BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002E16

Length=586
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010244367.1|  PREDICTED: vacuolar protein sorting-associat...    192   1e-57   Nelumbo nucifera [Indian lotus]
ref|XP_010086896.1|  Vacuolar protein sorting-associated protein ...    192   8e-57   
emb|CDP03214.1|  unnamed protein product                                189   1e-56   Coffea canephora [robusta coffee]
ref|XP_009765362.1|  PREDICTED: vacuolar protein sorting-associat...    189   1e-56   Nicotiana sylvestris
ref|XP_009593196.1|  PREDICTED: vacuolar protein sorting-associat...    189   2e-56   Nicotiana tomentosiformis
ref|XP_004239323.1|  PREDICTED: vacuolar protein sorting-associat...    188   4e-56   Solanum lycopersicum
gb|AFK48250.1|  unknown                                                 188   5e-56   Lotus japonicus
ref|XP_010267087.1|  PREDICTED: vacuolar protein sorting-associat...    187   8e-56   Nelumbo nucifera [Indian lotus]
ref|XP_006338191.1|  PREDICTED: vacuolar protein sorting-associat...    187   1e-55   Solanum tuberosum [potatoes]
ref|XP_004503518.1|  PREDICTED: vacuolar protein sorting-associat...    186   2e-55   
gb|AFK45318.1|  unknown                                                 186   4e-55   Lotus japonicus
ref|XP_007152939.1|  hypothetical protein PHAVU_004G173000g             185   7e-55   Phaseolus vulgaris [French bean]
ref|XP_008459153.1|  PREDICTED: vacuolar protein sorting-associat...    185   8e-55   Cucumis melo [Oriental melon]
ref|XP_002275998.1|  PREDICTED: vacuolar protein sorting-associat...    185   9e-55   Vitis vinifera
ref|XP_004141038.1|  PREDICTED: vacuolar protein sorting-associat...    184   1e-54   Cucumis sativus [cucumbers]
ref|XP_010929019.1|  PREDICTED: vacuolar protein sorting-associat...    184   2e-54   Elaeis guineensis
ref|XP_006584796.1|  PREDICTED: vacuolar protein sorting-associat...    183   3e-54   Glycine max [soybeans]
ref|XP_004503516.1|  PREDICTED: vacuolar protein sorting-associat...    183   4e-54   Cicer arietinum [garbanzo]
ref|XP_006451366.1|  hypothetical protein CICLE_v10009534mg             183   5e-54   
ref|XP_007012940.1|  Vacuolar protein sorting-associated protein ...    180   5e-53   
gb|KJB54326.1|  hypothetical protein B456_009G029400                    178   6e-53   Gossypium raimondii
ref|XP_010447884.1|  PREDICTED: vacuolar protein sorting-associat...    180   6e-53   Camelina sativa [gold-of-pleasure]
ref|XP_010433129.1|  PREDICTED: vacuolar protein sorting-associat...    180   8e-53   Camelina sativa [gold-of-pleasure]
ref|XP_006412871.1|  hypothetical protein EUTSA_v10026202mg             180   8e-53   Eutrema salsugineum [saltwater cress]
ref|XP_003525301.1|  PREDICTED: vacuolar protein sorting-associat...    179   1e-52   Glycine max [soybeans]
ref|XP_010438334.1|  PREDICTED: vacuolar protein sorting-associat...    179   2e-52   Camelina sativa [gold-of-pleasure]
ref|XP_004513085.1|  PREDICTED: vacuolar protein sorting-associat...    179   2e-52   Cicer arietinum [garbanzo]
ref|XP_011008899.1|  PREDICTED: vacuolar protein sorting-associat...    178   2e-52   Populus euphratica
gb|KJB54324.1|  hypothetical protein B456_009G029400                    178   3e-52   Gossypium raimondii
ref|XP_009137831.1|  PREDICTED: vacuolar protein sorting-associat...    178   3e-52   Brassica rapa
ref|XP_006371958.1|  hypothetical protein POPTR_0018s06680g             178   4e-52   Populus trichocarpa [western balsam poplar]
ref|XP_006284502.1|  hypothetical protein CARUB_v10005703mg             178   4e-52   
emb|CDY47783.1|  BnaC07g41770D                                          177   5e-52   Brassica napus [oilseed rape]
gb|AFK38664.1|  unknown                                                 177   9e-52   Medicago truncatula
ref|XP_006371957.1|  SNF7 family protein                                177   9e-52   
emb|CDY03333.1|  BnaC09g10150D                                          176   1e-51   
ref|XP_009112635.1|  PREDICTED: vacuolar protein sorting-associat...    176   1e-51   Brassica rapa
emb|CDY48731.1|  BnaA09g10060D                                          176   1e-51   Brassica napus [oilseed rape]
emb|CDY06832.1|  BnaC01g09310D                                          176   1e-51   
gb|KJB83083.1|  hypothetical protein B456_013G228900                    176   2e-51   Gossypium raimondii
gb|KHG00434.1|  Vacuolar sorting-associated protein 32 -like protein    176   2e-51   Gossypium arboreum [tree cotton]
ref|NP_179573.1|  vacuolar protein sorting-associated protein 32-1      176   2e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006408902.1|  hypothetical protein EUTSA_v10002096mg             176   2e-51   Eutrema salsugineum [saltwater cress]
ref|XP_009128967.1|  PREDICTED: vacuolar protein sorting-associat...    176   3e-51   Brassica rapa
ref|NP_194645.1|  vacuolar protein sorting-associated protein 32-2      175   5e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010526425.1|  PREDICTED: vacuolar protein sorting-associat...    175   5e-51   Tarenaya hassleriana [spider flower]
gb|ACJ85894.1|  unknown                                                 174   6e-51   Medicago truncatula
gb|ABK23499.1|  unknown                                                 171   2e-50   Picea sitchensis
gb|AAM66053.1|  copia-like retroelement pol polyprotein                 173   3e-50   Arabidopsis thaliana [mouse-ear cress]
gb|ABK25827.1|  unknown                                                 172   7e-50   Picea sitchensis
ref|XP_010489126.1|  PREDICTED: vacuolar protein sorting-associat...    172   1e-49   Camelina sativa [gold-of-pleasure]
ref|XP_010416624.1|  PREDICTED: vacuolar protein sorting-associat...    172   1e-49   Camelina sativa [gold-of-pleasure]
ref|XP_010467924.1|  PREDICTED: vacuolar protein sorting-associat...    171   1e-49   Camelina sativa [gold-of-pleasure]
ref|XP_011094781.1|  PREDICTED: vacuolar protein sorting-associat...    170   3e-49   Sesamum indicum [beniseed]
ref|XP_011093673.1|  PREDICTED: vacuolar protein sorting-associat...    170   5e-49   Sesamum indicum [beniseed]
gb|EYU20388.1|  hypothetical protein MIMGU_mgv1a013694mg                170   5e-49   Erythranthe guttata [common monkey flower]
ref|XP_010695089.1|  PREDICTED: vacuolar protein sorting-associat...    170   5e-49   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006355308.1|  PREDICTED: vacuolar protein sorting-associat...    170   6e-49   Solanum tuberosum [potatoes]
ref|XP_004245128.1|  PREDICTED: vacuolar protein sorting-associat...    170   6e-49   Solanum lycopersicum
ref|XP_009784949.1|  PREDICTED: vacuolar protein sorting-associat...    169   9e-49   Nicotiana sylvestris
ref|XP_006298305.1|  hypothetical protein CARUB_v10014370mg             170   2e-48   
ref|XP_009586832.1|  PREDICTED: vacuolar protein sorting-associat...    168   2e-48   Nicotiana tomentosiformis
ref|XP_011081721.1|  PREDICTED: vacuolar protein sorting-associat...    168   3e-48   Sesamum indicum [beniseed]
ref|XP_003577910.1|  PREDICTED: vacuolar protein sorting-associat...    168   3e-48   Brachypodium distachyon [annual false brome]
ref|XP_009610483.1|  PREDICTED: vacuolar protein sorting-associat...    168   3e-48   Nicotiana tomentosiformis
ref|XP_009800252.1|  PREDICTED: vacuolar protein sorting-associat...    168   3e-48   Nicotiana sylvestris
ref|XP_002283066.1|  PREDICTED: vacuolar protein sorting-associat...    167   4e-48   Vitis vinifera
ref|XP_010047627.1|  PREDICTED: vacuolar protein sorting-associat...    167   5e-48   Eucalyptus grandis [rose gum]
gb|KJB27119.1|  hypothetical protein B456_004G283100                    166   6e-48   Gossypium raimondii
ref|XP_010237993.1|  PREDICTED: vacuolar protein sorting-associat...    169   9e-48   
gb|EMS65379.1|  Vacuolar protein sorting-associated protein 32-li...    167   1e-47   Triticum urartu
dbj|BAK08135.1|  predicted protein                                      167   1e-47   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB27118.1|  hypothetical protein B456_004G283100                    167   1e-47   Gossypium raimondii
ref|XP_003564850.1|  PREDICTED: vacuolar protein sorting-associat...    167   1e-47   Brachypodium distachyon [annual false brome]
ref|XP_009394690.1|  PREDICTED: vacuolar protein sorting-associat...    166   1e-47   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008242449.1|  PREDICTED: vacuolar protein sorting-associat...    166   1e-47   Prunus mume [ume]
ref|XP_007202552.1|  hypothetical protein PRUPE_ppa011232mg             166   1e-47   
ref|XP_006572922.1|  PREDICTED: vacuolar protein sorting-associat...    166   2e-47   Glycine max [soybeans]
ref|XP_009352595.1|  PREDICTED: vacuolar protein sorting-associat...    166   2e-47   Pyrus x bretschneideri [bai li]
gb|ADE77819.1|  unknown                                                 166   2e-47   Picea sitchensis
gb|KDP33761.1|  hypothetical protein JCGZ_07332                         166   2e-47   Jatropha curcas
emb|CBI35999.3|  unnamed protein product                                165   2e-47   Vitis vinifera
ref|XP_006381690.1|  hypothetical protein POPTR_0006s15890g             164   2e-47   
gb|KHG10442.1|  Uncharacterized protein F383_09141                      166   3e-47   Gossypium arboreum [tree cotton]
ref|XP_002514179.1|  Charged multivesicular body protein 4b, puta...    166   3e-47   Ricinus communis
ref|XP_007160256.1|  hypothetical protein PHAVU_002G305900g             166   3e-47   Phaseolus vulgaris [French bean]
ref|XP_010942547.1|  PREDICTED: vacuolar protein sorting-associat...    166   3e-47   Elaeis guineensis
ref|XP_011016035.1|  PREDICTED: vacuolar protein sorting-associat...    165   3e-47   Populus euphratica
ref|XP_006381691.1|  hypothetical protein POPTR_0006s15890g             165   3e-47   
ref|XP_002281551.1|  PREDICTED: vacuolar protein sorting-associat...    165   3e-47   Vitis vinifera
