BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002E17

Length=457
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006361530.1|  PREDICTED: chlorophyll a-b binding protein 3...    226   4e-71   Solanum tuberosum [potatoes]
ref|XP_011096521.1|  PREDICTED: chlorophyll a-b binding protein 2...    226   9e-71   Sesamum indicum [beniseed]
ref|XP_009593856.1|  PREDICTED: chlorophyll a-b binding protein 4...    225   1e-70   Nicotiana tomentosiformis
ref|XP_009782924.1|  PREDICTED: chlorophyll a-b binding protein 5...    225   1e-70   Nicotiana sylvestris
ref|XP_009795316.1|  PREDICTED: chlorophyll a-b binding protein 4...    225   1e-70   Nicotiana sylvestris
ref|XP_009795315.1|  PREDICTED: chlorophyll a-b binding protein 4...    225   2e-70   Nicotiana sylvestris
ref|XP_008456347.1|  PREDICTED: chlorophyll a-b binding protein o...    225   2e-70   Cucumis melo [Oriental melon]
ref|XP_004145734.1|  PREDICTED: chlorophyll a-b binding protein, ...    225   2e-70   Cucumis sativus [cucumbers]
ref|XP_009628754.1|  PREDICTED: chlorophyll a-b binding protein 1...    224   2e-70   Nicotiana tomentosiformis
ref|XP_009790934.1|  PREDICTED: chlorophyll a-b binding protein 4...    224   2e-70   Nicotiana sylvestris
ref|XP_009611577.1|  PREDICTED: chlorophyll a-b binding protein 4...    224   2e-70   Nicotiana tomentosiformis
ref|XP_009618329.1|  PREDICTED: chlorophyll a-b binding protein 4...    224   2e-70   Nicotiana tomentosiformis
ref|XP_009790936.1|  PREDICTED: chlorophyll a-b binding protein 4...    224   3e-70   Nicotiana sylvestris
sp|P12470.1|CB25_NICPL  RecName: Full=Chlorophyll a-b binding pro...    224   3e-70   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
sp|P27492.1|CB21_TOBAC  RecName: Full=Chlorophyll a-b binding pro...    224   3e-70   Nicotiana tabacum [American tobacco]
ref|XP_009606802.1|  PREDICTED: chlorophyll a-b binding protein 1...    224   4e-70   Nicotiana tomentosiformis
ref|XP_004170962.1|  PREDICTED: chlorophyll a-b binding protein o...    224   5e-70   
ref|XP_004134603.1|  PREDICTED: chlorophyll a-b binding protein o...    223   7e-70   
ref|XP_004134608.1|  PREDICTED: chlorophyll a-b binding protein o...    223   7e-70   
ref|XP_009782922.1|  PREDICTED: chlorophyll a-b binding protein 5...    223   7e-70   Nicotiana sylvestris
ref|XP_009597417.1|  PREDICTED: chlorophyll a-b binding protein 5...    223   8e-70   Nicotiana tomentosiformis
ref|XP_009609679.1|  PREDICTED: chlorophyll a-b binding protein 7...    219   8e-70   Nicotiana tomentosiformis
ref|XP_009782923.1|  PREDICTED: chlorophyll a-b binding protein 5...    223   8e-70   Nicotiana sylvestris
ref|XP_009772885.1|  PREDICTED: chlorophyll a-b binding protein 5...    223   9e-70   Nicotiana sylvestris
ref|XP_006356073.1|  PREDICTED: chlorophyll a-b binding protein 3...    223   1e-69   Solanum tuberosum [potatoes]
gb|ABF17940.1|  putative chloroplast chlorophyll a/b-binding protein    223   1e-69   Carya cathayensis
ref|XP_009794580.1|  PREDICTED: chlorophyll a-b binding protein 7...    219   1e-69   Nicotiana sylvestris
sp|P08221.1|CB21_CUCSA  RecName: Full=Chlorophyll a-b binding pro...    222   1e-69   Cucumis sativus [cucumbers]
ref|XP_009628755.1|  PREDICTED: chlorophyll a-b binding protein 4...    222   2e-69   Nicotiana tomentosiformis
ref|XP_009795314.1|  PREDICTED: chlorophyll a-b binding protein 1...    222   2e-69   Nicotiana sylvestris
sp|P07369.1|CB2G_SOLLC  RecName: Full=Chlorophyll a-b binding pro...    222   2e-69   Solanum lycopersicum
sp|P27496.1|CB25_TOBAC  RecName: Full=Chlorophyll a-b binding pro...    222   2e-69   Nicotiana tabacum [American tobacco]
ref|XP_010317413.1|  PREDICTED: chlorophyll a-b binding protein 3...    222   3e-69   Solanum lycopersicum
gb|AAA34148.1|  chlorophyll a/b-binding protein Cab-3C                  222   3e-69   Solanum lycopersicum
ref|XP_006356077.1|  PREDICTED: chlorophyll a-b binding protein 3...    221   3e-69   Solanum tuberosum [potatoes]
sp|P12469.1|CB23_NICPL  RecName: Full=Chlorophyll a-b binding pro...    221   4e-69   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_009782921.1|  PREDICTED: chlorophyll a-b binding protein 5...    221   4e-69   Nicotiana sylvestris
ref|XP_009606800.1|  PREDICTED: chlorophyll a-b binding protein 5...    221   4e-69   Nicotiana tomentosiformis
ref|XP_010243713.1|  PREDICTED: chlorophyll a-b binding protein o...    221   5e-69   Nelumbo nucifera [Indian lotus]
sp|P04780.1|CB22_PETSP  RecName: Full=Chlorophyll a-b binding pro...    221   5e-69   Petunia sp.
ref|XP_006356075.1|  PREDICTED: chlorophyll a-b binding protein 3...    221   7e-69   Solanum tuberosum [potatoes]
ref|XP_006364025.1|  PREDICTED: chlorophyll a-b binding protein 5...    221   7e-69   Solanum tuberosum [potatoes]
ref|XP_009628757.1|  PREDICTED: chlorophyll a-b binding protein 1...    221   8e-69   Nicotiana tomentosiformis
ref|XP_006356078.1|  PREDICTED: chlorophyll a-b binding protein 3...    220   1e-68   
gb|ABD38707.1|  chloroplast chlorophyll a/b binding protein             219   2e-68   Pachysandra terminalis
ref|XP_010916097.1|  PREDICTED: chlorophyll a-b binding protein o...    219   2e-68   Elaeis guineensis
gb|ABB55370.1|  chlorophyll a-b binding protein 3C-like                 219   2e-68   Solanum tuberosum [potatoes]
ref|XP_008439658.1|  PREDICTED: chlorophyll a-b binding protein o...    219   2e-68   Cucumis melo [Oriental melon]
ref|XP_002316737.1|  Chlorophyll a-b binding protein 2                  219   2e-68   Populus trichocarpa [western balsam poplar]
ref|XP_008779641.1|  PREDICTED: chlorophyll a-b binding protein o...    219   3e-68   Phoenix dactylifera
gb|AAT08651.1|  chloroplast chlorophyll A-B binding protein             218   4e-68   Hyacinthus orientalis [common hyacinth]
ref|XP_008784387.1|  PREDICTED: chlorophyll a-b binding protein o...    219   4e-68   Phoenix dactylifera
ref|XP_009782821.1|  PREDICTED: chlorophyll a-b binding protein 7...    219   4e-68   Nicotiana sylvestris
ref|XP_009782905.1|  PREDICTED: chlorophyll a-b binding protein 7...    219   4e-68   Nicotiana sylvestris
sp|P27491.1|CB27_TOBAC  RecName: Full=Chlorophyll a-b binding pro...    219   4e-68   Nicotiana tabacum [American tobacco]
ref|XP_009775533.1|  PREDICTED: chlorophyll a-b binding protein 7...    219   4e-68   Nicotiana sylvestris
ref|XP_004164941.1|  PREDICTED: chlorophyll a-b binding protein 4...    214   4e-68   
sp|P04783.1|CB25_PETSP  RecName: Full=Chlorophyll a-b binding pro...    219   5e-68   Petunia sp.
gb|AIR93785.1|  chloroplast light harvesting chlorophyll A/B bind...    218   5e-68   Kalanchoe fedtschenkoi [lavender-scallops]
gb|AFO67219.1|  putative chlorophyll a/b binding protein                214   5e-68   Aralia elata
ref|XP_011011531.1|  PREDICTED: chlorophyll a-b binding protein o...    218   6e-68   Populus euphratica
ref|XP_011096520.1|  PREDICTED: chlorophyll a-b binding protein 2...    218   6e-68   Sesamum indicum [beniseed]
emb|CAA78379.1|  chlorophyll a/b-binding protein PS II-Type I           218   8e-68   Solanum tuberosum [potatoes]
ref|XP_006356076.1|  PREDICTED: chlorophyll a-b binding protein 3...    218   8e-68   
ref|XP_009759685.1|  PREDICTED: chlorophyll a-b binding protein 4...    218   1e-67   Nicotiana sylvestris
gb|AAA33396.1|  light-harvesting chlorophyll a/b protein precursor      218   1e-67   Lemna gibba
ref|XP_011085268.1|  PREDICTED: chlorophyll a-b binding protein 2...    218   1e-67   Sesamum indicum [beniseed]
ref|XP_009421488.1|  PREDICTED: chlorophyll a-b binding protein o...    218   1e-67   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006356074.1|  PREDICTED: chlorophyll a-b binding protein 3...    218   1e-67   Solanum tuberosum [potatoes]
gb|EYU38943.1|  hypothetical protein MIMGU_mgv1a012024mg                217   1e-67   Erythranthe guttata [common monkey flower]
ref|XP_009618330.1|  PREDICTED: chlorophyll a-b binding protein 4...    217   1e-67   Nicotiana tomentosiformis
ref|XP_009396492.1|  PREDICTED: chlorophyll a-b binding protein o...    217   2e-67   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010052093.1|  PREDICTED: chlorophyll a-b binding protein o...    217   2e-67   Eucalyptus grandis [rose gum]
ref|XP_004234241.1|  PREDICTED: uncharacterized protein LOC101245729    225   3e-67   
emb|CAJ77390.1|  major chlorophyll a/b binding protein LHCb1.2          216   3e-67   Spinacia oleracea
ref|XP_004294267.1|  PREDICTED: chlorophyll a-b binding protein o...    216   3e-67   Fragaria vesca subsp. vesca
ref|XP_010685893.1|  PREDICTED: chlorophyll a-b binding protein, ...    216   3e-67   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006356080.1|  PREDICTED: chlorophyll a-b binding protein 3...    216   3e-67   Solanum tuberosum [potatoes]
gb|EYU28187.1|  hypothetical protein MIMGU_mgv1a009948mg                218   4e-67   Erythranthe guttata [common monkey flower]
ref|XP_010247422.1|  PREDICTED: chlorophyll a-b binding protein o...    216   4e-67   Nelumbo nucifera [Indian lotus]
ref|XP_008444193.1|  PREDICTED: chlorophyll a-b binding protein o...    216   5e-67   Cucumis melo [Oriental melon]
ref|XP_004147416.1|  PREDICTED: chlorophyll a-b binding protein 4...    216   7e-67   Cucumis sativus [cucumbers]
gb|EYU28462.1|  hypothetical protein MIMGU_mgv1a012008mg                216   7e-67   Erythranthe guttata [common monkey flower]
sp|P12333.1|CB2A_SPIOL  RecName: Full=Chlorophyll a-b binding pro...    216   8e-67   Spinacia oleracea
gb|KCW75952.1|  hypothetical protein EUGRSUZ_D00320                     215   8e-67   Eucalyptus grandis [rose gum]
ref|XP_002519724.1|  chlorophyll A/B binding protein, putative          215   8e-67   Ricinus communis
emb|CAJ77391.1|  major chlorophyll a/b binding protein LHCb1.1          215   8e-67   Spinacia oleracea
gb|AAB61238.1|  chlorophyll a/b-binding protein                         215   1e-66   Mesembryanthemum crystallinum
ref|XP_002524616.1|  chlorophyll A/B binding protein, putative          215   1e-66   Ricinus communis
ref|XP_008229430.1|  PREDICTED: chlorophyll a-b binding protein o...    215   1e-66   Prunus mume [ume]
gb|AFC91647.1|  chloroplast chlorophyll A/B binding protein             215   1e-66   Hevea brasiliensis [jebe]
gb|AHB24929.1|  chloroplast light-harvesting complex II chlorophy...    215   1e-66   Sedum alfredii
gb|AGJ50622.1|  chlorophyll a/b binding protein                         215   1e-66   Salicornia brachiata
ref|XP_008229463.1|  PREDICTED: chlorophyll a-b binding protein, ...    213   2e-66   Prunus mume [ume]
emb|CAX64458.1|  major chlorophyll a/b binding protein LHCb1.4 pr...    214   2e-66   Spinacia oleracea
ref|XP_002285646.1|  PREDICTED: chlorophyll a-b binding protein o...    214   2e-66   Vitis vinifera
ref|XP_002306927.1|  Chlorophyll a-b binding protein 2                  214   2e-66   Populus trichocarpa [western balsam poplar]
ref|XP_002307725.1|  Chlorophyll a-b binding protein 2                  214   3e-66   Populus trichocarpa [western balsam poplar]
gb|KDP37945.1|  hypothetical protein JCGZ_04588                         214   3e-66   Jatropha curcas
ref|XP_010275593.1|  PREDICTED: chlorophyll a-b binding protein o...    214   3e-66   Nelumbo nucifera [Indian lotus]
gb|AFO67221.1|  putative chlorophyll a/b binding protein                210   3e-66   Aralia elata
ref|XP_008439659.1|  PREDICTED: chlorophyll a-b binding protein o...    216   4e-66   
sp|P04782.1|CB24_PETSP  RecName: Full=Chlorophyll a-b binding pro...    213   4e-66   Petunia sp.
gb|KCW75953.1|  hypothetical protein EUGRSUZ_D00321                     214   4e-66   Eucalyptus grandis [rose gum]
dbj|BAF95850.1|  putative chloroplast chlorophyll a/b binding pro...    212   5e-66   Vitis hybrid cultivar
sp|P04781.1|CB23_PETSP  RecName: Full=Chlorophyll a-b binding pro...    213   6e-66   Petunia sp.
ref|XP_010924306.1|  PREDICTED: chlorophyll a-b binding protein o...    213   6e-66   Elaeis guineensis
gb|AAT08668.1|  chloroplast chlorophyll A-B binding protein 40          212   6e-66   Hyacinthus orientalis [common hyacinth]
ref|XP_007217260.1|  hypothetical protein PRUPE_ppa010015mg             213   7e-66   Prunus persica
ref|XP_010904844.1|  PREDICTED: chlorophyll a-b binding protein o...    213   7e-66   Elaeis guineensis
gb|EYU28185.1|  hypothetical protein MIMGU_mgv1a012021mg                213   7e-66   Erythranthe guttata [common monkey flower]
gb|EYU28186.1|  hypothetical protein MIMGU_mgv1a012011mg                213   9e-66   Erythranthe guttata [common monkey flower]
ref|XP_009630190.1|  PREDICTED: chlorophyll a-b binding protein 2...    213   9e-66   Nicotiana tomentosiformis
ref|XP_008229429.1|  PREDICTED: chlorophyll a-b binding protein o...    213   9e-66   Prunus mume [ume]
ref|XP_009598574.1|  PREDICTED: chlorophyll a-b binding protein 2...    213   9e-66   Nicotiana tomentosiformis
ref|XP_009775649.1|  PREDICTED: chlorophyll a-b binding protein 2...    213   9e-66   Nicotiana sylvestris
ref|XP_010056879.1|  PREDICTED: chlorophyll a-b binding protein o...    212   1e-65   Eucalyptus grandis [rose gum]
ref|XP_004303878.1|  PREDICTED: chlorophyll a-b binding protein o...    212   2e-65   Fragaria vesca subsp. vesca
ref|XP_007215816.1|  hypothetical protein PRUPE_ppa010034mg             212   2e-65   Prunus persica
ref|XP_004302854.1|  PREDICTED: chlorophyll a-b binding protein o...    212   2e-65   Fragaria vesca subsp. vesca
ref|XP_009395692.1|  PREDICTED: chlorophyll a-b binding protein o...    212   2e-65   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAA80595.1|  chlorophyll a/b binding protein                         207   2e-65   Solanum tuberosum [potatoes]
ref|XP_008800689.1|  PREDICTED: chlorophyll a-b binding protein o...    212   2e-65   Phoenix dactylifera
ref|XP_010052095.1|  PREDICTED: chlorophyll a-b binding protein o...    212   2e-65   Eucalyptus grandis [rose gum]
ref|XP_008356026.1|  PREDICTED: chlorophyll a-b binding protein o...    212   2e-65   Malus domestica [apple tree]
ref|XP_009377335.1|  PREDICTED: chlorophyll a-b binding protein o...    212   2e-65   Pyrus x bretschneideri [bai li]
ref|XP_008364191.1|  PREDICTED: chlorophyll a-b binding protein o...    211   3e-65   
gb|AHB24928.1|  chloroplast chlorophyll a-b binding protein 2/3         211   3e-65   Sedum alfredii
gb|AAB61237.1|  chlorophyll a/b-binding protein                         211   4e-65   Mesembryanthemum crystallinum
gb|AAC25775.1|  chlorophyll a/b binding protein                         211   4e-65   Medicago sativa [alfalfa]
ref|NP_001266111.1|  chlorophyll a-b binding protein AB80, chloro...    211   5e-65   Cicer arietinum [garbanzo]
gb|ABV26426.1|  light-harvesting chlorophyll a/b-binding protein        207   5e-65   Camellia sinensis [black tea]
ref|XP_009786355.1|  PREDICTED: chlorophyll a-b binding protein 2...    211   6e-65   Nicotiana sylvestris
gb|AFK40061.1|  unknown                                                 211   6e-65   Medicago truncatula
ref|XP_009598577.1|  PREDICTED: chlorophyll a-b binding protein 2...    211   6e-65   Nicotiana tomentosiformis
dbj|BAA25389.1|  light harvesting chlorophyll a/b-binding protein       210   7e-65   Nicotiana sylvestris
ref|XP_009775645.1|  PREDICTED: chlorophyll a-b binding protein 2...    210   7e-65   Nicotiana sylvestris
ref|XP_009775650.1|  PREDICTED: chlorophyll a-b binding protein 2...    210   7e-65   Nicotiana sylvestris
gb|AAR10886.1|  chlorophyll a/b binding protein                         210   8e-65   Trifolium pratense [peavine clover]
ref|NP_001240146.1|  chlorophyll a-b binding protein 21, chloropl...    210   1e-64   Glycine max [soybeans]
ref|XP_011045092.1|  PREDICTED: chlorophyll a-b binding protein o...    210   1e-64   Populus euphratica
gb|EYU29602.1|  hypothetical protein MIMGU_mgv1a019986mg                210   1e-64   Erythranthe guttata [common monkey flower]
ref|XP_010052094.1|  PREDICTED: chlorophyll a-b binding protein o...    214   1e-64   
gb|EYU28183.1|  hypothetical protein MIMGU_mgv1a012019mg                210   1e-64   Erythranthe guttata [common monkey flower]
gb|ACN41907.1|  chlorophyll A/B binding protein                         210   1e-64   Gardenia jasminoides
gb|KJB66916.1|  hypothetical protein B456_010G165100                    210   1e-64   Gossypium raimondii
gb|EYU28184.1|  hypothetical protein MIMGU_mgv1a011918mg                210   1e-64   Erythranthe guttata [common monkey flower]
ref|XP_008371581.1|  PREDICTED: chlorophyll a-b binding protein o...    210   1e-64   
gb|AHM26643.1|  a-b binding protein                                     209   1e-64   Pyrus x bretschneideri [bai li]
ref|XP_008356022.1|  PREDICTED: chlorophyll a-b binding protein o...    209   1e-64   
ref|XP_008364187.1|  PREDICTED: chlorophyll a-b binding protein o...    209   1e-64   
ref|XP_009377344.1|  PREDICTED: chlorophyll a-b binding protein o...    209   2e-64   Pyrus x bretschneideri [bai li]
ref|XP_008366007.1|  PREDICTED: chlorophyll a-b binding protein o...    209   2e-64   
gb|AAA80593.1|  chlorophyll a/b binding protein                         209   2e-64   Solanum tuberosum [potatoes]
gb|EYU29604.1|  hypothetical protein MIMGU_mgv1a023200mg                209   2e-64   Erythranthe guttata [common monkey flower]
ref|XP_007151992.1|  hypothetical protein PHAVU_004G0927000g            207   2e-64   Phaseolus vulgaris [French bean]
ref|XP_004303877.1|  PREDICTED: chlorophyll a-b binding protein o...    209   3e-64   Fragaria vesca subsp. vesca
gb|KCW75954.1|  hypothetical protein EUGRSUZ_D00322                     212   3e-64   Eucalyptus grandis [rose gum]
gb|ABF70112.1|  chlorophyll A-B binding protein (CAB), putative         209   3e-64   Musa balbisiana [starchy banana]
gb|ACF23033.1|  ST140                                                   204   3e-64   Eutrema halophilum
ref|XP_008371583.1|  PREDICTED: chlorophyll a-b binding protein o...    209   3e-64   
ref|XP_006415534.1|  hypothetical protein EUTSA_v10008479mg             209   3e-64   Eutrema salsugineum [saltwater cress]
ref|XP_009389379.1|  PREDICTED: chlorophyll a-b binding protein o...    209   4e-64   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007211864.1|  hypothetical protein PRUPE_ppa010081mg             208   4e-64   Prunus persica
ref|XP_007211869.1|  hypothetical protein PRUPE_ppa010099mg             208   4e-64   Prunus persica
gb|AFK40204.1|  unknown                                                 206   4e-64   Lotus japonicus
gb|ABQ32304.1|  chloroplast light-harvesting chlorophyll a/b-bind...    208   4e-64   Artemisia annua [sweet Annie]
gb|AEQ67395.1|  chloroplast chlorophyll A/B binding protein             208   4e-64   Canarium album [Chinese white-olive]
emb|CDP06328.1|  unnamed protein product                                208   5e-64   Coffea canephora [robusta coffee]
ref|XP_003548106.1|  PREDICTED: chlorophyll a/b-binding protein p...    208   5e-64   
ref|XP_003548104.1|  PREDICTED: chlorophyll a-b binding protein 2...    208   6e-64   
ref|XP_010666522.1|  PREDICTED: uncharacterized protein LOC104883672    217   7e-64   
gb|AGV54498.1|  LHCII type I chlorophyll a/b-binding protein            208   7e-64   Phaseolus vulgaris [French bean]
ref|XP_011045093.1|  PREDICTED: chlorophyll a-b binding protein o...    208   7e-64   Populus euphratica
gb|KJB57287.1|  hypothetical protein B456_009G156900                    208   7e-64   Gossypium raimondii
emb|CDP06329.1|  unnamed protein product                                207   8e-64   Coffea canephora [robusta coffee]
gb|ACO51067.1|  chloroplast chlorophyll A-B binding protein             207   8e-64   Gossypium hirsutum [American cotton]
ref|XP_010538237.1|  PREDICTED: chlorophyll a-b binding protein 1...    207   9e-64   Tarenaya hassleriana [spider flower]
ref|XP_007158464.1|  hypothetical protein PHAVU_002G154500g             207   9e-64   Phaseolus vulgaris [French bean]
ref|XP_006365573.1|  PREDICTED: chlorophyll a-b binding protein 1...    207   9e-64   
ref|XP_006365560.1|  PREDICTED: chlorophyll a-b binding protein 1...    207   9e-64   Solanum tuberosum [potatoes]
gb|AAA18529.1|  chlorophyll A/B binding protein                         207   1e-63   Gossypium hirsutum [American cotton]
gb|AGU28449.1|  chlorophyll A/B binding protein 1                       205   1e-63   Sinapis alba [bai jie]
gb|AAA80591.1|  chlorophyll a/b binding protein                         207   1e-63   Solanum tuberosum [potatoes]
ref|XP_002890838.1|  hypothetical protein ARALYDRAFT_473204             207   1e-63   
gb|AAA80592.1|  chlorophyll a/b binding protein                         207   1e-63   Solanum tuberosum [potatoes]
gb|ABN49454.2|  chloroplast chlorophyll a/b binding protein             207   1e-63   Pisum sativum [garden pea]
gb|AAW31511.1|  light-harvesting chlorophyll-a/b binding protein ...    207   1e-63   Pisum sativum [garden pea]
gb|KJB69716.1|  hypothetical protein B456_011G041600                    207   1e-63   Gossypium raimondii
ref|XP_007151979.1|  hypothetical protein PHAVU_004G091600g             207   1e-63   Phaseolus vulgaris [French bean]
ref|XP_009598575.1|  PREDICTED: chlorophyll a-b binding protein 2...    207   1e-63   Nicotiana tomentosiformis
gb|AGV54521.1|  LHCII type I chlorophyll a/b-binding protein            207   1e-63   Phaseolus vulgaris [French bean]
gb|ACA52202.1|  chloroplast chlorophyll A/B-binding protein             202   1e-63   Oenothera grandiflora
gb|AAB87573.1|  chlorophyll a/b binding protein of LHCII type I p...    207   2e-63   Panax ginseng [Asiatic ginseng]
ref|XP_002283566.1|  PREDICTED: chlorophyll a-b binding protein o...    207   2e-63   Vitis vinifera
gb|AAF89206.1|AF279249_1  LHCII type I chlorophyll a/b-binding pr...    207   2e-63   Vigna radiata [mung bean]
gb|EYU19613.1|  hypothetical protein MIMGU_mgv1a011885mg                207   2e-63   Erythranthe guttata [common monkey flower]
sp|P04779.1|CB21_PETSP  RecName: Full=Chlorophyll a-b binding pro...    207   2e-63   Petunia sp.
ref|XP_006305533.1|  hypothetical protein CARUB_v10010022mg             207   2e-63   Capsella rubella
ref|XP_006304391.1|  hypothetical protein CARUB_v10010908mg             207   2e-63   Capsella rubella
prf||1204205B  protein 1B,chlorophyll binding                           206   2e-63
gb|AAB61236.1|  chlorophyll a/b-binding protein                         206   2e-63   Mesembryanthemum crystallinum
gb|KDP37944.1|  hypothetical protein JCGZ_04587                         206   2e-63   Jatropha curcas
gb|KDO36894.1|  hypothetical protein CISIN_1g044971mg                   202   3e-63   Citrus sinensis [apfelsine]
sp|P07371.1|CB22_PEA  RecName: Full=Chlorophyll a-b binding prote...    206   3e-63   Pisum sativum [garden pea]
ref|XP_004233101.1|  PREDICTED: chlorophyll a-b binding protein 1...    206   3e-63   
ref|XP_004233096.1|  PREDICTED: chlorophyll a-b binding protein 1...    206   3e-63   
ref|XP_006365572.1|  PREDICTED: chlorophyll a-b binding protein 1...    206   3e-63   Solanum tuberosum [potatoes]
gb|AES74698.2|  light-harvesting complex I chlorophyll A/B-bindin...    206   3e-63   Medicago truncatula
ref|XP_010666512.1|  PREDICTED: chlorophyll a-b binding protein, ...    206   3e-63   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007151996.1|  hypothetical protein PHAVU_004G093000g             206   3e-63   Phaseolus vulgaris [French bean]
ref|XP_006368026.1|  PREDICTED: chlorophyll a-b binding protein 1...    206   3e-63   Solanum tuberosum [potatoes]
ref|XP_004961193.1|  PREDICTED: chlorophyll a-b binding protein M...    206   3e-63   Setaria italica
ref|XP_009416547.1|  PREDICTED: chlorophyll a-b binding protein o...    206   3e-63   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010549470.1|  PREDICTED: chlorophyll a-b binding protein 1...    206   3e-63   Tarenaya hassleriana [spider flower]
gb|ABW70800.1|  chloroplast light harvesting chlorophyll a/b bind...    206   3e-63   Populus euphratica
ref|XP_009377327.1|  PREDICTED: chlorophyll a-b binding protein o...    206   4e-63   Pyrus x bretschneideri [bai li]
ref|XP_010231410.1|  PREDICTED: chlorophyll a-b binding protein o...    206   4e-63   Brachypodium distachyon [annual false brome]
gb|AFI60242.1|  light harvesting chlorophyll a/b binding protein        206   4e-63   Panicum virgatum
ref|XP_002893588.1|  hypothetical protein ARALYDRAFT_473203             206   4e-63   
gb|KCW73782.1|  hypothetical protein EUGRSUZ_E02381                     205   4e-63   Eucalyptus grandis [rose gum]
gb|EYU19649.1|  hypothetical protein MIMGU_mgv1a011927mg                206   5e-63   Erythranthe guttata [common monkey flower]
gb|AAZ79657.1|  putative chlorophyll a/b-binding protein                206   5e-63   Fagus sylvatica
dbj|BAA24493.1|  chlorophyll a/b-binding protein                        206   5e-63   Fagus crenata
ref|NP_174286.1|  chlorophyll A/B binding protein 1                     206   5e-63   Arabidopsis thaliana [mouse-ear cress]
emb|CDP06330.1|  unnamed protein product                                206   6e-63   Coffea canephora [robusta coffee]
