical protein PHAVU_010G144900g [Phaseolus vulgaris]
Length=495

 Score =   191 bits (484),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 109/129 (84%), Gaps = 0/129 (0%)
 Frame = +3

Query  135  HMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVD  314
            ++R   RW +   +L+ELEEKC TP+ KL+++ADAM VEMHAGLASEGGSKLKMLI+YVD
Sbjct  27   YVRKCRRWGRVTEILQELEEKCATPSWKLKRIADAMNVEMHAGLASEGGSKLKMLITYVD  86

Query  315  NLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDF  494
             LP+G EEGL+YALDLGGTNFRV+RVQLGGK+ G++++ES EVSIP +LMVG+S  LFD+
Sbjct  87   KLPTGYEEGLYYALDLGGTNFRVLRVQLGGKDGGIISQESTEVSIPPNLMVGTSAELFDY  146

Query  495  IAHELAMFV  521
            IA EL  FV
Sbjct  147  IAAELGKFV  155



>gb|AAT47078.1| unknown protein [Oryza sativa Japonica Group]
Length=1142

 Score =   196 bits (497),  Expect = 3e-54, Method: Composition-based stats.
 Identities = 92/131 (70%), Positives = 107/131 (82%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            R  +R + RW +  A+L+ELEE+C  P G+LRQVADAMAVEMHAGLASEGGSKLKM+ISY
Sbjct  22   RRQLREAKRWGRADAVLRELEERCAAPPGRLRQVADAMAVEMHAGLASEGGSKLKMIISY  81

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VD LPSG+E+G+FYALDLGGTNFRV+RVQLGGKE  V+ +E  E+SIP HLM G S  LF
Sbjct  82   VDALPSGEEKGVFYALDLGGTNFRVLRVQLGGKEGRVIKQEHDEISIPPHLMTGGSNELF  141

Query  489  DFIAHELAMFV  521
            DFIA  LA FV
Sbjct  142  DFIASSLAKFV  152



>dbj|BAJ89593.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87024.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=495

 Score =   190 bits (482),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 90/131 (69%), Positives = 107/131 (82%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            R  MR + RW +  A+L+ L+E+C  P  +LRQVADA+AVEMHAGLASEGGSKL M+ISY
Sbjct  24   RRQMREAKRWGRADAVLRGLDERCAAPPARLRQVADAVAVEMHAGLASEGGSKLGMIISY  83

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VD+LPSG E+GLFYALDLGGTNFRV+RVQLGGKE  VV +E +E+SIP HLM G+S+ LF
Sbjct  84   VDSLPSGQEKGLFYALDLGGTNFRVLRVQLGGKEGRVVKQECEEISIPAHLMTGTSQELF  143

Query  489  DFIAHELAMFV  521
            DFIA  LA FV
Sbjct  144  DFIAAALAKFV  154



>gb|KJB35041.1| hypothetical protein B456_006G096800 [Gossypium raimondii]
Length=496

 Score =   190 bits (482),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 89/128 (70%), Positives = 108/128 (84%), Gaps = 0/128 (0%)
 Frame = +3

Query  138  MRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDN  317
            M+ SG+W K + ++KE EE C TP  KL+QVADAM VEMHAGLASEGGSKLKMLI+YVD+
Sbjct  28   MKKSGKWVKAMEIVKEFEESCRTPISKLKQVADAMTVEMHAGLASEGGSKLKMLITYVDS  87

Query  318  LPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFI  497
            LP+GDE+GLFYALDLGGTNFRV+RV LGGK+ G++ ++ +EVSIP + M GSS ALFD+I
Sbjct  88   LPTGDEKGLFYALDLGGTNFRVLRVLLGGKDGGILKQQFKEVSIPPNKMTGSSAALFDYI  147

Query  498  AHELAMFV  521
            A ELA FV
Sbjct  148  AAELAKFV  155



>gb|EMT07302.1| Hexokinase-2 [Aegilops tauschii]
Length=446

 Score =   188 bits (477),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 91/131 (69%), Positives = 105/131 (80%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            R  MR + RW +  A+L+ LEE+   P  +LRQVADAMAVEMHAGLASEGGSKL M+ISY
Sbjct  22   RRQMREAKRWGRADAVLRGLEERSAAPPARLRQVADAMAVEMHAGLASEGGSKLGMIISY  81

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VD+LPSG E+GLFYALDLGGTNFRV+RVQLGGKE  VV +E  E+SIP HLM G+S+ LF
Sbjct  82   VDSLPSGQEKGLFYALDLGGTNFRVLRVQLGGKEGRVVKQECDEISIPAHLMTGTSQELF  141

Query  489  DFIAHELAMFV  521
            DFIA  LA FV
Sbjct  142  DFIAAALAKFV  152



>ref|XP_006426867.1| hypothetical protein CICLE_v10025452mg [Citrus clementina]
 gb|ESR40107.1| hypothetical protein CICLE_v10025452mg [Citrus clementina]
Length=496

 Score =   189 bits (480),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 89/128 (70%), Positives = 106/128 (83%), Gaps = 0/128 (0%)
 Frame = +3

Query  138  MRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDN  317
            ++  G+  K   ++KE EEKC TPA KL+QVADAM VEMHAGLASEGGSKLKM+ISYVDN
Sbjct  28   VKRGGKCGKANGIMKEFEEKCRTPAAKLKQVADAMTVEMHAGLASEGGSKLKMIISYVDN  87

Query  318  LPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFI  497
            LP+GDE+G +YALDLGGTNFRV+RV LGGK  G++N+E  EVSIP HLM G+S+ALFD+I
Sbjct  88   LPTGDEKGTYYALDLGGTNFRVLRVHLGGKGVGLINQEFAEVSIPPHLMTGTSDALFDYI  147

Query  498  AHELAMFV  521
            A EL  FV
Sbjct  148  AAELGKFV  155



>ref|XP_010047255.1| PREDICTED: hexokinase-2-like [Eucalyptus grandis]
Length=244

 Score =   182 bits (462),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 87/126 (69%), Positives = 101/126 (80%), Gaps = 0/126 (0%)
 Frame = +3

Query  144  SSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLP  323
            + G+W +   ++KELEEKCGTP  KLRQVADAM VEMHAGLA +GGSKLKMLISYVD+LP
Sbjct  42   TDGKWERAAEMVKELEEKCGTPVWKLRQVADAMVVEMHAGLAYDGGSKLKMLISYVDSLP  101

Query  324  SGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIAH  503
            +GDE+GL+YALDLGGT+F V+ V L  KEKG+V RE +EVS P HLM GSS  LFDFIA 
Sbjct  102  TGDEKGLYYALDLGGTDFCVLHVHLSRKEKGIVKREFEEVSTPPHLMTGSSNELFDFIAM  161

Query  504  ELAMFV  521
             L  FV
Sbjct  162  ALTKFV  167



>ref|XP_009394175.1| PREDICTED: hexokinase-2-like [Musa acuminata subsp. malaccensis]
Length=493

 Score =   188 bits (478),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 92/131 (70%), Positives = 105/131 (80%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            RH MRS+ RWA+  A+L+ELEEKC TP  KL +VADAM  EMHAGL SE  SKLKM+ISY
Sbjct  25   RHRMRSAERWARAAAVLRELEEKCATPVEKLWEVADAMTKEMHAGLESEDVSKLKMIISY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VD LP+GDE GLFYALDLGGTNFRV+RVQLGG+E  VV +E++EVSIP  LMVG S+ LF
Sbjct  85   VDKLPTGDERGLFYALDLGGTNFRVLRVQLGGREGRVVRQEAKEVSIPHDLMVGRSDELF  144

Query  489  DFIAHELAMFV  521
            DFIA  L  FV
Sbjct  145  DFIASALVKFV  155



>ref|XP_006465701.1| PREDICTED: hexokinase-1-like [Citrus sinensis]
Length=496

 Score =   187 bits (476),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 89/128 (70%), Positives = 106/128 (83%), Gaps = 0/128 (0%)
 Frame = +3

Query  138  MRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDN  317
            ++  G+  K   ++KE EEKC TPA KL+ VADAM VEMHAGLASEGGSKLKM+ISYVDN
Sbjct  28   VKRGGKCGKANGIMKEFEEKCRTPAAKLKLVADAMTVEMHAGLASEGGSKLKMIISYVDN  87

Query  318  LPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFI  497
            LP+GDE+G +YALDLGGTNFRV+RV LGGK  G++N+E  EVSIP HLM G+S+ALFD+I
Sbjct  88   LPTGDEKGTYYALDLGGTNFRVLRVHLGGKGVGLINQEFAEVSIPPHLMTGTSDALFDYI  147

Query  498  AHELAMFV  521
            A ELA FV
Sbjct  148  AAELAKFV  155



>gb|KCW79126.1| hypothetical protein EUGRSUZ_C005691, partial [Eucalyptus grandis]
Length=320

 Score =   182 bits (462),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 87/126 (69%), Positives = 101/126 (80%), Gaps = 0/126 (0%)
 Frame = +3

Query  144  SSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLP  323
            + G+W +   ++KELEEKCGTP  KLRQVADAM VEMHAGLA +GGSKLKMLISYVD+LP
Sbjct  42   TDGKWERAAEMVKELEEKCGTPVWKLRQVADAMVVEMHAGLAYDGGSKLKMLISYVDSLP  101

Query  324  SGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIAH  503
            +GDE+GL+YALDLGGT+F V+ V L  KEKG+V RE +EVS P HLM GSS  LFDFIA 
Sbjct  102  TGDEKGLYYALDLGGTDFCVLHVHLSRKEKGIVKREFEEVSTPPHLMTGSSNELFDFIAM  161

Query  504  ELAMFV  521
             L  FV
Sbjct  162  ALTKFV  167



>ref|XP_010232254.1| PREDICTED: hexokinase-9-like isoform X2 [Brachypodium distachyon]
Length=471