ref|XP_009398754.1|  PREDICTED: vacuolar protein sorting-associat...    165   4e-47   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004251182.1|  PREDICTED: vacuolar protein sorting-associat...    165   5e-47   Solanum lycopersicum
ref|XP_006340250.1|  PREDICTED: vacuolar protein sorting-associat...    165   5e-47   Solanum tuberosum [potatoes]
ref|XP_006583569.1|  PREDICTED: vacuolar protein sorting-associat...    164   6e-47   Glycine max [soybeans]
ref|XP_008337624.1|  PREDICTED: vacuolar protein sorting-associat...    165   6e-47   
dbj|BAJ86054.1|  predicted protein                                      164   8e-47   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ98801.1|  predicted protein                                      164   8e-47   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009395523.1|  PREDICTED: vacuolar protein sorting-associat...    164   9e-47   
ref|XP_003563642.1|  PREDICTED: vacuolar protein sorting-associat...    164   9e-47   Brachypodium distachyon [annual false brome]
ref|XP_004135686.1|  PREDICTED: vacuolar protein sorting-associat...    164   1e-46   Cucumis sativus [cucumbers]
ref|XP_008387512.1|  PREDICTED: vacuolar protein sorting-associat...    164   1e-46   Malus domestica [apple tree]
gb|EMT22613.1|  Vacuolar protein sorting-associated 32-1-like pro...    164   1e-46   
ref|XP_004287507.1|  PREDICTED: vacuolar protein sorting-associat...    164   1e-46   Fragaria vesca subsp. vesca
ref|NP_001058040.1|  Os06g0608500                                       164   2e-46   
ref|XP_004965917.1|  PREDICTED: vacuolar protein sorting-associat...    164   2e-46   Setaria italica
ref|XP_006656230.1|  PREDICTED: vacuolar protein sorting-associat...    163   2e-46   Oryza brachyantha
gb|ACN85265.1|  charged multivesicular body protein 4b                  163   2e-46   Oryza alta
ref|NP_001152491.1|  charged multivesicular body protein 4b             163   2e-46   Zea mays [maize]
ref|XP_009102133.1|  PREDICTED: vacuolar protein sorting-associat...    163   3e-46   Brassica rapa
ref|XP_008812733.1|  PREDICTED: vacuolar protein sorting-associat...    163   3e-46   Phoenix dactylifera
ref|XP_002437263.1|  hypothetical protein SORBIDRAFT_10g023830          162   6e-46   Sorghum bicolor [broomcorn]
ref|XP_008450809.1|  PREDICTED: vacuolar protein sorting-associat...    162   6e-46   Cucumis melo [Oriental melon]
gb|AFK39612.1|  unknown                                                 162   6e-46   Medicago truncatula
gb|KJB27120.1|  hypothetical protein B456_004G283100                    161   1e-45   Gossypium raimondii
ref|XP_004158431.1|  PREDICTED: vacuolar protein sorting-associat...    160   1e-45   
ref|XP_011014015.1|  PREDICTED: vacuolar protein sorting-associat...    160   2e-45   Populus euphratica
ref|XP_009399850.1|  PREDICTED: vacuolar protein sorting-associat...    160   3e-45   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006580488.1|  PREDICTED: vacuolar protein sorting-associat...    159   3e-45   
ref|XP_008803193.1|  PREDICTED: vacuolar protein sorting-associat...    160   3e-45   
ref|XP_010540987.1|  PREDICTED: vacuolar protein sorting-associat...    160   4e-45   Tarenaya hassleriana [spider flower]
emb|CDY35892.1|  BnaA07g00950D                                          160   4e-45   Brassica napus [oilseed rape]
gb|KJB06748.1|  hypothetical protein B456_001G010300                    160   4e-45   Gossypium raimondii
ref|XP_009396303.1|  PREDICTED: vacuolar protein sorting-associat...    159   5e-45   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010548688.1|  PREDICTED: vacuolar protein sorting-associat...    159   9e-45   Tarenaya hassleriana [spider flower]
gb|KHG25044.1|  VPS32.2: Vacuolar protein sorting-associated prot...    158   1e-44   Gossypium arboreum [tree cotton]
gb|KJB65082.1|  hypothetical protein B456_010G080200                    159   1e-44   Gossypium raimondii
gb|KHG25043.1|  VPS32.2: Vacuolar protein sorting-associated prot...    159   1e-44   Gossypium arboreum [tree cotton]
ref|XP_010942907.1|  PREDICTED: vacuolar protein sorting-associat...    158   2e-44   Elaeis guineensis
ref|XP_002883967.1|  hypothetical protein ARALYDRAFT_343220             157   2e-44   
gb|KHN40351.1|  Vacuolar protein sorting-associated protein 32 li...    158   3e-44   Glycine soja [wild soybean]
gb|ACJ83886.1|  unknown                                                 157   3e-44   Medicago truncatula
gb|ACU23713.1|  unknown                                                 155   6e-44   Glycine max [soybeans]
ref|XP_011077951.1|  PREDICTED: vacuolar protein sorting-associat...    157   7e-44   Sesamum indicum [beniseed]
gb|EYU30671.1|  hypothetical protein MIMGU_mgv1a013622mg                156   7e-44   Erythranthe guttata [common monkey flower]
ref|XP_006451365.1|  hypothetical protein CICLE_v10009534mg             155   1e-43   
ref|NP_974635.1|  vacuolar protein sorting-associated protein 32-2      155   2e-43   Arabidopsis thaliana [mouse-ear cress]
emb|CDY48599.1|  BnaA01g07660D                                          165   4e-43   Brassica napus [oilseed rape]
gb|KJB83084.1|  hypothetical protein B456_013G228900                    154   4e-43   Gossypium raimondii
ref|XP_003630667.1|  Vacuolar protein sorting-associated protein-...    155   4e-43   
ref|XP_007227580.1|  hypothetical protein PRUPE_ppa011190mg             153   4e-43   
ref|XP_008673975.1|  PREDICTED: charged multivesicular body prote...    155   6e-43   Zea mays [maize]
gb|EMS60758.1|  Vacuolar protein sorting-associated protein 32-li...    158   6e-43   Triticum urartu
ref|XP_009337137.1|  PREDICTED: vacuolar protein sorting-associat...    154   6e-43   Pyrus x bretschneideri [bai li]
ref|XP_007227579.1|  hypothetical protein PRUPE_ppa011190mg             153   2e-42   
ref|XP_008377929.1|  PREDICTED: vacuolar protein sorting-associat...    153   2e-42   
ref|XP_008220429.1|  PREDICTED: vacuolar protein sorting-associat...    153   3e-42   Prunus mume [ume]
emb|CDX82742.1|  BnaC07g01240D                                          152   4e-42   
ref|XP_002455955.1|  hypothetical protein SORBIDRAFT_03g027900          152   4e-42   Sorghum bicolor [broomcorn]
ref|NP_001241771.1|  charged multivesicular body protein 4b             152   4e-42   Zea mays [maize]
ref|XP_004969169.1|  PREDICTED: vacuolar protein sorting-associat...    152   5e-42   Setaria italica
dbj|BAJ91819.1|  predicted protein                                      150   5e-42   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001130288.1|  uncharacterized protein LOC100191382               151   8e-42   Zea mays [maize]
ref|NP_001147424.1|  charged multivesicular body protein 4b             151   8e-42   Zea mays [maize]
gb|ACG30556.1|  charged multivesicular body protein 4b                  151   9e-42   Zea mays [maize]
ref|XP_001769849.1|  predicted protein                                  150   2e-41   
ref|XP_006660479.1|  PREDICTED: vacuolar protein sorting-associat...    150   3e-41   Oryza brachyantha
gb|ACJ86115.1|  unknown                                                 150   3e-41   Medicago truncatula
ref|XP_009418535.1|  PREDICTED: vacuolar protein sorting-associat...    150   3e-41   
ref|XP_009361474.1|  PREDICTED: vacuolar protein sorting-associat...    149   6e-41   Pyrus x bretschneideri [bai li]
ref|XP_008393670.1|  PREDICTED: vacuolar protein sorting-associat...    149   7e-41   Malus domestica [apple tree]
ref|NP_001062723.1|  Os09g0267600                                       149   8e-41   
ref|XP_010690124.1|  PREDICTED: vacuolar protein sorting-associat...    149   1e-40   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004291010.1|  PREDICTED: vacuolar protein sorting-associat...    147   4e-40   Fragaria vesca subsp. vesca
gb|KJB65080.1|  hypothetical protein B456_010G080200                    145   4e-40   Gossypium raimondii
ref|XP_009620038.1|  PREDICTED: vacuolar protein sorting-associat...    147   5e-40   
ref|XP_007152943.1|  hypothetical protein PHAVU_004G173400g             145   2e-39   Phaseolus vulgaris [French bean]
ref|XP_006842643.1|  hypothetical protein AMTR_s00077p00189740          145   2e-39   Amborella trichopoda
ref|XP_008782995.1|  PREDICTED: vacuolar protein sorting-associat...    142   9e-39   Phoenix dactylifera
ref|XP_006853757.1|  hypothetical protein AMTR_s00056p00189660          138   6e-38   
gb|EAZ08368.1|  hypothetical protein OsI_30625                          148   2e-37   Oryza sativa Indica Group [Indian rice]
gb|EEE69315.1|  hypothetical protein OsJ_28603                          148   3e-37   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010931425.1|  PREDICTED: vacuolar protein sorting-associat...    137   2e-36   Elaeis guineensis
gb|EMT15574.1|  Vacuolar protein sorting-associated 32-2-like pro...    135   4e-36   
gb|ABK25790.1|  unknown                                                 133   5e-36   Picea sitchensis
gb|EYU29306.1|  hypothetical protein MIMGU_mgv1a014523mg                134   1e-35   Erythranthe guttata [common monkey flower]
ref|NP_001130264.1|  uncharacterized protein LOC100191358               132   9e-35   
ref|XP_002466250.1|  hypothetical protein SORBIDRAFT_01g004370          132   9e-35   
ref|XP_008788033.1|  PREDICTED: vacuolar protein sorting-associat...    132   2e-34   Phoenix dactylifera
ref|XP_010049157.1|  PREDICTED: vacuolar protein sorting-associat...    130   1e-33   Eucalyptus grandis [rose gum]
ref|XP_010049158.1|  PREDICTED: vacuolar protein sorting-associat...    129   2e-33   Eucalyptus grandis [rose gum]
gb|AET05142.2|  charged multivesicular body protein                     127   1e-32   Medicago truncatula
ref|XP_010922839.1|  PREDICTED: vacuolar protein sorting-associat...    127   2e-32   Elaeis guineensis
ref|XP_008804654.1|  PREDICTED: vacuolar protein sorting-associat...    127   2e-32   Phoenix dactylifera