ref|XP_010478366.1|  PREDICTED: chlorophyll a-b binding protein 1...    206   6e-63   Camelina sativa [gold-of-pleasure]
ref|XP_010499509.1|  PREDICTED: chlorophyll a-b binding protein 1...    206   6e-63   Camelina sativa [gold-of-pleasure]
ref|XP_007025143.1|  Chlorophyll a-b binding protein, chloroplastic     205   6e-63   
ref|XP_010460769.1|  PREDICTED: chlorophyll a-b binding protein 1...    206   6e-63   
gb|ACR08639.1|  chloroplast chlorophyll A/B binding protein             205   6e-63   Mangifera indica
emb|CDY66768.1|  BnaAnng22920D                                          205   7e-63   Brassica napus [oilseed rape]
gb|ACD64978.1|  chloroplast chlorophyll a/b-binding protein             205   7e-63   Ophiopogon japonicus
ref|XP_010460768.1|  PREDICTED: chlorophyll a-b binding protein 2...    205   7e-63   Camelina sativa [gold-of-pleasure]
gb|ACU23974.1|  unknown                                                 205   7e-63   Glycine max [soybeans]
ref|XP_006467509.1|  PREDICTED: chlorophyll a-b binding protein 3...    205   7e-63   Citrus sinensis [apfelsine]
gb|AAA80594.1|  chlorophyll a/b binding protein                         205   9e-63   Solanum tuberosum [potatoes]
ref|XP_010926397.1|  PREDICTED: chlorophyll a-b binding protein o...    205   9e-63   Elaeis guineensis
ref|XP_004293579.1|  PREDICTED: chlorophyll a-b binding protein o...    205   9e-63   Fragaria vesca subsp. vesca
gb|AAO45885.1|  chlorophyll a/b-binding protein precursor               203   1e-62   Citrus limon [lemon]
gb|ADC35579.1|  chloroplast chlorophyll a/b binding protein             205   1e-62   Lycoris radiata [higanbana]
ref|XP_009141380.1|  PREDICTED: chlorophyll a-b binding protein 1...    205   1e-62   Brassica rapa
ref|XP_009102798.1|  PREDICTED: chlorophyll a-b binding protein 1...    205   1e-62   Brassica rapa
gb|KHN28981.1|  Chlorophyll a-b binding protein 3, chloroplastic        204   1e-62   Glycine soja [wild soybean]
gb|AEO51755.1|  chloroplast chlorophyll A/B binding protein             204   1e-62   Dimocarpus longan [longan]
ref|NP_001241277.1|  uncharacterized protein LOC100805310               204   1e-62   Glycine max [soybeans]
sp|P09756.1|CB23_SOYBN  RecName: Full=Chlorophyll a-b binding pro...    204   1e-62   Glycine max [soybeans]
gb|KFK44818.1|  hypothetical protein AALP_AA1G306800                    204   1e-62   Arabis alpina [alpine rockcress]
emb|CDY35271.1|  BnaC03g59520D                                          204   1e-62   Brassica napus [oilseed rape]
emb|CDX99866.1|  BnaC05g22880D                                          204   1e-62   
ref|XP_007151990.1|  hypothetical protein PHAVU_004G092600g             204   1e-62   Phaseolus vulgaris [French bean]
gb|EYU43278.1|  hypothetical protein MIMGU_mgv1a011933mg                204   2e-62   Erythranthe guttata [common monkey flower]
emb|CDY26306.1|  BnaA09g26570D                                          204   2e-62   Brassica napus [oilseed rape]
sp|P92919.1|CB23_APIGR  RecName: Full=Chlorophyll a-b binding pro...    204   2e-62   Apium graveolens
ref|XP_004489391.1|  PREDICTED: chlorophyll a-b binding protein 3...    204   2e-62   Cicer arietinum [garbanzo]
gb|ACG30091.1|  chlorophyll a-b binding protein 2                       203   2e-62   Zea mays [maize]
sp|P12329.1|CB21_MAIZE  RecName: Full=Chlorophyll a-b binding pro...    204   2e-62   Zea mays [maize]
gb|EYU43289.1|  hypothetical protein MIMGU_mgv11b019945mg               204   2e-62   Erythranthe guttata [common monkey flower]
gb|AAT08694.1|  chloroplast chlorophyll A-B binding protein 40          202   2e-62   Hyacinthus orientalis [common hyacinth]
gb|ADL41158.1|  chloroplast light-harvesting chlorophyll a/b bind...    204   2e-62   Triticum aestivum [Canadian hard winter wheat]
gb|KEH25006.1|  light-harvesting complex I chlorophyll A/B-bindin...    204   2e-62   Medicago truncatula
gb|AAL38341.1|  chlorophyll a/b-binding protein                         204   2e-62   Arabidopsis thaliana [mouse-ear cress]
gb|AFW90594.1|  chloroplast chlorophyll a/b binding protein             204   2e-62   Solanum tuberosum [potatoes]
ref|XP_010499505.1|  PREDICTED: chlorophyll a-b binding protein 2...    204   3e-62   Camelina sativa [gold-of-pleasure]
ref|NP_564339.1|  chlorophyll A/B binding protein 3                     204   3e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006449645.1|  hypothetical protein CICLE_v10016286mg             204   3e-62   
ref|XP_010097596.1|  Chlorophyll a-b binding protein 40                 204   3e-62   Morus notabilis
ref|XP_006856963.1|  hypothetical protein AMTR_s00189p00032350          204   3e-62   Amborella trichopoda
gb|AAF26741.1|AF220527_1  chlorophyll a/b binding protein precursor     204   3e-62   Euphorbia esula [wolf's milk]
ref|XP_010316911.1|  PREDICTED: chlorophyll a-b binding protein 1...    204   3e-62   
gb|AAF89207.1|AF279250_1  LHCII type I chlorophyll a/b-binding pr...    203   3e-62   Vigna radiata [mung bean]
ref|XP_006449643.1|  hypothetical protein CICLE_v10016287mg             203   3e-62   Citrus clementina [clementine]
gb|ABG29728.1|  chloroplast chlorophyll a/b binding protein             204   4e-62   Brassica napus [oilseed rape]
gb|AAH53854.1|  Unknown (protein for IMAGE:5194336)                     204   4e-62   Homo sapiens [man]
dbj|BAJ87673.1|  predicted protein                                      203   4e-62   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006415537.1|  hypothetical protein EUTSA_v10008476mg             203   5e-62   Eutrema salsugineum [saltwater cress]
gb|KEH25005.1|  light-harvesting complex I chlorophyll A/B-bindin...    203   5e-62   Medicago truncatula
gb|AFV34722.1|  light harvesting chlorophyll a/b-binding protein 1-1    203   5e-62   Dendrocalamus latiflorus [sweet bamboo]
ref|XP_006449644.1|  hypothetical protein CICLE_v10016074mg             204   5e-62   
ref|XP_007025148.1|  Chlorophyll a-b binding protein, chloroplastic     203   5e-62   
gb|AEY85026.1|  light-harvesting complex II protein                     203   5e-62   
ref|XP_002460622.1|  hypothetical protein SORBIDRAFT_02g032040          203   5e-62   
gb|EEE69526.1|  hypothetical protein OsJ_28989                          202   6e-62   
ref|XP_011460161.1|  PREDICTED: chlorophyll a-b binding protein o...    203   6e-62   
gb|KEH25007.1|  light-harvesting complex I chlorophyll A/B-bindin...    203   6e-62   
ref|XP_010316912.1|  PREDICTED: chlorophyll a-b binding protein 1...    202   7e-62   
gb|AFK39586.1|  unknown                                                 202   7e-62   
ref|XP_004957570.1|  PREDICTED: chlorophyll a-b binding protein 1...    202   7e-62   
ref|XP_002455902.1|  hypothetical protein SORBIDRAFT_03g027040          202   8e-62   
gb|AAB18209.1|  chlorophyll a/b-binding protein WCAB precursor          202   8e-62   
gb|EMT29002.1|  Chlorophyll a-b binding protein, chloroplastic          202   9e-62   
dbj|BAA03104.1|  light-harvesting chlorophyll a/b-binding protein...    202   9e-62   
gb|KFK36334.1|  hypothetical protein AALP_AA4G109200                    202   1e-61   
ref|NP_001147639.1|  chlorophyll a-b binding protein 1, chloropla...    202   1e-61   
dbj|BAJ08392.1|  light harvesting chlorophyll a/b-binding protein...    202   1e-61   
ref|XP_010097597.1|  Chlorophyll a-b binding protein 40                 202   1e-61   
ref|NP_001142284.1|  uncharacterized protein LOC100274453               202   1e-61   
gb|ACU23816.1|  unknown                                                 202   1e-61   
ref|XP_002455901.1|  hypothetical protein SORBIDRAFT_03g027030          202   1e-61   
emb|CDX84316.1|  BnaC04g10780D                                          202   1e-61   
ref|XP_010509751.1|  PREDICTED: chlorophyll a-b binding protein 1...    202   1e-61   
ref|XP_006410587.1|  hypothetical protein EUTSA_v10017088mg             202   2e-61   
emb|CDY17247.1|  BnaA05g09410D                                          202   2e-61   
dbj|BAJ93064.1|  predicted protein                                      202   2e-61   
ref|XP_008358195.1|  PREDICTED: chlorophyll a-b binding protein o...    202   2e-61   
ref|XP_010231015.1|  PREDICTED: chlorophyll a-b binding protein o...    201   2e-61   
gb|EYU35814.1|  hypothetical protein MIMGU_mgv1a011908mg                202   2e-61   
ref|XP_010237260.1|  PREDICTED: chlorophyll a-b binding protein o...    202   2e-61   
gb|AFW90512.1|  chlorophyll a/b-binding protein                         201   2e-61   
sp|P27490.1|CB28_PEA  RecName: Full=Chlorophyll a-b binding prote...    201   2e-61   
ref|XP_009143778.1|  PREDICTED: chlorophyll a-b binding protein 1...    201   2e-61   
gb|AAD21625.1|  putative chlorophyll a/b-binding protein                201   3e-61   
ref|NP_565787.1|  light-harvesting chlorophyll protein complex II...    201   3e-61   
gb|AHA84197.1|  chlorophyll a/b-binding protein                         201   3e-61   
ref|XP_004969083.1|  PREDICTED: chlorophyll a-b binding protein 2...    201   3e-61   
gb|AEV59638.1|  chloroplast photosystem II light harvesting compl...    199   4e-61   
ref|XP_006293384.1|  hypothetical protein CARUB_v10023856mg             201   4e-61   
gb|EMS57503.1|  Chlorophyll a-b binding protein, chloroplastic          201   4e-61   
ref|XP_002879498.1|  LHB1B1                                             201   4e-61   
gb|AEV59641.1|  chloroplast photosystem II light harvesting compl...    199   5e-61   
ref|XP_002515206.1|  chlorophyll A/B binding protein, putative          201   6e-61   
dbj|BAJ89881.1|  predicted protein                                      200   6e-61   
emb|CDX98158.1|  BnaC07g09400D                                          200   7e-61   
gb|AEV59640.1|  chloroplast photosystem II light harvesting compl...    199   7e-61   
dbj|BAJ90643.1|  predicted protein                                      200   7e-61   
gb|ABQ81856.1|  chloroplast chlorophyll a/b binding protein             200   7e-61   
sp|P08963.1|CB22_HORVU  RecName: Full=Chlorophyll a-b binding pro...    200   7e-61   
gb|EMT29003.1|  Chlorophyll a-b binding protein, chloroplastic          200   8e-61   
ref|XP_009363087.1|  PREDICTED: chlorophyll a-b binding protein o...    200   9e-61   
gb|AEV59642.1|  chloroplast photosystem II light harvesting compl...    199   9e-61   
emb|CAG25596.1|  putative chlorophyll a/b binding protein               199   1e-60   
sp|P13851.1|CB21_SINAL  RecName: Full=Chlorophyll a-b binding pro...    200   1e-60   
gb|AAG40044.2|AF324693_1  At2g34430                                     200   1e-60   
emb|CDY17248.1|  BnaA05g09400D                                          200   1e-60   
ref|XP_007158961.1|  hypothetical protein PHAVU_002G196400g             199   1e-60   
gb|AAM64379.1|  putative photosystem II type I chlorophyll a b bi...    199   1e-60   
ref|NP_001062939.1|  Os09g0346500                                       199   1e-60   
gb|AEV59639.1|  chloroplast photosystem II light harvesting compl...    199   1e-60   
gb|EYU43279.1|  hypothetical protein MIMGU_mgv1a011871mg                200   1e-60   
gb|ABQ81857.1|  chloroplast chlorophyll a/b binding protein             199   1e-60   
ref|XP_006467511.1|  PREDICTED: chlorophyll a-b binding protein 3...    203   1e-60   
gb|EMS51039.1|  Chlorophyll a-b binding protein 3C, chloroplastic       199   1e-60   
ref|NP_565786.1|  photosystem II light harvesting complex protein...    199   1e-60   
ref|XP_009400578.1|  PREDICTED: chlorophyll a-b binding protein o...    199   1e-60   
emb|CDX79562.1|  BnaC03g18980D                                          199   1e-60   
gb|AAL67432.1|AF458406_1  chlorophyll a/b binding protein               199   1e-60   
ref|XP_010509756.1|  PREDICTED: chlorophyll a-b binding protein 1...    199   1e-60   
gb|AHA84168.1|  chlorophyll a/b-binding protein                         199   1e-60   
gb|EMS50796.1|  Chlorophyll a-b binding protein, chloroplastic          199   1e-60   
ref|XP_010504897.1|  PREDICTED: chlorophyll a-b binding protein 1...    200   1e-60   
gb|EPS64140.1|  chlorophyll a-b binding protein 21, chloroplastic       199   2e-60   
ref|NP_001043493.1|  Os01g0600900                                       199   2e-60   
ref|XP_006295385.1|  hypothetical protein CARUB_v10024479mg             199   2e-60   
gb|EMS50795.1|  Chlorophyll a-b binding protein, chloroplastic          201   2e-60   
prf||1503276A  chlorophyll a/b binding protein                          198   2e-60
gb|ACN31249.1|  unknown                                                 198   2e-60   
ref|XP_010504898.1|  PREDICTED: chlorophyll a-b binding protein 1...    199   2e-60   
gb|KFK36335.1|  hypothetical protein AALP_AA4G109300                    199   2e-60   
gb|AEV59643.1|  chloroplast photosystem II light harvesting compl...    198   2e-60   
gb|AEV59645.1|  chloroplast photosystem II light harvesting compl...    198   2e-60   
ref|XP_007221496.1|  hypothetical protein PRUPE_ppa010066mg             199   2e-60   
dbj|BAA00536.1|  type I light-harvesting chlorophyll a/b-binding ...    199   3e-60   
ref|XP_009360962.1|  PREDICTED: chlorophyll a-b binding protein o...    199   3e-60   
ref|XP_003578592.1|  PREDICTED: chlorophyll a-b binding protein o...    198   3e-60   
sp|P12471.1|CB21_SOYBN  RecName: Full=Chlorophyll a-b binding pro...    198   3e-60   
gb|AAP44089.1|  chlorophyll a/b binding protein                         199   3e-60   
gb|AGU28448.1|  light-harvesting chlorophyll-protein complex II s...    199   3e-60   
ref|NP_001235283.1|  chlorophyll a/b-binding protein                    198   3e-60   
ref|XP_008343203.1|  PREDICTED: chlorophyll a-b binding protein o...    200   4e-60   
sp|P04784.1|CB21_WHEAT  RecName: Full=Chlorophyll a-b binding pro...    198   4e-60   
gb|EMT04380.1|  Chlorophyll a-b binding protein, chloroplastic          202   4e-60   
gb|AAG52048.1|AC022455_2  chlorophyll A-B-binding protein 2 precu...    197   4e-60   
gb|AAA60965.1|  light-harvesting chlorophyll a/b binding protein ...    198   5e-60   
gb|KFK44817.1|  hypothetical protein AALP_AA1G306700                    198   6e-60   
ref|XP_009132986.1|  PREDICTED: chlorophyll a-b binding protein 1...    198   6e-60   
ref|NP_001148439.1|  chlorophyll a-b binding protein 2                  197   6e-60   
ref|XP_008675448.1|  PREDICTED: chlorophyll a-b binding protein o...    197   6e-60   
gb|ACL50948.1|  putative chloroplast chlorophyll a/b binding protein    197   7e-60   
gb|KFK42335.1|  hypothetical protein AALP_AA2G243100                    197   7e-60   
tpg|DAA58853.1|  TPA: hypothetical protein ZEAMMB73_924562              197   8e-60   
gb|EMT02412.1|  Chlorophyll a-b binding protein, chloroplastic          197   8e-60   
gb|ABM66819.1|  chloroplast light-harvesting chlorophyll a/b bind...    197   8e-60   
dbj|BAJ85110.1|  predicted protein                                      197   1e-59   
emb|CDX84315.1|  BnaC04g10770D                                          199   1e-59   
dbj|BAJ87045.1|  predicted protein                                      197   1e-59   
gb|EMS67016.1|  Chlorophyll a-b binding protein, chloroplastic          197   1e-59   
dbj|BAJ86427.1|  predicted protein                                      197   2e-59   
dbj|BAJ90772.1|  predicted protein                                      196   2e-59   
gb|AAD27879.2|AF139467_1  LHCII type I chlorophyll a/b binding pr...    196   2e-59   
gb|EMT02225.1|  Chlorophyll a-b binding protein, chloroplastic          196   2e-59   
gb|EMT11232.1|  Chlorophyll a-b binding protein, chloroplastic          197   2e-59   
dbj|BAD97888.1|  CAB homologue1                                         195   2e-59   
gb|EMS50797.1|  Chlorophyll a-b binding protein, chloroplastic          196   3e-59   
gb|EMS45686.1|  Chlorophyll a-b binding protein, chloroplastic          196   3e-59   
gb|EMT25652.1|  hypothetical protein F775_43704                         205   3e-59   
gb|EMS50798.1|  Chlorophyll a-b binding protein, chloroplastic          197   4e-59   
dbj|BAK02173.1|  predicted protein                                      196   4e-59   
ref|XP_006365561.1|  PREDICTED: chlorophyll a-b binding protein 1...    196   4e-59   
gb|EMS59660.1|  Chlorophyll a-b binding protein, chloroplastic          197   4e-59   
ref|XP_006368025.1|  PREDICTED: chlorophyll a-b binding protein 1...    196   4e-59   
gb|EMT04379.1|  Chlorophyll a-b binding protein, chloroplastic          196   4e-59   
ref|XP_009109634.1|  PREDICTED: chlorophyll a-b binding protein 2...    196   4e-59   
gb|AFW90565.1|  chlorophyll a-b binding protein 3C-like mRNA            194   5e-59   
ref|XP_002302798.2|  hypothetical protein POPTR_0002s19010g             195   8e-59   
emb|CAA32108.1|  chlorophyll a/b-binding preprotein (AA -31 to 235)     195   8e-59   
ref|XP_010412864.1|  PREDICTED: uncharacterized protein LOC104699228    202   1e-58   
gb|EYU28189.1|  hypothetical protein MIMGU_mgv1a020664mg                194   1e-58   
dbj|BAK03973.1|  predicted protein                                      194   1e-58   
gb|EMS51257.1|  Chlorophyll a-b binding protein 1, chloroplastic        195   2e-58   
ref|XP_002273106.2|  PREDICTED: chlorophyll a-b binding protein o...    194   2e-58   
emb|CAA61432.1|  LHCII type I protein                                   194   2e-58   
ref|XP_009143774.1|  PREDICTED: chlorophyll a-b binding protein 1...    194   2e-58   
ref|XP_004170963.1|  PREDICTED: chlorophyll a-b binding protein o...    189   2e-58   
ref|XP_003633024.1|  PREDICTED: chlorophyll a-b binding protein o...    193   3e-58   
ref|XP_002881334.1|  chlorophyll A-B-binding protein 2 precursor        193   3e-58   
gb|EMT09894.1|  Chlorophyll a-b binding protein, chloroplastic          193   3e-58   
pdb|1RWT|A  Chain A, Crystal Structure Of Spinach Major Light-har...    192   5e-58   
ref|XP_003618482.1|  Chlorophyll a/b-binding protein                    192   6e-58   
ref|XP_004148579.1|  PREDICTED: chlorophyll a-b binding protein 3...    192   7e-58   
dbj|BAJ87240.1|  predicted protein                                      192   8e-58   
ref|XP_006844081.1|  hypothetical protein AMTR_s00006p00251360          192   1e-57   
ref|XP_006660556.1|  PREDICTED: chlorophyll a-b binding protein 2...    192   1e-57   
gb|KHN41291.1|  Chlorophyll a-b binding protein of LHCII type I, ...    191   1e-57   
ref|XP_002275075.1|  PREDICTED: chlorophyll a-b binding protein o...    191   2e-57   
ref|XP_010091411.1|  Chlorophyll a-b binding protein 16                 191   2e-57   
emb|CAN78667.1|  hypothetical protein VITISV_031287                     191   2e-57   
ref|XP_009102801.1|  PREDICTED: chlorophyll a-b binding protein 1...    191   2e-57   
gb|ABK26463.1|  unknown                                                 190   3e-57   
emb|CAH59405.1|  light harvesting protein 1                             189   3e-57   
emb|CAC38830.1|  chlorophyll a/b binding protein                        191   4e-57   
gb|ABK22510.1|  unknown                                                 191   6e-57   
gb|ACN40044.1|  unknown                                                 190   7e-57   
ref|XP_008447450.1|  PREDICTED: chlorophyll a-b binding protein o...    190   8e-57   
gb|AAU89255.1|  chloroplast light harvesting chlorophyll a/b bind...    189   8e-57   
ref|XP_006840305.1|  hypothetical protein AMTR_s00045p00070890          189   9e-57   
emb|CAA32109.1|  chlorophyll a/b-binding preprotein (AA -28 to 235)     189   1e-56   
gb|AIB04243.1|  chloroplast light harvesting chlorophyll a/b bind...    187   2e-56   
sp|P15193.1|CB2A_PINSY  RecName: Full=Chlorophyll a-b binding pro...    189   2e-56   
gb|AAU89265.1|  chloroplast light harvesting chlorophyll a/b bind...    188   2e-56   
ref|WP_037445947.1|  hypothetical protein                               186   2e-56   
gb|AAY81730.1|  chloroplast putative light harvesting chlorophyll...    188   2e-56   
gb|ACI90635.1|  chloroplast light harvesting chlorophyll a/b bind...    188   2e-56   
emb|CAA47950.1|  chlorophyll a/b binding protein                        189   2e-56   
gb|ADV19258.1|  chlorophyll a/b-binding protein-like protein            187   2e-56   
sp|P24006.1|CB2A_PYRPY  RecName: Full=Chlorophyll a-b binding pro...    189   2e-56   
gb|AIW08054.1|  chloroplast light harvesting chlorophyll a/b bind...    188   2e-56   
gb|ABK23263.1|  unknown                                                 189   2e-56   
emb|CAA57407.1|  light harvesting chlorophyll a /b-binding protei...    189   3e-56   
gb|AIW07979.1|  chloroplast light harvesting chlorophyll a/b bind...    188   3e-56   
gb|ABK23849.1|  unknown                                                 189   3e-56   
gb|ABK26071.1|  unknown                                                 189   3e-56   
gb|AAU89250.1|  chloroplast light harvesting chlorophyll a/b bind...    188   3e-56   
gb|AAU89264.1|  chloroplast light harvesting chlorophyll a/b bind...    188   3e-56   
gb|AAU89263.1|  chloroplast light harvesting chlorophyll a/b bind...    188   3e-56   
gb|ABK20976.1|  unknown                                                 188   3e-56   
gb|AAU89253.1|  chloroplast light harvesting chlorophyll a/b bind...    188   4e-56   
gb|AAU89251.1|  chloroplast light harvesting chlorophyll a/b bind...    188   4e-56   
gb|EMT03811.1|  Chlorophyll a-b binding protein, chloroplastic          186   4e-56   
ref|XP_011003152.1|  PREDICTED: chlorophyll a-b binding protein o...    187   5e-56   
pdb|1VCR|A  Chain A, An Icosahedral Assembly Of Light-Harvesting ...    186   6e-56   
gb|AIB04244.1|  chloroplast light harvesting chlorophyll a/b bind...    186   7e-56   
gb|ACI90632.1|  chloroplast light harvesting chlorophyll a/b bind...    187   7e-56   
emb|CAA57408.1|  light harvesting chlorophyll a /b-binding protei...    187   8e-56   
gb|ACI90636.1|  chloroplast light harvesting chlorophyll a/b bind...    186   9e-56   
gb|ABK22330.1|  unknown                                                 187   9e-56   
gb|AAU89254.1|  chloroplast light harvesting chlorophyll a/b bind...    186   1e-55   
ref|WP_039311774.1|  hypothetical protein                               182   1e-55   
gb|AAU89256.1|  chloroplast light harvesting chlorophyll a/b bind...    186   1e-55   
gb|AAU89257.1|  chloroplast light harvesting chlorophyll a/b bind...    186   1e-55   
gb|AAU89262.1|  chloroplast light harvesting chlorophyll a/b bind...    186   1e-55   
gb|AAY81729.1|  chloroplast putative light harvesting chlorophyll...    186   1e-55   
gb|ACN40194.1|  unknown                                                 187   1e-55   
emb|CAA57409.1|  light harvesting chlorophyll a /b-binding protei...    187   1e-55   
gb|ABK24790.1|  unknown                                                 182   2e-55   
gb|ACA52201.1|  chloroplast chlorophyll A/B-binding protein             181   2e-55   
ref|XP_006840304.1|  hypothetical protein AMTR_s00045p00069900          186   2e-55   
gb|AAU89261.1|  chloroplast light harvesting chlorophyll a/b bind...    186   2e-55   
ref|WP_039311800.1|  hypothetical protein                               181   2e-55   
gb|ACI90631.1|  chloroplast light harvesting chlorophyll a/b bind...    186   2e-55   
gb|EMS67017.1|  Chlorophyll a-b binding protein, chloroplastic          186   2e-55   
gb|ACN40027.1|  unknown                                                 186   2e-55   
gb|AAU89252.1|  chloroplast light harvesting chlorophyll a/b bind...    186   2e-55   
gb|AAC78690.1|  chlorophyll a/b-binding protein                         186   2e-55   
ref|NP_001105545.1|  chlorophyll a-b binding protein M9, chloropl...    186   2e-55   
ref|XP_004512704.1|  PREDICTED: chlorophyll a-b binding protein A...    182   3e-55   
gb|ACY66805.1|  chlorophyll a/b-binding protein                         186   3e-55   
ref|XP_002960494.1|  light-harvesting complex                           186   3e-55   
ref|XP_002967230.1|  light-harvesting complex                           185   6e-55   
sp|Q00827.1|CB48_MAIZE  RecName: Full=Chlorophyll a-b binding pro...    185   7e-55   
ref|XP_010374558.1|  PREDICTED: chlorophyll a-b binding protein o...    184   9e-55   
ref|XP_002440263.1|  hypothetical protein SORBIDRAFT_09g028720          184   9e-55   
ref|XP_010250249.1|  PREDICTED: chlorophyll a-b binding protein, ...    181   1e-54   
emb|CAA27542.1|  chlorophyll a/b binding protein (LHCP AB 180)          183   1e-54   
gb|EMT23952.1|  Chlorophyll a-b binding protein 1B, chloroplastic       184   1e-54   
gb|ACF84273.1|  unknown                                                 184   1e-54   
sp|P15194.1|CB2B_PINSY  RecName: Full=Chlorophyll a-b binding pro...    184   1e-54   
ref|XP_010275544.1|  PREDICTED: chlorophyll a-b binding protein o...    184   1e-54   
gb|ABN46977.1|  chlorophyll a/b-binding protein                         184   2e-54   
pdb|2BHW|A  Chain A, Pea Light-Harvesting Complex Ii At 2.5 Angst...    183   2e-54   
gb|ACF85694.1|  unknown                                                 184   2e-54   