 Score =   185 bits (470),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/131 (67%), Positives = 105/131 (80%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            R  +R + RWA+  A+L +L+E+C  PA +LR VADAM VEM AGLASE GSKLKML++Y
Sbjct  22   RQRLREAKRWARAAAVLCDLQERCAAPAARLRMVADAMDVEMRAGLASEDGSKLKMLVTY  81

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VD+LPSGDE+GLFYALDLGGTNFRV+RVQLGGKE+ V+ +ES  VSIP+HLM GS   LF
Sbjct  82   VDSLPSGDEKGLFYALDLGGTNFRVLRVQLGGKEQRVIKQESVGVSIPQHLMSGSPHELF  141

Query  489  DFIAHELAMFV  521
            DFIA  L  FV
Sbjct  142  DFIAAALTKFV  152



>ref|XP_003567061.1| PREDICTED: hexokinase-9-like isoform X1 [Brachypodium distachyon]
Length=496

 Score =   186 bits (471),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/131 (67%), Positives = 105/131 (80%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            R  +R + RWA+  A+L +L+E+C  PA +LR VADAM VEM AGLASE GSKLKML++Y
Sbjct  22   RQRLREAKRWARAAAVLCDLQERCAAPAARLRMVADAMDVEMRAGLASEDGSKLKMLVTY  81

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VD+LPSGDE+GLFYALDLGGTNFRV+RVQLGGKE+ V+ +ES  VSIP+HLM GS   LF
Sbjct  82   VDSLPSGDEKGLFYALDLGGTNFRVLRVQLGGKEQRVIKQESVGVSIPQHLMSGSPHELF  141

Query  489  DFIAHELAMFV  521
            DFIA  L  FV
Sbjct  142  DFIAAALTKFV  152



>ref|XP_010041948.1| PREDICTED: hexokinase-1-like [Eucalyptus grandis]
Length=232

 Score =   178 bits (451),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 84/126 (67%), Positives = 100/126 (79%), Gaps = 0/126 (0%)
 Frame = +3

Query  144  SSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLP  323
            + G+W +   ++KELEEKCGTP  K RQVA+AM V+MHAGL  +GGSKLKMLISYVD+LP
Sbjct  43   TDGKWERAAEMVKELEEKCGTPVWKPRQVAEAMVVKMHAGLTYDGGSKLKMLISYVDSLP  102

Query  324  SGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIAH  503
            +GDE+GL+YALDLGGTNF ++RV L  KEKG+V RE +EVSIP HLM GS   LFDFIA 
Sbjct  103  TGDEKGLYYALDLGGTNFCILRVHLSRKEKGIVKREFEEVSIPPHLMTGSLNELFDFIAM  162

Query  504  ELAMFV  521
             L  FV
Sbjct  163  ALTKFV  168



>ref|XP_011080413.1| PREDICTED: hexokinase-1-like [Sesamum indicum]
Length=489

 Score =   184 bits (468),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 89/131 (68%), Positives = 108/131 (82%), Gaps = 1/131 (1%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            R  M+  G+WA+ +ALLKE EEKC TP  KL+QVADA+ VEMHAGLASEGGSKLKMLIS+
Sbjct  25   RQRMKRCGKWARAMALLKEFEEKCATPEAKLKQVADALTVEMHAGLASEGGSKLKMLISF  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            + NLP+GDE+G+FYALDLGGTNFRV+RVQL G+  GVV++E  EVSIP  L  G+S+ LF
Sbjct  85   IANLPTGDEDGIFYALDLGGTNFRVLRVQLRGR-GGVVHQEIAEVSIPPALTGGTSDELF  143

Query  489  DFIAHELAMFV  521
            D+IA +LA FV
Sbjct  144  DYIAEKLANFV  154



>ref|XP_003568034.1| PREDICTED: hexokinase-2 isoform X1 [Brachypodium distachyon]
Length=494

 Score =   184 bits (466),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 88/131 (67%), Positives = 107/131 (82%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            R  +R + RWA+  A+L+ELEE+C     +LRQVADA+AVEMHAGLASEGGSKL M+IS+
Sbjct  22   RRQIREAKRWARAAAVLRELEERCAATPARLRQVADAVAVEMHAGLASEGGSKLGMIISH  81

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            V++LPSG E+GLFYALDLGGTNFRV+RVQLGGKE  VV +E +E+SIP +LM G+S  LF
Sbjct  82   VESLPSGQEKGLFYALDLGGTNFRVLRVQLGGKEGRVVKQECEEISIPTNLMTGNSHDLF  141

Query  489  DFIAHELAMFV  521
            DFIA  LA FV
Sbjct  142  DFIAAALAKFV  152



>ref|XP_002283574.1| PREDICTED: hexokinase-2 [Vitis vinifera]
Length=498

 Score =   183 bits (465),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 89/131 (68%), Positives = 106/131 (81%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            R  MR +    K + ++K+ EE C T   KL+ VADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RRRMRCANGRVKAMEIVKDFEEDCATSYSKLKHVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLP+GDE+GLFYALDLGGTNFRV+RVQLGG++  +VN+E  EVSIP +LMV S++ALF
Sbjct  85   VDNLPTGDEKGLFYALDLGGTNFRVLRVQLGGRDGRIVNQEFVEVSIPPNLMVKSTDALF  144

Query  489  DFIAHELAMFV  521
            D+IA ELA FV
Sbjct  145  DYIATELAKFV  155



>ref|XP_004513053.1| PREDICTED: hexokinase-1-like [Cicer arietinum]
Length=499

 Score =   182 bits (463),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/126 (70%), Positives = 103/126 (82%), Gaps = 0/126 (0%)
 Frame = +3

Query  144  SSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLP  323
            SSG+W     ++K   E+CGTP  KL++VA+AM  EM+ GLASEGGSKLKMLIS+VDNLP
Sbjct  31   SSGKWGMAEDIVKRFGEECGTPIEKLKKVAEAMVFEMNKGLASEGGSKLKMLISFVDNLP  90

Query  324  SGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIAH  503
            SG+E+G+FYALDLGGTNFR +RVQLGGKEKGV N ES+EVSIP HLM GS+  LFDFIA 
Sbjct  91   SGNEKGMFYALDLGGTNFRALRVQLGGKEKGVANVESEEVSIPPHLMTGSAHELFDFIAT  150

Query  504  ELAMFV  521
             LA FV
Sbjct  151  SLAKFV  156



>emb|CAN74362.1| hypothetical protein VITISV_016381 [Vitis vinifera]
Length=533

 Score =   182 bits (463),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 89/131 (68%), Positives = 106/131 (81%), Gaps = 0/131 (0%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            R  MR +    K + ++K+ EE C T   KL+ VADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RRRMRCANGRVKAMEIVKDFEEDCATSYSKLKHVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLP+GDE+GLFYALDLGGTNFRV+RVQLGG++  +VN+E  EVSIP +LMV S++ALF
Sbjct  85   VDNLPTGDEKGLFYALDLGGTNFRVLRVQLGGRDGHIVNQEFVEVSIPPNLMVKSTDALF  144

Query  489  DFIAHELAMFV  521
            D+IA ELA FV
Sbjct  145  DYIATELAKFV  155



>ref|XP_010665885.1| PREDICTED: hexokinase-1-like isoform X1 [Beta vulgaris subsp. 
vulgaris]
Length=513

 Score =   181 bits (459),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 82/128 (64%), Positives = 106/128 (83%), Gaps = 0/128 (0%)
 Frame = +3

Query  138  MRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDN  317
            M++   W +T+ +L++ EEKCGTP  KL+QVADAM +EMHAGLAS+ GS +KMLISYVDN
Sbjct  28   MKNGANWRRTMEILRDFEEKCGTPIEKLKQVADAMVMEMHAGLASDDGSSIKMLISYVDN  87

Query  318  LPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFI  497
            LP+GDE+GLFYALDLGGTNFRV+RVQLGGK+ G+ ++E  EV IP  LM+G+S+ LF +I
Sbjct  88   LPTGDEDGLFYALDLGGTNFRVLRVQLGGKDGGIKHQEFAEVPIPVELMIGTSDDLFGYI  147

Query  498  AHELAMFV  521
            A E+A F+
Sbjct  148  ASEVAKFI  155



>dbj|BAP47497.1| hexokinase [Gentiana triflora]
Length=497

 Score =   178 bits (452),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 90/131 (69%), Positives = 107/131 (82%), Gaps = 1/131 (1%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            RHHM++S +W K + +L+ELEE C T   KL+Q+ADAM VEMHAGLASEGGSKLKMLI+Y
Sbjct  25   RHHMKNSAKWGKALEILEELEENCATSTWKLKQIADAMTVEMHAGLASEGGSKLKMLITY  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VDNLP+G+E+G+FYALDLGGTNFRVMRV  G  E+ +VN E    SIP HLMVG+S+ALF
Sbjct  85   VDNLPTGEEKGVFYALDLGGTNFRVMRVHFGEAEEQIVNEEVH-TSIPLHLMVGTSDALF  143

Query  489  DFIAHELAMFV  521
            DFIA  LA FV
Sbjct  144  DFIASTLAKFV  154



>ref|XP_002988103.1| hypothetical protein SELMODRAFT_269350 [Selaginella moellendorffii]
 gb|EFJ10895.1| hypothetical protein SELMODRAFT_269350 [Selaginella moellendorffii]
Length=513

 Score =   178 bits (451),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/130 (64%), Positives = 101/130 (78%), Gaps = 0/130 (0%)
 Frame = +3

Query  132  HHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYV  311
              +R    W +   ++ E    C TP  +LRQ+ D M VEMHAGLA +GGSKLKM++SYV
Sbjct  28   RRLRQRTSWKRAQCIVDEFRGGCSTPLSRLRQIVDNMVVEMHAGLAIDGGSKLKMVLSYV  87