ref|XP_003630666.1|  Vacuolar protein sorting-associated protein-...    127   2e-32   
ref|XP_009767750.1|  PREDICTED: vacuolar protein sorting-associat...    125   8e-32   Nicotiana sylvestris
ref|XP_008679351.1|  PREDICTED: vacuolar protein sorting-associat...    125   9e-32   Zea mays [maize]
ref|XP_010931424.1|  PREDICTED: vacuolar protein sorting-associat...    124   2e-31   Elaeis guineensis
ref|XP_004978491.1|  PREDICTED: vacuolar protein sorting-associat...    124   4e-31   Setaria italica
ref|XP_003579007.1|  PREDICTED: vacuolar protein sorting-associat...    122   1e-30   
ref|XP_002450174.1|  hypothetical protein SORBIDRAFT_05g001480          122   2e-30   Sorghum bicolor [broomcorn]
ref|NP_001065616.1|  Os11g0123500                                       121   2e-30   
gb|EEC67568.1|  hypothetical protein OsI_34912                          121   2e-30   Oryza sativa Indica Group [Indian rice]
ref|XP_006663763.1|  PREDICTED: vacuolar protein sorting-associat...    121   4e-30   Oryza brachyantha
ref|NP_001066025.2|  Os12g0121400                                       121   4e-30   
dbj|BAJ97352.1|  predicted protein                                      121   4e-30   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS66152.1|  Vacuolar protein sorting-associated protein 32-li...    121   1e-29   Triticum urartu
gb|EMT02888.1|  Vacuolar protein sorting-associated 32-1-like pro...    122   1e-29   
ref|XP_006662688.1|  PREDICTED: vacuolar protein sorting-associat...    117   5e-29   Oryza brachyantha
ref|XP_006662687.1|  PREDICTED: vacuolar protein sorting-associat...    117   8e-29   Oryza brachyantha
ref|XP_006662689.1|  PREDICTED: vacuolar protein sorting-associat...    117   9e-29   Oryza brachyantha
gb|KCW44187.1|  hypothetical protein EUGRSUZ_L02392                     115   7e-28   Eucalyptus grandis [rose gum]
gb|ADD22150.1|  copia-like retroelement pol polyprotein                 109   4e-27   Oryza barthii [African wild rice]
gb|EYU27236.1|  hypothetical protein MIMGU_mgv1a019968mg                112   4e-27   Erythranthe guttata [common monkey flower]
ref|XP_006837368.1|  hypothetical protein AMTR_s00111p00112330          112   1e-26   
ref|XP_010042633.1|  PREDICTED: vacuolar protein sorting-associat...    108   1e-26   
gb|ABG21860.1|  SNF7 family protein, expressed                          109   4e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008660967.1|  PREDICTED: uncharacterized protein LOC103640100    114   5e-26   
gb|AFM35785.1|  hypothetical protein                                    106   9e-26   Oryza eichingeri
gb|KCW44188.1|  hypothetical protein EUGRSUZ_L02392                     107   5e-25   Eucalyptus grandis [rose gum]
gb|KHN40354.1|  Vacuolar protein sorting-associated protein 32 li...    102   4e-24   Glycine soja [wild soybean]
ref|XP_007512667.1|  predicted protein                                  103   2e-23   Bathycoccus prasinos
ref|XP_011462899.1|  PREDICTED: vacuolar protein sorting-associat...    103   2e-23   Fragaria vesca subsp. vesca
ref|XP_010047642.1|  PREDICTED: vacuolar protein sorting-associat...    102   4e-23   Eucalyptus grandis [rose gum]
ref|XP_010041560.1|  PREDICTED: vacuolar protein sorting-associat...  99.4    5e-22   
gb|EPS70822.1|  hypothetical protein M569_03937                       95.9    6e-22   Genlisea aurea
gb|KCW79570.1|  hypothetical protein EUGRSUZ_C00937                   99.8    6e-22   Eucalyptus grandis [rose gum]
ref|XP_010047632.1|  PREDICTED: vacuolar protein sorting-associat...  99.4    7e-22   Eucalyptus grandis [rose gum]
ref|XP_010041559.1|  PREDICTED: vacuolar protein sorting-associat...  99.4    8e-22   Eucalyptus grandis [rose gum]
ref|XP_003064051.1|  predicted protein                                96.3    1e-20   Micromonas pusilla CCMP1545
gb|ADD22155.1|  copia-like retroelement pol polyprotein               87.4    1e-18   Oryza barthii [African wild rice]
ref|XP_003083989.1|  B1008E06.13 gene product (ISS)                   90.9    1e-18   Ostreococcus tauri
ref|XP_001422047.1|  predicted protein                                89.7    2e-18   Ostreococcus lucimarinus CCE9901
ref|XP_002502293.1|  predicted protein                                87.8    1e-17   Micromonas commoda
ref|XP_010047630.1|  PREDICTED: vacuolar protein sorting-associat...  82.8    5e-16   
ref|XP_010047629.1|  PREDICTED: vacuolar protein sorting-associat...  82.8    5e-16   Eucalyptus grandis [rose gum]
ref|XP_010047637.1|  PREDICTED: vacuolar protein sorting-associat...  80.9    1e-15   Eucalyptus grandis [rose gum]
ref|XP_010047636.1|  PREDICTED: vacuolar protein sorting-associat...  80.9    1e-15   Eucalyptus grandis [rose gum]
gb|KCW79575.1|  hypothetical protein EUGRSUZ_C00942                   80.5    2e-15   Eucalyptus grandis [rose gum]
ref|XP_010047635.1|  PREDICTED: vacuolar protein sorting-associat...  80.5    4e-15   
emb|CDX93849.1|  BnaC04g20080D                                        77.8    5e-15   
ref|XP_011400131.1|  Vacuolar protein sorting-associated protein ...  79.7    6e-15   Auxenochlorella protothecoides
ref|XP_005850888.1|  hypothetical protein CHLNCDRAFT_56887            81.6    1e-14   Chlorella variabilis
ref|XP_005651060.1|  Snf7-domain-containing protein                   76.6    1e-13   Coccomyxa subellipsoidea C-169
ref|XP_004339619.1|  Vacuolarsorting protein SNF7, putative           73.6    9e-13   Acanthamoeba castellanii str. Neff
gb|ACG47769.1|  hypothetical protein                                  70.1    3e-12   Zea mays [maize]
gb|EPB89680.1|  hypothetical protein HMPREF1544_03479                 70.9    8e-12   Mucor circinelloides f. circinelloides 1006PhL
dbj|GAN08360.1|  snf7-domain-containing protein                       70.9    8e-12   Mucor ambiguus
gb|KFH63786.1|  hypothetical protein MVEG_10479                       69.3    2e-11   Mortierella verticillata NRRL 6337
emb|CEG74761.1|  Putative Snf7 domain-containing protein              68.2    5e-11   Rhizopus microsporus
gb|KCW79579.1|  hypothetical protein EUGRSUZ_C00942                   67.0    1e-10   Eucalyptus grandis [rose gum]
gb|ETM54563.1|  hypothetical protein L914_02125                       67.4    2e-10   Phytophthora parasitica
ref|XP_009530245.1|  hypothetical protein PHYSODRAFT_513547           67.4    2e-10   Phytophthora sojae
ref|XP_011463655.1|  PREDICTED: vacuolar protein sorting-associat...  66.6    2e-10   Fragaria vesca subsp. vesca
gb|ETP52853.1|  hypothetical protein F442_02191                       67.4    2e-10   Phytophthora parasitica P10297
gb|ETK94880.1|  hypothetical protein L915_02144                       67.4    2e-10   Phytophthora parasitica
gb|KDO21729.1|  hypothetical protein SPRG_13145                       67.0    2e-10   Saprolegnia parasitica CBS 223.65
gb|ERZ97722.1|  hypothetical protein GLOINDRAFT_339995                66.6    2e-10   
ref|XP_008618112.1|  hypothetical protein SDRG_13792                  67.0    2e-10   Saprolegnia diclina VS20
gb|KDD73593.1|  Snf7-like protein                                     65.9    3e-10   Helicosporidium sp. ATCC 50920
gb|ETI55055.1|  hypothetical protein F443_02236                       66.6    3e-10   Phytophthora parasitica P1569
ref|XP_008899868.1|  hypothetical protein PPTG_22013                  68.6    3e-10   Phytophthora parasitica INRA-310
ref|XP_002900107.1|  conserved hypothetical protein                   66.2    4e-10   Phytophthora infestans T30-4
emb|CDS14366.1|  hypothetical protein LRAMOSA06535                    65.5    5e-10   Lichtheimia ramosa
ref|XP_009040331.1|  hypothetical protein AURANDRAFT_31558            65.5    6e-10   Aureococcus anophagefferens
emb|CCA71790.1|  related to SNF7 protein                              65.5    6e-10   Serendipita indica DSM 11827
ref|XP_006680691.1|  hypothetical protein BATDEDRAFT_26522            65.1    9e-10   Batrachochytrium dendrobatidis JAM81
gb|KIM23711.1|  hypothetical protein M408DRAFT_332203                 64.7    1e-09   Serendipita vermifera MAFF 305830
ref|XP_004363525.1|  hypothetical protein CAOG_03797                  64.7    1e-09   Capsaspora owczarzaki ATCC 30864
ref|XP_001695329.1|  component of the ESCRT-III complex               64.7    1e-09   Chlamydomonas reinhardtii
gb|EPY52980.1|  vacuolar sorting protein Vps32                        63.5    3e-09   Schizosaccharomyces cryophilus OY26
dbj|BAH71170.1|  ACYPI007250                                          62.8    3e-09   Acyrthosiphon pisum
gb|KJB65081.1|  hypothetical protein B456_010G080200                  62.4    3e-09   Gossypium raimondii
emb|CDH56827.1|  sphingosine kinase                                   65.9    4e-09   Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_001951538.1|  PREDICTED: charged multivesicular body prote...  63.2    4e-09   Acyrthosiphon pisum
gb|EIE89277.1|  hypothetical protein RO3G_13988                       62.4    4e-09   Rhizopus delemar RA 99-880
gb|EPX73966.1|  vacuolar sorting protein Vps32                        63.2    4e-09   Schizosaccharomyces octosporus yFS286
ref|XP_008872252.1|  hypothetical protein H310_08328                  63.2    5e-09   Aphanomyces invadans
emb|CCI46598.1|  unnamed protein product                              62.4    8e-09   Albugo candida
ref|XP_009836975.1|  hypothetical protein H257_11676                  62.4    9e-09   Aphanomyces astaci
ref|XP_001642600.1|  hypothetical protein Kpol_297p3                  60.8    3e-08   Vanderwaltozyma polyspora DSM 70294
emb|CEG74762.1|  hypothetical protein RMATCC62417_09918               59.7    3e-08   Rhizopus microsporus
ref|XP_002778623.1|  vacuolar sorting protein snf7, putative          59.3    4e-08   Perkinsus marinus ATCC 50983
ref|XP_002768058.1|  vacuolar sorting protein snf7, putative          60.1    5e-08   Perkinsus marinus ATCC 50983
ref|XP_002767060.1|  vacuolar sorting protein snf7, putative          60.1    5e-08   Perkinsus marinus ATCC 50983