>ref|XP_006361530.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006361531.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like 
isoform X2 [Solanum tuberosum]
Length=267

 Score =   226 bits (577),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 108/118 (92%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SPS+ EITGN +FTMRKTA K KPVSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKAVKLSPSSSEITGNGRFTMRKTATKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132



>ref|XP_011096521.1| PREDICTED: chlorophyll a-b binding protein 21, chloroplastic-like 
[Sesamum indicum]
Length=286

 Score =   226 bits (576),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 120/134 (90%), Positives = 125/134 (93%), Gaps = 0/134 (0%)
 Frame = +3

Query  54   TNMaastmalssssfaGKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVK  233
            T MAASTMALSS SFAG+AVK+SPS PEITGN + +MRKT  KPKP SSGSPWYGPDRVK
Sbjct  18   TTMAASTMALSSPSFAGQAVKLSPSAPEITGNGRVSMRKTVAKPKPASSGSPWYGPDRVK  77

Query  234  YLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPE  413
            YLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPE
Sbjct  78   YLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPE  137

Query  414  LLSRNGVKFGEAVW  455
            LL+RNGVKFGEAVW
Sbjct  138  LLARNGVKFGEAVW  151



>ref|XP_009593856.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=267

 Score =   225 bits (574),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 108/118 (92%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SPS+ EITGN K TMRKTA K KPVSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKAVKLSPSSSEITGNGKVTMRKTASKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132



>ref|XP_009782924.1| PREDICTED: chlorophyll a-b binding protein 50, chloroplastic-like 
[Nicotiana sylvestris]
Length=267

 Score =   225 bits (574),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 108/118 (92%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SPS+ EITGN K TMRKTA K KPVSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKAVKLSPSSSEITGNGKVTMRKTASKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132



>ref|XP_009795316.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic-like 
[Nicotiana sylvestris]
 dbj|BAA25392.1| light harvesting chlorophyll a/b-binding protein [Nicotiana sylvestris]
Length=267

 Score =   225 bits (574),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 108/118 (92%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SPS+ EITGN K TMRKTA K KPVSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKAVKLSPSSSEITGNGKVTMRKTASKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132



>ref|XP_009795315.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic 
[Nicotiana sylvestris]
Length=267

 Score =   225 bits (573),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 108/118 (92%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SPS+ EITGN K TMRKTA K KPVSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKAVKLSPSSSEITGNGKVTMRKTASKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132



>ref|XP_008456347.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Cucumis 
melo]
Length=267

 Score =   225 bits (573),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 106/118 (90%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK+SP+  ++ G  + TMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  15   GQAVKLSPTASDLLGEGRITMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  132



>ref|XP_004145734.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004169747.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic-like 
[Cucumis sativus]
 gb|KGN46826.1| hypothetical protein Csa_6G139750 [Cucumis sativus]
Length=267

 Score =   225 bits (573),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 106/118 (90%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK+SP+  ++ G  + TMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  15   GQAVKLSPTASDLLGEGRITMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  132



>ref|XP_009628754.1| PREDICTED: chlorophyll a-b binding protein 16, chloroplastic 
[Nicotiana tomentosiformis]
Length=266

 Score =   224 bits (572),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 108/118 (92%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SPS+ EITGN K TMRKTA K KPVSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  14   GKAVKLSPSSSEITGNGKVTMRKTASKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLTGE  73

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  74   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  131



>ref|XP_009790934.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic-like 
[Nicotiana sylvestris]
 dbj|BAA25396.1| light harvesting chlorophyll a/b-binding protein [Nicotiana sylvestris]
Length=267

 Score =   224 bits (572),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 108/118 (92%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SPS+ EITGN K TMRKTA K KPVSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKAVKLSPSSSEITGNGKVTMRKTATKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132



>ref|XP_009611577.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=262

 Score =   224 bits (571),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 108/118 (92%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SPS+ EITGN K TMRKTA K KPVSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  10   GKAVKLSPSSSEITGNGKATMRKTASKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLTGE  69

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  70   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  127



>ref|XP_009618329.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic-like 
[Nicotiana tomentosiformis]
 ref|XP_009628756.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=267

 Score =   224 bits (572),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 107/118 (91%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SPS+ EITGN K TMRKTA K KPVSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKAVKLSPSSSEITGNGKVTMRKTASKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNG+KFGEAVW
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGIKFGEAVW  132



>ref|XP_009790936.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic-like 
[Nicotiana sylvestris]
Length=267

 Score =   224 bits (572),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 108/118 (92%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SPS+ EITGN K TMRKTA K KPVSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKAVKLSPSSSEITGNGKVTMRKTATKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132



>sp|P12470.1|CB25_NICPL RecName: Full=Chlorophyll a-b binding protein E, chloroplastic; 
AltName: Full=LHCII type I CAB-E; Short=LHCP; Flags: Precursor 
[Nicotiana plumbaginifolia]
 gb|AAA34056.1| chlorophyll a/b-binding protein-E [Nicotiana plumbaginifolia]
Length=266

 Score =   224 bits (571),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 107/118 (91%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SPS+ E+TGN K TMRKTA K KPVSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  14   GKAVKLSPSSSEVTGNGKVTMRKTANKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLTGE  73

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  74   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  131



>sp|P27492.1|CB21_TOBAC RecName: Full=Chlorophyll a-b binding protein 16, chloroplastic; 
AltName: Full=LHCII type I CAB-16; Short=LHCP; Flags: Precursor 
[Nicotiana tabacum]
 emb|CAA36955.1| unnamed protein product [Nicotiana tabacum]
Length=266

 Score =   224 bits (571),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 107/118 (91%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SPS+ E+TGN K TMRKTA K KPVSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  14   GKAVKLSPSSSEVTGNGKVTMRKTASKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLTGE  73

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  74   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  131



>ref|XP_009606802.1| PREDICTED: chlorophyll a-b binding protein 16, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=266

 Score =   224 bits (570),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 107/118 (91%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SPS+ EITGN K TMRKTA K KP+SSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  14   GKAVKLSPSSSEITGNGKVTMRKTASKAKPLSSGSPWYGPDRVKYLGPFSGESPSYLTGE  73

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  74   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  131



>ref|XP_004170962.1| PREDICTED: chlorophyll a-b binding protein of LHCII type I, chloroplastic-like 
[Cucumis sativus]
 gb|KGN49375.1| hypothetical protein Csa_6G522690 [Cucumis sativus]
Length=265

 Score =   224 bits (570),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 109/118 (92%), Positives = 112/118 (95%), Gaps = 2/118 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK+SP+ PEI GNAKFTMRKTA K   VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  15   GQAVKLSPTAPEIQGNAKFTMRKTASKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  130



>ref|XP_004134603.1| PREDICTED: chlorophyll a-b binding protein of LHCII type I, chloroplastic-like 
isoform 1 [Cucumis sativus]
 ref|XP_004134604.1| PREDICTED: chlorophyll a-b binding protein of LHCII type I, chloroplastic-like 
isoform 2 [Cucumis sativus]
 ref|XP_004134605.1| PREDICTED: chlorophyll a-b binding protein of LHCII type I, chloroplastic-like 
isoform 3 [Cucumis sativus]
 gb|KGN49374.1| hypothetical protein Csa_6G522680 [Cucumis sativus]
Length=265

 Score =   223 bits (569),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 109/118 (92%), Positives = 112/118 (95%), Gaps = 2/118 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK+SP+ PEI GNAKFTMRKTA K   VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  15   GQAVKLSPNAPEIQGNAKFTMRKTASKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  130



>ref|XP_004134608.1| PREDICTED: chlorophyll a-b binding protein of LHCII type I, chloroplastic-like 
[Cucumis sativus]
Length=265

 Score =   223 bits (569),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 109/118 (92%), Positives = 112/118 (95%), Gaps = 2/118 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK+SP+ PEI GNAKFTMRKTA K   VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  15   GQAVKLSPNAPEIQGNAKFTMRKTASKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  130



>ref|XP_009782922.1| PREDICTED: chlorophyll a-b binding protein 50, chloroplastic 
[Nicotiana sylvestris]
Length=267

 Score =   223 bits (569),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 107/118 (91%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SPS+ EITGN K TMRKT  K KPVSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKAVKLSPSSSEITGNGKVTMRKTVTKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132



>ref|XP_009597417.1| PREDICTED: chlorophyll a-b binding protein 50, chloroplastic 
[Nicotiana tomentosiformis]
Length=267

 Score =   223 bits (568),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 107/118 (91%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SPS+ EITGN K TMRKT  K KPVSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKAVKLSPSSSEITGNGKVTMRKTVTKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132



>ref|XP_009609679.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic-like, 
partial [Nicotiana tomentosiformis]
Length=139

 Score =   219 bits (557),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 105/118 (89%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G AVK+SPS+ EITGN K  MRKT  K KPVSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GNAVKLSPSSSEITGNGKAIMRKTVTKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132



>ref|XP_009782923.1| PREDICTED: chlorophyll a-b binding protein 50, chloroplastic-like 
[Nicotiana sylvestris]
Length=267

 Score =   223 bits (568),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 107/118 (91%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SPS+ EITGN K TMRKT  K KPVSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKAVKLSPSSSEITGNGKVTMRKTVTKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132



>ref|XP_009772885.1| PREDICTED: chlorophyll a-b binding protein 50, chloroplastic-like 
[Nicotiana sylvestris]
Length=267

 Score =   223 bits (568),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 107/118 (91%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SPS+ EITGN K TMRKT  K KPVSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKAVKLSPSSSEITGNGKVTMRKTVTKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132



>ref|XP_006356073.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like 
[Solanum tuberosum]
Length=267

 Score =   223 bits (568),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 105/118 (89%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SPS+ EITGN + TMRKTA K KP SSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKAVKLSPSSSEITGNGRITMRKTAAKAKPASSGSPWYGPDRVKYLGPFSGEAPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEA+W
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAIW  132