Query  312  DNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFD  491
            DNLP+G+EEGLFYALDLGGTNFRV+RVQLGGKEK ++N+E +EVSIP  +MVGS+E LFD
Sbjct  88   DNLPTGNEEGLFYALDLGGTNFRVLRVQLGGKEKRIMNQEYKEVSIPPKVMVGSNEDLFD  147

Query  492  FIAHELAMFV  521
            FIA ELA FV
Sbjct  148  FIATELASFV  157



>ref|XP_002972691.1| hypothetical protein SELMODRAFT_441916 [Selaginella moellendorffii]
 gb|EFJ25912.1| hypothetical protein SELMODRAFT_441916 [Selaginella moellendorffii]
Length=513

 Score =   177 bits (449),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 82/130 (63%), Positives = 101/130 (78%), Gaps = 0/130 (0%)
 Frame = +3

Query  132  HHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYV  311
              +R    W +   ++ E    C TP  +LRQ+ D M VEMHAGLA +GGSKLKM++SYV
Sbjct  28   RRLRQRTSWKRAQCIVDEFRGGCSTPLSRLRQIVDNMVVEMHAGLAIDGGSKLKMVLSYV  87

Query  312  DNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFD  491
            DNLP+G+EEGLFYALDLGGTNFRV+RVQ+GGKEK ++N+E +EVSIP  +MVGS+E LFD
Sbjct  88   DNLPTGNEEGLFYALDLGGTNFRVLRVQMGGKEKRIMNQEYKEVSIPPKVMVGSNEDLFD  147

Query  492  FIAHELAMFV  521
            FIA ELA FV
Sbjct  148  FIATELASFV  157



>gb|KDO50431.1| hypothetical protein CISIN_1g0104561mg, partial [Citrus sinensis]
 gb|KDO50432.1| hypothetical protein CISIN_1g0104561mg, partial [Citrus sinensis]
Length=229

 Score =   169 bits (428),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 77/131 (59%), Positives = 101/131 (77%), Gaps = 0/131 (0%)
 Frame = +3

Query  132  HHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYV  311
              ++S  +W + + +L+ELEE C T   +LRQV DAMAVEMHAGLASEGGSKLKML+++V
Sbjct  28   KRVKSRRKWKRVMGVLRELEEGCETTVSRLRQVVDAMAVEMHAGLASEGGSKLKMLLTFV  87

Query  312  DNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFD  491
            DNLP+G E+G++YALDLGGTNFRV+RVQLGG+   +++ + +   IP  LM G+SE LFD
Sbjct  88   DNLPTGSEKGIYYALDLGGTNFRVLRVQLGGQRSSILSSDVERQPIPPELMTGTSEDLFD  147

Query  492  FIAHELAMFVK  524
            FIA  L  FV+
Sbjct  148  FIASALQQFVE  158



>ref|XP_002313358.2| hexokinase family protein [Populus trichocarpa]
 gb|EEE87313.2| hexokinase family protein [Populus trichocarpa]
Length=508

 Score =   174 bits (442),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 79/124 (64%), Positives = 100/124 (81%), Gaps = 0/124 (0%)
 Frame = +3

Query  153  RWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLPSGD  332
            +W + V +L+ELEE C TP G+LRQV DAMAVEMHAGLASEGGSKLKML+++VD+LP+G 
Sbjct  33   KWKRVVGVLRELEEACETPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTFVDHLPTGS  92

Query  333  EEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIAHELA  512
            E G +YALDLGGTNFRV+RVQLGG+   +++++ +   IPRHLM  +SE LFDFIA  L 
Sbjct  93   EIGTYYALDLGGTNFRVLRVQLGGRRSSILSQDVERRPIPRHLMTSTSEDLFDFIASTLK  152

Query  513  MFVK  524
             FV+
Sbjct  153  QFVE  156



>gb|KEH27216.1| hexokinase [Medicago truncatula]
Length=496

 Score =   174 bits (440),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 88/132 (67%), Positives = 100/132 (76%), Gaps = 3/132 (2%)
 Frame = +3

Query  135  HMRSSG---RWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLIS  305
              RS G   +W K   +LK   E+C T   KL+ VA+AM VEMH GL +EGGS LKMLIS
Sbjct  22   QQRSKGGCEKWEKVEEILKVFGEECETSIEKLKSVAEAMVVEMHNGLENEGGSMLKMLIS  81

Query  306  YVDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEAL  485
            +VDNLPSGDE+GLFYALDLGGTNFR +R+QLGGKEKGVV  E++EVSIP HLM GSS  L
Sbjct  82   FVDNLPSGDEKGLFYALDLGGTNFRALRIQLGGKEKGVVKVETEEVSIPPHLMTGSSHEL  141

Query  486  FDFIAHELAMFV  521
            FDFIA  LA FV
Sbjct  142  FDFIATSLAKFV  153



>ref|XP_011045448.1| PREDICTED: hexokinase-3-like [Populus euphratica]
Length=488

 Score =   173 bits (438),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 77/124 (62%), Positives = 101/124 (81%), Gaps = 0/124 (0%)
 Frame = +3

Query  153  RWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLPSGD  332
            +W + V++LKELEE C TP G+LRQV DAMAVEMHAGLASEGGSKLKML+++VD+LP+G 
Sbjct  33   KWKRVVSVLKELEEACETPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTFVDHLPTGS  92

Query  333  EEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIAHELA  512
            E G +YALDLGGTNFRV+R+QLGG+   +++++ +   IP+HL+  +SE LFDFIA  L 
Sbjct  93   EIGTYYALDLGGTNFRVLRIQLGGRRSSILSQDVERQPIPQHLLTSTSEDLFDFIASTLK  152

Query  513  MFVK  524
             FV+
Sbjct  153  QFVE  156



>ref|XP_010246625.1| PREDICTED: hexokinase-3-like [Nelumbo nucifera]
Length=511

 Score =   173 bits (438),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 81/131 (62%), Positives = 101/131 (77%), Gaps = 0/131 (0%)
 Frame = +3

Query  132  HHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYV  311
              ++S  +W + V +L+ELEE C T  G+LRQV DAMAVEMHAGLASEGGSKLKML+++V
Sbjct  26   RRVKSRRKWNRVVGVLRELEEGCSTSIGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTFV  85

Query  312  DNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFD  491
            DNLP+G+E+G +YALDLGGTNFRV+RVQLGGK   ++  E +   IP HLM  +SE LFD
Sbjct  86   DNLPNGNEKGTYYALDLGGTNFRVLRVQLGGKNSLILGHEVERQPIPEHLMTSTSEDLFD  145

Query  492  FIAHELAMFVK  524
            FIA  L  FV+
Sbjct  146  FIASTLEKFVE  156



>gb|AHY84733.1| hexokinase [Manihot esculenta]
Length=506

 Score =   172 bits (436),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 77/124 (62%), Positives = 100/124 (81%), Gaps = 0/124 (0%)
 Frame = +3

Query  153  RWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLPSGD  332
            +W++ V LL+ELEE C TP G+LRQV DAMAVEMHAGLASEGGSKLKML+++VD+LP+G 
Sbjct  33   KWSRVVGLLRELEESCETPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTFVDHLPTGS  92

Query  333  EEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIAHELA  512
            E G +YALDLGGTNFRV+RVQLGG+   +++++ +   IP+HLM  + E LFDFIA  L 
Sbjct  93   EVGTYYALDLGGTNFRVIRVQLGGRRSSILSKDVELQPIPQHLMTSTREDLFDFIASTLK  152

Query  513  MFVK  524
             F++
Sbjct  153  QFIE  156



>ref|XP_002298298.1| hexokinase family protein [Populus trichocarpa]
 gb|EEE83103.1| hexokinase family protein [Populus trichocarpa]
Length=508

 Score =   172 bits (435),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 77/124 (62%), Positives = 100/124 (81%), Gaps = 0/124 (0%)
 Frame = +3

Query  153  RWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLPSGD  332
            +W + V +L+ELEE C TP G+LRQV DAMAVEMHAGLASEGGSKLKML+++VD+LP+G 
Sbjct  33   KWKRVVRVLEELEEACETPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTFVDHLPTGS  92

Query  333  EEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIAHELA  512
            E G +YALDLGGTNFRV+R+QLGG+   +++++ +   IP+HLM  +SE LFDFIA  L 
Sbjct  93   EIGTYYALDLGGTNFRVLRIQLGGRRSSILSQDVERQPIPQHLMTSTSEDLFDFIASTLK  152

Query  513  MFVK  524
             FV+
Sbjct  153  QFVE  156



>tpg|DAA57818.1| TPA: hypothetical protein ZEAMMB73_547897 [Zea mays]
Length=371

 Score =   169 bits (427),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 83/138 (60%), Positives = 104/138 (75%), Gaps = 7/138 (5%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLAS---EGGSK----  287
            R  +R + RWA+  A+L++L+E+C  P  +LRQVADAM  EM AGLAS   EG S     
Sbjct  25   RQRLREARRWARAGAVLRDLQERCAAPVERLRQVADAMVAEMRAGLASNDSEGDSGSSVL  84

Query  288  LKMLISYVDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMV  467
            LKML++YVD+LPSGDE+GLFYALDLGGTNFRV+R+Q GGKE+ +V +ES+ VSIP+HLM 
Sbjct  85   LKMLVTYVDSLPSGDEKGLFYALDLGGTNFRVLRIQFGGKEQRIVKQESKTVSIPQHLMS  144

Query  468  GSSEALFDFIAHELAMFV  521
              S  LFDFIA  LA F+
Sbjct  145  RGSNELFDFIAAALAKFI  162



>ref|XP_011032066.1| PREDICTED: hexokinase-3 isoform X1 [Populus euphratica]
 ref|XP_011032067.1| PREDICTED: hexokinase-3 isoform X2 [Populus euphratica]
Length=508