gb|EIE77900.1|  hypothetical protein RO3G_02604                       58.9    6e-08   Rhizopus delemar RA 99-880
ref|XP_003330405.1|  hypothetical protein PGTG_11742                  59.7    6e-08   Puccinia graminis f. sp. tritici CRL 75-36-700-3
ref|XP_003686497.1|  hypothetical protein TPHA_0G02270                60.1    7e-08   Tetrapisispora phaffii CBS 4417
ref|XP_007417204.1|  hypothetical protein MELLADRAFT_40270            59.7    7e-08   Melampsora larici-populina 98AG31
ref|XP_002781729.1|  vacuolar sorting protein snf7, putative          59.3    1e-07   Perkinsus marinus ATCC 50983
gb|AFW61107.1|  hypothetical protein ZEAMMB73_096269                  58.9    1e-07   
emb|CBQ69482.1|  related to SNF7 protein                              58.9    1e-07   
ref|XP_007880482.1|  hypothetical protein PFL1_04763                  58.9    1e-07   
ref|XP_003673364.1|  hypothetical protein NCAS_0A04190                58.9    2e-07   
ref|XP_002297307.1|  copia-like retroelement pol polyprotein foun...  57.8    2e-07   
gb|KFB44423.1|  AGAP005316-PA-like protein                            58.2    2e-07   
ref|XP_003670252.1|  hypothetical protein NDAI_0E01930                58.2    4e-07   
gb|KDQ64275.1|  hypothetical protein JAAARDRAFT_27897                 57.0    4e-07   
gb|EMS19162.1|  vacuolar sorting protein VPS32                        57.4    5e-07   
emb|CDH10204.1|  probable Vacuolar-sorting protein SNF7               57.4    6e-07   
emb|CCF50222.1|  related to SNF7 protein                              57.0    7e-07   
dbj|GAC92801.1|  hypothetical protein PHSY_000357                     56.6    7e-07   
gb|KIO16167.1|  hypothetical protein M407DRAFT_247050                 57.0    7e-07   
ref|XP_003678739.1|  hypothetical protein TDEL_0A01960                57.0    7e-07   
ref|XP_315330.3|  AGAP005316-PA                                       57.0    8e-07   
ref|XP_011391345.1|  hypothetical protein UMAG_05062                  56.6    8e-07   
emb|CDH10203.1|  probable Vacuolar-sorting protein SNF7               57.0    9e-07   
emb|CDH16058.1|  probable Vacuolar-sorting protein SNF7               57.0    1e-06   
gb|EST09102.1|  hypothetical protein PSEUBRA_SCAF12g01695             56.6    1e-06   
gb|ETN65923.1|  charged multivesicular body protein 4b                57.0    1e-06   
dbj|GAK67740.1|  snf7-domain-containing protein                       56.6    1e-06   
gb|ETS65438.1|  hypothetical protein PaG_00172                        56.6    1e-06   
ref|XP_008813593.1|  PREDICTED: vacuolar protein sorting-associat...  53.9    1e-06   
ref|XP_002172497.1|  vacuolar sorting protein Vps32                   56.2    1e-06   
ref|XP_009398495.1|  PREDICTED: vacuolar protein sorting-associat...  54.3    1e-06   
dbj|GAC71549.1|  protein involved in glucose derepression and pre...  56.2    1e-06   
ref|XP_009398494.1|  PREDICTED: vacuolar protein sorting-associat...  54.7    1e-06   
gb|KIJ56853.1|  hypothetical protein M422DRAFT_22989                  56.2    1e-06   
ref|XP_008813592.1|  PREDICTED: vacuolar protein sorting-associat...  53.9    1e-06   
ref|XP_002498865.1|  ZYRO0G20416p                                     56.2    2e-06   
gb|KDR12954.1|  Charged multivesicular body protein 4b                56.2    2e-06   
ref|XP_011104440.1|  snf7p                                            56.2    2e-06   
gb|KDN36559.1|  Snf7-domain-containing protein                        55.8    2e-06   
gb|EHN01312.1|  Snf7p                                                 56.2    2e-06   
gb|EPY30608.1|  charged multivesicular body protein 6                 55.8    2e-06   
gb|EPY37874.1|  charged multivesicular body protein 6                 55.8    2e-06   
emb|CCA14800.1|  predicted protein putative                           55.8    2e-06   
ref|XP_001659957.1|  AAEL001698-PA                                    55.5    2e-06   
gb|EPY39439.1|  charged multivesicular body protein 6                 55.8    2e-06   
ref|XP_002423140.1|  Charged multivesicular body protein 4C, puta...  55.1    3e-06   
ref|XP_003957070.1|  hypothetical protein KAFR_0D02870                55.5    3e-06   
emb|CDH16059.1|  probable Vacuolar-sorting protein SNF7               55.5    3e-06   
gb|KCW44271.1|  hypothetical protein EUGRSUZ_L02295                   53.5    3e-06   
emb|CCI50623.1|  unnamed protein product                              55.5    3e-06   
emb|CCI50624.1|  unnamed protein product                              55.1    3e-06   
ref|XP_002958746.1|  hypothetical protein VOLCADRAFT_121743           56.6    3e-06   
ref|XP_004923469.1|  PREDICTED: charged multivesicular body prote...  55.1    3e-06   
ref|XP_007444680.1|  PREDICTED: charged multivesicular body prote...  55.1    4e-06   
ref|XP_002552908.1|  KLTH0D04268p                                     55.1    4e-06   
ref|NP_594271.1|  ESCRT III complex subunit Vps32                     55.1    4e-06   
emb|CDI55558.1|  related to SNF7 protein                              54.7    4e-06   
emb|CEP63589.1|  LALA0S08e06040g1_1                                   55.1    4e-06   
ref|XP_009155845.1|  hypothetical protein HMPREF1120_03523            54.7    4e-06   
gb|KGB36934.1|  Charged multivesicular body protein 4b                54.3    5e-06   
gb|KIW02651.1|  hypothetical protein PV09_06089                       54.7    5e-06   
ref|XP_008470005.1|  PREDICTED: charged multivesicular body prote...  54.7    5e-06   
gb|KDE02889.1|  hypothetical protein MVLG_06574                       54.7    5e-06   
gb|EAZ39859.1|  hypothetical protein OsJ_24299                        52.0    6e-06   
gb|EWM24858.1|  chromatin modifying protein 5                         54.7    6e-06   
ref|XP_003444811.1|  PREDICTED: charged multivesicular body prote...  54.3    6e-06   
ref|XP_009268113.1|  Vacuolar-sorting protein SNF7                    54.7    7e-06   
emb|CCD80096.1|  snf7-related                                         54.3    7e-06   
emb|CCD80097.1|  snf7-related                                         54.3    7e-06   
ref|XP_005733094.1|  PREDICTED: charged multivesicular body prote...  54.3    7e-06   
ref|NP_001152667.1|  retrotransposon protein                          52.0    7e-06   
emb|CBN76446.1|  conserved unknown protein                            54.3    8e-06   
ref|XP_007733955.1|  hypothetical protein A1O3_05645                  53.9    8e-06   
emb|CDQ60782.1|  unnamed protein product                              53.9    9e-06   
ref|XP_002182334.1|  predicted protein                                53.5    1e-05   
gb|KIW43569.1|  hypothetical protein PV06_04660                       53.9    1e-05   
gb|KIW11119.1|  hypothetical protein PV08_10419                       53.5    1e-05   
ref|XP_006012406.1|  PREDICTED: charged multivesicular body prote...  53.9    1e-05   
ref|XP_007725273.1|  hypothetical protein A1O1_06204                  53.5    1e-05   
ref|XP_011331968.1|  PREDICTED: charged multivesicular body prote...  53.5    1e-05   
ref|XP_007372197.1|  hypothetical protein SPAPADRAFT_57850            53.5    1e-05   
ref|XP_011049617.1|  PREDICTED: charged multivesicular body prote...  53.5    1e-05   
ref|XP_011251977.1|  PREDICTED: charged multivesicular body prote...  53.5    1e-05   
ref|XP_011149764.1|  PREDICTED: charged multivesicular body prote...  53.5    1e-05   
gb|EHJ67943.1|  hypothetical protein KGM_19860                        53.5    1e-05   
ref|XP_445498.1|  hypothetical protein                                53.5    1e-05   
ref|XP_006657713.1|  PREDICTED: vacuolar protein sorting-associat...  51.2    1e-05   
ref|XP_006957347.1|  Snf7-domain-containing protein                   53.5    1e-05   
ref|XP_007883782.1|  PREDICTED: charged multivesicular body prote...  53.9    1e-05   
ref|XP_010238191.1|  PREDICTED: vacuolar protein sorting-associat...  51.2    1e-05   
ref|XP_004957734.1|  PREDICTED: vacuolar protein sorting-associat...  51.2    1e-05   
ref|XP_004179248.1|  hypothetical protein TBLA_0B09140                53.5    1e-05   
ref|XP_011473632.1|  PREDICTED: charged multivesicular body prote...  53.1    2e-05   
ref|NP_001059677.1|  Os07g0490700                                     51.2    2e-05   
ref|XP_003694360.1|  PREDICTED: charged multivesicular body prote...  53.1    2e-05   
ref|XP_006616761.1|  PREDICTED: charged multivesicular body prote...  53.1    2e-05   
gb|EAZ03917.1|  hypothetical protein OsI_26050                        51.2    2e-05   
ref|XP_001728762.1|  hypothetical protein MGL_4097                    53.5    2e-05   
ref|XP_395324.2|  PREDICTED: charged multivesicular body protein ...  53.1    2e-05   
gb|EDL85951.1|  rCG37275, isoform CRA_a                               52.4    2e-05   
ref|XP_003400738.1|  PREDICTED: charged multivesicular body prote...  53.1    2e-05   
gb|KIV96901.1|  hypothetical protein PV10_00715                       53.1    2e-05   
ref|XP_009019383.1|  hypothetical protein HELRODRAFT_155763           52.8    2e-05   
ref|XP_003448421.1|  PREDICTED: charged multivesicular body prote...  53.1    2e-05   
ref|XP_010901229.1|  PREDICTED: charged multivesicular body prote...  53.1    2e-05   
gb|EHH65412.1|  Protein CGI-301                                       52.4    2e-05   
ref|XP_008545624.1|  PREDICTED: charged multivesicular body prote...  53.1    2e-05   
ref|XP_007784848.1|  hypothetical protein W97_08791                   53.1    2e-05   
ref|XP_004548898.1|  PREDICTED: charged multivesicular body prote...  52.8    2e-05   
ref|XP_008123232.1|  PREDICTED: charged multivesicular body prote...  53.1    2e-05   
ref|XP_006783088.1|  PREDICTED: charged multivesicular body prote...  52.8    2e-05   
ref|XP_005724445.1|  PREDICTED: charged multivesicular body prote...  52.8    2e-05   
ref|XP_969990.1|  PREDICTED: charged multivesicular body protein 4b   52.8    2e-05   