>gb|ABF17940.1| putative chloroplast chlorophyll a/b-binding protein [Carya cathayensis]
Length=267

 Score =   223 bits (568),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+A+K++PS+ ++ G  + TMRKTAG+PKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  15   GQAIKLAPSSSDLLGEGRVTMRKTAGRPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVW  132



>ref|XP_009794580.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic-like, 
partial [Nicotiana sylvestris]
Length=159

 Score =   219 bits (558),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 105/118 (89%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G AVK+SPS+ EITGN K  MRKT  K KPVSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GNAVKLSPSSSEITGNGKAIMRKTVTKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132



>sp|P08221.1|CB21_CUCSA RecName: Full=Chlorophyll a-b binding protein of LHCII type I, 
chloroplastic; Short=CAB; Short=LHCP; Flags: Precursor, partial 
[Cucumis sativus]
 gb|AAA33124.1| chlorophyll a/b-binding protein, partial [Cucumis sativus]
Length=255

 Score =   222 bits (566),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 109/118 (92%), Positives = 112/118 (95%), Gaps = 2/118 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK+SP+ PEI GNAKFTMRKTA K   VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  5    GQAVKLSPNAPEIQGNAKFTMRKTASKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  62

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  63   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  120



>ref|XP_009628755.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic 
[Nicotiana tomentosiformis]
 sp|P27495.1|CB24_TOBAC RecName: Full=Chlorophyll a-b binding protein 40, chloroplastic; 
AltName: Full=LHCII type I CAB-40; Short=LHCP; Flags: Precursor 
[Nicotiana tabacum]
 emb|CAA36958.1| unnamed protein product [Nicotiana tabacum]
Length=267

 Score =   222 bits (566),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/118 (91%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SPS+ EITGN K TMRKTA K K VSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKAVKLSPSSSEITGNGKVTMRKTASKAKTVSSGSPWYGPDRVKYLGPFSGESPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132



>ref|XP_009795314.1| PREDICTED: chlorophyll a-b binding protein 16, chloroplastic-like 
[Nicotiana sylvestris]
 dbj|BAA25393.1| light harvesting chlorophyll a/b-binding protein [Nicotiana sylvestris]
Length=266

 Score =   222 bits (566),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/118 (91%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SPS+ EITGN K TMRKTA K KPVSSGS WYGPDRVKYLGPFSGE PSYLTGE
Sbjct  14   GKAVKLSPSSSEITGNGKVTMRKTASKAKPVSSGSLWYGPDRVKYLGPFSGESPSYLTGE  73

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  74   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  131



>sp|P07369.1|CB2G_SOLLC RecName: Full=Chlorophyll a-b binding protein 3C, chloroplastic; 
AltName: Full=LHCII type I CAB-3C; Short=LHCP; Flags: Precursor 
[Solanum lycopersicum]
 prf||1204205G protein 3C,chlorophyll binding
Length=267

 Score =   222 bits (566),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 106/118 (90%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SPS+ EITGN + TMRKTA K KP SSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKAVKLSPSSSEITGNGRVTMRKTATKAKPASSGSPWYGPDRVKYLGPFSGESPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132



>sp|P27496.1|CB25_TOBAC RecName: Full=Chlorophyll a-b binding protein 50, chloroplastic; 
AltName: Full=LHCII type I CAB-50; Short=LHCP; Flags: Precursor 
[Nicotiana tabacum]
 emb|CAA36956.1| unnamed protein product [Nicotiana tabacum]
Length=267

 Score =   222 bits (566),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 106/118 (90%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SPS+ EITGN K TMRKT  K KP+SSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKAVKLSPSSSEITGNGKVTMRKTVTKAKPLSSGSPWYGPDRVKYLGPFSGESPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132



>ref|XP_010317413.1| PREDICTED: chlorophyll a-b binding protein 3A, chloroplastic-like 
[Solanum lycopersicum]
Length=267

 Score =   222 bits (565),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GK VK++PS+ EI+GN + TMRKTA KPKP SSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKTVKLAPSSSEISGNGRITMRKTAAKPKPASSGSPWYGPDRVKYLGPFSGESPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132



>gb|AAA34148.1| chlorophyll a/b-binding protein Cab-3C [Solanum lycopersicum]
Length=267

 Score =   222 bits (565),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 106/118 (90%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SPS+ EITGN + TMRKTA K KP SSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKAVKLSPSSSEITGNGRVTMRKTATKAKPASSGSPWYGPDRVKYLGPFSGESPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132



>ref|XP_006356077.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like 
[Solanum tuberosum]
Length=267

 Score =   221 bits (564),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 105/118 (89%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SPS+ EITGN + TMRKTA K KP SSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKAVKLSPSSSEITGNGRVTMRKTAAKAKPASSGSPWYGPDRVKYLGPFSGESPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETF+KNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  75   FPGDYGWDTAGLSADPETFSKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132



>sp|P12469.1|CB23_NICPL RecName: Full=Chlorophyll a-b binding protein C, chloroplastic; 
AltName: Full=LHCII type I CAB-C; Short=LHCP; Flags: Precursor 
[Nicotiana plumbaginifolia]
 gb|AAA34055.1| chlorophyll a/b-binding protein-C [Nicotiana plumbaginifolia]
Length=267

 Score =   221 bits (564),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 106/118 (90%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SPS+ EITGN K TMRKTA K KPVSS SPWYGP+RVKYLGPFSGE PSYLTGE
Sbjct  15   GKAVKLSPSSSEITGNGKVTMRKTASKAKPVSSSSPWYGPNRVKYLGPFSGESPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132



>ref|XP_009782921.1| PREDICTED: chlorophyll a-b binding protein 50, chloroplastic-like 
[Nicotiana sylvestris]
Length=267

 Score =   221 bits (564),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 106/118 (90%), Positives = 109/118 (92%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SPS+ EI GN K TMRKT  K KPVSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKAVKLSPSSSEIIGNGKVTMRKTVTKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132



>ref|XP_009606800.1| PREDICTED: chlorophyll a-b binding protein 50, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=267

 Score =   221 bits (564),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 106/118 (90%), Positives = 109/118 (92%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SPS+ EITGN K TMRKT  K KPVSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKAVKLSPSSSEITGNGKVTMRKTVTKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAML ALGCVFPELL+RNGVKFGEAVW
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLAALGCVFPELLARNGVKFGEAVW  132



>ref|XP_010243713.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Nelumbo nucifera]
Length=267

 Score =   221 bits (563),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 109/118 (92%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK++PS  E+ G  + TMRKT  KPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  15   GKAVKLAPSASELLGEGRITMRKTVAKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132



>sp|P04780.1|CB22_PETSP RecName: Full=Chlorophyll a-b binding protein 22L, chloroplastic; 
AltName: Full=LHCII type I CAB-22L; Short=LHCP; Flags: 
Precursor [Petunia sp.]
 emb|CAA26212.1| unnamed protein product [Petunia sp.]
Length=267

 Score =   221 bits (563),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 106/118 (90%), Positives = 109/118 (92%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GK VK+SPS+ EITGN K TMRKTA K KPVSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKVVKLSPSSSEITGNGKATMRKTATKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPEL +RNGVKFGEAVW
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELFARNGVKFGEAVW  132



>ref|XP_006356075.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like 
isoform X1 [Solanum tuberosum]
Length=267

 Score =   221 bits (562),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 105/118 (89%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SPS+ EITGN + TMRKTA K KP SSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKAVKLSPSSSEITGNGRVTMRKTATKAKPASSGSPWYGPDRVKYLGPFSGESPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETF+KNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  75   FPGDYGWDTAGLSADPETFSKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132



>ref|XP_006364025.1| PREDICTED: chlorophyll a-b binding protein 50, chloroplastic-like 
[Solanum tuberosum]
Length=267

 Score =   221 bits (562),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 105/118 (89%), Positives = 109/118 (92%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SPS+ EITGN K  MRKT  K KP+SSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKAVKLSPSSSEITGNGKVMMRKTVTKAKPISSGSPWYGPDRVKYLGPFSGESPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132



>ref|XP_009628757.1| PREDICTED: chlorophyll a-b binding protein 16, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=266

 Score =   221 bits (562),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 105/118 (89%), Positives = 109/118 (92%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAV++SPS+ EI GN K TMRKT  K KPVSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  14   GKAVRLSPSSSEIIGNGKVTMRKTVTKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLTGE  73

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  74   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  131



>ref|XP_006356078.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like 
[Solanum tuberosum]
Length=267

 Score =   220 bits (560),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SPS+ E+TGN + TMRKTA K KP SSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKAVKLSPSSSEVTGNGRVTMRKTATKAKPASSGSPWYGPDRVKYLGPFSGESPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETF+KNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  75   FPGDYGWDTAGLSADPETFSKNRELEVIHGRWAMLGALGCVFPELLARNGVKFGEAVW  132



>gb|ABD38707.1| chloroplast chlorophyll a/b binding protein [Pachysandra terminalis]
Length=267

 Score =   219 bits (559),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK++PS  E+ G  + +MRKT G+PKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  15   GKAVKLAPSASELLGVGRVSMRKTGGRPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132



>ref|XP_010916097.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Elaeis guineensis]
Length=266

 Score =   219 bits (559),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 109/118 (92%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SPS  EI G  + TMRKT  KPKPV++GSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  14   GKAVKLSPSASEINGEGRITMRKTVPKPKPVAAGSPWYGPDRVKYLGPFSGEPPSYLTGE  73

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  74   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  131



>gb|ABB55370.1| chlorophyll a-b binding protein 3C-like [Solanum tuberosum]
Length=267

 Score =   219 bits (559),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 109/118 (92%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SPS+ EITGN + TMRK+  K KP SSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKAVKLSPSSSEITGNGRITMRKSVAKAKPASSGSPWYGPDRVKYLGPFSGEAPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132



>ref|XP_008439658.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Cucumis melo]
Length=265

 Score =   219 bits (558),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 107/118 (91%), Positives = 110/118 (93%), Gaps = 2/118 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SP+ PEI G  + TMRKTA   KPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  15   GKAVKLSPNAPEIQGTGRITMRKTA--TKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  130



>ref|XP_002316737.1| Chlorophyll a-b binding protein 2 [Populus trichocarpa]
 gb|EEE97349.1| Chlorophyll a-b binding protein 2 [Populus trichocarpa]
Length=264

 Score =   219 bits (558),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 106/118 (90%), Positives = 111/118 (94%), Gaps = 3/118 (3%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SPS+PE+ GN + +MRKT    KPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  15   GKAVKLSPSSPELMGNGRVSMRKTT---KPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  71

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  72   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  129



>ref|XP_008779641.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Phoenix dactylifera]
Length=266

 Score =   219 bits (558),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK++PS  +I G  + TMRK+ G+PKP++SGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  14   GKAVKLAPSASDIIGEGRITMRKSVGRPKPIASGSPWYGPDRVKYLGPFSGEPPSYLTGE  73

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  74   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  131



>gb|AAT08651.1| chloroplast chlorophyll A-B binding protein [Hyacinthus orientalis]
Length=239

 Score =   218 bits (555),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G AVK++PS+  ++G+ +FTMRKTAGKPK VSSGSPWYGP+RVKYLGPFSGE PSYLTGE
Sbjct  26   GTAVKLTPSSSVVSGDGRFTMRKTAGKPKTVSSGSPWYGPERVKYLGPFSGEAPSYLTGE  85

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  86   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  143



>ref|XP_008784387.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Phoenix dactylifera]
Length=266

 Score =   219 bits (557),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 109/118 (92%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK++PS  EI G  + TMRKT  +PKPV+SGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  14   GKAVKLAPSASEILGEGRITMRKTFSRPKPVASGSPWYGPDRVKYLGPFSGEPPSYLTGE  73

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  74   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  131



>ref|XP_009782821.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic-like 
[Nicotiana sylvestris]
Length=267

 Score =   219 bits (557),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 105/118 (89%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G AVK+SPS+ EITGN K  MRKT  K KPVSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GNAVKLSPSSSEITGNGKAIMRKTVTKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132



>ref|XP_009782905.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic-like 
[Nicotiana sylvestris]
Length=267

 Score =   219 bits (557),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 105/118 (89%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G AVK+SPS+ EITGN K  MRKT  K KPVSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GNAVKLSPSSSEITGNGKAIMRKTVTKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132



>sp|P27491.1|CB27_TOBAC RecName: Full=Chlorophyll a-b binding protein 7, chloroplastic; 
AltName: Full=LHCII type I CAB-7; Short=LHCP; Flags: Precursor 
[Nicotiana tabacum]
 emb|CAA41187.1| chlorophyll a /b binding protein [Nicotiana tabacum]
Length=267

 Score =   219 bits (557),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 105/118 (89%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G AVK+SPS+ EITGN K  MRKT  K KPVSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GNAVKLSPSSSEITGNGKAIMRKTVTKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132



>ref|XP_009775533.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic [Nicotiana 
sylvestris]
 dbj|BAA25395.1| light harvesting chlorophyll a/b-binding protein [Nicotiana sylvestris]
Length=267

 Score =   219 bits (557),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 105/118 (89%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G AVK+SPS+ EITGN K  MRKT  K KPVSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GNAVKLSPSSSEITGNGKAIMRKTVTKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132



>ref|XP_004164941.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic-like, 
partial [Cucumis sativus]
Length=149

 Score =   214 bits (546),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 111/118 (94%), Gaps = 2/118 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GK VK++PS+PE+ GN++ TMRK+A   K VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  15   GKVVKLTPSSPELFGNSRVTMRKSA--TKSVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  130



>sp|P04783.1|CB25_PETSP RecName: Full=Chlorophyll a-b binding protein 91R, chloroplastic; 
AltName: Full=LHCII type I CAB-91R; Short=LHCP; Flags: 
Precursor [Petunia sp.]
 emb|CAA26209.1| unnamed protein product [Petunia sp.]
Length=267

 Score =   219 bits (557),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 106/118 (90%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK SPS+ EITGN K TMRKT  K KPVSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKAVKFSPSSSEITGNGKATMRKTVTKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTA LSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  75   FPGDYGWDTAELSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132



>gb|AIR93785.1| chloroplast light harvesting chlorophyll A/B binding protein 
[Kalanchoe fedtschenkoi]
Length=267

 Score =   218 bits (556),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 109/118 (92%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+A+K++PS  +I G  + +MRKT  KPKPVSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GQAIKLAPSASDILGEGRISMRKTGAKPKPVSSGSPWYGPDRVKYLGPFSGEAPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  132



>gb|AFO67219.1| putative chlorophyll a/b binding protein, partial [Aralia elata]
Length=155

 Score =   214 bits (546),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 110/118 (93%), Gaps = 3/118 (3%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVKV+PS+ E+ GN + +MRKTA   KPVSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKAVKVAPSSSELFGNGRISMRKTA---KPVSSGSPWYGPDRVKYLGPFSGEAPSYLTGE  71

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  72   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVW  129



>ref|XP_011011531.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Populus euphratica]
 ref|XP_011016419.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Populus euphratica]
Length=264

 Score =   218 bits (556),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 105/118 (89%), Positives = 111/118 (94%), Gaps = 3/118 (3%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK++PS+PE+ GN + +MRKT    KPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  15   GKAVKLTPSSPELMGNGRVSMRKTT---KPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  71

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  72   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  129



>ref|XP_011096520.1| PREDICTED: chlorophyll a-b binding protein 21, chloroplastic 
[Sesamum indicum]
Length=265

 Score =   218 bits (556),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 105/118 (89%), Positives = 110/118 (93%), Gaps = 2/118 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK+SPS PEITGN + +MRKT  KP  VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  15   GQAVKLSPSAPEITGNGRVSMRKTVAKP--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130



>emb|CAA78379.1| chlorophyll a/b-binding protein PS II-Type I [Solanum tuberosum]
Length=267

 Score =   218 bits (555),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 105/118 (89%), Positives = 109/118 (92%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SPS+ EITGN +FTMRKTA K KPVSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKAVKLSPSSSEITGNGRFTMRKTAAKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
             PGDYGWDTAGLSADPETFAKNRELEVIH RWA+L  LGCVFPELLSRNGVKFGEAVW
Sbjct  75   KPGDYGWDTAGLSADPETFAKNRELEVIHCRWAILERLGCVFPELLSRNGVKFGEAVW  132



>ref|XP_006356076.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like 
isoform X2 [Solanum tuberosum]
Length=267

 Score =   218 bits (555),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 109/118 (92%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SPS+ E+TGN + TMRK+  K KP SSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKAVKLSPSSSEVTGNGRVTMRKSVAKAKPASSGSPWYGPDRVKYLGPFSGESPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETF+KNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  75   FPGDYGWDTAGLSADPETFSKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132



>ref|XP_009759685.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic-like 
[Nicotiana sylvestris]
 dbj|BAA25394.1| light harvesting chlorophyll a/b-binding protein [Nicotiana sylvestris]
Length=267

 Score =   218 bits (554),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 105/118 (89%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SPS+ EI GN K TMRKT  K KPVSSGSPWYGPDRVKYLGPFSG  PSYLTGE
Sbjct  15   GKAVKLSPSSYEIIGNGKVTMRKTVIKAKPVSSGSPWYGPDRVKYLGPFSGNSPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132



>gb|AAA33396.1| light-harvesting chlorophyll a/b protein precursor [Lemna gibba]
Length=266

 Score =   218 bits (554),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK++P+  E+ G  + +MRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  14   GKAVKLAPAASEVFGEGRVSMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEAPSYLTGE  73

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            F GDYGWDTAGLSADPETFAKNRELEVIH+RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  74   FAGDYGWDTAGLSADPETFAKNRELEVIHARWAMLGALGCVFPELLARNGVKFGEAVW  131



>ref|XP_011085268.1| PREDICTED: chlorophyll a-b binding protein 21, chloroplastic-like 
[Sesamum indicum]
Length=265

 Score =   218 bits (554),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 105/118 (89%), Positives = 110/118 (93%), Gaps = 2/118 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK+SPST EITGN + +MRKT  KP  VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  15   GQAVKLSPSTSEITGNGRVSMRKTVAKP--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130



>ref|XP_009421488.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Musa acuminata subsp. malaccensis]
Length=266

 Score =   218 bits (554),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 109/118 (92%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK++PS  +I G  + TMRK+A + KPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  14   GKAVKLAPSASDILGEGRITMRKSAARSKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  73

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  74   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  131



>ref|XP_006356074.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like 
[Solanum tuberosum]
Length=267

 Score =   218 bits (554),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GK VK+SPS+ EITGN + TMRKT  K KP SSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKTVKLSPSSYEITGNGRVTMRKTTTKAKPASSGSPWYGPDRVKYLGPFSGEAPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132



>gb|EYU38943.1| hypothetical protein MIMGU_mgv1a012024mg [Erythranthe guttata]
Length=264

 Score =   217 bits (553),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 105/118 (89%), Positives = 110/118 (93%), Gaps = 3/118 (3%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK   STPEITGN + +MRKTA KPKP SSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GQAVK---STPEITGNGRISMRKTAAKPKPASSGSPWYGPDRVKYLGPFSGEAPSYLTGE  71

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETF+KNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  72   FPGDYGWDTAGLSADPETFSKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVW  129



>ref|XP_009618330.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=265

 Score =   217 bits (553),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 107/118 (91%), Positives = 109/118 (92%), Gaps = 2/118 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SPS  E TGN K TMRKTA K KPVSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKAVKLSPS--ETTGNGKVTMRKTASKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLTGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130



>ref|XP_009396492.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Musa acuminata subsp. malaccensis]
Length=266

 Score =   217 bits (553),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 109/118 (92%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK++PS  ++ G  + TMRKT  KPKPV+SGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  14   GQAVKLAPSASDVLGGGRVTMRKTGAKPKPVASGSPWYGPDRVKYLGPFSGEPPSYLTGE  73

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  74   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  131



>ref|XP_010052093.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Eucalyptus grandis]
 gb|KCW75951.1| hypothetical protein EUGRSUZ_D00319 [Eucalyptus grandis]
Length=265

 Score =   217 bits (552),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 110/118 (93%), Gaps = 2/118 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK+SPSTPE+ GN + +MRKT GKP  VSSGSPWYGPDR KYLGPFSGEPPSYLTGE
Sbjct  15   GQAVKLSPSTPELLGNGRVSMRKTVGKP--VSSGSPWYGPDRAKYLGPFSGEPPSYLTGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNG+KFGEAVW
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGIKFGEAVW  130



>ref|XP_004234241.1| PREDICTED: uncharacterized protein LOC101245729 [Solanum lycopersicum]
Length=554

 Score =   225 bits (573),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 106/118 (90%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SPS+ EI+GN + TMRKTA KPKP SSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKAVKLSPSSSEISGNGRITMRKTAAKPKPASSGSPWYGPDRVKYLGPFSGESPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132


 Score =   222 bits (566),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 106/118 (90%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SPS+ EITGN + TMRKTA K KP SSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  302  GKAVKLSPSSSEITGNGRVTMRKTATKAKPASSGSPWYGPDRVKYLGPFSGESPSYLTGE  361

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  362  FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  419



>emb|CAJ77390.1| major chlorophyll a/b binding protein LHCb1.2 [Spinacia oleracea]
Length=267

 Score =   216 bits (551),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKA+K+ P+  EI G  + TMRKTAGKPK VSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKAIKLGPTASEILGEGRVTMRKTAGKPKNVSSGSPWYGPDRVKYLGPFSGEAPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETF+KNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  75   FPGDYGWDTAGLSADPETFSKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132



>ref|XP_004294267.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Fragaria vesca subsp. vesca]
Length=267

 Score =   216 bits (551),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK+SPST  + G  + TMRKTA K K VSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GQAVKLSPSTSTLFGEGRVTMRKTAAKSKNVSSGSPWYGPDRVKYLGPFSGEAPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  132



>ref|XP_010685893.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic [Beta 
vulgaris subsp. vulgaris]
Length=267

 Score =   216 bits (551),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GK +K+ P+  EI G  + TMRKTAGKPKP+SSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKPIKLGPTPSEILGEGRITMRKTAGKPKPISSGSPWYGPDRVKYLGPFSGEAPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132



>ref|XP_006356080.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like 
[Solanum tuberosum]
Length=267