 Score =   171 bits (433),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 77/124 (62%), Positives = 99/124 (80%), Gaps = 0/124 (0%)
 Frame = +3

Query  153  RWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLPSGD  332
            +W + V +L+ELEE C TP G+LRQV DAMAVEMHAGLASEGGSKLKML+++VD+LP G 
Sbjct  33   KWKRVVGVLRELEEACETPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTFVDHLPRGS  92

Query  333  EEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIAHELA  512
            E G +YALDLGGTNFRV+R+QLGG+   +++++ +   IP+HLM  +SE LFDFIA  L 
Sbjct  93   EIGTYYALDLGGTNFRVLRIQLGGRRSSILSQDVERQPIPQHLMTSTSEDLFDFIASTLK  152

Query  513  MFVK  524
             FV+
Sbjct  153  QFVE  156



>tpg|DAA57819.1| TPA: hypothetical protein ZEAMMB73_547897 [Zea mays]
Length=400

 Score =   169 bits (427),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 83/138 (60%), Positives = 104/138 (75%), Gaps = 7/138 (5%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLAS---EGGSK----  287
            R  +R + RWA+  A+L++L+E+C  P  +LRQVADAM  EM AGLAS   EG S     
Sbjct  25   RQRLREARRWARAGAVLRDLQERCAAPVERLRQVADAMVAEMRAGLASNDSEGDSGSSVL  84

Query  288  LKMLISYVDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMV  467
            LKML++YVD+LPSGDE+GLFYALDLGGTNFRV+R+Q GGKE+ +V +ES+ VSIP+HLM 
Sbjct  85   LKMLVTYVDSLPSGDEKGLFYALDLGGTNFRVLRIQFGGKEQRIVKQESKTVSIPQHLMS  144

Query  468  GSSEALFDFIAHELAMFV  521
              S  LFDFIA  LA F+
Sbjct  145  RGSNELFDFIAAALAKFI  162



>gb|KHN09247.1| Hexokinase-3 [Glycine soja]
Length=477

 Score =   170 bits (431),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 100/129 (78%), Gaps = 0/129 (0%)
 Frame = +3

Query  138  MRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDN  317
            MRS G+W + V +L+E+EE C T  G+LRQV DAMAVEMHAGLASEGGSKLKMLI++V N
Sbjct  1    MRSRGKWKRVVRVLREVEEGCETSVGRLRQVVDAMAVEMHAGLASEGGSKLKMLITFVHN  60

Query  318  LPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFI  497
            LP+G E+G +YALDLGGTNFRV+RV L G++  V+  E +   IP+HLM  +SE LFDFI
Sbjct  61   LPNGTEKGTYYALDLGGTNFRVLRVHLHGQQSSVLEHEVERQPIPQHLMTSTSEDLFDFI  120

Query  498  AHELAMFVK  524
            A  L  F++
Sbjct  121  ASSLKEFIE  129



>gb|KDP22128.1| hypothetical protein JCGZ_25959 [Jatropha curcas]
Length=499

 Score =   170 bits (431),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 80/127 (63%), Positives = 101/127 (80%), Gaps = 0/127 (0%)
 Frame = +3

Query  144  SSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLP  323
            S  +W + + +LKELEE C T  G+LRQV DAMAVEMHAGLASEGGSKLKML++YVD+LP
Sbjct  30   SRKKWRRVLGVLKELEESCETTIGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDHLP  89

Query  324  SGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIAH  503
            +G E G +YALDLG TNFRV+RVQLGG+E  +++++ ++  IP+HLM  SSE LFDFIA 
Sbjct  90   TGSEIGTYYALDLGDTNFRVLRVQLGGRESLMLSKDVEQQPIPQHLMTSSSEDLFDFIAS  149

Query  504  ELAMFVK  524
             L  FV+
Sbjct  150  TLKQFVE  156



>ref|XP_003537744.1| PREDICTED: hexokinase-3-like [Glycine max]
Length=504

 Score =   170 bits (431),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 100/129 (78%), Gaps = 0/129 (0%)
 Frame = +3

Query  138  MRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDN  317
            MRS G+W + V +L+E+EE C T  G+LRQV DAMAVEMHAGLASEGGSKLKMLI++V N
Sbjct  28   MRSRGKWKRVVRVLREVEEGCETSVGRLRQVVDAMAVEMHAGLASEGGSKLKMLITFVHN  87

Query  318  LPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFI  497
            LP+G E+G +YALDLGGTNFRV+RV L G++  V+  E +   IP+HLM  +SE LFDFI
Sbjct  88   LPNGTEKGTYYALDLGGTNFRVLRVHLHGQQSSVLEHEVERQPIPQHLMTSTSEDLFDFI  147

Query  498  AHELAMFVK  524
            A  L  F++
Sbjct  148  ASSLKEFIE  156



>ref|XP_010673708.1| PREDICTED: hexokinase-3-like isoform X1 [Beta vulgaris subsp. 
vulgaris]
Length=509

 Score =   170 bits (431),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/127 (62%), Positives = 99/127 (78%), Gaps = 0/127 (0%)
 Frame = +3

Query  138  MRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDN  317
            ++S  +W + V +LKELEE CGT   +L+QV DAMAVEMHAGLASEGGSKLKML+++VD 
Sbjct  28   VKSRRKWQRVVGVLKELEECCGTHVSRLKQVVDAMAVEMHAGLASEGGSKLKMLLTFVDK  87

Query  318  LPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFI  497
            LP+G E+G++YALDLGGTNFRV+RVQLGG+  G+V  + +   IP HLM  +SE LFDFI
Sbjct  88   LPNGSEKGIYYALDLGGTNFRVLRVQLGGRRSGIVRHDVERKPIPEHLMTSTSEDLFDFI  147

Query  498  AHELAMF  518
            A  L  F
Sbjct  148  ATSLKDF  154



>ref|XP_008800256.1| PREDICTED: hexokinase-3-like isoform X2 [Phoenix dactylifera]
Length=227

 Score =   163 bits (413),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 101/131 (77%), Gaps = 0/131 (0%)
 Frame = +3

Query  132  HHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYV  311
               RS  +W + V +L+E E+ C T  G+L+QV DAMAVEMHAGLAS+GGSKLKML+S++
Sbjct  26   RRARSQRKWRRAVEVLREFEDGCATSIGRLKQVVDAMAVEMHAGLASDGGSKLKMLLSFI  85

Query  312  DNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFD  491
            D+LP+G+E G +YALDLGGTNFRV+RV+LGGK   + + + +  +IPR LM G+SE LFD
Sbjct  86   DSLPNGNEIGTYYALDLGGTNFRVLRVRLGGKGSMISSPQVERQAIPRELMSGTSEDLFD  145

Query  492  FIAHELAMFVK  524
            FIA +L  FV+
Sbjct  146  FIAMKLKQFVE  156



>ref|NP_001044102.1| Os01g0722700 [Oryza sativa Japonica Group]
 dbj|BAF06016.1| Os01g0722700 [Oryza sativa Japonica Group]
 dbj|BAG91675.1| unnamed protein product [Oryza sativa Japonica Group]
Length=294

 Score =   165 bits (417),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/116 (66%), Positives = 97/116 (84%), Gaps = 0/116 (0%)
 Frame = +3

Query  174  LLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLPSGDEEGLFYA  353
            LL++L+E+C  P   LRQVADAMA EM AGLA+EGGS L+ML++YVD+LPSG E+G+FYA
Sbjct  42   LLRDLQERCAAPVELLRQVADAMAAEMRAGLAAEGGSDLQMLVTYVDSLPSGGEKGMFYA  101

Query  354  LDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIAHELAMFV  521
            LDLGGTNFRV+RVQLGGKE+ ++ ++S+ +SIP+HLM  SS  LFDF+A  LA FV
Sbjct  102  LDLGGTNFRVLRVQLGGKERRIIKQDSEGISIPQHLMSSSSHELFDFVAVALAKFV  157



>ref|XP_007015149.1| Hexokinase-like 1 [Theobroma cacao]
 gb|EOY32768.1| Hexokinase-like 1 [Theobroma cacao]
Length=506

 Score =   169 bits (428),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/129 (61%), Positives = 99/129 (77%), Gaps = 0/129 (0%)
 Frame = +3

Query  132  HHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYV  311
              ++S  +W + V +LKELEE C T  G+LRQV DAMAVEMHAGLASEGGSKLKML+++V
Sbjct  26   RRVKSRRKWKRVVGVLKELEESCETTVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTFV  85

Query  312  DNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFD  491
            DNLPSG E+G +YALDLGGTNFRV+RV+LGG+   V++++ +   IP+ LM G SE L D
Sbjct  86   DNLPSGSEKGTYYALDLGGTNFRVLRVELGGQRSSVLDQDVERQPIPQQLMSGRSEDLLD  145

Query  492  FIAHELAMF  518
            FIA  L  F
Sbjct  146  FIASSLQQF  154



>ref|XP_009405075.1| PREDICTED: hexokinase-2-like [Musa acuminata subsp. malaccensis]
Length=534

 Score =   169 bits (429),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 97/117 (83%), Gaps = 2/117 (2%)
 Frame = +3

Query  174  LLKELEEKCGTPAGKLRQVADAMAVEMHAGL--ASEGGSKLKMLISYVDNLPSGDEEGLF  347
            ++++LEE C TP  +L+QVA AMA EMHAGL  A  GGSKL+ML S+VD LP+GDEEGLF
Sbjct  35   IVRQLEEACATPTERLKQVAQAMAAEMHAGLLAADAGGSKLRMLPSFVDKLPTGDEEGLF  94