gb|EPY28503.1|  charged multivesicular body protein 6                 52.4    2e-05   
ref|XP_010395470.1|  PREDICTED: charged multivesicular body prote...  52.0    2e-05   
ref|XP_002460717.1|  hypothetical protein SORBIDRAFT_02g033670        50.8    2e-05   
ref|XP_008291224.1|  PREDICTED: charged multivesicular body prote...  52.8    2e-05   
ref|XP_007640041.1|  PREDICTED: charged multivesicular body prote...  52.4    2e-05   
gb|EFB21620.1|  hypothetical protein PANDA_004508                     52.4    2e-05   
gb|KIV82424.1|  hypothetical protein PV11_04539                       52.8    2e-05   
ref|XP_007007517.1|  hypothetical protein TREMEDRAFT_40846            52.8    2e-05   
ref|NP_956489.1|  charged multivesicular body protein 4b              52.8    2e-05   
ref|XP_001526663.1|  vacuolar sorting protein SNF7                    52.8    2e-05   
ref|XP_007073741.1|  PREDICTED: charged multivesicular body prote...  52.4    3e-05   
gb|EDL85952.1|  rCG37275, isoform CRA_b                               52.4    3e-05   
ref|XP_006202700.1|  PREDICTED: charged multivesicular body prote...  52.0    3e-05   
ref|XP_008024413.1|  hypothetical protein SETTUDRAFT_168698           52.8    3e-05   
ref|XP_008406414.1|  PREDICTED: charged multivesicular body prote...  52.8    3e-05   
ref|XP_005363151.1|  PREDICTED: charged multivesicular body prote...  52.8    3e-05   
ref|XP_011219584.1|  PREDICTED: charged multivesicular body prote...  52.4    3e-05   
ref|XP_007579268.1|  PREDICTED: charged multivesicular body prote...  52.4    3e-05   
ref|XP_005810877.1|  PREDICTED: charged multivesicular body prote...  52.4    3e-05   
ref|XP_005429698.1|  PREDICTED: charged multivesicular body prote...  52.0    3e-05   
ref|XP_008701592.1|  PREDICTED: charged multivesicular body prote...  52.4    3e-05   
gb|EJK70064.1|  hypothetical protein THAOC_08613                      52.8    3e-05   
ref|XP_006001928.1|  PREDICTED: charged multivesicular body prote...  52.4    3e-05   
ref|XP_007193330.1|  PREDICTED: charged multivesicular body prote...  52.4    3e-05   
gb|EHH19769.1|  Protein CGI-301                                       52.4    3e-05   
gb|AAP06222.1|  SJCHGC01931 protein                                   52.4    3e-05   
ref|XP_004272781.1|  PREDICTED: charged multivesicular body prote...  52.4    3e-05   
ref|XP_008147944.1|  PREDICTED: charged multivesicular body prote...  52.4    3e-05   
ref|XP_001381361.2|  PREDICTED: charged multivesicular body prote...  52.4    3e-05   
ref|XP_004897884.1|  PREDICTED: charged multivesicular body prote...  52.4    3e-05   
ref|XP_005688722.1|  PREDICTED: charged multivesicular body prote...  52.4    3e-05   
ref|XP_006860740.1|  PREDICTED: charged multivesicular body prote...  52.4    3e-05   
ref|XP_007932762.1|  PREDICTED: charged multivesicular body prote...  52.4    3e-05   
ref|XP_007105959.1|  PREDICTED: charged multivesicular body prote...  52.4    3e-05   
ref|XP_006992893.1|  PREDICTED: charged multivesicular body prote...  52.4    3e-05   
ref|XP_005976888.1|  PREDICTED: charged multivesicular body prote...  52.4    3e-05   
ref|XP_006764654.1|  PREDICTED: charged multivesicular body prote...  52.4    3e-05   
ref|XP_005879855.1|  PREDICTED: charged multivesicular body prote...  52.4    3e-05   
ref|XP_004746667.1|  PREDICTED: charged multivesicular body prote...  52.4    3e-05   
ref|XP_011497111.1|  PREDICTED: charged multivesicular body prote...  52.4    3e-05   
emb|CDQ56063.1|  unnamed protein product                              52.4    3e-05   
ref|XP_001105255.1|  PREDICTED: charged multivesicular body prote...  52.4    3e-05   
ref|XP_010626688.1|  PREDICTED: charged multivesicular body prote...  52.4    3e-05   
ref|XP_004867983.1|  PREDICTED: charged multivesicular body prote...  52.4    3e-05   
ref|NP_083638.1|  charged multivesicular body protein 4b              52.4    3e-05   
gb|EHB11300.1|  Charged multivesicular body protein 4b                52.4    3e-05   
ref|XP_007522736.1|  PREDICTED: charged multivesicular body prote...  52.4    3e-05   
ref|XP_004746668.1|  PREDICTED: charged multivesicular body prote...  52.4    3e-05   
ref|XP_004687332.1|  PREDICTED: charged multivesicular body prote...  52.4    3e-05   
ref|XP_003788156.1|  PREDICTED: charged multivesicular body prote...  52.4    3e-05   
ref|NP_001263385.1|  chromatin modifying protein 4B-like 1            52.4    3e-05   
ref|XP_008505143.1|  PREDICTED: charged multivesicular body prote...  52.4    4e-05   
ref|XP_542966.1|  PREDICTED: charged multivesicular body protein 4b   52.4    4e-05   
ref|XP_006881515.1|  PREDICTED: charged multivesicular body prote...  52.4    4e-05   
ref|XP_004612619.1|  PREDICTED: charged multivesicular body prote...  52.4    4e-05   
ref|XP_006089478.1|  PREDICTED: charged multivesicular body prote...  52.4    4e-05   
ref|XP_003708355.1|  PREDICTED: charged multivesicular body prote...  52.4    4e-05   
ref|XP_010358883.1|  PREDICTED: charged multivesicular body prote...  52.4    4e-05   
ref|XP_002710845.1|  PREDICTED: charged multivesicular body prote...  52.4    4e-05   
ref|XP_006075807.1|  PREDICTED: charged multivesicular body prote...  52.4    4e-05   
ref|NP_789782.1|  charged multivesicular body protein 4b              52.4    4e-05   
ref|XP_005084699.1|  PREDICTED: charged multivesicular body prote...  52.4    4e-05   
ref|XP_004327134.1|  PREDICTED: charged multivesicular body prote...  52.4    4e-05   
ref|XP_004014551.1|  PREDICTED: charged multivesicular body prote...  52.4    4e-05   
ref|XP_003932100.1|  PREDICTED: charged multivesicular body prote...  52.4    4e-05   
ref|NP_001121978.1|  charged multivesicular body protein 4b           52.4    4e-05   
ref|XP_006224779.1|  PREDICTED: charged multivesicular body prote...  52.8    4e-05   
ref|XP_006144215.1|  PREDICTED: charged multivesicular body prote...  52.0    4e-05   
ref|XP_004668152.1|  PREDICTED: charged multivesicular body prote...  52.4    4e-05   
emb|CCJ28951.1|  unnamed protein product                              52.0    4e-05   
emb|CDQ64053.1|  unnamed protein product                              52.4    4e-05   
ref|XP_006921792.1|  PREDICTED: charged multivesicular body prote...  52.4    4e-05   
emb|CAF95754.1|  unnamed protein product                              52.0    4e-05   
ref|XP_007907476.1|  PREDICTED: charged multivesicular body prote...  52.0    4e-05   
ref|XP_010981963.1|  PREDICTED: charged multivesicular body prote...  52.0    4e-05   
ref|XP_010959151.1|  PREDICTED: charged multivesicular body prote...  52.0    4e-05   
gb|AFK11394.1|  charged multivesicular body protein 4b                52.0    4e-05   
ref|XP_006267354.1|  PREDICTED: charged multivesicular body prote...  52.0    4e-05   
ref|XP_006022300.1|  PREDICTED: charged multivesicular body prote...  52.0    4e-05   
ref|XP_003832047.1|  PREDICTED: charged multivesicular body prote...  52.0    4e-05   
ref|XP_006179340.1|  PREDICTED: charged multivesicular body prote...  52.0    4e-05   
ref|XP_005295458.1|  PREDICTED: charged multivesicular body prote...  52.0    4e-05   
ref|XP_006022299.1|  PREDICTED: charged multivesicular body prote...  52.0    4e-05   
ref|XP_002542468.1|  vacuolar sorting protein snf-7                   52.0    5e-05   
gb|KIX07627.1|  hypothetical protein Z518_02280                       52.0    5e-05   
emb|CDQ69788.1|  unnamed protein product                              52.0    5e-05   
ref|XP_003411709.1|  PREDICTED: charged multivesicular body prote...  52.0    5e-05   
ref|XP_006267355.1|  PREDICTED: charged multivesicular body prote...  52.0    5e-05   
gb|ELK29657.1|  Charged multivesicular body protein 4b                52.4    5e-05   
ref|NP_001006286.1|  charged multivesicular body protein 4b           52.0    5e-05   
gb|EMS65996.1|  Vacuolar protein sorting-associated protein 32-li...  49.7    5e-05   
ref|XP_008287460.1|  PREDICTED: charged multivesicular body prote...  52.0    5e-05   
ref|XP_010582352.1|  PREDICTED: charged multivesicular body prote...  52.0    5e-05   
ref|XP_009091182.1|  PREDICTED: charged multivesicular body prote...  52.0    5e-05   
ref|XP_003012616.1|  hypothetical protein ARB_01229                   52.0    5e-05   
gb|KFW78592.1|  Charged multivesicular body protein 4b                52.0    5e-05   
ref|XP_007435791.1|  PREDICTED: charged multivesicular body prote...  52.0    5e-05   
gb|ETE67218.1|  Charged multivesicular body protein 4b                52.0    5e-05   
ref|XP_003220536.1|  PREDICTED: charged multivesicular body prote...  52.0    5e-05   
gb|KEF62581.1|  hypothetical protein A1O9_00554                       52.0    6e-05   
gb|KDO18501.1|  hypothetical protein SPRG_16177                       51.6    6e-05   
ref|XP_008605661.1|  hypothetical protein SDRG_01885                  51.6    6e-05   
gb|EDL06092.1|  chromatin modifying protein 4B                        52.0    6e-05   
ref|XP_003134450.4|  PREDICTED: LOW QUALITY PROTEIN: charged mult...  52.4    6e-05   
ref|XP_010919710.1|  PREDICTED: vacuolar protein sorting-associat...  49.7    6e-05   
gb|KIW61450.1|  hypothetical protein PV05_01570                       51.6    7e-05   
ref|XP_005532929.1|  PREDICTED: charged multivesicular body prote...  51.6    8e-05   
gb|EMG46740.1|  Vacuolar-sorting protein SNF7                         51.6    8e-05   
gb|EPY31129.1|  charged multivesicular body protein 6                 51.6    8e-05   
ref|XP_005532930.1|  PREDICTED: charged multivesicular body prote...  51.6    8e-05   
ref|XP_010767659.1|  PREDICTED: charged multivesicular body prote...  51.2    8e-05   
ref|XP_010896031.1|  PREDICTED: charged multivesicular body prote...  51.2    9e-05   
gb|EPZ31077.1|  Snf7 domain-containing protein                        52.0    9e-05   
ref|XP_001607501.2|  PREDICTED: charged multivesicular body prote...  51.2    9e-05   