 Score =   216 bits (551),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GK VK+SPS+ EITGN + TMRK+A K KP S GSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKTVKLSPSSSEITGNGRVTMRKSAAKAKPASFGSPWYGPDRVKYLGPFSGEAPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETF+KNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  75   FPGDYGWDTAGLSADPETFSKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132



>gb|EYU28187.1| hypothetical protein MIMGU_mgv1a009948mg [Erythranthe guttata]
Length=326

 Score =   218 bits (555),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 118/134 (88%), Positives = 123/134 (92%), Gaps = 3/134 (2%)
 Frame = +3

Query  54   TNMaastmalssssfaGKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVK  233
            T MAAS+MALSS SFAG+AVK   STPE TGN + +MRKTA KPKP SSGSPWYGPDRVK
Sbjct  61   TTMAASSMALSSPSFAGQAVK---STPEFTGNGRVSMRKTAAKPKPASSGSPWYGPDRVK  117

Query  234  YLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPE  413
            YLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPE
Sbjct  118  YLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPE  177

Query  414  LLSRNGVKFGEAVW  455
            LL+RNGVKFGEAVW
Sbjct  178  LLARNGVKFGEAVW  191



>ref|XP_010247422.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Nelumbo nucifera]
Length=268

 Score =   216 bits (550),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 104/119 (87%), Positives = 109/119 (92%), Gaps = 1/119 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPE-ITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTG  278
            GKAVK++PS  E + G  + TMRKT  KPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTG
Sbjct  15   GKAVKLAPSASEKLLGEGRVTMRKTVAKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTG  74

Query  279  EFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            EFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  75   EFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  133



>ref|XP_008444193.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Cucumis melo]
Length=265

 Score =   216 bits (550),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 111/118 (94%), Gaps = 2/118 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK++PS+PE+ GN++  MRK+A K   VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  15   GKAVKLTPSSPELFGNSRVNMRKSAAKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  130



>ref|XP_004147416.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic-like 
[Cucumis sativus]
 gb|KGN65549.1| Chlorophyll A/B binding protein [Cucumis sativus]
Length=265

 Score =   216 bits (549),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 111/118 (94%), Gaps = 2/118 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GK VK++PS+PE+ GN++ TMRK+A   K VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  15   GKVVKLTPSSPELFGNSRVTMRKSA--TKSVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  130



>gb|EYU28462.1| hypothetical protein MIMGU_mgv1a012008mg [Erythranthe guttata]
Length=264

 Score =   216 bits (549),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 109/118 (92%), Gaps = 3/118 (3%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK   STPE TGN + +MRKTA KPKP SSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GQAVK---STPEFTGNGRISMRKTAAKPKPASSGSPWYGPDRVKYLGPFSGEAPSYLTGE  71

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETF+KNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  72   FPGDYGWDTAGLSADPETFSKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVW  129



>sp|P12333.1|CB2A_SPIOL RecName: Full=Chlorophyll a-b binding protein, chloroplastic; 
AltName: Full=LHCII type I CAB; Short=LHCP; Flags: Precursor 
[Spinacia oleracea]
 emb|CAA32526.1| chlorophyll a/b binding protein precursor [Spinacia oleracea]
 emb|CAJ77389.3| major chlorophyll a/b binding protein LHCb1.3 [Spinacia oleracea]
Length=267

 Score =   216 bits (549),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 106/118 (90%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+ P+  EI G  + TMRKTAGKPK V S SPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKAVKLGPTASEIIGEGRITMRKTAGKPKTVQSSSPWYGPDRVKYLGPFSGESPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132



>gb|KCW75952.1| hypothetical protein EUGRSUZ_D00320 [Eucalyptus grandis]
Length=265

 Score =   215 bits (548),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 110/118 (93%), Gaps = 2/118 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK+SPSTPE+ GN + +MRKT GKP  VSSGSPWYGPDR K+LGPFSGEPPSYLTGE
Sbjct  15   GQAVKLSPSTPELLGNGRVSMRKTVGKP--VSSGSPWYGPDRAKHLGPFSGEPPSYLTGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNG+KFGEAVW
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGIKFGEAVW  130



>ref|XP_002519724.1| chlorophyll A/B binding protein, putative [Ricinus communis]
 gb|EEF42697.1| chlorophyll A/B binding protein, putative [Ricinus communis]
Length=265

 Score =   215 bits (548),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 109/118 (92%), Gaps = 2/118 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SPS PE+ GN + +MRKTA K   VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  15   GKAVKLSPSAPELMGNGRVSMRKTAAKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130



>emb|CAJ77391.1| major chlorophyll a/b binding protein LHCb1.1 [Spinacia oleracea]
 emb|CAX64457.1| major chlorophyll a/b binding protein LHCb1.1 precursor [Spinacia 
oleracea]
Length=267

 Score =   215 bits (548),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK++PST ++ G  + +MRK+AGKPK VSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKAVKLNPSTSDMIGEGRISMRKSAGKPKNVSSGSPWYGPDRVKYLGPFSGEAPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETF+KNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  75   FPGDYGWDTAGLSADPETFSKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132



>gb|AAB61238.1| chlorophyll a/b-binding protein [Mesembryanthemum crystallinum]
Length=267

 Score =   215 bits (548),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK++P+T +I G  + TMRKTAGK K VSS SPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKAVKLNPTTSQILGEGRITMRKTAGKTKNVSSDSPWYGPDRVKYLGPFSGEAPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132



>ref|XP_002524616.1| chlorophyll A/B binding protein, putative [Ricinus communis]
 gb|EEF37824.1| chlorophyll A/B binding protein, putative [Ricinus communis]
Length=265

 Score =   215 bits (547),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 109/118 (92%), Gaps = 2/118 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SPS PE+ GN + +MRKTA K   VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  15   GKAVKLSPSAPELMGNGRVSMRKTAAKN--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130



>ref|XP_008229430.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Prunus mume]
Length=267

 Score =   215 bits (547),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 106/118 (90%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK+  S   I G  + TMRKTA KPK VSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GQAVKLGSSVSNIVGEGRVTMRKTASKPKNVSSGSPWYGPDRVKYLGPFSGEAPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  132



>gb|AFC91647.1| chloroplast chlorophyll A/B binding protein [Hevea brasiliensis]
Length=265

 Score =   215 bits (547),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 110/118 (93%), Gaps = 2/118 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK++PS P + GNA+ +MRK+ GKP  VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  15   GKAVKLTPSAPGLMGNARVSMRKSVGKP--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130



>gb|AHB24929.1| chloroplast light-harvesting complex II chlorophyll a/b binding 
protein 1 [Sedum alfredii]
Length=267

 Score =   215 bits (547),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK++P+  ++ GN+K TMRKTA K KP  S SPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GQAVKLTPTVSDLYGNSKVTMRKTAAKSKPTVSSSPWYGPDRVKYLGPFSGEAPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  132



>gb|AGJ50622.1| chlorophyll a/b binding protein [Salicornia brachiata]
Length=267

 Score =   215 bits (547),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GK +K+ P+  EI G  + TMRKTAGKPK V+SGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  15   GKPIKLGPNAAEILGEGRVTMRKTAGKPKQVASGSPWYGPDRVKYLGPFSGEPPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
             PGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  75   LPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132



>ref|XP_008229463.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic-like 
[Prunus mume]
Length=215

 Score =   213 bits (542),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK+  S   I G  + TMRKTA K K VSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GQAVKLGSSVSNIVGEGRVTMRKTASKSKNVSSGSPWYGPDRVKYLGPFSGEAPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  132



>emb|CAX64458.1| major chlorophyll a/b binding protein LHCb1.4 precursor [Spinacia 
oleracea]
Length=267

 Score =   214 bits (545),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKA+K+ P+  EI    + TMRKTAGKPK VSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKAIKLGPTASEILSEGRVTMRKTAGKPKNVSSGSPWYGPDRVKYLGPFSGEAPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETF+KNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  75   FPGDYGWDTAGLSADPETFSKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132



>ref|XP_002285646.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Vitis 
vinifera]
 emb|CAN73057.1| hypothetical protein VITISV_007597 [Vitis vinifera]
Length=267

 Score =   214 bits (545),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 100/118 (85%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKA+K++PS  ++ G  + TMRKT G+ KPVSSGSPWYG DRVKYLGPFSGEPPSYLTGE
Sbjct  15   GKALKLAPSASDLLGEGRVTMRKTGGRAKPVSSGSPWYGTDRVKYLGPFSGEPPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132



>ref|XP_002306927.1| Chlorophyll a-b binding protein 2 [Populus trichocarpa]
 gb|ABK95787.1| unknown [Populus trichocarpa]
 gb|ABK96559.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|ABK96723.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|ABK96730.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE93923.1| Chlorophyll a-b binding protein 2 [Populus trichocarpa]
Length=264

 Score =   214 bits (545),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 109/118 (92%), Gaps = 3/118 (3%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK++PS+ EI GN + +MRKT    KPV SGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  15   GKAVKLNPSSSEIMGNGRVSMRKTT---KPVPSGSPWYGPDRVKYLGPFSGEPPSYLTGE  71

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  72   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  129



>ref|XP_002307725.1| Chlorophyll a-b binding protein 2 [Populus trichocarpa]
 gb|ABK94788.1| unknown [Populus trichocarpa]
 gb|EEE94721.1| Chlorophyll a-b binding protein 2 [Populus trichocarpa]
Length=264

 Score =   214 bits (545),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 109/118 (92%), Gaps = 3/118 (3%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK++PS+ EI GN + +MRKT    KPV SGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  15   GKAVKLNPSSSEIMGNGRVSMRKTT---KPVPSGSPWYGPDRVKYLGPFSGEPPSYLTGE  71

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  72   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  129



>gb|KDP37945.1| hypothetical protein JCGZ_04588 [Jatropha curcas]
Length=265

 Score =   214 bits (545),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 108/118 (92%), Gaps = 2/118 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+ PS PE+ GN + TMRKTA K   VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  15   GKAVKLGPSAPELMGNGRVTMRKTASKN--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130



>ref|XP_010275593.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Nelumbo 
nucifera]
Length=269

 Score =   214 bits (545),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 103/120 (86%), Positives = 109/120 (91%), Gaps = 2/120 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPE--ITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  275
            GKAVK++PS     + G  + TMRKT  KPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  15   GKAVKLAPSAASELLLGQGRVTMRKTVVKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  74

Query  276  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH+RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  75   GEFPGDYGWDTAGLSADPETFAKNRELEVIHARWAMLGALGCVFPELLARNGVKFGEAVW  134



>gb|AFO67221.1| putative chlorophyll a/b binding protein, partial [Aralia elata]
Length=152

 Score =   210 bits (534),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 108/118 (92%), Gaps = 1/118 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVKV+PS+ E+ GN + +MRKT  KP   SSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKAVKVAPSSSELFGNGRISMRKTGKKPV-ASSGSPWYGPDRVKYLGPFSGEAPSYLTGE  73

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  74   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVW  131



>ref|XP_008439659.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Cucumis melo]
Length=338

 Score =   216 bits (549),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 106/118 (90%), Positives = 109/118 (92%), Gaps = 2/118 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SP+ PEI G  + TMRKTA   K VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  88   GKAVKLSPNAPEIQGTGRITMRKTA--TKSVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  145

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  146  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  203



>sp|P04782.1|CB24_PETSP RecName: Full=Chlorophyll a-b binding protein 25, chloroplastic; 
AltName: Full=LHCII type I CAB-25; Short=LHCP; Flags: Precursor 
[Petunia sp.]
 emb|CAA26211.1| unnamed protein product [Petunia sp.]
Length=266

 Score =   213 bits (543),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 107/118 (91%), Gaps = 1/118 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAV V PS+ +ITGN K TMRKT  K KPVSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKAVNV-PSSSQITGNGKATMRKTVTKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLTGE  73

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPEL +RNGVKFGEAVW
Sbjct  74   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELFARNGVKFGEAVW  131



>gb|KCW75953.1| hypothetical protein EUGRSUZ_D00321 [Eucalyptus grandis]
Length=300

 Score =   214 bits (546),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 108/118 (92%), Gaps = 2/118 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK+SPSTPE+ GN + +MRK     KPVSSGSPWYGPDR KYLGPFSGEPPSYLTGE
Sbjct  50   GQAVKLSPSTPELLGNGRISMRKAV--RKPVSSGSPWYGPDRAKYLGPFSGEPPSYLTGE  107

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  108  FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  165



>dbj|BAF95850.1| putative chloroplast chlorophyll a/b binding protein [Vitis hybrid 
cultivar]
Length=234

 Score =   212 bits (540),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 99/118 (84%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKA +++PS  ++ G  + TMRKT G+ KPVSSGSPWYG DRVKYLGPFSGEPPSYLTGE
Sbjct  13   GKAFQLAPSASDLLGEGRVTMRKTGGRAKPVSSGSPWYGTDRVKYLGPFSGEPPSYLTGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130



>sp|P04781.1|CB23_PETSP RecName: Full=Chlorophyll a-b binding protein 22R, chloroplastic; 
AltName: Full=LHCII type I CAB-22R; Short=LHCP; Flags: 
Precursor [Petunia sp.]
 emb|CAA26213.1| unnamed protein product [Petunia sp.]
Length=267

 Score =   213 bits (543),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+S S+ EITGN K TMRKT  K KP SS SPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKAVKLSSSSSEITGNGKVTMRKTVTKAKPASSSSPWYGPDRVKYLGPFSGEAPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FP DYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPEL +RNG+KFGEAVW
Sbjct  75   FPSDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELFARNGIKFGEAVW  132



>ref|XP_010924306.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Elaeis 
guineensis]
Length=264

 Score =   213 bits (542),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 108/118 (92%), Gaps = 2/118 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK++PST  I G  + TMRKT GKP  VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  14   GKAVKLAPSTSPILGEGRVTMRKTVGKP--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  71

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  72   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  129



>gb|AAT08668.1| chloroplast chlorophyll A-B binding protein 40 [Hyacinthus orientalis]
Length=237

 Score =   212 bits (540),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 100/116 (86%), Positives = 108/116 (93%), Gaps = 0/116 (0%)
 Frame = +3

Query  108  AVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFP  287
            AVK++PS+  ++G+ +FTMRKT  KPK VSSGSPWYGPDRVKYLGPFSGE PSYLTGEFP
Sbjct  2    AVKLTPSSSGVSGDGRFTMRKTVAKPKTVSSGSPWYGPDRVKYLGPFSGEAPSYLTGEFP  61

Query  288  GDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            GDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  62   GDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  117



>ref|XP_007217260.1| hypothetical protein PRUPE_ppa010015mg [Prunus persica]
 gb|AAA50310.1| light-harvesting chlorophyll a/b-binding protein [Prunus persica]
 gb|EMJ18459.1| hypothetical protein PRUPE_ppa010015mg [Prunus persica]
Length=267

 Score =   213 bits (542),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK+  S   I G  + TMRKTA K K VSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GQAVKLGSSVSNIVGEGRITMRKTASKSKNVSSGSPWYGPDRVKYLGPFSGEAPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  132



>ref|XP_010904844.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Elaeis guineensis]
Length=266

 Score =   213 bits (542),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 99/118 (84%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK++PS  +I G  + TMRK+ G+ +PV S SPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  14   GKAVKLAPSASDIIGEGRITMRKSVGRSRPVVSDSPWYGPDRVKYLGPFSGEPPSYLTGE  73

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  74   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  131



>gb|EYU28185.1| hypothetical protein MIMGU_mgv1a012021mg [Erythranthe guttata]
Length=264

 Score =   213 bits (542),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 108/118 (92%), Gaps = 3/118 (3%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK   STPE T   +F+MRKTA KPKP +SGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GQAVK---STPEFTTTGRFSMRKTAAKPKPAASGSPWYGPDRVKYLGPFSGEAPSYLTGE  71

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  72   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVW  129



>gb|EYU28186.1| hypothetical protein MIMGU_mgv1a012011mg [Erythranthe guttata]
Length=264

 Score =   213 bits (541),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 108/118 (92%), Gaps = 3/118 (3%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK   STPE T   +F+MRKTA KPKP SSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GQAVK---STPEFTTTGRFSMRKTAAKPKPASSGSPWYGPDRVKYLGPFSGEAPSYLTGE  71

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETF+KNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  72   FPGDYGWDTAGLSADPETFSKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVW  129



>ref|XP_009630190.1| PREDICTED: chlorophyll a-b binding protein 21, chloroplastic 
[Nicotiana tomentosiformis]
 sp|P27493.1|CB22_TOBAC RecName: Full=Chlorophyll a-b binding protein 21, chloroplastic; 
AltName: Full=LHCII type I CAB-21; Short=LHCP; Flags: Precursor 
[Nicotiana tabacum]
 emb|CAA36957.1| unnamed protein product [Nicotiana tabacum]
Length=265

 Score =   213 bits (541),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 108/118 (92%), Gaps = 2/118 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK+SPS PEITGN + +MRKT  KP  V+S SPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GQAVKLSPSAPEITGNGRVSMRKTVAKP--VASSSPWYGPDRVKYLGPFSGESPSYLTGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130



>ref|XP_008229429.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Prunus mume]
Length=267

 Score =   213 bits (541),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK+  S   I G  + TMRKTA K K VSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GQAVKLGSSVSNIVGEGRVTMRKTASKSKNVSSGSPWYGPDRVKYLGPFSGEAPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  132



>ref|XP_009598574.1| PREDICTED: chlorophyll a-b binding protein 21, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=265

 Score =   213 bits (541),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 108/118 (92%), Gaps = 2/118 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK+SPS PEITGN + +MRKT  KP  V+S SPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GQAVKLSPSAPEITGNGRVSMRKTVAKP--VASSSPWYGPDRVKYLGPFSGESPSYLTGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130



>ref|XP_009775649.1| PREDICTED: chlorophyll a-b binding protein 21, chloroplastic-like 
[Nicotiana sylvestris]
 dbj|BAA25390.1| light harvesting chlorophyll a/b-binding protein [Nicotiana sylvestris]
Length=265

 Score =   213 bits (541),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 108/118 (92%), Gaps = 2/118 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK+SPS PEITGN + +MRKT  KP  V+S SPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GQAVKLSPSAPEITGNGRVSMRKTVAKP--VASSSPWYGPDRVKYLGPFSGESPSYLTGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130



>ref|XP_010056879.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Eucalyptus grandis]
Length=265

 Score =   212 bits (540),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 108/118 (92%), Gaps = 2/118 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAV++SPSTPE+ G  + TMRKT    K VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  15   GKAVQLSPSTPELFGKGRVTMRKTV--TKQVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130



>ref|XP_004303878.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Fragaria vesca subsp. vesca]
Length=267

 Score =   212 bits (540),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/118 (85%), Positives = 106/118 (90%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AV++SP+   I G  + TMRKT  K K VSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GQAVQLSPAASNIFGEGRITMRKTGAKSKAVSSGSPWYGPDRVKYLGPFSGEAPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVW  132



>ref|XP_007215816.1| hypothetical protein PRUPE_ppa010034mg [Prunus persica]
 gb|EMJ17015.1| hypothetical protein PRUPE_ppa010034mg [Prunus persica]
Length=267

 Score =   212 bits (539),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK+  S   I G  + TMRKTA + K VSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GQAVKLGSSVSNIVGEGRVTMRKTASRSKNVSSGSPWYGPDRVKYLGPFSGEAPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  132



>ref|XP_004302854.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Fragaria vesca subsp. vesca]
Length=267

 Score =   212 bits (539),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK++PS+  I G  + TMRKTA K K VSSGS WYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GQAVKLNPSSSNINGEGRVTMRKTASKSKTVSSGSLWYGPDRVKYLGPFSGEAPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVW  132



>ref|XP_009395692.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Musa acuminata subsp. malaccensis]
Length=266

 Score =   212 bits (539),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 104/118 (88%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK  PS  ++ G  + TMRKT  KPK   SGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  14   GKAVKFGPSVADVLGGGRVTMRKTGAKPKSAPSGSPWYGPDRVKYLGPFSGEPPSYLTGE  73

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  74   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLSRNGVKFGEAVW  131



>gb|AAA80595.1| chlorophyll a/b binding protein, partial [Solanum tuberosum]
Length=135

 Score =   207 bits (527),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/118 (85%), Positives = 104/118 (88%), Gaps = 2/118 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK+SPS  EITGN + TMRK   K  P  S SPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GQAVKLSPSASEITGNGRITMRKAVAKSAP--SSSPWYGPDRVKYLGPFSGESPSYLTGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130



>ref|XP_008800689.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Phoenix 
dactylifera]
Length=264

 Score =   212 bits (539),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 107/118 (91%), Gaps = 2/118 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK++PST  I G  + TMRKT GKP P  SGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  14   GKAVKLAPSTSTILGEGRVTMRKTIGKPVP--SGSPWYGPDRVKYLGPFSGEPPSYLTGE  71

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  72   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  129



>ref|XP_010052095.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Eucalyptus 
grandis]
Length=264

 Score =   212 bits (539),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 107/118 (91%), Gaps = 3/118 (3%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SP+TP++ GN + TMRK     KP SSGSPWYGPDR KYLGPFSGEPPSYLTGE
Sbjct  15   GKAVKLSPATPDLLGNGRVTMRKAV---KPASSGSPWYGPDRAKYLGPFSGEPPSYLTGE  71

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  72   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  129



>ref|XP_008356026.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Malus 
domestica]
 ref|XP_008364190.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Malus domestica]
Length=265

 Score =   212 bits (539),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 108/118 (92%), Gaps = 2/118 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAV++SP   E+ GN + +MRKTA   K VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  15   GKAVQLSPGATELFGNGRVSMRKTA--TKKVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  130



>ref|XP_009377335.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Pyrus x bretschneideri]
Length=267

 Score =   212 bits (539),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 99/118 (84%), Positives = 106/118 (90%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK++PS+  + G  + TMRKTA K K VSSGSPWYGPDR KYLGPFSGE PSYLTGE
Sbjct  15   GQAVKLNPSSSNLLGEGRVTMRKTAAKSKKVSSGSPWYGPDRAKYLGPFSGESPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGC+FPELLSRNGVKFGEA W
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCIFPELLSRNGVKFGEATW  132



>ref|XP_008364191.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Malus domestica]
 ref|XP_009360860.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Pyrus 
x bretschneideri]
Length=264

 Score =   211 bits (538),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 108/118 (92%), Gaps = 2/118 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAV++SP   E+ GN + +MRKTA   K VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  14   GKAVQLSPGATELFGNGRVSMRKTA--TKKVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  71