Query  348  YALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIAHELAMF  518
            Y LDLGGTNFRV+RVQLGGKE+G++ +ES+EV IP HLM GSS+ LFDFIA ELA F
Sbjct  95   YGLDLGGTNFRVLRVQLGGKERGIIEQESKEVPIPPHLMFGSSDELFDFIAIELADF  151



>gb|ACN29323.1| unknown [Zea mays]
Length=482

 Score =   169 bits (427),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 83/138 (60%), Positives = 104/138 (75%), Gaps = 7/138 (5%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLAS---EGGSK----  287
            R  +R + RWA+  A+L++L+E+C  P  +LRQVADAM  EM AGLAS   EG S     
Sbjct  3    RQRLREARRWARAGAVLRDLQERCAAPVERLRQVADAMVAEMRAGLASNDSEGDSGSSVL  62

Query  288  LKMLISYVDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMV  467
            LKML++YVD+LPSGDE+GLFYALDLGGTNFRV+R+Q GGKE+ +V +ES+ VSIP+HLM 
Sbjct  63   LKMLVTYVDSLPSGDEKGLFYALDLGGTNFRVLRIQFGGKEQRIVKQESKTVSIPQHLMS  122

Query  468  GSSEALFDFIAHELAMFV  521
              S  LFDFIA  LA F+
Sbjct  123  RGSNELFDFIAAALAKFI  140



>gb|KJB83525.1| hypothetical protein B456_013G251900 [Gossypium raimondii]
 gb|KJB83526.1| hypothetical protein B456_013G251900 [Gossypium raimondii]
Length=355

 Score =   166 bits (420),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 78/124 (63%), Positives = 99/124 (80%), Gaps = 1/124 (1%)
 Frame = +3

Query  153  RWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLPSGD  332
            +W + V +LKE+EE C T  G+L+QV DAMAVEMHAGLASEGGSKLKML+++VDNLPSG 
Sbjct  33   KWKRVVGVLKEMEESCETTVGRLKQVVDAMAVEMHAGLASEGGSKLKMLLTFVDNLPSGS  92

Query  333  EEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIAHELA  512
            E+G+FYALDLGGTNFRV+RV+LGG ++  ++ + ++  IP  LM G SE LFDFIA  L 
Sbjct  93   EKGIFYALDLGGTNFRVLRVELGG-QRSDLDPDVEQQPIPEQLMTGRSEDLFDFIASSLY  151

Query  513  MFVK  524
             FV+
Sbjct  152  QFVE  155



>ref|NP_001146056.1| hypothetical protein [Zea mays]
 gb|ACL53123.1| unknown [Zea mays]
 tpg|DAA57820.1| TPA: hypothetical protein ZEAMMB73_547897 [Zea mays]
Length=504

 Score =   169 bits (427),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 83/138 (60%), Positives = 104/138 (75%), Gaps = 7/138 (5%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLAS---EGGSK----  287
            R  +R + RWA+  A+L++L+E+C  P  +LRQVADAM  EM AGLAS   EG S     
Sbjct  25   RQRLREARRWARAGAVLRDLQERCAAPVERLRQVADAMVAEMRAGLASNDSEGDSGSSVL  84

Query  288  LKMLISYVDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMV  467
            LKML++YVD+LPSGDE+GLFYALDLGGTNFRV+R+Q GGKE+ +V +ES+ VSIP+HLM 
Sbjct  85   LKMLVTYVDSLPSGDEKGLFYALDLGGTNFRVLRIQFGGKEQRIVKQESKTVSIPQHLMS  144

Query  468  GSSEALFDFIAHELAMFV  521
              S  LFDFIA  LA F+
Sbjct  145  RGSNELFDFIAAALAKFI  162



>gb|KJB83527.1| hypothetical protein B456_013G251900 [Gossypium raimondii]
Length=361

 Score =   166 bits (419),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 78/124 (63%), Positives = 99/124 (80%), Gaps = 1/124 (1%)
 Frame = +3

Query  153  RWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLPSGD  332
            +W + V +LKE+EE C T  G+L+QV DAMAVEMHAGLASEGGSKLKML+++VDNLPSG 
Sbjct  33   KWKRVVGVLKEMEESCETTVGRLKQVVDAMAVEMHAGLASEGGSKLKMLLTFVDNLPSGS  92

Query  333  EEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIAHELA  512
            E+G+FYALDLGGTNFRV+RV+LGG ++  ++ + ++  IP  LM G SE LFDFIA  L 
Sbjct  93   EKGIFYALDLGGTNFRVLRVELGG-QRSDLDPDVEQQPIPEQLMTGRSEDLFDFIASSLY  151

Query  513  MFVK  524
             FV+
Sbjct  152  QFVE  155



>ref|XP_006470700.1| PREDICTED: hexokinase-3-like [Citrus sinensis]
Length=510

 Score =   168 bits (426),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 101/130 (78%), Gaps = 0/130 (0%)
 Frame = +3

Query  135  HMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVD  314
             ++S  +W + + +L+ELEE C T   +LRQV DAMAVEMHAGLASEGGSKLKML+++VD
Sbjct  29   RVKSRRKWKRVMGVLRELEEGCETTVSRLRQVVDAMAVEMHAGLASEGGSKLKMLLTFVD  88

Query  315  NLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDF  494
            NLP+G E+G++YALDLGGTNFRV+RVQLGG+   +++ + +   IP  LM G+SE LFDF
Sbjct  89   NLPTGSEKGIYYALDLGGTNFRVLRVQLGGQRSSILSSDVERQPIPPELMTGTSEDLFDF  148

Query  495  IAHELAMFVK  524
            IA  L  FV+
Sbjct  149  IASALQQFVE  158



>ref|XP_006446203.1| hypothetical protein CICLE_v10014962mg [Citrus clementina]
 gb|ESR59443.1| hypothetical protein CICLE_v10014962mg [Citrus clementina]
Length=510

 Score =   168 bits (426),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 101/130 (78%), Gaps = 0/130 (0%)
 Frame = +3

Query  135  HMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVD  314
             ++S  +W + + +L+ELEE C T   +LRQV DAMAVEMHAGLASEGGSKLKML+++VD
Sbjct  29   RVKSRRKWKRVMGVLRELEEGCETTVSRLRQVVDAMAVEMHAGLASEGGSKLKMLLTFVD  88

Query  315  NLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDF  494
            NLP+G E+G++YALDLGGTNFRV+RVQLGG+   +++ + +   IP  LM G+SE LFDF
Sbjct  89   NLPTGSEKGIYYALDLGGTNFRVLRVQLGGQRSSILSSDVERQPIPPELMTGTSEDLFDF  148

Query  495  IAHELAMFVK  524
            IA  L  FV+
Sbjct  149  IASALQQFVE  158



>ref|XP_010273315.1| PREDICTED: hexokinase-3-like [Nelumbo nucifera]
Length=513

 Score =   168 bits (426),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 78/131 (60%), Positives = 100/131 (76%), Gaps = 0/131 (0%)
 Frame = +3

Query  132  HHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYV  311
              ++S  +W++ V +LKELEE C T  G+L+QV DAMAVEMHAGLASEGGSKLKML+++V
Sbjct  26   RRVKSRRKWSRVVGVLKELEEGCSTSIGRLKQVVDAMAVEMHAGLASEGGSKLKMLLTFV  85

Query  312  DNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFD  491
            DNLP G+E+G +YAL LGGTNFRV+RVQLGG+   ++  E     IP+HLM  +SE LFD
Sbjct  86   DNLPDGNEKGTYYALHLGGTNFRVLRVQLGGENSLILGHEVDRQPIPQHLMTSTSEGLFD  145

Query  492  FIAHELAMFVK  524
            FI  +L  FV+
Sbjct  146  FIVSKLEQFVE  156



>ref|XP_008450397.1| PREDICTED: hexokinase-3-like [Cucumis melo]
Length=507

 Score =   168 bits (425),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 78/131 (60%), Positives = 98/131 (75%), Gaps = 0/131 (0%)
 Frame = +3

Query  132  HHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYV  311
              ++S  +W + V +L+ELE  C TP  +LRQV DAMAVEMHAGLASEGGSKLKML++YV
Sbjct  27   RRVKSRSKWKRVVGVLEELEATCDTPVRRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYV  86

Query  312  DNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFD  491
            DNLP+G E+G FYALDLGGTNFRV+RV LGG+    +  + +   IP++LM G+ E LFD
Sbjct  87   DNLPNGSEKGTFYALDLGGTNFRVLRVHLGGQRSLTLKHDVERQPIPQNLMTGTREGLFD  146

Query  492  FIAHELAMFVK  524
            FIA  L  FV+
Sbjct  147  FIASSLKEFVE  157



>ref|XP_008800255.1| PREDICTED: hexokinase-3-like isoform X1 [Phoenix dactylifera]
Length=295

 Score =   162 bits (411),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/128 (59%), Positives = 101/128 (79%), Gaps = 0/128 (0%)
 Frame = +3

Query  141  RSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNL  320
            RS  +W + V +L+E E+ C T  G+L+QV DAMAVEMHAGLAS+GGSKLKML+S++D+L
Sbjct  29   RSQRKWRRAVEVLREFEDGCATSIGRLKQVVDAMAVEMHAGLASDGGSKLKMLLSFIDSL  88

Query  321  PSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIA  500
            P+G+E G +YALDLGGTNFRV+RV+LGGK   + + + +  +IPR LM G+SE LFDFIA
Sbjct  89   PNGNEIGTYYALDLGGTNFRVLRVRLGGKGSMISSPQVERQAIPRELMSGTSEDLFDFIA  148

Query  501  HELAMFVK  524
             +L  FV+
Sbjct  149  MKLKQFVE  156



>gb|AEB00843.1| hexokinase 7 [Hordeum vulgare subsp. vulgare]
Length=186

 Score =   159 bits (401),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/116 (67%), Positives = 92/116 (79%), Gaps = 0/116 (0%)
 Frame = +3