>ref|XP_010244367.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Nelumbo nucifera]
 ref|XP_010244368.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Nelumbo nucifera]
Length=218

 Score =   192 bits (487),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 124/128 (97%), Positives = 126/128 (98%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            MFTRIFGKPKQETNALATLDKLNETLEMLEKKEKVL KKAA+EVEKAKEFTRAKNKRAAI
Sbjct  1    MFTRIFGKPKQETNALATLDKLNETLEMLEKKEKVLIKKAASEVEKAKEFTRAKNKRAAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGA+AMKAMQKATNID
Sbjct  61   QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGASAMKAMQKATNID  120

Query  563  DVDXTMDE  586
            DVD TMDE
Sbjct  121  DVDKTMDE  128



>ref|XP_010086896.1| Vacuolar protein sorting-associated protein 32-2-like protein 
[Morus notabilis]
 gb|EXB24687.1| Vacuolar protein sorting-associated protein 32-2-like protein 
[Morus notabilis]
Length=283

 Score =   192 bits (488),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 124/129 (96%), Positives = 128/129 (99%), Gaps = 0/129 (0%)
 Frame = +2

Query  200  TMFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAA  379
            TMFTRIFGKPKQETNALATLDKLNETLEMLEKKEKVLQKKA+AEVE+AKEFTRAKNK+AA
Sbjct  65   TMFTRIFGKPKQETNALATLDKLNETLEMLEKKEKVLQKKASAEVERAKEFTRAKNKKAA  124

Query  380  IQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNI  559
            IQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGA+AMKAMQKATNI
Sbjct  125  IQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGASAMKAMQKATNI  184

Query  560  DDVDXTMDE  586
            DDVD TMDE
Sbjct  185  DDVDKTMDE  193



>emb|CDP03214.1| unnamed protein product [Coffea canephora]
Length=220

 Score =   189 bits (481),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 123/128 (96%), Positives = 126/128 (98%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            MFTRIFGKPKQETNA+ TLDKLNETLEMLEKKEKVLQKKA+AEVEKAKEFTRAKNKRAAI
Sbjct  1    MFTRIFGKPKQETNAVTTLDKLNETLEMLEKKEKVLQKKASAEVEKAKEFTRAKNKRAAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGA+AMKAMQKATNID
Sbjct  61   QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGASAMKAMQKATNID  120

Query  563  DVDXTMDE  586
            DVD TMDE
Sbjct  121  DVDKTMDE  128



>ref|XP_009765362.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Nicotiana sylvestris]
Length=218

 Score =   189 bits (481),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 122/128 (95%), Positives = 127/128 (99%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            MF++IFGKPKQETNALATLDKLNETLEMLEKKEKVLQKKA+AEVEKAK+FTRAKNKRAAI
Sbjct  1    MFSKIFGKPKQETNALATLDKLNETLEMLEKKEKVLQKKASAEVEKAKDFTRAKNKRAAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGA+AMKAMQKATNID
Sbjct  61   QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGASAMKAMQKATNID  120

Query  563  DVDXTMDE  586
            DVD TMDE
Sbjct  121  DVDKTMDE  128



>ref|XP_009593196.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Nicotiana tomentosiformis]
 ref|XP_009593197.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Nicotiana tomentosiformis]
Length=218

 Score =   189 bits (479),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 122/128 (95%), Positives = 127/128 (99%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            MF++IFGKPKQETNALATLDKLNETLEMLEKKEKVLQKKA+AEVEKAK+FTRAKNKRAAI
Sbjct  1    MFSKIFGKPKQETNALATLDKLNETLEMLEKKEKVLQKKASAEVEKAKDFTRAKNKRAAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGA+AMKAMQKATNID
Sbjct  61   QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGASAMKAMQKATNID  120

Query  563  DVDXTMDE  586
            DVD TMDE
Sbjct  121  DVDKTMDE  128



>ref|XP_004239323.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Solanum lycopersicum]
Length=218

 Score =   188 bits (478),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 121/128 (95%), Positives = 125/128 (98%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            MF+RIFGKPKQETNAL TLDKLNETLEMLEKKEKVLQKKA+ EVEKAK+FTRAKNKRAAI
Sbjct  1    MFSRIFGKPKQETNALMTLDKLNETLEMLEKKEKVLQKKASTEVEKAKDFTRAKNKRAAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGA+AMKAMQKATNID
Sbjct  61   QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGASAMKAMQKATNID  120

Query  563  DVDXTMDE  586
            DVD TMDE
Sbjct  121  DVDKTMDE  128



>gb|AFK48250.1| unknown [Lotus japonicus]
Length=218

 Score =   188 bits (477),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 119/128 (93%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            MFTRIFGKPKQE NALATLDKLNETL+MLEKKEKVL KKA+ EVEKAK+FT+AKNKRAAI
Sbjct  1    MFTRIFGKPKQEANALATLDKLNETLDMLEKKEKVLIKKASQEVEKAKDFTKAKNKRAAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGA+AMKAMQKATNID
Sbjct  61   QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGASAMKAMQKATNID  120

Query  563  DVDXTMDE  586
            DVD TMDE
Sbjct  121  DVDKTMDE  128



>ref|XP_010267087.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Nelumbo nucifera]
Length=218

 Score =   187 bits (476),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 120/128 (94%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            MFTR+FGKPKQETNAL TLDKLNETLEMLEKKE VL KKAA+EVEKAKEFTRAKNKRAAI
Sbjct  1    MFTRLFGKPKQETNALETLDKLNETLEMLEKKENVLLKKAASEVEKAKEFTRAKNKRAAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            QCLKRK+LYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGA+AMKAMQKATNID
Sbjct  61   QCLKRKKLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGASAMKAMQKATNID  120