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  72   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  129



>gb|AHB24928.1| chloroplast chlorophyll a-b binding protein 2/3 [Sedum alfredii]
Length=267

 Score =   211 bits (538),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 99/118 (84%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK + S  E+ G+ + TMRKTA KPKP +S SPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GQAVKTASSASEVFGSGRVTMRKTAAKPKPSASSSPWYGPDRVKYLGPFSGEAPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPE+LS+NGVKFGEAVW
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVW  132



>gb|AAB61237.1| chlorophyll a/b-binding protein [Mesembryanthemum crystallinum]
Length=267

 Score =   211 bits (537),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 100/118 (85%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GK VK++P+  EI G  + TMRKTAGK K VSS SPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKMVKLAPTASEILGEGRITMRKTAGKTKSVSSDSPWYGPDRVKYLGPFSGESPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETF KNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  75   FPGDYGWDTAGLSADPETFTKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132



>gb|AAC25775.1| chlorophyll a/b binding protein [Medicago sativa]
Length=266

 Score =   211 bits (537),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 109/118 (92%), Gaps = 1/118 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GK VK++PS+ E+ G A+FTMRK+A   K  SSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  15   GKPVKLTPSSQEL-GAARFTMRKSATTKKVASSGSPWYGPDRVKYLGPFSGEPPSYLTGE  73

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  74   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  131



>ref|NP_001266111.1| chlorophyll a-b binding protein AB80, chloroplastic-like [Cicer 
arietinum]
 emb|CAA10284.1| chlorophyll a/b binding protein [Cicer arietinum]
Length=266

 Score =   211 bits (537),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 109/118 (92%), Gaps = 1/118 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GK VK+SPS+ E+ G ++FTMRK+A   K  SSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  15   GKPVKLSPSSQEL-GASRFTMRKSATTKKVASSGSPWYGPDRVKYLGPFSGEPPSYLTGE  73

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  74   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  131



>gb|ABV26426.1| light-harvesting chlorophyll a/b-binding protein [Camellia sinensis]
Length=153

 Score =   207 bits (526),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 98/118 (83%), Positives = 107/118 (91%), Gaps = 2/118 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKA+K+SPSTP++ G  + +MRKT GKP  V SGSPWYGPDRV YLGP SG+PPSYLTGE
Sbjct  12   GKAIKLSPSTPDLVGRGRISMRKTGGKP--VRSGSPWYGPDRVLYLGPLSGDPPSYLTGE  69

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETF+KNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  70   FPGDYGWDTAGLSADPETFSKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  127



>ref|XP_009786355.1| PREDICTED: chlorophyll a-b binding protein 21, chloroplastic-like 
[Nicotiana sylvestris]
 dbj|BAA25388.1| light harvesting chlorophyll a/b-binding protein [Nicotiana sylvestris]
Length=265

 Score =   211 bits (536),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 107/118 (91%), Gaps = 2/118 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK+SPS  EITGN + +MRKTA KP  VSS SPWYGPDRVKYLGPFSGE PSYLT E
Sbjct  15   GQAVKLSPSASEITGNGRVSMRKTAAKP--VSSSSPWYGPDRVKYLGPFSGESPSYLTSE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130



>gb|AFK40061.1| unknown [Medicago truncatula]
 gb|KEH31368.1| light-harvesting complex I chlorophyll A/B-binding protein [Medicago 
truncatula]
Length=266

 Score =   211 bits (536),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 108/118 (92%), Gaps = 1/118 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GK VK++PS+ E+ G A+FTMRK A   K  SSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  15   GKPVKLTPSSQEL-GAARFTMRKAATTKKVASSGSPWYGPDRVKYLGPFSGEPPSYLTGE  73

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  74   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  131



>ref|XP_009598577.1| PREDICTED: chlorophyll a-b binding protein 21, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=265

 Score =   211 bits (536),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 107/118 (91%), Gaps = 2/118 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK+SPS  EITGN + +MRKT  KP  V+S SPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GQAVKLSPSASEITGNGRVSMRKTVAKP--VASSSPWYGPDRVKYLGPFSGESPSYLTGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130



>dbj|BAA25389.1| light harvesting chlorophyll a/b-binding protein [Nicotiana sylvestris]
Length=265

 Score =   210 bits (535),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 107/118 (91%), Gaps = 2/118 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK+SPS  EITGN + +MRKT  KP  V+S SPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GQAVKLSPSASEITGNGRVSMRKTVAKP--VASSSPWYGPDRVKYLGPFSGESPSYLTGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130



>ref|XP_009775645.1| PREDICTED: chlorophyll a-b binding protein 21, chloroplastic-like 
[Nicotiana sylvestris]
 dbj|BAA25391.1| light harvesting chlorophyll a/b-binding protein [Nicotiana sylvestris]
Length=265

 Score =   210 bits (535),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 107/118 (91%), Gaps = 2/118 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK+SPS  EITGN + +MRKT  KP  V+S SPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GQAVKLSPSASEITGNGRVSMRKTVAKP--VASSSPWYGPDRVKYLGPFSGEAPSYLTGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130



>ref|XP_009775650.1| PREDICTED: chlorophyll a-b binding protein 21, chloroplastic 
[Nicotiana sylvestris]
Length=265

 Score =   210 bits (535),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 107/118 (91%), Gaps = 2/118 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK+SPS  EITGN + +MRKT  KP  V+S SPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GQAVKLSPSASEITGNGRVSMRKTVAKP--VASSSPWYGPDRVKYLGPFSGESPSYLTGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130



>gb|AAR10886.1| chlorophyll a/b binding protein [Trifolium pratense]
Length=266

 Score =   210 bits (535),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 108/118 (92%), Gaps = 1/118 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GK VK++PS+ E+ G AKFTMRK A   K  SSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  15   GKPVKLTPSSQEL-GVAKFTMRKGATTKKVASSGSPWYGPDRVKYLGPFSGEPPSYLTGE  73

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  74   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  131



>ref|NP_001240146.1| chlorophyll a-b binding protein 21, chloroplastic-like [Glycine 
max]
 gb|AAA50172.1| photosystem II type I chlorophyll a/b-binding protein [Glycine 
max]
 gb|ACU18421.1| unknown [Glycine max]
 gb|KHN41285.1| Chlorophyll a-b binding protein 21, chloroplastic [Glycine soja]
Length=264

 Score =   210 bits (534),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 110/118 (93%), Gaps = 3/118 (3%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+A+K++PSTPE+ G  + +MRKTA K   VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  15   GQAIKLAPSTPEL-GVGRVSMRKTASKT--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  71

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  72   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  129



>ref|XP_011045092.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Populus 
euphratica]
Length=263

 Score =   210 bits (534),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 109/118 (92%), Gaps = 4/118 (3%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK++PS+ EI GN + +MRKT    KPV SGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  15   GKAVKLNPSSSEI-GNGRISMRKTT---KPVPSGSPWYGPDRVKYLGPFSGEPPSYLTGE  70

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  71   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  128



>gb|EYU29602.1| hypothetical protein MIMGU_mgv1a019986mg [Erythranthe guttata]
Length=260

 Score =   210 bits (534),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 103/119 (87%), Positives = 110/119 (92%), Gaps = 4/119 (3%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGN-AKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTG  278
            G+AVK+SP   EIT N ++ +MRKTA KPKP SSGSPWYGPDRVKYLGPFSGE PSYLTG
Sbjct  10   GQAVKLSP---EITANYSRVSMRKTAAKPKPASSGSPWYGPDRVKYLGPFSGEAPSYLTG  66

Query  279  EFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            EFPGDYGWDTAGLSADPETF+KNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  67   EFPGDYGWDTAGLSADPETFSKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVW  125



>ref|XP_010052094.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Eucalyptus grandis]
Length=400

 Score =   214 bits (545),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 108/118 (92%), Gaps = 2/118 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK+SPSTPE+ GN + +MRK     KPVSSGSPWYGPDR KYLGPFSGEPPSYLTGE
Sbjct  15   GQAVKLSPSTPELLGNGRISMRKAV--RKPVSSGSPWYGPDRAKYLGPFSGEPPSYLTGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130



>gb|EYU28183.1| hypothetical protein MIMGU_mgv1a012019mg [Erythranthe guttata]
 gb|EYU28188.1| hypothetical protein MIMGU_mgv1a012022mg [Erythranthe guttata]
Length=264

 Score =   210 bits (534),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 107/118 (91%), Gaps = 3/118 (3%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK   STPE T + + +MRKTA KPKP +S SPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GQAVK---STPEFTSSGRISMRKTAAKPKPAASSSPWYGPDRVKYLGPFSGEAPSYLTGE  71

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  72   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVW  129



>gb|ACN41907.1| chlorophyll A/B binding protein [Gardenia jasminoides]
Length=264

 Score =   210 bits (534),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 100/118 (85%), Positives = 108/118 (92%), Gaps = 3/118 (3%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK+SPS PE+ GN + +M++T    +PVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  15   GQAVKLSPSAPELMGNGRISMKRTT---RPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  71

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAM GALGCVFPELLSRNGVKFGEAVW
Sbjct  72   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMPGALGCVFPELLSRNGVKFGEAVW  129



>gb|KJB66916.1| hypothetical protein B456_010G165100 [Gossypium raimondii]
Length=265

 Score =   210 bits (534),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 107/118 (91%), Gaps = 2/118 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK SPSTP+I GN + +MRKTA   KP +SGSPWYGPDRV YLGP SGEPPSYLTGE
Sbjct  15   GKAVKFSPSTPKIQGNGRVSMRKTA--TKPAASGSPWYGPDRVLYLGPLSGEPPSYLTGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   FPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130



>gb|EYU28184.1| hypothetical protein MIMGU_mgv1a011918mg [Erythranthe guttata]
Length=266

 Score =   210 bits (534),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 107/118 (91%), Gaps = 1/118 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK+SP     TG  + +MRKT+ KPKP SSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GQAVKLSPEVTG-TGTGRISMRKTSAKPKPASSGSPWYGPDRVKYLGPFSGEAPSYLTGE  73

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  74   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVW  131



>ref|XP_008371581.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Malus 
domestica]
Length=265

 Score =   210 bits (534),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 107/118 (91%), Gaps = 2/118 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAV++SP   E+ GN + +MRKTA   K VSSGSPWYGPDRVKYLGPFSGEPPSYL GE
Sbjct  15   GKAVQLSPGATELFGNGRVSMRKTA--TKQVSSGSPWYGPDRVKYLGPFSGEPPSYLKGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  130



>gb|AHM26643.1| a-b binding protein [Pyrus x bretschneideri]
Length=264

 Score =   209 bits (533),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 107/118 (91%), Gaps = 2/118 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAV++SP   E+ GN + +MRKTA   K VSSGSPWYGPDRVKYLGPFSGEPPSYL GE
Sbjct  14   GKAVQLSPGATELFGNGRVSMRKTA--TKQVSSGSPWYGPDRVKYLGPFSGEPPSYLKGE  71

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  72   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  129



>ref|XP_008356022.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Malus domestica]
Length=265

 Score =   209 bits (533),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 107/118 (91%), Gaps = 2/118 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAV++SP   E+ GN + +MRKTA   K VSSGSPWYGPDRVKYLGPFSGEPPSYL GE
Sbjct  15   GKAVQLSPGATELFGNGRVSMRKTA--TKQVSSGSPWYGPDRVKYLGPFSGEPPSYLKGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  130



>ref|XP_008364187.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Malus domestica]
Length=265

 Score =   209 bits (533),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 107/118 (91%), Gaps = 2/118 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAV++SP   E+ GN + +MRKTA   K VSSGSPWYGPDRVKYLGPFSGEPPSYL GE
Sbjct  15   GKAVQLSPGATELFGNGRVSMRKTA--TKQVSSGSPWYGPDRVKYLGPFSGEPPSYLKGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  130



>ref|XP_009377344.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Pyrus x bretschneideri]
Length=267

 Score =   209 bits (533),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 100/118 (85%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK+S ST  + G  + TMRKTA K K VS GSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GQAVKLSKSTSTLRGEGRITMRKTAAKSKNVSCGSPWYGPDRVKYLGPFSGESPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGC+FPELLSRN VKFGEAVW
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCIFPELLSRNRVKFGEAVW  132



>ref|XP_008366007.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Malus 
domestica]
Length=265

 Score =   209 bits (533),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 107/118 (91%), Gaps = 2/118 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAV++SP   E+ GN + +MRK A   K VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  15   GKAVQLSPGATELFGNGRVSMRKXA--TKKVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  130



>gb|AAA80593.1| chlorophyll a/b binding protein [Solanum tuberosum]
Length=265

 Score =   209 bits (533),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 105/118 (89%), Gaps = 2/118 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK+SPST EITGN + TMRK   K  P  S SPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GQAVKLSPSTSEITGNGRITMRKAVAKSAP--SSSPWYGPDRVKYLGPFSGESPSYLTGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130



>gb|EYU29604.1| hypothetical protein MIMGU_mgv1a023200mg [Erythranthe guttata]
 gb|EYU30287.1| hypothetical protein MIMGU_mgv1a011913mg [Erythranthe guttata]
 gb|EYU30288.1| hypothetical protein MIMGU_mgv1a020332mg [Erythranthe guttata]
Length=267

 Score =   209 bits (533),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 103/119 (87%), Positives = 110/119 (92%), Gaps = 4/119 (3%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGN-AKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTG  278
            G+AVK+SP   EIT N ++ +MRKTA KPKP SSGSPWYGPDRVKYLGPFSGE PSYLTG
Sbjct  17   GQAVKLSP---EITANYSRVSMRKTAAKPKPASSGSPWYGPDRVKYLGPFSGEAPSYLTG  73

Query  279  EFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            EFPGDYGWDTAGLSADPETF+KNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  74   EFPGDYGWDTAGLSADPETFSKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVW  132



>ref|XP_007151992.1| hypothetical protein PHAVU_004G0927000g, partial [Phaseolus vulgaris]
 gb|ESW23986.1| hypothetical protein PHAVU_004G0927000g, partial [Phaseolus vulgaris]
Length=206

 Score =   207 bits (527),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 100/118 (85%), Positives = 110/118 (93%), Gaps = 3/118 (3%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+A+K+SP+TP+I+G  + +MRKTA K   VSSGSPWYGPDRVKYLGPFSGE PSYLTG+
Sbjct  15   GQAIKLSPATPDISGG-RISMRKTASKS--VSSGSPWYGPDRVKYLGPFSGEAPSYLTGQ  71

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  72   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVW  129



>ref|XP_004303877.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Fragaria vesca subsp. vesca]
Length=267

 Score =   209 bits (532),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 100/118 (85%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK+  ST  + G  + TMRKTA K K VSS SPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GQAVKLGSSTSNLLGEGRVTMRKTAAKSKNVSSVSPWYGPDRVKYLGPFSGEAPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVW  132



>gb|KCW75954.1| hypothetical protein EUGRSUZ_D00322 [Eucalyptus grandis]
Length=358

 Score =   212 bits (539),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 107/118 (91%), Gaps = 3/118 (3%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SP+TP++ GN + TMRK     KP SSGSPWYGPDR KYLGPFSGEPPSYLTGE
Sbjct  109  GKAVKLSPATPDLLGNGRVTMRKAV---KPASSGSPWYGPDRAKYLGPFSGEPPSYLTGE  165

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  166  FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  223



>gb|ABF70112.1| chlorophyll A-B binding protein (CAB), putative [Musa balbisiana]
Length=267

 Score =   209 bits (531),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 99/119 (83%), Positives = 107/119 (90%), Gaps = 1/119 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVS-SGSPWYGPDRVKYLGPFSGEPPSYLTG  278
            GKAVK++PS  ++ G  + TMRK+  K KP + SGSPWYGPDRVKYLGPFSGEPPSYLTG
Sbjct  14   GKAVKLAPSASDVLGEGRVTMRKSTAKAKPAAASGSPWYGPDRVKYLGPFSGEPPSYLTG  73

Query  279  EFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            EFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  74   EFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132



>gb|ACF23033.1| ST140, partial [Eutrema halophilum]
Length=141

 Score =   204 bits (520),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 98/118 (83%), Positives = 107/118 (91%), Gaps = 1/118 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SP+  E+ G+ + TMRKT  KPK   SGSPWYG DRVKYLGPFSGEPPSYLTGE
Sbjct  15   GKAVKISPAASEVLGSGRVTMRKTVAKPKG-PSGSPWYGSDRVKYLGPFSGEPPSYLTGE  73

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPG+YGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPELL+RNGVKFG+AVW
Sbjct  74   FPGNYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPELLARNGVKFGKAVW  131



>ref|XP_008371583.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Malus domestica]
 ref|XP_008356023.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Malus domestica]
 ref|XP_008364186.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Malus domestica]
Length=291

 Score =   209 bits (533),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 107/118 (91%), Gaps = 2/118 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAV++SP   E+ GN + +MRKTA   K VSSGSPWYGPDRVKYLGPFSGEPPSYL GE
Sbjct  41   GKAVQLSPGATELFGNGRVSMRKTA--TKQVSSGSPWYGPDRVKYLGPFSGEPPSYLKGE  98

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  99   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  156



>ref|XP_006415534.1| hypothetical protein EUTSA_v10008479mg [Eutrema salsugineum]
 ref|XP_006415536.1| hypothetical protein EUTSA_v10008481mg [Eutrema salsugineum]
 gb|ESQ33887.1| hypothetical protein EUTSA_v10008479mg [Eutrema salsugineum]
 gb|ESQ33889.1| hypothetical protein EUTSA_v10008481mg [Eutrema salsugineum]
Length=267

 Score =   209 bits (531),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 100/118 (85%), Positives = 107/118 (91%), Gaps = 1/118 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SP+  E+ G+ + TMRKT  KPK   SGSPWYG DRVKYLGPFSGEPPSYLTGE
Sbjct  15   GKAVKISPAASEVLGSGRVTMRKTVAKPKG-PSGSPWYGSDRVKYLGPFSGEPPSYLTGE  73

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  74   FPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVW  131



>ref|XP_009389379.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Musa acuminata subsp. malaccensis]
Length=267

 Score =   209 bits (531),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 99/119 (83%), Positives = 107/119 (90%), Gaps = 1/119 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVS-SGSPWYGPDRVKYLGPFSGEPPSYLTG  278
            GKAVK++PS  ++ G  + TMRK+  K KP + SGSPWYGPDRVKYLGPFSGEPPSYLTG
Sbjct  14   GKAVKLAPSASDVLGEGRVTMRKSTAKAKPAAASGSPWYGPDRVKYLGPFSGEPPSYLTG  73

Query  279  EFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            EFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  74   EFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132



>ref|XP_007211864.1| hypothetical protein PRUPE_ppa010081mg [Prunus persica]
 ref|XP_008225346.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Prunus mume]
 gb|EMJ13063.1| hypothetical protein PRUPE_ppa010081mg [Prunus persica]
Length=265

 Score =   208 bits (530),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 100/118 (85%), Positives = 107/118 (91%), Gaps = 2/118 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAV+++P   E+ GN + +MRKT  K   VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  15   GKAVQLAPGATELFGNGRVSMRKTGAKQ--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVW  130



>ref|XP_007211869.1| hypothetical protein PRUPE_ppa010099mg [Prunus persica]
 ref|XP_008225347.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Prunus 
mume]
 gb|EMJ13068.1| hypothetical protein PRUPE_ppa010099mg [Prunus persica]
Length=264

 Score =   208 bits (530),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 100/118 (85%), Positives = 107/118 (91%), Gaps = 2/118 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAV+++P   E+ GN + +MRKT  K   VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  14   GKAVQLAPGATELFGNGRVSMRKTGAKQ--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  71

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  72   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVW  129



>gb|AFK40204.1| unknown [Lotus japonicus]
Length=202

 Score =   206 bits (525),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 99/118 (84%), Positives = 106/118 (90%), Gaps = 3/118 (3%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+A+K++PS   +    + TMRKT  K KPVSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GQAIKLAPS---VQDTGRITMRKTTTKSKPVSSGSPWYGPDRVKYLGPFSGESPSYLTGE  71

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  72   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVW  129



>gb|ABQ32304.1| chloroplast light-harvesting chlorophyll a/b-binding protein 
[Artemisia annua]
Length=254

 Score =   208 bits (529),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 99/118 (84%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK +PS  E+ GN + +MRKTA   K   SGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  2    GQAVKAAPSNSELLGNGRVSMRKTAAPKKVAPSGSPWYGPDRVKYLGPFSGEAPSYLTGE  61

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  62   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVW  119



>gb|AEQ67395.1| chloroplast chlorophyll A/B binding protein [Canarium album]
Length=264

 Score =   208 bits (530),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 105/118 (89%), Gaps = 3/118 (3%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SPS PE+ GN +  MRKT  KP    SGSPWYGPDRVKYLGP SGEPPSYLTGE
Sbjct  15   GKAVKLSPSAPELMGNGRVNMRKTFNKPP---SGSPWYGPDRVKYLGPLSGEPPSYLTGE  71

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  72   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  129



>emb|CDP06328.1| unnamed protein product [Coffea canephora]
Length=264

 Score =   208 bits (529),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 98/118 (83%), Positives = 108/118 (92%), Gaps = 3/118 (3%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK++PS PE+ GN + +M++T+   +P  SGSPWYGPDRVKYLGPFSG+PPSYLTGE
Sbjct  15   GKAVKLNPSAPELMGNGRISMKRTS---RPAPSGSPWYGPDRVKYLGPFSGDPPSYLTGE  71

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  72   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLSRNGVKFGEAVW  129



>ref|XP_003548106.1| PREDICTED: chlorophyll a/b-binding protein precursor isoform 
1 [Glycine max]
 gb|KHN41288.1| Chlorophyll a-b binding protein 21, chloroplastic [Glycine soja]
Length=264

 Score =   208 bits (529),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 110/118 (93%), Gaps = 3/118 (3%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+A+K++PSTP++ G  + +MRKTA K   VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  15   GQAIKLAPSTPQL-GVGRVSMRKTASKT--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  71

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  72   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVW  129



>ref|XP_003548104.1| PREDICTED: chlorophyll a-b binding protein 21, chloroplastic-like 
[Glycine max]
Length=264