Query  174  LLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLPSGDEEGLFYA  353
            L+ +L EKC TP   LR VA AMA EM AGL  EGGS++KML+SYVD LP+G E+GLFY 
Sbjct  5    LVADLREKCDTPVSLLRDVAAAMADEMCAGLEKEGGSRVKMLLSYVDKLPTGREDGLFYG  64

Query  354  LDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIAHELAMFV  521
            LDLGGTNFRV++VQLGG +K V++RES+EV+IP HLM GSS  LF FIA ELA FV
Sbjct  65   LDLGGTNFRVLKVQLGGNDKHVISRESREVAIPPHLMSGSSSELFAFIASELAKFV  120



>ref|XP_003540378.1| PREDICTED: hexokinase-3-like [Glycine max]
Length=504

 Score =   166 bits (421),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 79/131 (60%), Positives = 98/131 (75%), Gaps = 0/131 (0%)
 Frame = +3

Query  132  HHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYV  311
              MRS G W +   +LKE+EE C T  G+LRQV DAMAVEMHAGLASEGGSKLKML++YV
Sbjct  26   QRMRSRGNWKRVARVLKEVEEGCETSVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYV  85

Query  312  DNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFD  491
             NLP+G E+G +YALDLGGTNFRV+RV L G++  V+  E +   IP++LM  +SE LFD
Sbjct  86   HNLPNGTEKGTYYALDLGGTNFRVLRVHLHGQQSSVLEHEVERQPIPQNLMTSTSEDLFD  145

Query  492  FIAHELAMFVK  524
            FIA  L  F++
Sbjct  146  FIASSLKEFIE  156



>gb|KHN25630.1| Hexokinase-3 [Glycine soja]
Length=387

 Score =   164 bits (414),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 77/129 (60%), Positives = 94/129 (73%), Gaps = 0/129 (0%)
 Frame = +3

Query  135  HMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVD  314
            H RS  +W K   +++ELEE C T  G+LRQV DAMAVEMHAGLASEGGSKLKML+++VD
Sbjct  33   HKRSRRKWKKVANVVRELEEGCATRVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTFVD  92

Query  315  NLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDF  494
            NLP+G E G +YAL LGGTNFRV+RVQL G+       E +   IP+H+M  +SE LFDF
Sbjct  93   NLPNGTERGTYYALHLGGTNFRVLRVQLNGQPSSDFEHEVERQPIPQHVMTSTSEDLFDF  152

Query  495  IAHELAMFV  521
            IA  L  F+
Sbjct  153  IASSLKEFI  161



>gb|KJB83523.1| hypothetical protein B456_013G251900 [Gossypium raimondii]
Length=504

 Score =   166 bits (420),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 78/124 (63%), Positives = 99/124 (80%), Gaps = 1/124 (1%)
 Frame = +3

Query  153  RWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLPSGD  332
            +W + V +LKE+EE C T  G+L+QV DAMAVEMHAGLASEGGSKLKML+++VDNLPSG 
Sbjct  33   KWKRVVGVLKEMEESCETTVGRLKQVVDAMAVEMHAGLASEGGSKLKMLLTFVDNLPSGS  92

Query  333  EEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIAHELA  512
            E+G+FYALDLGGTNFRV+RV+LGG ++  ++ + ++  IP  LM G SE LFDFIA  L 
Sbjct  93   EKGIFYALDLGGTNFRVLRVELGG-QRSDLDPDVEQQPIPEQLMTGRSEDLFDFIASSLY  151

Query  513  MFVK  524
             FV+
Sbjct  152  QFVE  155



>gb|KJB83524.1| hypothetical protein B456_013G251900 [Gossypium raimondii]
Length=505

 Score =   166 bits (420),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 78/124 (63%), Positives = 99/124 (80%), Gaps = 1/124 (1%)
 Frame = +3

Query  153  RWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLPSGD  332
            +W + V +LKE+EE C T  G+L+QV DAMAVEMHAGLASEGGSKLKML+++VDNLPSG 
Sbjct  33   KWKRVVGVLKEMEESCETTVGRLKQVVDAMAVEMHAGLASEGGSKLKMLLTFVDNLPSGS  92

Query  333  EEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIAHELA  512
            E+G+FYALDLGGTNFRV+RV+LGG ++  ++ + ++  IP  LM G SE LFDFIA  L 
Sbjct  93   EKGIFYALDLGGTNFRVLRVELGG-QRSDLDPDVEQQPIPEQLMTGRSEDLFDFIASSLY  151

Query  513  MFVK  524
             FV+
Sbjct  152  QFVE  155



>gb|EYU46224.1| hypothetical protein MIMGU_mgv1a004779mg [Erythranthe guttata]
Length=510

 Score =   166 bits (419),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 101/132 (77%), Gaps = 1/132 (1%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            R   R SG W + + +L+ELEE C TP G+LRQV DAMAVEMHAGLASEGGSKLKML+++
Sbjct  26   RTVRRRSG-WRRVLRVLEELEEGCATPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTF  84

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            + NLP+G+E+G++YALDLGGTNFRV+RV+LGG+   +   +     IP+HLM  ++E LF
Sbjct  85   IHNLPTGNEKGIYYALDLGGTNFRVLRVKLGGERSSITELDVDRKPIPQHLMTSTTEELF  144

Query  489  DFIAHELAMFVK  524
            DFIA  L  FV+
Sbjct  145  DFIATSLKDFVE  156



>gb|AHY84732.1| hexokinase [Manihot esculenta]
Length=508

 Score =   166 bits (419),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 75/124 (60%), Positives = 99/124 (80%), Gaps = 0/124 (0%)
 Frame = +3

Query  153  RWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLPSGD  332
            +W + V +L+ELEE C T  G+L+QV DAMAVEMHAGLASEGGSKLKML+++VD+LP+G 
Sbjct  33   KWGRVVGVLRELEESCETTVGRLKQVVDAMAVEMHAGLASEGGSKLKMLLTFVDHLPTGS  92

Query  333  EEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIAHELA  512
            E G +YALDLGGTNFRV+RVQLGG+   +++++ +   IP+HLM  +SE LFDFIA  L 
Sbjct  93   EVGTYYALDLGGTNFRVLRVQLGGRLSSILSKDVELQPIPQHLMRSTSEDLFDFIASTLK  152

Query  513  MFVK  524
             F++
Sbjct  153  QFIE  156



>ref|XP_004139044.1| PREDICTED: hexokinase-3-like [Cucumis sativus]
 gb|KGN66504.1| hypothetical protein Csa_1G615730 [Cucumis sativus]
Length=507

 Score =   166 bits (419),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 78/131 (60%), Positives = 97/131 (74%), Gaps = 0/131 (0%)
 Frame = +3

Query  132  HHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYV  311
              ++S  +W + V +L+ELE  C TP  +LRQV DAMAVEMHAGLASEGGSKLKML++YV
Sbjct  27   RRVKSRSKWKRVVGVLEELEATCDTPLRRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYV  86

Query  312  DNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFD  491
            DNLP+G E G FYALDLGGTNFRV+RV LGG+    +  + +   IP++LM G+ E LFD
Sbjct  87   DNLPNGSEIGTFYALDLGGTNFRVLRVPLGGQRSLTLKHDVERQPIPQNLMTGTREGLFD  146

Query  492  FIAHELAMFVK  524
            FIA  L  FV+
Sbjct  147  FIASSLKEFVE  157



>ref|XP_009366073.1| PREDICTED: hexokinase-3 [Pyrus x bretschneideri]
 ref|XP_009375355.1| PREDICTED: hexokinase-3-like [Pyrus x bretschneideri]
Length=508

 Score =   166 bits (419),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 77/131 (59%), Positives = 99/131 (76%), Gaps = 0/131 (0%)
 Frame = +3

Query  132  HHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYV  311
              +RS  +W++ V +LK+LE+ C T  G+LRQV DAMAVEMHAGLAS+GGSKLKML+++V
Sbjct  26   RRIRSRRKWSRVVGVLKDLEQSCETTVGRLRQVVDAMAVEMHAGLASDGGSKLKMLLTFV  85

Query  312  DNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFD  491
            D LPSG E+G +YALDLGGTNFRV+RV+LGG     +  +    +IP+ LM G+SE LFD
Sbjct  86   DKLPSGSEKGTYYALDLGGTNFRVLRVKLGGTRSSTLEHDVCRQAIPQDLMTGTSEDLFD  145

Query  492  FIAHELAMFVK  524
            FIA  L  FV+
Sbjct  146  FIASSLKEFVE  156



>ref|XP_004154641.1| PREDICTED: hexokinase-3-like [Cucumis sativus]
Length=507

 Score =   166 bits (419),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 78/131 (60%), Positives = 97/131 (74%), Gaps = 0/131 (0%)
 Frame = +3

Query  132  HHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYV  311
              ++S  +W + V +L+ELE  C TP  +LRQV DAMAVEMHAGLASEGGSKLKML++YV
Sbjct  27   RRVKSRSKWKRVVGVLEELEATCDTPLRRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYV  86

Query  312  DNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFD  491
            DNLP+G E G FYALDLGGTNFRV+RV LGG+    +  + +   IP++LM G+ E LFD
Sbjct  87   DNLPNGSEIGTFYALDLGGTNFRVLRVHLGGQRSLTLKHDVERQPIPQNLMTGTREGLFD  146

Query  492  FIAHELAMFVK  524
            FIA  L  FV+
Sbjct  147  FIASSLKEFVE  157