Query  563  DVDXTMDE  586
            DVD TMDE
Sbjct  121  DVDKTMDE  128



>ref|XP_006338191.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Solanum tuberosum]
Length=218

 Score =   187 bits (474),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 120/128 (94%), Positives = 125/128 (98%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            MF+R+FGKPKQETNAL TLDKLNETLEMLEKKEKVLQKKA+ EVEKAK+FTRAKNKRAAI
Sbjct  1    MFSRMFGKPKQETNALMTLDKLNETLEMLEKKEKVLQKKASTEVEKAKDFTRAKNKRAAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGA+AMKAMQKATNID
Sbjct  61   QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGASAMKAMQKATNID  120

Query  563  DVDXTMDE  586
            DVD TMDE
Sbjct  121  DVDKTMDE  128



>ref|XP_004503518.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like isoform X1 [Cicer arietinum]
 ref|XP_004503519.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like isoform X2 [Cicer arietinum]
 ref|XP_004503520.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like isoform X3 [Cicer arietinum]
 ref|XP_004503521.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like isoform X4 [Cicer arietinum]
Length=218

 Score =   186 bits (473),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 121/128 (95%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            MFTRIFGKPKQE NAL TLDKLNETLEMLEKKEKVL KK+AAEVEKAKEFTRAKNKRAAI
Sbjct  1    MFTRIFGKPKQEANALTTLDKLNETLEMLEKKEKVLLKKSAAEVEKAKEFTRAKNKRAAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATT+TVDALRTGA+AMKAMQKATNID
Sbjct  61   QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTDTVDALRTGASAMKAMQKATNID  120

Query  563  DVDXTMDE  586
            DVD TMDE
Sbjct  121  DVDKTMDE  128



>gb|AFK45318.1| unknown [Lotus japonicus]
Length=218

 Score =   186 bits (471),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 121/128 (95%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            MFTRIFGKPKQE NAL T DKLNETLEMLEKKEKVL KKA+AEVEKAKEFTRAKNKRAAI
Sbjct  1    MFTRIFGKPKQEANALTTFDKLNETLEMLEKKEKVLLKKASAEVEKAKEFTRAKNKRAAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGA+AMKAMQKATNID
Sbjct  61   QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGASAMKAMQKATNID  120

Query  563  DVDXTMDE  586
            DVD TMDE
Sbjct  121  DVDKTMDE  128



>ref|XP_007152939.1| hypothetical protein PHAVU_004G173000g [Phaseolus vulgaris]
 gb|ESW24933.1| hypothetical protein PHAVU_004G173000g [Phaseolus vulgaris]
Length=218

 Score =   185 bits (469),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 119/128 (93%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            MF+R+FGKPKQETNA+ATLDKLNETLEMLEKKEKVL KK +AEVEKAKEFTR KNKRAAI
Sbjct  1    MFSRMFGKPKQETNAVATLDKLNETLEMLEKKEKVLLKKVSAEVEKAKEFTRGKNKRAAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAA MKAMQKATNID
Sbjct  61   QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAATMKAMQKATNID  120

Query  563  DVDXTMDE  586
            DVD TMDE
Sbjct  121  DVDKTMDE  128



>ref|XP_008459153.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Cucumis melo]
 ref|XP_008459161.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Cucumis melo]
 ref|XP_008459166.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Cucumis melo]
Length=218

 Score =   185 bits (469),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 117/128 (91%), Positives = 122/128 (95%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            MF R+FGKPKQE NALATL+KL+ETLEMLEKKE VL KKAAAEVE+AKEFTR KNKRAAI
Sbjct  1    MFNRLFGKPKQEANALATLEKLSETLEMLEKKENVLVKKAAAEVERAKEFTRVKNKRAAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGA+AMKAMQKATNID
Sbjct  61   QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGASAMKAMQKATNID  120

Query  563  DVDXTMDE  586
            DVD TMDE
Sbjct  121  DVDKTMDE  128



>ref|XP_002275998.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Vitis vinifera]
 emb|CAN68229.1| hypothetical protein VITISV_026042 [Vitis vinifera]
 emb|CBI20606.3| unnamed protein product [Vitis vinifera]
Length=216

 Score =   185 bits (469),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 120/128 (94%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            MFTR+FGKPKQE NAL TLDKLNETLEMLEKKE VL KKAAAEVEKAKEFTRAKNKRAAI
Sbjct  1    MFTRLFGKPKQEANALTTLDKLNETLEMLEKKEGVLLKKAAAEVEKAKEFTRAKNKRAAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            QCLKRKRLYEQQIEQLGNFQLRIHDQMI+LEGAKATTETVDALRTGA+AMKAMQKATNID
Sbjct  61   QCLKRKRLYEQQIEQLGNFQLRIHDQMILLEGAKATTETVDALRTGASAMKAMQKATNID  120

Query  563  DVDXTMDE  586
            DVD TMDE
Sbjct  121  DVDKTMDE  128



>ref|XP_004141038.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Cucumis sativus]
 ref|XP_004157906.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Cucumis sativus]
 gb|KGN60554.1| hypothetical protein Csa_2G000620 [Cucumis sativus]
Length=218

 Score =   184 bits (468),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 117/128 (91%), Positives = 122/128 (95%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            MF R+FGKPKQE NALATL+KL+ETLEMLEKKE VL KKAAAEVE+AKEFTR KNKRAAI
Sbjct  1    MFNRLFGKPKQEANALATLEKLSETLEMLEKKENVLVKKAAAEVERAKEFTRGKNKRAAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGA+AMKAMQKATNID
Sbjct  61   QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGASAMKAMQKATNID  120

Query  563  DVDXTMDE  586
            DVD TMDE
Sbjct  121  DVDKTMDE  128



>ref|XP_010929019.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Elaeis guineensis]
Length=221

 Score =   184 bits (467),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 115/128 (90%), Positives = 125/128 (98%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            MF+RIFGKPK++TNALATLDKLNETLE+LEK+EKVL KK AAEVE+AKEFTRAKNKRAAI
Sbjct  4    MFSRIFGKPKEQTNALATLDKLNETLELLEKREKVLLKKVAAEVERAKEFTRAKNKRAAI  63

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            QCLK+KR+YEQQ+EQLGNFQLRIHDQMIMLEGAKATTETVDALRTGA+AMKAMQKATNID
Sbjct  64   QCLKKKRIYEQQVEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGASAMKAMQKATNID  123

Query  563  DVDXTMDE  586
            DVD TMDE
Sbjct  124  DVDKTMDE  131



>ref|XP_006584796.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like isoform X1 [Glycine max]
 ref|XP_006584797.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like isoform X2 [Glycine max]
 ref|XP_006584798.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like isoform X3 [Glycine max]
 gb|KHN16666.1| Vacuolar protein sorting-associated protein 32 like 1 [Glycine 
soja]
Length=218

 Score =   183 bits (465),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 120/128 (94%), Positives = 122/128 (95%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            MFTRIFGKPKQE N L TLDKLNETLEMLEKKEKVL KKAAAEVEKAKEFTRAKNKRAAI
Sbjct  1    MFTRIFGKPKQEANTLTTLDKLNETLEMLEKKEKVLLKKAAAEVEKAKEFTRAKNKRAAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            QCLKRKRLYEQ +EQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAM+AMQKATNID
Sbjct  61   QCLKRKRLYEQHVEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMRAMQKATNID  120

Query  563  DVDXTMDE  586
            DVD TMDE
Sbjct  121  DVDKTMDE  128



>ref|XP_004503516.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like isoform X1 [Cicer arietinum]
 ref|XP_004503517.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like isoform X2 [Cicer arietinum]
Length=218

 Score =   183 bits (464),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 120/128 (94%), Positives = 121/128 (95%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            MF+RIFGKPKQE N L TLDKLNETLEMLEKKEKVL KKA AEVEKAKEFTRAKNKRAAI
Sbjct  1    MFSRIFGKPKQEANTLTTLDKLNETLEMLEKKEKVLLKKAGAEVEKAKEFTRAKNKRAAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAA MKAMQKATNID
Sbjct  61   QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAATMKAMQKATNID  120

Query  563  DVDXTMDE  586
            DVD TMDE
Sbjct  121  DVDKTMDE  128



>ref|XP_006451366.1| hypothetical protein CICLE_v10009534mg [Citrus clementina]
 ref|XP_006451367.1| hypothetical protein CICLE_v10009534mg [Citrus clementina]
 ref|XP_006475370.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Citrus sinensis]
 gb|ESR64606.1| hypothetical protein CICLE_v10009534mg [Citrus clementina]
 gb|ESR64607.1| hypothetical protein CICLE_v10009534mg [Citrus clementina]
 gb|KDO55910.1| hypothetical protein CISIN_1g027751mg [Citrus sinensis]
 gb|KDO55911.1| hypothetical protein CISIN_1g027751mg [Citrus sinensis]
 gb|KDO55912.1| hypothetical protein CISIN_1g027751mg [Citrus sinensis]
 gb|KDO55913.1| hypothetical protein CISIN_1g027751mg [Citrus sinensis]
 gb|KDO55914.1| hypothetical protein CISIN_1g027751mg [Citrus sinensis]
Length=219

 Score =   183 bits (464),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 116/128 (91%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            MFTR+FGKPKQETNAL TLDKLNETLEMLEKKEKVL KKA+ EVEKAK++++AKNKRAAI
Sbjct  1    MFTRLFGKPKQETNALTTLDKLNETLEMLEKKEKVLLKKASVEVEKAKDYSKAKNKRAAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGA+ MKAMQKATNID
Sbjct  61   QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGASTMKAMQKATNID  120

Query  563  DVDXTMDE  586
            DVD TMDE
Sbjct  121  DVDKTMDE  128



>ref|XP_007012940.1| Vacuolar protein sorting-associated protein 32 isoform 1 [Theobroma 
cacao]
 ref|XP_007012941.1| Vacuolar protein sorting-associated protein 32 isoform 1 [Theobroma 
cacao]
 gb|EOY30559.1| Vacuolar protein sorting-associated protein 32 isoform 1 [Theobroma 
cacao]
 gb|EOY30560.1| Vacuolar protein sorting-associated protein 32 isoform 1 [Theobroma 
cacao]
Length=218