 Score =   208 bits (529),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 110/118 (93%), Gaps = 3/118 (3%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+A+K++PSTP++ G  + +MRKTA K   V+SGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  15   GQAIKLAPSTPQL-GVGRVSMRKTASKT--VTSGSPWYGPDRVKYLGPFSGEPPSYLTGE  71

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  72   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  129



>ref|XP_010666522.1| PREDICTED: uncharacterized protein LOC104883672 [Beta vulgaris 
subsp. vulgaris]
Length=624

 Score =   217 bits (553),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAV + P+  EI G  + TMRKTAGKPK VSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  372  GKAVNLGPNASEILGEGRITMRKTAGKPKQVSSGSPWYGPDRVKYLGPFSGEAPSYLTGE  431

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  432  FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  489


 Score =   207 bits (526),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 101/119 (85%), Positives = 105/119 (88%), Gaps = 1/119 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPV-SSGSPWYGPDRVKYLGPFSGEPPSYLTG  278
            GKAVK+ P+  EI G  + TMRKT GK KP  SS SPWYGPDRVKYLGPFSGE PSYLTG
Sbjct  15   GKAVKLGPTAWEILGEGRVTMRKTGGKTKPAASSSSPWYGPDRVKYLGPFSGEAPSYLTG  74

Query  279  EFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            EFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  75   EFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  133



>gb|AGV54498.1| LHCII type I chlorophyll a/b-binding protein [Phaseolus vulgaris]
Length=264

 Score =   208 bits (529),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 109/118 (92%), Gaps = 3/118 (3%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+A+K+SPSTP+++   + +MRKTA K   VSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GQAIKLSPSTPDLS-TGRISMRKTASKS--VSSGSPWYGPDRVKYLGPFSGEAPSYLTGE  71

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  72   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  129



>ref|XP_011045093.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Populus euphratica]
Length=263

 Score =   208 bits (529),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 108/118 (92%), Gaps = 4/118 (3%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK++P + EI GN + +MRKT    KPV SGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  15   GKAVKLNPFS-EIMGNGRISMRKTT---KPVPSGSPWYGPDRVKYLGPFSGEPPSYLTGE  70

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  71   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  128



>gb|KJB57287.1| hypothetical protein B456_009G156900 [Gossypium raimondii]
Length=265

 Score =   208 bits (529),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 100/118 (85%), Positives = 106/118 (90%), Gaps = 2/118 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SPS P+I GN + +MRKTA K  P  SGSPWYGPDRV YLGP SGEPPSYLTGE
Sbjct  15   GKAVKLSPSAPKIQGNGRVSMRKTATKAAP--SGSPWYGPDRVLYLGPLSGEPPSYLTGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   FPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130



>emb|CDP06329.1| unnamed protein product [Coffea canephora]
Length=264

 Score =   207 bits (528),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 98/118 (83%), Positives = 108/118 (92%), Gaps = 3/118 (3%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK++PS PE+ GN + +M++T+   +P  SGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  15   GKAVKLNPSAPELMGNGRISMKRTS---RPSPSGSPWYGPDRVKYLGPFSGEPPSYLTGE  71

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELLSRNGV+FGEAVW
Sbjct  72   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLSRNGVQFGEAVW  129



>gb|ACO51067.1| chloroplast chlorophyll A-B binding protein [Gossypium hirsutum]
Length=264

 Score =   207 bits (528),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 105/118 (89%), Gaps = 3/118 (3%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK SPSTPEI G  + +MRKT    KPV SGSPWYGPDRV YLGP SGEPPSYLTGE
Sbjct  15   GKAVKFSPSTPEIQGTGRVSMRKTT---KPVPSGSPWYGPDRVLYLGPLSGEPPSYLTGE  71

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  72   FPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  129



>ref|XP_010538237.1| PREDICTED: chlorophyll a-b binding protein 1, chloroplastic-like 
[Tarenaya hassleriana]
Length=267

 Score =   207 bits (528),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 100/118 (85%), Positives = 106/118 (90%), Gaps = 1/118 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SP+  EI G A+ TMRK+  KP    SGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  15   GKAVKLSPTASEILGTARVTMRKSTAKPTG-PSGSPWYGPDRVKYLGPFSGEPPSYLTGE  73

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  74   FPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  131



>ref|XP_007158464.1| hypothetical protein PHAVU_002G154500g [Phaseolus vulgaris]
 ref|XP_007158466.1| hypothetical protein PHAVU_002G154700g [Phaseolus vulgaris]
 gb|ESW30458.1| hypothetical protein PHAVU_002G154500g [Phaseolus vulgaris]
 gb|ESW30460.1| hypothetical protein PHAVU_002G154700g [Phaseolus vulgaris]
Length=264

 Score =   207 bits (528),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 109/118 (92%), Gaps = 3/118 (3%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+A+K+SPSTP+++   + +MRKTA K   VSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GQAIKLSPSTPDLS-TGRISMRKTASKS--VSSGSPWYGPDRVKYLGPFSGEAPSYLTGE  71

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  72   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  129



>ref|XP_006365573.1| PREDICTED: chlorophyll a-b binding protein 1B, chloroplastic-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006365574.1| PREDICTED: chlorophyll a-b binding protein 1B, chloroplastic-like 
isoform X2 [Solanum tuberosum]
Length=265

 Score =   207 bits (528),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 100/118 (85%), Positives = 104/118 (88%), Gaps = 2/118 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK+SPS  EITGN + TMRK   K  P  S SPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GQAVKLSPSASEITGNGRITMRKAVAKSAP--SSSPWYGPDRVKYLGPFSGESPSYLTGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130



>ref|XP_006365560.1| PREDICTED: chlorophyll a-b binding protein 1B, chloroplastic-like 
[Solanum tuberosum]
Length=265

 Score =   207 bits (528),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 100/118 (85%), Positives = 104/118 (88%), Gaps = 2/118 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK+SPS  EITGN + TMRK   K  P  S SPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GQAVKLSPSASEITGNGRITMRKAVAKSAP--SSSPWYGPDRVKYLGPFSGESPSYLTGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130



>gb|AAA18529.1| chlorophyll A/B binding protein [Gossypium hirsutum]
Length=264

 Score =   207 bits (528),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 105/118 (89%), Gaps = 3/118 (3%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK SPSTPEI G  + +MRKT    KPV SGSPWYGPDRV YLGP SGEPPSYLTGE
Sbjct  15   GKAVKFSPSTPEIQGTGRVSMRKTT---KPVPSGSPWYGPDRVLYLGPLSGEPPSYLTGE  71

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  72   FPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  129



>gb|AGU28449.1| chlorophyll A/B binding protein 1, partial [Sinapis alba]
Length=193

 Score =   205 bits (521),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 98/118 (83%), Positives = 106/118 (90%), Gaps = 1/118 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SP+  E+ G+ + TMRKT  KPK   SGSPWYG +RVKYLGPFSGEPPSYLTGE
Sbjct  15   GKAVKISPAASEVLGSGRVTMRKTVAKPKG-PSGSPWYGSERVKYLGPFSGEPPSYLTGE  73

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  74   FPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  131



>gb|AAA80591.1| chlorophyll a/b binding protein [Solanum tuberosum]
Length=265

 Score =   207 bits (528),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 100/118 (85%), Positives = 104/118 (88%), Gaps = 2/118 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK+SPS  EI+GN + TMRK   K  P  S SPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GQAVKLSPSASEISGNGRITMRKAVAKSAP--SSSPWYGPDRVKYLGPFSGESPSYLTGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLSRNGVKFGEAVW  130



>ref|XP_002890838.1| hypothetical protein ARALYDRAFT_473204 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67097.1| hypothetical protein ARALYDRAFT_473204 [Arabidopsis lyrata subsp. 
lyrata]
Length=262

 Score =   207 bits (527),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 100/118 (85%), Positives = 107/118 (91%), Gaps = 1/118 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SP+  E+ G+ + TMRKT  KPK   SGSPWYG DRVKYLGPFSGEPPSYLTGE
Sbjct  10   GKAVKLSPAASEVLGSGRVTMRKTTAKPKG-PSGSPWYGSDRVKYLGPFSGEPPSYLTGE  68

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  69   FPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVW  126



>gb|AAA80592.1| chlorophyll a/b binding protein [Solanum tuberosum]
Length=265

 Score =   207 bits (528),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 100/118 (85%), Positives = 104/118 (88%), Gaps = 2/118 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK+SPS  EITGN + TMRK   K  P  S SPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GQAVKLSPSASEITGNGRITMRKAVAKSAP--SSSPWYGPDRVKYLGPFSGESPSYLTGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130



>gb|ABN49454.2| chloroplast chlorophyll a/b binding protein [Pisum sativum]
Length=266

 Score =   207 bits (527),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 108/118 (92%), Gaps = 1/118 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GK VK++PS+ E+ G A+FTMRK+A   K  SSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKPVKLNPSSQEL-GGARFTMRKSATTKKVASSGSPWYGPDRVKYLGPFSGESPSYLTGE  73

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETF+KNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  74   FPGDYGWDTAGLSADPETFSKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  131



>gb|AAW31511.1| light-harvesting chlorophyll-a/b binding protein Lhcb1 [Pisum 
sativum]
Length=266

 Score =   207 bits (527),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 108/118 (92%), Gaps = 1/118 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GK VK++PS+ E+ G A+FTMRK+A   K  SSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKPVKLNPSSQEL-GGARFTMRKSATTKKVASSGSPWYGPDRVKYLGPFSGESPSYLTGE  73

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETF+KNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  74   FPGDYGWDTAGLSADPETFSKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  131



>gb|KJB69716.1| hypothetical protein B456_011G041600 [Gossypium raimondii]
Length=264

 Score =   207 bits (527),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 105/118 (89%), Gaps = 3/118 (3%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK SPSTPEI G  + +MRKT    KPV SGSPWYGPDRV YLGP SGEPPSYLTGE
Sbjct  15   GKAVKFSPSTPEIRGTGRVSMRKTT---KPVPSGSPWYGPDRVLYLGPLSGEPPSYLTGE  71

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  72   FPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  129



>ref|XP_007151979.1| hypothetical protein PHAVU_004G091600g [Phaseolus vulgaris]
 gb|ESW23973.1| hypothetical protein PHAVU_004G091600g [Phaseolus vulgaris]
Length=264

 Score =   207 bits (527),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 100/118 (85%), Positives = 110/118 (93%), Gaps = 3/118 (3%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+A+K+SP+TP+I+G  + +MRKTA K   VSSGSPWYGPDRVKYLGPFSGE PSYLTG+
Sbjct  15   GQAIKLSPATPDISGG-RISMRKTASKS--VSSGSPWYGPDRVKYLGPFSGEAPSYLTGQ  71

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  72   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVW  129



>ref|XP_009598575.1| PREDICTED: chlorophyll a-b binding protein 21, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=265

 Score =   207 bits (527),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 100/118 (85%), Positives = 106/118 (90%), Gaps = 2/118 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK+SPS  EITG  + +MRKT  KP  V+S SPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GQAVKLSPSASEITGYGRVSMRKTVAKP--VASSSPWYGPDRVKYLGPFSGESPSYLTGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130



>gb|AGV54521.1| LHCII type I chlorophyll a/b-binding protein [Phaseolus vulgaris]
Length=264

 Score =   207 bits (527),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 109/118 (92%), Gaps = 3/118 (3%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+A+K+SPSTP+++   + +MRKTA K   VSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GQAIKLSPSTPDLS-TGRISMRKTASKS--VSSGSPWYGPDRVKYLGPFSGEAPSYLTGE  71

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  72   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  129



>gb|ACA52202.1| chloroplast chlorophyll A/B-binding protein, partial [Oenothera 
grandiflora]
Length=118

 Score =   202 bits (514),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 106/118 (90%), Gaps = 4/118 (3%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKP-VSSGSPWYGPDRVKYLGPFSGEPPSYLTG  278
            GKAVK+SP   E+      TMRKTAGK KP VSSGSPWYGPDRVKYLGPFSGE PSYLTG
Sbjct  4    GKAVKLSP---EVLTTGGITMRKTAGKAKPAVSSGSPWYGPDRVKYLGPFSGEAPSYLTG  60

Query  279  EFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAV  452
            EFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAV
Sbjct  61   EFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAV  118



>gb|AAB87573.1| chlorophyll a/b binding protein of LHCII type I precursor [Panax 
ginseng]
Length=266

 Score =   207 bits (526),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 100/118 (85%), Positives = 107/118 (91%), Gaps = 1/118 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G AVKV+PS+ E+ G+ + +MRKT  KP   SSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GMAVKVAPSSSELFGSGRISMRKTGKKPA-ASSGSPWYGPDRVKYLGPFSGEAPSYLTGE  73

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  74   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVW  131



>ref|XP_002283566.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Vitis 
vinifera]
 emb|CAN74831.1| hypothetical protein VITISV_023674 [Vitis vinifera]
Length=270

 Score =   207 bits (526),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 99/120 (83%), Positives = 106/120 (88%), Gaps = 2/120 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITG--NAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  275
            G+AVK++P+  E+      + TMRK+  K K VSSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  16   GQAVKLAPNVTELLAGDQGRVTMRKSVAKSKAVSSGSPWYGPDRVKYLGPFSGEPPSYLT  75

Query  276  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  76   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLSRNGVKFGEAVW  135



>gb|AAF89206.1|AF279249_1 LHCII type I chlorophyll a/b-binding protein [Vigna radiata]
Length=264

 Score =   207 bits (526),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 100/118 (85%), Positives = 109/118 (92%), Gaps = 3/118 (3%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+A+K+SPSTPE++G  + +MRK A K   VSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GQAIKLSPSTPELSGG-RISMRKAASKS--VSSGSPWYGPDRVKYLGPFSGEAPSYLTGE  71

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  72   FPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVW  129



>gb|EYU19613.1| hypothetical protein MIMGU_mgv1a011885mg [Erythranthe guttata]
Length=267

 Score =   207 bits (526),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 101/120 (84%), Positives = 109/120 (91%), Gaps = 5/120 (4%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNA--KFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  275
            G+AVK++P   EIT N+  + +MRKTA KPK VSS SPWYGPDRVKYLGPFSGE PSYLT
Sbjct  16   GQAVKIAP---EITANSVGRVSMRKTAAKPKQVSSSSPWYGPDRVKYLGPFSGEAPSYLT  72

Query  276  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            GEFPGDYGWDTAGLSADPETF+KNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFSKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVW  132



>sp|P04779.1|CB21_PETSP RecName: Full=Chlorophyll a-b binding protein 13, chloroplastic; 
AltName: Full=LHCII type I CAB-13; Short=LHCP; Flags: Precursor 
[Petunia sp.]
 emb|CAA26210.1| unnamed protein product [Petunia sp.]
Length=266

 Score =   207 bits (526),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 104/118 (88%), Gaps = 1/118 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAV V PS+ EIT N K TMRKT  K KPVSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKAVNV-PSSSEITRNGKVTMRKTVTKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLTGE  73

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADP TFAKNR+LEVIH RW MLGALGCVFPEL +RNGVKFGEAVW
Sbjct  74   FPGDYGWDTAGLSADPATFAKNRKLEVIHCRWTMLGALGCVFPELFARNGVKFGEAVW  131



>ref|XP_006305533.1| hypothetical protein CARUB_v10010022mg [Capsella rubella]
 ref|XP_006305913.1| hypothetical protein CARUB_v10011129mg [Capsella rubella]
 gb|EOA38431.1| hypothetical protein CARUB_v10010022mg [Capsella rubella]
 gb|EOA38811.1| hypothetical protein CARUB_v10011129mg [Capsella rubella]
Length=267

 Score =   207 bits (526),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 99/118 (84%), Positives = 107/118 (91%), Gaps = 1/118 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAV +SP++ E+ G+ + TMRKT  KPK   SGSPWYG DRVKYLGPFSGEPPSYLTGE
Sbjct  15   GKAVNLSPASSEVLGSGRVTMRKTVAKPKG-PSGSPWYGSDRVKYLGPFSGEPPSYLTGE  73

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  74   FPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVW  131



>ref|XP_006304391.1| hypothetical protein CARUB_v10010908mg [Capsella rubella]
 gb|EOA37289.1| hypothetical protein CARUB_v10010908mg [Capsella rubella]
Length=267

 Score =   207 bits (526),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 99/118 (84%), Positives = 108/118 (92%), Gaps = 1/118 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SP++ E+ G+ + TMRKT  KPK   SGSPWYG +RVKYLGPFSGEPPSYLTGE
Sbjct  15   GKAVKLSPASSEVLGSGRVTMRKTVAKPKG-PSGSPWYGSERVKYLGPFSGEPPSYLTGE  73

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  74   FPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVW  131



>prf||1204205B protein 1B,chlorophyll binding
Length=265

 Score =   206 bits (525),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 99/118 (84%), Positives = 104/118 (88%), Gaps = 2/118 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK+SPS  EI+GN + TMRK   K  P  S SPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GQAVKLSPSASEISGNGRITMRKAVAKSAP--SSSPWYGPDRVKYLGPFSGESPSYLTGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130



>gb|AAB61236.1| chlorophyll a/b-binding protein [Mesembryanthemum crystallinum]
Length=267

 Score =   206 bits (525),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 98/118 (83%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SP+  E  G  + TMRK AGK K  +  SPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKAVKLSPTASETLGEGRITMRKAAGKSKVATIDSPWYGPDRVKYLGPFSGESPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132



>gb|KDP37944.1| hypothetical protein JCGZ_04587 [Jatropha curcas]
Length=260

 Score =   206 bits (525),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 106/118 (90%), Gaps = 2/118 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+ PS PE+ GN + TMRKTA K   VSSGSPWYGPD VK LGPFSGEPPSYLTGE
Sbjct  10   GKAVKLGPSPPELMGNGRVTMRKTASKN--VSSGSPWYGPDGVKNLGPFSGEPPSYLTGE  67

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  68   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  125



>gb|KDO36894.1| hypothetical protein CISIN_1g044971mg, partial [Citrus sinensis]
Length=153

 Score =   202 bits (515),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 98/118 (83%), Positives = 105/118 (89%), Gaps = 2/118 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAV ++PS  E++   + +MRKTA   K VSSGSPWYG DRVKYLGPFSGEPPSYLTGE
Sbjct  14   GKAVNLAPSGNELSNGGRISMRKTA--SKSVSSGSPWYGLDRVKYLGPFSGEPPSYLTGE  71

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  72   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  129



>sp|P07371.1|CB22_PEA RecName: Full=Chlorophyll a-b binding protein AB80, chloroplastic; 
AltName: Full=LHCII type I CAB-AB80; Short=LHCP; Flags: 
Precursor [Pisum sativum]
 gb|AAA63413.1| cab precursor [Pisum sativum]
 gb|AAA33651.1| polypeptide 15 precursor [Pisum sativum]
 prf||1006296A protein,chlorophyll a/b binding
Length=269

 Score =   206 bits (525),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 100/118 (85%), Positives = 108/118 (92%), Gaps = 1/118 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GK +K++PS+ E+ G A+FTMRK+A   K  SSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  18   GKQLKLNPSSQEL-GAARFTMRKSATTKKVASSGSPWYGPDRVKYLGPFSGESPSYLTGE  76

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETF+KNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  77   FPGDYGWDTAGLSADPETFSKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  134



>ref|XP_004233101.1| PREDICTED: chlorophyll a-b binding protein 1B, chloroplastic-like 
[Solanum lycopersicum]
Length=265

 Score =   206 bits (525),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 99/118 (84%), Positives = 104/118 (88%), Gaps = 2/118 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK+SPS  EI+GN + TMRK   K  P  S SPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GQAVKLSPSASEISGNGRITMRKAVAKSAP--SSSPWYGPDRVKYLGPFSGESPSYLTGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130



>ref|XP_004233096.1| PREDICTED: chlorophyll a-b binding protein 1C, chloroplastic 
[Solanum lycopersicum]
 ref|XP_004233099.1| PREDICTED: chlorophyll a-b binding protein 1C, chloroplastic 
[Solanum lycopersicum]
 ref|XP_004233100.1| PREDICTED: chlorophyll a-b binding protein 1C, chloroplastic 
[Solanum lycopersicum]
 ref|XP_010316910.1| PREDICTED: chlorophyll a-b binding protein 1C, chloroplastic 
[Solanum lycopersicum]
 ref|XP_010316913.1| PREDICTED: chlorophyll a-b binding protein 1C, chloroplastic 
[Solanum lycopersicum]
 sp|P07370.1|CB2B_SOLLC RecName: Full=Chlorophyll a-b binding protein 1B, chloroplastic; 
AltName: Full=LHCII type I CAB-1B; Short=LHCP; Flags: Precursor 
[Solanum lycopersicum]
 gb|AAA34147.1| chlorophyll a/b-binding protein Cab-1B [Solanum lycopersicum]
Length=265

 Score =   206 bits (525),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 99/118 (84%), Positives = 104/118 (88%), Gaps = 2/118 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK+SPS  EI+GN + TMRK   K  P  S SPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GQAVKLSPSASEISGNGRITMRKAVAKSAP--SSSPWYGPDRVKYLGPFSGESPSYLTGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130



>ref|XP_006365572.1| PREDICTED: chlorophyll a-b binding protein 1B, chloroplastic-like 
[Solanum tuberosum]
 gb|AAA80589.1| chlorophyll a/b binding protein [Solanum tuberosum]
Length=265

 Score =   206 bits (525),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 99/118 (84%), Positives = 104/118 (88%), Gaps = 2/118 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK+SPS  EI+GN + TMRK   K  P  S SPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GQAVKLSPSASEISGNGRITMRKAVAKSAP--SSSPWYGPDRVKYLGPFSGESPSYLTGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130



>gb|AES74698.2| light-harvesting complex I chlorophyll A/B-binding protein [Medicago 
truncatula]
Length=265

 Score =   206 bits (525),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 107/118 (91%), Gaps = 2/118 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKA+K+SPSTP++    + TMRKT  K K V SGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKAIKLSPSTPDLV-MGRITMRKTTNK-KNVPSGSPWYGPDRVKYLGPFSGEAPSYLTGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  130



>ref|XP_010666512.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic-like 
[Beta vulgaris subsp. vulgaris]
Length=268

 Score =   206 bits (525),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 101/119 (85%), Positives = 105/119 (88%), Gaps = 1/119 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPV-SSGSPWYGPDRVKYLGPFSGEPPSYLTG  278
            GKAVK+ P+  EI G  + TMRKT GK KP  SS SPWYGPDRVKYLGPFSGE PSYLTG
Sbjct  15   GKAVKLGPTAWEILGEGRVTMRKTGGKTKPAASSSSPWYGPDRVKYLGPFSGEAPSYLTG  74