>sp|Q2KNB7.1|HXK9_ORYSJ RecName: Full=Hexokinase-9; AltName: Full=Hexokinase-5 [Oryza 
sativa Japonica Group]
 gb|AAX68421.1| hexokinase 5 [Oryza sativa Japonica Group]
 gb|AAZ93626.1| hexokinase 9 [Oryza sativa Japonica Group]
 gb|EAZ13381.1| hypothetical protein OsJ_03300 [Oryza sativa Japonica Group]
Length=502

 Score =   165 bits (418),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 76/116 (66%), Positives = 97/116 (84%), Gaps = 0/116 (0%)
 Frame = +3

Query  174  LLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLPSGDEEGLFYA  353
            LL++L+E+C  P   LRQVADAMA EM AGLA+EGGS L+ML++YVD+LPSG E+G+FYA
Sbjct  42   LLRDLQERCAAPVELLRQVADAMAAEMRAGLAAEGGSDLQMLVTYVDSLPSGGEKGMFYA  101

Query  354  LDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIAHELAMFV  521
            LDLGGTNFRV+RVQLGGKE+ ++ ++S+ +SIP+HLM  SS  LFDF+A  LA FV
Sbjct  102  LDLGGTNFRVLRVQLGGKERRIIKQDSEGISIPQHLMSSSSHELFDFVAVALAKFV  157



>gb|AAL16967.1|AF367451_1 hexokinase [Prunus persica]
Length=224

 Score =   159 bits (401),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 78/94 (83%), Positives = 84/94 (89%), Gaps = 0/94 (0%)
 Frame = +3

Query  240  MAVEMHAGLASEGGSKLKMLISYVDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGV  419
            M VEMHAGLASEGGSKLKMLISYVDNLP+GDE+GLFYALDLGGTNFRV+RVQLGGKEK V
Sbjct  1    MTVEMHAGLASEGGSKLKMLISYVDNLPTGDEQGLFYALDLGGTNFRVIRVQLGGKEKRV  60

Query  420  VNRESQEVSIPRHLMVGSSEALFDFIAHELAMFV  521
            V +E  EVSIP +LM G+SEALFDFIA  LA FV
Sbjct  61   VKQEFDEVSIPPNLMTGTSEALFDFIAEALAKFV  94



>ref|XP_010921910.1| PREDICTED: hexokinase-3-like isoform X1 [Elaeis guineensis]
Length=498

 Score =   164 bits (416),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/129 (59%), Positives = 101/129 (78%), Gaps = 0/129 (0%)
 Frame = +3

Query  138  MRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDN  317
            ++S  +W + V +L+E EE C T  G+LRQV DAMAVEMHAGLAS+GGSKL+ML+++VDN
Sbjct  28   VQSRRKWRRAVEMLQEFEEGCATSIGRLRQVVDAMAVEMHAGLASDGGSKLRMLLTFVDN  87

Query  318  LPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFI  497
            LP G+E+G +YALDLGGTNFRV+RVQLGG+   +++ + +   IP+ LM G+SE LFDFI
Sbjct  88   LPDGNEKGTYYALDLGGTNFRVLRVQLGGRGSMILSHQVKHHPIPQELMSGTSEDLFDFI  147

Query  498  AHELAMFVK  524
            A  L  FV+
Sbjct  148  ARTLKQFVE  156



>gb|KHG14450.1| hypothetical protein F383_08688 [Gossypium arboreum]
Length=504

 Score =   164 bits (416),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 78/124 (63%), Positives = 99/124 (80%), Gaps = 1/124 (1%)
 Frame = +3

Query  153  RWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLPSGD  332
            +W + V +LKELEE C T  G+L+QV DAMAVEMHAGLASEGGSKLKML+++VD+LPSG 
Sbjct  33   KWKRVVGVLKELEESCETTVGRLKQVVDAMAVEMHAGLASEGGSKLKMLLTFVDSLPSGS  92

Query  333  EEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIAHELA  512
            E+G+FYALDLGGTNFRV+RV+LGG ++  ++ + ++  IP  LM G SE LFDFIA  L 
Sbjct  93   EKGIFYALDLGGTNFRVLRVELGG-QRSDLDPDVEQQPIPEQLMTGRSEDLFDFIASSLY  151

Query  513  MFVK  524
             FV+
Sbjct  152  QFVE  155



>gb|EAY75659.1| hypothetical protein OsI_03566 [Oryza sativa Indica Group]
Length=502

 Score =   164 bits (415),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/116 (65%), Positives = 97/116 (84%), Gaps = 0/116 (0%)
 Frame = +3

Query  174  LLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLPSGDEEGLFYA  353
            LL++L+++C  P   LRQVADAMA EM AGLA+EGGS L+ML++YVD+LPSG E+G+FYA
Sbjct  42   LLRDLQKRCAAPVELLRQVADAMAAEMRAGLAAEGGSDLQMLVTYVDSLPSGGEKGMFYA  101

Query  354  LDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIAHELAMFV  521
            LDLGGTNFRV+RVQLGGKE+ ++ ++S+ +SIP+HLM  SS  LFDF+A  LA FV
Sbjct  102  LDLGGTNFRVLRVQLGGKERRIIKQDSEGISIPQHLMSSSSHELFDFVAAALAKFV  157



>gb|EMT15586.1| Hexokinase-7 [Aegilops tauschii]
Length=430

 Score =   162 bits (410),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 80/116 (69%), Positives = 92/116 (79%), Gaps = 0/116 (0%)
 Frame = +3

Query  174  LLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLPSGDEEGLFYA  353
            ++ +L E+C TPA +L  VA AM  EM AGL  EGGSK+KM+ISYVDNLP+G EEGLFYA
Sbjct  12   VVAQLREECATPATRLDGVATAMEEEMRAGLHQEGGSKIKMIISYVDNLPNGSEEGLFYA  71

Query  354  LDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIAHELAMFV  521
            LDLGGTNFRV+RVQL GK+K VV RES+EVSIP HLM GS+  LF FIA  LA FV
Sbjct  72   LDLGGTNFRVLRVQLAGKDKRVVKRESREVSIPPHLMSGSAAELFGFIASALAKFV  127



>ref|XP_009414963.1| PREDICTED: hexokinase-3-like [Musa acuminata subsp. malaccensis]
Length=499

 Score =   163 bits (412),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 77/121 (64%), Positives = 96/121 (79%), Gaps = 0/121 (0%)
 Frame = +3

Query  162  KTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLPSGDEEG  341
            + VAL++ELE  C TP G+LRQV DAMAVEMHAGLAS+GGSKLKML++++DNLP G EEG
Sbjct  36   QAVALVRELEVACDTPVGRLRQVVDAMAVEMHAGLASDGGSKLKMLLTFIDNLPDGTEEG  95

Query  342  LFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIAHELAMFV  521
             +YALDLGGTNFRV+RVQLGGK   +++ + +   IP+ LM G+SE LF FIA  L  FV
Sbjct  96   TYYALDLGGTNFRVLRVQLGGKGSMILSHKVESQPIPQELMTGTSEELFTFIASILKRFV  155

Query  522  K  524
            +
Sbjct  156  Q  156



>ref|XP_001754148.1| hexokinase protein HXK7 [Physcomitrella patens]
 gb|EDQ81049.1| hexokinase protein HXK7 [Physcomitrella patens]
Length=521

 Score =   163 bits (412),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 78/116 (67%), Positives = 92/116 (79%), Gaps = 0/116 (0%)
 Frame = +3

Query  174  LLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLPSGDEEGLFYA  353
            +L E +E C TP  +LRQV DAMAVEMHAGL SEGGSKLKML +Y+D LP G E GL+YA
Sbjct  42   ILLEFQEACYTPLARLRQVVDAMAVEMHAGLVSEGGSKLKMLPTYIDRLPDGHERGLYYA  101

Query  354  LDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIAHELAMFV  521
            +DLGGTNFRV+RVQLGG E  V+ +E +EV+IP  LM+G+SE LFDFIA EL  FV
Sbjct  102  VDLGGTNFRVLRVQLGGLEGRVIKQEYEEVAIPPELMLGTSEQLFDFIAKELVSFV  157



>emb|CDM84160.1| unnamed protein product [Triticum aestivum]
Length=358

 Score =   160 bits (404),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 81/131 (62%), Positives = 98/131 (75%), Gaps = 13/131 (10%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            R  +R + RWA+  A+L +L+E+C  PA +L QV+DAM VEM AGLASE GSKLKML++Y
Sbjct  22   RQRLREAKRWARVAAVLSDLQERCVAPAARLLQVSDAMDVEMRAGLASEDGSKLKMLVTY  81

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VD+LPSGDE+GLFYALDLGGTNFRV+RVQLGGKE+ V+ +ES          VG    LF
Sbjct  82   VDSLPSGDEKGLFYALDLGGTNFRVLRVQLGGKEQRVIKQES----------VGE---LF  128

Query  489  DFIAHELAMFV  521
            DFIA  LA FV
Sbjct  129  DFIAAALAKFV  139



>ref|XP_003610965.1| Hexokinase [Medicago truncatula]
 gb|AES93923.1| hexokinase [Medicago truncatula]
Length=496

 Score =   162 bits (411),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 79/127 (62%), Positives = 93/127 (73%), Gaps = 0/127 (0%)
 Frame = +3

Query  141  RSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNL  320
            +S  +W K   +LKE EE C T  G+LRQV DAMAVEMHAGLASEGGSKLKML++YVDNL
Sbjct  29   KSRRKWKKVANVLKEFEEGCDTSVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDNL  88

Query  321  PSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIA  500
            P+G E+G +YAL LGGTNFRV RV L G+   V+  E +   IP HLM G+S+ LFDFIA
Sbjct  89   PNGTEKGPYYALHLGGTNFRVTRVHLSGQPSPVLEHEVERQPIPPHLMTGTSKDLFDFIA  148