Query  279  EFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            EFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  75   EFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  133



>ref|XP_007151996.1| hypothetical protein PHAVU_004G093000g [Phaseolus vulgaris]
 gb|ESW23990.1| hypothetical protein PHAVU_004G093000g [Phaseolus vulgaris]
Length=264

 Score =   206 bits (524),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 99/118 (84%), Positives = 110/118 (93%), Gaps = 3/118 (3%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+A+K+SP+TP+++G  + +MRKTA K   VSSGSPWYGPDRVKYLGPFSGE PSYLTG+
Sbjct  15   GQAIKLSPATPDLSGG-RISMRKTASKS--VSSGSPWYGPDRVKYLGPFSGEAPSYLTGQ  71

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  72   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVW  129



>ref|XP_006368026.1| PREDICTED: chlorophyll a-b binding protein 1B, chloroplastic-like 
[Solanum tuberosum]
Length=265

 Score =   206 bits (524),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 99/118 (84%), Positives = 104/118 (88%), Gaps = 2/118 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK+SPS  EI+GN + TMRK   K  P  S SPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GQAVKLSPSASEISGNGRITMRKAVSKSAP--SSSPWYGPDRVKYLGPFSGESPSYLTGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130



>ref|XP_004961193.1| PREDICTED: chlorophyll a-b binding protein M9, chloroplastic-like 
[Setaria italica]
Length=264

 Score =   206 bits (524),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 105/118 (89%), Gaps = 3/118 (3%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAV V  S   + G A+ TMRKTA KPKP +SGSPWYGPDRV YLGP SGEPPSYLTGE
Sbjct  15   GKAVNVPSS---LFGEARVTMRKTAAKPKPAASGSPWYGPDRVLYLGPLSGEPPSYLTGE  71

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  72   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVW  129



>ref|XP_009416547.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Musa acuminata subsp. malaccensis]
 gb|ABF69952.1| chlorophyll A-B binding protein (CAB), putative [Musa acuminata]
Length=265

 Score =   206 bits (524),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 99/118 (84%), Positives = 104/118 (88%), Gaps = 1/118 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK++PS   + G  + TMRK  GKP   SSGSPWYGPDRVKYLGP SGEPPSYLTGE
Sbjct  14   GKAVKLAPSASGVLGQGRVTMRKAGGKPA-ASSGSPWYGPDRVKYLGPLSGEPPSYLTGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130



>ref|XP_010549470.1| PREDICTED: chlorophyll a-b binding protein 1, chloroplastic isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010549471.1| PREDICTED: chlorophyll a-b binding protein 1, chloroplastic isoform 
X2 [Tarenaya hassleriana]
Length=268

 Score =   206 bits (524),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 100/118 (85%), Positives = 105/118 (89%), Gaps = 2/118 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SP+  EI G A+ TMRK A    P  SGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  17   GKAVKLSPAASEILGTARVTMRKAAKPSGP--SGSPWYGPDRVKYLGPFSGEPPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  75   FPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132



>gb|ABW70800.1| chloroplast light harvesting chlorophyll a/b binding protein 
[Populus euphratica]
Length=263

 Score =   206 bits (524),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 107/118 (91%), Gaps = 4/118 (3%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK++P + EI GN   +MRKT    KPV SGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  15   GKAVKLNPFS-EIMGNGCISMRKTT---KPVPSGSPWYGPDRVKYLGPFSGEPPSYLTGE  70

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  71   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  128



>ref|XP_009377327.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Pyrus x bretschneideri]
Length=267

 Score =   206 bits (524),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 96/118 (81%), Positives = 104/118 (88%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK+S ST  + G  + TM KTA K K VS+G  WYGPDRV+YLGPFSG+ PSYLTGE
Sbjct  15   GQAVKLSQSTSTLLGEGRITMHKTAAKSKNVSAGREWYGPDRVRYLGPFSGQSPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGC+FPELLSRNGVKFGEAVW
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCIFPELLSRNGVKFGEAVW  132



>ref|XP_010231410.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Brachypodium 
distachyon]
Length=266

 Score =   206 bits (524),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 106/118 (90%), Gaps = 1/118 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK  PS+  + G A+ TMRKTA K KPVSSGSPWYG DRV YLGP SGEPPSYLTGE
Sbjct  15   GKAVKNLPSS-ALFGEARVTMRKTAAKAKPVSSGSPWYGSDRVLYLGPLSGEPPSYLTGE  73

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELE+IHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  74   FPGDYGWDTAGLSADPETFAKNRELELIHSRWAMLGALGCVFPELLARNGVKFGEAVW  131



>gb|AFI60242.1| light harvesting chlorophyll a/b binding protein, partial [Panicum 
virgatum]
Length=260

 Score =   206 bits (523),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 105/118 (89%), Gaps = 3/118 (3%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAV V  S   + G A+ TMRKTA KPKP +SGSPWYGPDRV YLGP SGEPPSYLTGE
Sbjct  11   GKAVNVPSS---LFGEARVTMRKTAAKPKPAASGSPWYGPDRVLYLGPLSGEPPSYLTGE  67

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  68   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVW  125



>ref|XP_002893588.1| hypothetical protein ARALYDRAFT_473203 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69847.1| hypothetical protein ARALYDRAFT_473203 [Arabidopsis lyrata subsp. 
lyrata]
Length=262

 Score =   206 bits (523),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 99/118 (84%), Positives = 106/118 (90%), Gaps = 1/118 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAV +SP+  E+ G+ + TMRKT  KPK   SGSPWYG DRVKYLGPFSGEPPSYLTGE
Sbjct  10   GKAVNLSPAASEVLGSGRVTMRKTVAKPKG-PSGSPWYGSDRVKYLGPFSGEPPSYLTGE  68

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  69   FPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVW  126



>gb|KCW73782.1| hypothetical protein EUGRSUZ_E02381 [Eucalyptus grandis]
Length=252

 Score =   205 bits (522),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 100/115 (87%), Positives = 105/115 (91%), Gaps = 2/115 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAV++SPSTPE+ G  + TMRKT    K VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  15   GKAVQLSPSTPELFGKGRVTMRKTV--TKQVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGE  446
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGE
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGE  127



>gb|EYU19649.1| hypothetical protein MIMGU_mgv1a011927mg [Erythranthe guttata]
Length=266

 Score =   206 bits (523),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 99/118 (84%), Positives = 104/118 (88%), Gaps = 1/118 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AV +SP      G  + +MRKTA KPKP SS SPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GQAVNLSPEISTANG-GRISMRKTAAKPKPASSSSPWYGPDRVKYLGPFSGEAPSYLTGE  73

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  74   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVW  131



>gb|AAZ79657.1| putative chlorophyll a/b-binding protein [Fagus sylvatica]
Length=260

 Score =   206 bits (523),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 109/118 (92%), Gaps = 3/118 (3%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK++PSTPE+    + +MRK+A +   VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  12   GKAVKLAPSTPELN-VGRVSMRKSASRN--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  68

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  69   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVW  126



>dbj|BAA24493.1| chlorophyll a/b-binding protein [Fagus crenata]
Length=264

 Score =   206 bits (523),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 109/118 (92%), Gaps = 3/118 (3%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK++PSTPE+    + +MRK+A +   VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  15   GKAVKLAPSTPELN-VGRVSMRKSASRN--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  71

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  72   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVW  129



>ref|NP_174286.1| chlorophyll A/B binding protein 1 [Arabidopsis thaliana]
 sp|P04778.1|CB1C_ARATH RecName: Full=Chlorophyll a-b binding protein 1, chloroplastic; 
AltName: Full=Chlorophyll a-b protein 140; Short=CAB-140; 
AltName: Full=LHCII type I CAB-1; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAG10603.1|AC008030_3 Putative chlorophyll a/b-binding protein [Arabidopsis thaliana]
 gb|AAL16289.1|AF428359_1 At1g29930/F1N18_23 [Arabidopsis thaliana]
 emb|CAA27543.1| chlorophyll a/b binding protein (LHCP AB 140) [Arabidopsis thaliana]
 gb|AAK74031.1| At1g29930/F1N18_23 [Arabidopsis thaliana]
 gb|AAK93612.1| putative photosystem II type I chlorophyll a/b binding protein 
[Arabidopsis thaliana]
 gb|AAL25594.1| At1g29930/F1N18_23 [Arabidopsis thaliana]
 gb|AAM14108.1| putative chlorophyll a/b-binding protein [Arabidopsis thaliana]
 gb|AEE31151.1| chlorophyll a-b binding protein 1 [Arabidopsis thaliana]
Length=267

 Score =   206 bits (523),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 99/118 (84%), Positives = 106/118 (90%), Gaps = 1/118 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SP+  E+ G+ + TMRKT  KPK   SGSPWYG DRVKYLGPFSGE PSYLTGE
Sbjct  15   GKAVKLSPAASEVLGSGRVTMRKTVAKPKG-PSGSPWYGSDRVKYLGPFSGESPSYLTGE  73

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  74   FPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVW  131



>emb|CDP06330.1| unnamed protein product [Coffea canephora]
Length=264

 Score =   206 bits (523),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 97/118 (82%), Positives = 107/118 (91%), Gaps = 3/118 (3%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK++PS PE+ GN + +M++T+   +P  SGSPWYG DRVKYLGPFSGEPPSYLTGE
Sbjct  15   GKAVKLNPSAPELMGNGRISMKRTS---RPAPSGSPWYGRDRVKYLGPFSGEPPSYLTGE  71

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELLSRNGV+FGEAVW
Sbjct  72   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLSRNGVQFGEAVW  129



>ref|XP_010478366.1| PREDICTED: chlorophyll a-b binding protein 1, chloroplastic-like 
[Camelina sativa]
Length=267

 Score =   206 bits (523),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 99/118 (84%), Positives = 106/118 (90%), Gaps = 1/118 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SP+  E+ G+ + TMRKT  KPK   SGSPWYG DRVKYLGPFSGE PSYLTGE
Sbjct  15   GKAVKLSPAASEVLGSGRVTMRKTVAKPKG-PSGSPWYGSDRVKYLGPFSGESPSYLTGE  73

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  74   FPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVW  131



>ref|XP_010499509.1| PREDICTED: chlorophyll a-b binding protein 1, chloroplastic [Camelina 
sativa]
 ref|XP_010499510.1| PREDICTED: chlorophyll a-b binding protein 1, chloroplastic [Camelina 
sativa]
Length=267

 Score =   206 bits (523),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 99/118 (84%), Positives = 106/118 (90%), Gaps = 1/118 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SP+  E+ G+ + TMRKT  KPK   SGSPWYG DRVKYLGPFSGE PSYLTGE
Sbjct  15   GKAVKLSPAASEVLGSGRVTMRKTVAKPKG-PSGSPWYGSDRVKYLGPFSGESPSYLTGE  73

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  74   FPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVW  131



>ref|XP_007025143.1| Chlorophyll a-b binding protein, chloroplastic [Theobroma cacao]
 gb|EOY27765.1| Chlorophyll a-b binding protein, chloroplastic [Theobroma cacao]
Length=264

 Score =   205 bits (522),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 99/118 (84%), Positives = 105/118 (89%), Gaps = 3/118 (3%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SP TPEI GN + +MRKT  +P    SGSPWYGPDRV YLGP SGEPPSYLTGE
Sbjct  15   GKAVKLSPLTPEIQGNGRVSMRKTGTRPP---SGSPWYGPDRVLYLGPLSGEPPSYLTGE  71

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  72   FPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  129



>ref|XP_010460769.1| PREDICTED: chlorophyll a-b binding protein 1, chloroplastic-like 
[Camelina sativa]
Length=267

 Score =   206 bits (523),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 99/118 (84%), Positives = 106/118 (90%), Gaps = 1/118 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SP+  E+ G+ + TMRKT  KPK   SGSPWYG DRVKYLGPFSGE PSYLTGE
Sbjct  15   GKAVKLSPAASEVLGSGRVTMRKTVAKPKG-PSGSPWYGSDRVKYLGPFSGESPSYLTGE  73

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  74   FPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVW  131



>gb|ACR08639.1| chloroplast chlorophyll A/B binding protein [Mangifera indica]
Length=264

 Score =   205 bits (522),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 99/118 (84%), Positives = 106/118 (90%), Gaps = 3/118 (3%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SP+  E+ GN + +MR+TA   KP  SGSPWYGPDRVKYL PFSGEPPSYLTGE
Sbjct  15   GKAVKLSPAPRELMGNGRVSMRRTA---KPTPSGSPWYGPDRVKYLSPFSGEPPSYLTGE  71

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  72   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  129



>emb|CDY66768.1| BnaAnng22920D [Brassica napus]
 emb|CDY43676.1| BnaA04g20150D [Brassica napus]
Length=267

 Score =   205 bits (522),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 99/118 (84%), Positives = 106/118 (90%), Gaps = 1/118 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SPS  E+ G+ + TMRKT  KPK   SGSPWYG +RVKYLGPFSGEPPSYLTGE
Sbjct  15   GKAVKLSPSASEVLGSGRVTMRKTVAKPKG-PSGSPWYGSERVKYLGPFSGEPPSYLTGE  73

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  74   FPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  131



>gb|ACD64978.1| chloroplast chlorophyll a/b-binding protein [Ophiopogon japonicus]
Length=264

 Score =   205 bits (522),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 101/119 (85%), Positives = 107/119 (90%), Gaps = 4/119 (3%)
 Frame = +3

Query  102  GKAVKVSPS-TPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTG  278
            GKAVK++PS   E+ GN + +MRKT    K VSSGSPWYGPDRVKYLGPFSGEPPSYLTG
Sbjct  14   GKAVKLAPSPASELMGNGRISMRKTG---KSVSSGSPWYGPDRVKYLGPFSGEPPSYLTG  70

Query  279  EFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            EFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  71   EFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  129



>ref|XP_010460768.1| PREDICTED: chlorophyll a-b binding protein 2, chloroplastic-like 
[Camelina sativa]
Length=267

 Score =   205 bits (522),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 99/118 (84%), Positives = 106/118 (90%), Gaps = 1/118 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAV +SP+  E+ G+ + TMRKTA KPK   SGSPWYG DRVKYLGPFSGE PSYLTGE
Sbjct  15   GKAVNLSPAASEVLGSGRVTMRKTAAKPKG-PSGSPWYGSDRVKYLGPFSGESPSYLTGE  73

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  74   FPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVW  131



>gb|ACU23974.1| unknown [Glycine max]
Length=264

 Score =   205 bits (522),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 100/118 (85%), Positives = 109/118 (92%), Gaps = 3/118 (3%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+A+K++PSTP++ G  + +MRKTA K   V+SGSPWYGPDRVKYLGPFSGEPPSY TGE
Sbjct  15   GQAIKLAPSTPQL-GVGRVSMRKTASKT--VTSGSPWYGPDRVKYLGPFSGEPPSYRTGE  71

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  72   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  129



>ref|XP_006467509.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like 
[Citrus sinensis]
Length=264

 Score =   205 bits (522),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 99/118 (84%), Positives = 106/118 (90%), Gaps = 2/118 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAV ++PS  E++   + +MRKTA   K VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  14   GKAVNLAPSGNELSNGGRISMRKTA--SKSVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  71

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  72   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  129



>gb|AAA80594.1| chlorophyll a/b binding protein [Solanum tuberosum]
Length=265

 Score =   205 bits (521),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 98/118 (83%), Positives = 103/118 (87%), Gaps = 2/118 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK+SPS  EI+GN + TMRK   K  P  S SPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GQAVKLSPSASEISGNGRITMRKAVAKSAP--SSSPWYGPDRVKYLGPFSGESPSYLTGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGE VW
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEVVW  130



>ref|XP_010926397.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Elaeis guineensis]
Length=264

 Score =   205 bits (521),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 100/118 (85%), Positives = 105/118 (89%), Gaps = 2/118 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK++PS   I GN + TMRKT+ K  P  SGSPWYGPDRVKYLGP SGEPPSYLTGE
Sbjct  14   GKAVKLAPSASPILGNGRVTMRKTSTKRVP--SGSPWYGPDRVKYLGPLSGEPPSYLTGE  71

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  72   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  129



>ref|XP_004293579.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Fragaria 
vesca subsp. vesca]
Length=263

 Score =   205 bits (521),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 100/118 (85%), Positives = 108/118 (92%), Gaps = 4/118 (3%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAV+++P+  E+ G  + +MRKT GK   VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  15   GKAVQLAPT--EVFGTGRISMRKTVGKA--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  70

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  71   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVW  128



>gb|AAO45885.1| chlorophyll a/b-binding protein precursor [Citrus limon]
Length=216

 Score =   203 bits (517),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 98/118 (83%), Positives = 105/118 (89%), Gaps = 2/118 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAV ++PS  E++   + +MRKT    K VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  14   GKAVNLAPSGNELSNGGRISMRKTG--SKSVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  71

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  72   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  129



>gb|ADC35579.1| chloroplast chlorophyll a/b binding protein [Lycoris radiata]
Length=265

 Score =   205 bits (521),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 101/119 (85%), Positives = 106/119 (89%), Gaps = 3/119 (3%)
 Frame = +3

Query  102  GKAVKVSPSTP-EITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTG  278
            GKAVK+ PS   E+ GN + +MRKT  KP  VSSGSPWYG DRVKYLGPFSGEPPSYLTG
Sbjct  14   GKAVKLGPSAASELLGNGRISMRKTIAKP--VSSGSPWYGADRVKYLGPFSGEPPSYLTG  71

Query  279  EFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            EFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  72   EFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130



>ref|XP_009141380.1| PREDICTED: chlorophyll a-b binding protein 1, chloroplastic-like 
[Brassica rapa]
Length=267

 Score =   205 bits (521),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 99/118 (84%), Positives = 106/118 (90%), Gaps = 1/118 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SPS  E+ G+ + TMRKT  KPK   SGSPWYG +RVKYLGPFSGEPPSYLTGE
Sbjct  15   GKAVKLSPSASEVLGSGRVTMRKTHAKPKG-PSGSPWYGSERVKYLGPFSGEPPSYLTGE  73

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  74   FPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  131



>ref|XP_009102798.1| PREDICTED: chlorophyll a-b binding protein 1, chloroplastic [Brassica 
rapa]
 emb|CDY43198.1| BnaA07g07560D [Brassica napus]
Length=267

 Score =   205 bits (521),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 98/118 (83%), Positives = 106/118 (90%), Gaps = 1/118 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SP+  E+ G+ + TMRKT  KPK   SGSPWYG +RVKYLGPFSGEPPSYLTGE
Sbjct  15   GKAVKLSPAASEVLGSGRVTMRKTVAKPKG-PSGSPWYGAERVKYLGPFSGEPPSYLTGE  73

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  74   FPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  131



>gb|KHN28981.1| Chlorophyll a-b binding protein 3, chloroplastic [Glycine soja]
Length=263

 Score =   204 bits (520),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 106/118 (90%), Gaps = 5/118 (4%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+ PS PE+    + +MRKT    K VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  16   GKAVKLGPSAPEV---GRVSMRKTV--TKQVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  70

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  71   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  128



>gb|AEO51755.1| chloroplast chlorophyll A/B binding protein [Dimocarpus longan]
Length=263

 Score =   204 bits (520),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 97/118 (82%), Positives = 106/118 (90%), Gaps = 3/118 (3%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAV+++P+  ++ GN + TMRKT    + VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  14   GKAVQLAPTGNDLMGNGRVTMRKTG---RQVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  70

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWD AGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  71   FPGDYGWDAAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  128



>ref|NP_001241277.1| uncharacterized protein LOC100805310 [Glycine max]
 gb|ACU24438.1| unknown [Glycine max]
Length=263

 Score =   204 bits (520),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 106/118 (90%), Gaps = 5/118 (4%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+ PS PE+    + +MRKT    K VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  16   GKAVKLGPSAPEV---GRVSMRKTV--TKQVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  70

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  71   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  128



>sp|P09756.1|CB23_SOYBN RecName: Full=Chlorophyll a-b binding protein 3, chloroplastic; 
AltName: Full=LHCII type I CAB-3; Short=LHCP; Flags: Precursor 
[Glycine max]
 emb|CAA31419.1| chlorophyll a/b binding preprotein (AA - 32 to 231) [Glycine 
max]
Length=263

 Score =   204 bits (520),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 106/118 (90%), Gaps = 5/118 (4%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+ PS PE+    + +MRKT    K VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  16   GKAVKLGPSAPEV---GRVSMRKTV--TKQVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  70

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  71   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  128



>gb|KFK44818.1| hypothetical protein AALP_AA1G306800 [Arabis alpina]
Length=267

 Score =   204 bits (520),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 98/118 (83%), Positives = 107/118 (91%), Gaps = 1/118 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SP++ E+ G+ + TMRKT  KPK   SGSPWYG DRVKYLGPFSGE PSYLTGE
Sbjct  15   GKAVKLSPASSEVLGSGRVTMRKTVAKPKG-PSGSPWYGSDRVKYLGPFSGESPSYLTGE  73

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPELL++NGVKFGEAVW
Sbjct  74   FPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPELLAKNGVKFGEAVW  131



>emb|CDY35271.1| BnaC03g59520D [Brassica napus]
 emb|CDX90218.1| BnaA08g17660D [Brassica napus]
Length=267

 Score =   204 bits (520),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 98/118 (83%), Positives = 106/118 (90%), Gaps = 1/118 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SP+  E+ G+ + TMRKT  KPK   SGSPWYG +RVKYLGPFSGEPPSYLTGE
Sbjct  15   GKAVKLSPAASEVLGSGRVTMRKTVAKPKG-PSGSPWYGSERVKYLGPFSGEPPSYLTGE  73

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  74   FPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  131



>emb|CDX99866.1| BnaC05g22880D [Brassica napus]
Length=267

 Score =   204 bits (520),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 98/118 (83%), Positives = 106/118 (90%), Gaps = 1/118 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SP+  E+ G+ + TMRKT  KPK   SGSPWYG +RVKYLGPFSGEPPSYLTGE
Sbjct  15   GKAVKLSPAASEVLGSGRVTMRKTVAKPKG-QSGSPWYGFERVKYLGPFSGEPPSYLTGE  73

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            FPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  74   FPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  131



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 566299029105