Query  501  HELAMFV  521
              L  FV
Sbjct  149  SSLKEFV  155



>emb|CDP09609.1| unnamed protein product [Coffea canephora]
Length=509

 Score =   162 bits (411),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 79/131 (60%), Positives = 97/131 (74%), Gaps = 1/131 (1%)
 Frame = +3

Query  135  HMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVD  314
             ++S  RW K V +L+E EE C TP  KLRQV DAMAVEMHAGLASEGGSKLKML+++V 
Sbjct  28   RVKSRRRWTKVVKVLEEFEEGCATPVEKLRQVVDAMAVEMHAGLASEGGSKLKMLLTFVQ  87

Query  315  NLPSGD-EEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFD  491
            NLP+G  E+G++Y LDLGGTNFRV+RVQLGG+   ++    +   IP HLM  +SE LFD
Sbjct  88   NLPTGYVEKGVYYGLDLGGTNFRVLRVQLGGQRSAILEPGVERQPIPEHLMTSTSEELFD  147

Query  492  FIAHELAMFVK  524
            FIA  L  FV+
Sbjct  148  FIAASLQKFVE  158



>gb|EMT31348.1| Hexokinase-9 [Aegilops tauschii]
Length=732

 Score =   164 bits (415),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 82/131 (63%), Positives = 99/131 (76%), Gaps = 13/131 (10%)
 Frame = +3

Query  129  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  308
            R  +R + RWA+  A+L +L+E+C  PA +L QV+DAM VEM AGLASE GSKLKML++Y
Sbjct  22   RQRLREAKRWARVAAVLSDLQERCAAPAAQLLQVSDAMDVEMRAGLASEDGSKLKMLVTY  81

Query  309  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  488
            VD+LPSGDE+GLFYALDLGGTNFRV+RVQLGGKE+GV+ +ES          VG    LF
Sbjct  82   VDSLPSGDEKGLFYALDLGGTNFRVLRVQLGGKEQGVIKQES----------VGE---LF  128

Query  489  DFIAHELAMFV  521
            DFIA  LA FV
Sbjct  129  DFIAAALAEFV  139



>ref|XP_004511503.1| PREDICTED: hexokinase-3-like [Cicer arietinum]
Length=498

 Score =   162 bits (410),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 79/127 (62%), Positives = 93/127 (73%), Gaps = 0/127 (0%)
 Frame = +3

Query  141  RSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNL  320
            +S  +W K   +LKELEE C T  G+LRQV DAMAVEMHAGLASEGGSKLKML++YVDNL
Sbjct  29   KSRRKWRKVANVLKELEEGCDTSVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDNL  88

Query  321  PSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIA  500
            P+G E+G +YAL LGGTNFRV RV L G+   V+  E +   IP HLM  +SE LFDFIA
Sbjct  89   PNGTEKGPYYALHLGGTNFRVTRVHLTGQPSPVLEHEVERQPIPPHLMTSTSEDLFDFIA  148

Query  501  HELAMFV  521
              L  F+
Sbjct  149  SSLKEFI  155



>gb|ABR18277.1| unknown [Picea sitchensis]
Length=551

 Score =   162 bits (411),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 78/123 (63%), Positives = 97/123 (79%), Gaps = 1/123 (1%)
 Frame = +3

Query  156  WAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKL-KMLISYVDNLPSGD  332
            W +   ++KELE +C TP  +LR+V DAMA E+  GLASE  S L KM+ISYVD LP+GD
Sbjct  88   WKRAEGIVKELERQCSTPISRLREVVDAMAEELRVGLASEAKSNLLKMVISYVDTLPTGD  147

Query  333  EEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIAHELA  512
            E+GLFYALDLGGTNFRV+RVQLGGKE  V+++E  EV+IP +LMVG+ + LFD+IA ELA
Sbjct  148  EKGLFYALDLGGTNFRVLRVQLGGKEGRVIDKEFTEVTIPANLMVGTEKELFDYIASELA  207

Query  513  MFV  521
             FV
Sbjct  208  KFV  210



>ref|XP_006362320.1| PREDICTED: hexokinase-3-like [Solanum tuberosum]
Length=512

 Score =   162 bits (409),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 75/124 (60%), Positives = 95/124 (77%), Gaps = 0/124 (0%)
 Frame = +3

Query  153  RWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLPSGD  332
            +W K V +L+ELEE C T   +L+QV DAMAVEMHAGLASEGGSKLKML++YVD LP+G 
Sbjct  33   KWLKMVKVLEELEESCDTTVFRLKQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGS  92

Query  333  EEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIAHELA  512
            EEG +YALDLGGTNFRV+RV LG +   ++ ++ +   IP+HLM  +SE LFDFIA  L 
Sbjct  93   EEGTYYALDLGGTNFRVLRVHLGDQRSAILGQDIERQPIPQHLMTSTSEDLFDFIASSLK  152

Query  513  MFVK  524
             F++
Sbjct  153  DFIE  156



>gb|KHN35090.1| Hexokinase-3 [Glycine soja]
Length=316

 Score =   158 bits (399),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/123 (60%), Positives = 91/123 (74%), Gaps = 0/123 (0%)
 Frame = +3

Query  153  RWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLPSGD  332
            +W K   +++ELEE C T  G+LRQV DAMAVEMHAGLASEGGSKLKML+++VDNLP+G 
Sbjct  33   KWKKVANVVRELEEGCDTRVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTFVDNLPNGT  92

Query  333  EEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIAHELA  512
            E G +YAL LGGTNFRV+RVQL G+       E +   IP+H+M  +SE LFDFIA  L 
Sbjct  93   ERGTYYALHLGGTNFRVLRVQLNGQPSSDFEHEVERQPIPQHVMTSTSEDLFDFIASSLK  152

Query  513  MFV  521
             F+
Sbjct  153  EFI  155



>ref|XP_004251354.1| PREDICTED: hexokinase-3-like [Solanum lycopersicum]
 ref|XP_010313255.1| PREDICTED: hexokinase-3-like [Solanum lycopersicum]
Length=511

 Score =   161 bits (408),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/124 (60%), Positives = 95/124 (77%), Gaps = 0/124 (0%)
 Frame = +3

Query  153  RWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLPSGD  332
            +W K V +L+ELEE C T   +L+QV DAMAVEMHAGLASEGGSKLKML++YVD LP+G 
Sbjct  33   KWLKMVKVLEELEESCDTTVFRLKQVVDAMAVEMHAGLASEGGSKLKMLLTYVDKLPNGR  92

Query  333  EEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIAHELA  512
            EEG +YALDLGGTNFRV+RV LG +   ++ ++ +   IP+HLM  +SE LFDFIA  L 
Sbjct  93   EEGTYYALDLGGTNFRVLRVHLGDQRSAILGQDIERQPIPQHLMTSTSEDLFDFIASSLK  152

Query  513  MFVK  524
             F++
Sbjct  153  DFIE  156



>ref|XP_008775016.1| PREDICTED: hexokinase-3-like isoform X1 [Phoenix dactylifera]
Length=499

 Score =   161 bits (408),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/124 (60%), Positives = 97/124 (78%), Gaps = 0/124 (0%)
 Frame = +3

Query  153  RWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLPSGD  332
            +W + V +L+E EE C T  G+L QV DAMAVEMHAGLAS+GGSKLKML++++DNLP G+
Sbjct  33   KWRRAVEVLREFEEGCATSIGRLGQVVDAMAVEMHAGLASDGGSKLKMLLTFIDNLPDGN  92

Query  333  EEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIAHELA  512
            E+G +YALDLGGTNFRV+RVQLGGK   +++ + +   IP+ LM G+SE LFD+IA  L 
Sbjct  93   EKGTYYALDLGGTNFRVLRVQLGGKGSMIISHQVEYHPIPQELMSGTSEDLFDYIAMTLK  152

Query  513  MFVK  524
             FV+
Sbjct  153  QFVE  156



>ref|XP_008775017.1| PREDICTED: hexokinase-3-like isoform X2 [Phoenix dactylifera]
Length=498

 Score =   161 bits (407),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/124 (60%), Positives = 97/124 (78%), Gaps = 0/124 (0%)
 Frame = +3

Query  153  RWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLPSGD  332
            +W + V +L+E EE C T  G+L QV DAMAVEMHAGLAS+GGSKLKML++++DNLP G+
Sbjct  33   KWRRAVEVLREFEEGCATSIGRLGQVVDAMAVEMHAGLASDGGSKLKMLLTFIDNLPDGN  92

Query  333  EEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIAHELA  512
            E+G +YALDLGGTNFRV+RVQLGGK   +++ + +   IP+ LM G+SE LFD+IA  L 
Sbjct  93   EKGTYYALDLGGTNFRVLRVQLGGKGSMIISHQVEYHPIPQELMSGTSEDLFDYIAMTLK  152

Query  513  MFVK  524
             FV+
Sbjct  153  QFVE  156



>ref|XP_001752229.1| hexokinase protein HXK8 [Physcomitrella patens]
 gb|EDQ82962.1| hexokinase protein HXK8 [Physcomitrella patens]
Length=517

 Score =   161 bits (407),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/116 (66%), Positives = 94/116 (81%), Gaps = 0/116 (0%)
 Frame = +3

Query  174  LLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLPSGDEEGLFYA  353
            +L E +E C TP  +LRQV DAMAVEMHAGL SEGGSKLKML +++D+LP G+E+GL+YA
Sbjct  42   ILVEFQEACETPLPRLRQVVDAMAVEMHAGLVSEGGSKLKMLPTFIDHLPDGNEKGLYYA  101

Query  354  LDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIAHELAMFV  521
            +DLGGTNFRV+R QLGG E  V+ +E +EV+IP  LM+G+SE LFDFIA EL  FV
Sbjct  102  VDLGGTNFRVLRTQLGGLEGRVIKQEYEEVAIPPELMLGTSEQLFDFIAKELVSFV  157



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 561572122600