 Score =   180 bits (457),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 118/128 (92%), Positives = 122/128 (95%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            MF R+FGKPKQETNAL TLDKLNETLEMLEKKEKVL KKAAAEVEKAKEF + +NKRAAI
Sbjct  1    MFNRLFGKPKQETNALTTLDKLNETLEMLEKKEKVLVKKAAAEVEKAKEFAKGRNKRAAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGA+AMKAMQKATNID
Sbjct  61   QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGASAMKAMQKATNID  120

Query  563  DVDXTMDE  586
            DVD TMDE
Sbjct  121  DVDKTMDE  128



>gb|KJB54326.1| hypothetical protein B456_009G029400 [Gossypium raimondii]
Length=159

 Score =   178 bits (452),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 115/128 (90%), Positives = 122/128 (95%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            MF R+ GKPKQE NAL +LDKL+ETLEMLEKKEKVL KKA+AEVEKAKEFT+AKNKRAAI
Sbjct  1    MFNRLLGKPKQEPNALTSLDKLHETLEMLEKKEKVLLKKASAEVEKAKEFTKAKNKRAAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALR+GA+AMKAMQKATNID
Sbjct  61   QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRSGASAMKAMQKATNID  120

Query  563  DVDXTMDE  586
            DVD TMDE
Sbjct  121  DVDKTMDE  128



>ref|XP_010447884.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Camelina sativa]
Length=218

 Score =   180 bits (457),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 115/128 (90%), Positives = 121/128 (95%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            M  R+FGKPKQE+NAL TLDKLNETLEMLEKKEKVL KKA  EVEKAKE+TRAKNKRAAI
Sbjct  1    MMNRLFGKPKQESNALQTLDKLNETLEMLEKKEKVLLKKAGQEVEKAKEYTRAKNKRAAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            QCLKRKRLYEQQ+EQLGNFQLRIHDQMIMLEGAKATTETVDALR+GA+AMKAMQKATNID
Sbjct  61   QCLKRKRLYEQQVEQLGNFQLRIHDQMIMLEGAKATTETVDALRSGASAMKAMQKATNID  120

Query  563  DVDXTMDE  586
            DVD TMDE
Sbjct  121  DVDKTMDE  128



>ref|XP_010433129.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Camelina sativa]
Length=218

 Score =   180 bits (456),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 115/128 (90%), Positives = 121/128 (95%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            M  R+FGKPKQE+NAL TLDKLNETLEMLEKKEKVL KKA  EVEKAKE+TRAKNKRAAI
Sbjct  1    MMNRLFGKPKQESNALQTLDKLNETLEMLEKKEKVLLKKAGQEVEKAKEYTRAKNKRAAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            QCLKRKRLYEQQ+EQLGNFQLRIHDQMIMLEGAKATTETVDALR+GA+AMKAMQKATNID
Sbjct  61   QCLKRKRLYEQQVEQLGNFQLRIHDQMIMLEGAKATTETVDALRSGASAMKAMQKATNID  120

Query  563  DVDXTMDE  586
            DVD TMDE
Sbjct  121  DVDKTMDE  128



>ref|XP_006412871.1| hypothetical protein EUTSA_v10026202mg [Eutrema salsugineum]
 ref|XP_006412872.1| hypothetical protein EUTSA_v10026202mg [Eutrema salsugineum]
 ref|XP_006412873.1| hypothetical protein EUTSA_v10026202mg [Eutrema salsugineum]
 ref|XP_006412874.1| hypothetical protein EUTSA_v10026202mg [Eutrema salsugineum]
 gb|ESQ54324.1| hypothetical protein EUTSA_v10026202mg [Eutrema salsugineum]
 gb|ESQ54325.1| hypothetical protein EUTSA_v10026202mg [Eutrema salsugineum]
 gb|ESQ54326.1| hypothetical protein EUTSA_v10026202mg [Eutrema salsugineum]
 gb|ESQ54327.1| hypothetical protein EUTSA_v10026202mg [Eutrema salsugineum]
Length=218

 Score =   180 bits (456),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 115/128 (90%), Positives = 121/128 (95%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            M  R+FGKPKQE+NAL TLDKLNETLEMLEKKEKVL KKA  EVEKAKE+TRAKNKRAAI
Sbjct  1    MMNRLFGKPKQESNALQTLDKLNETLEMLEKKEKVLLKKAGQEVEKAKEYTRAKNKRAAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            QCLKRKRLYEQQ+EQLGNFQLRIHDQMIMLEGAKATTETVDALR+GA+AMKAMQKATNID
Sbjct  61   QCLKRKRLYEQQVEQLGNFQLRIHDQMIMLEGAKATTETVDALRSGASAMKAMQKATNID  120

Query  563  DVDXTMDE  586
            DVD TMDE
Sbjct  121  DVDKTMDE  128



>ref|XP_003525301.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like isoformX2 [Glycine max]
 gb|KHM99831.1| Vacuolar protein sorting-associated protein 32 like 1 [Glycine 
soja]
Length=218

 Score =   179 bits (454),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 116/128 (91%), Positives = 119/128 (93%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            MFTRIFGKPK E N L  LD+LN+ LEMLEKKEKVL KKAAAEVEKAKEFTRAKNKRAAI
Sbjct  1    MFTRIFGKPKPEVNTLTALDELNDKLEMLEKKEKVLLKKAAAEVEKAKEFTRAKNKRAAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAM+AMQK TNID
Sbjct  61   QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMRAMQKETNID  120

Query  563  DVDXTMDE  586
            DVD TMDE
Sbjct  121  DVDKTMDE  128



>ref|XP_010438334.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Camelina sativa]
Length=218

 Score =   179 bits (453),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 114/128 (89%), Positives = 121/128 (95%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            M  R+FGKPKQE+NAL TLDKLNETLEMLEKKEKVL KKA  EVEKAKE+TRAKNKR+AI
Sbjct  1    MMNRLFGKPKQESNALQTLDKLNETLEMLEKKEKVLLKKAGQEVEKAKEYTRAKNKRSAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            QCLKRKRLYEQQ+EQLGNFQLRIHDQMIMLEGAKATTETVDALR+GA+AMKAMQKATNID
Sbjct  61   QCLKRKRLYEQQVEQLGNFQLRIHDQMIMLEGAKATTETVDALRSGASAMKAMQKATNID  120

Query  563  DVDXTMDE  586
            DVD TMDE
Sbjct  121  DVDKTMDE  128



>ref|XP_004513085.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Cicer arietinum]
Length=219

 Score =   179 bits (453),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 118/129 (91%), Positives = 123/129 (95%), Gaps = 1/129 (1%)
 Frame = +2

Query  203  MFTRIFGKPKQET-NALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAA  379
            MF+R+FGKPKQET NA+ATLDKLNETLEMLEKKEKVL KKA AEVEKAKEFT+ KNK+AA
Sbjct  1    MFSRVFGKPKQETSNAVATLDKLNETLEMLEKKEKVLLKKAGAEVEKAKEFTKGKNKKAA  60

Query  380  IQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNI  559
            IQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAA MKAMQKATNI
Sbjct  61   IQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAATMKAMQKATNI  120

Query  560  DDVDXTMDE  586
            DDVD TMDE
Sbjct  121  DDVDKTMDE  129



>ref|XP_011008899.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Populus euphratica]
 ref|XP_011008900.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Populus euphratica]
Length=215

 Score =   178 bits (452),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 118/128 (92%), Positives = 122/128 (95%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            MF R+FGKPKQETNAL +LDKLNETLEMLEKKEKVL KKAAAEVEKAKE+TR KNKRAAI
Sbjct  1    MFNRLFGKPKQETNALTSLDKLNETLEMLEKKEKVLVKKAAAEVEKAKEYTRGKNKRAAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            QCLKRKRL EQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGA+AMKAMQKATNID
Sbjct  61   QCLKRKRLDEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGASAMKAMQKATNID  120

Query  563  DVDXTMDE  586
            DVD TMDE
Sbjct  121  DVDKTMDE  128



>gb|KJB54324.1| hypothetical protein B456_009G029400 [Gossypium raimondii]
 gb|KJB54325.1| hypothetical protein B456_009G029400 [Gossypium raimondii]
Length=219

 Score =   178 bits (452),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 115/128 (90%), Positives = 122/128 (95%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            MF R+ GKPKQE NAL +LDKL+ETLEMLEKKEKVL KKA+AEVEKAKEFT+AKNKRAAI
Sbjct  1    MFNRLLGKPKQEPNALTSLDKLHETLEMLEKKEKVLLKKASAEVEKAKEFTKAKNKRAAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALR+GA+AMKAMQKATNID
Sbjct  61   QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRSGASAMKAMQKATNID  120

Query  563  DVDXTMDE  586
            DVD TMDE
Sbjct  121  DVDKTMDE  128



>ref|XP_009137831.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Brassica rapa]
 emb|CDY30232.1| BnaA03g49380D [Brassica napus]
Length=213

 Score =   178 bits (452),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 115/128 (90%), Positives = 120/128 (94%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            M  R+FGKPK ETNAL TLDKLNETLEMLEKKEKVL KKA  EVEKAKE+TRAKNKRAAI
Sbjct  1    MMNRLFGKPKPETNALQTLDKLNETLEMLEKKEKVLLKKAGQEVEKAKEYTRAKNKRAAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            QCLKRKRLYEQQ+EQLGNFQLRIHDQMIMLEGAKATTETVDALR+GA+AMKAMQKATNID
Sbjct  61   QCLKRKRLYEQQVEQLGNFQLRIHDQMIMLEGAKATTETVDALRSGASAMKAMQKATNID  120

Query  563  DVDXTMDE  586
            DVD TMDE
Sbjct  121  DVDKTMDE  128



>ref|XP_006371958.1| hypothetical protein POPTR_0018s06680g [Populus trichocarpa]
 gb|ERP49755.1| hypothetical protein POPTR_0018s06680g [Populus trichocarpa]
Length=215

 Score =   178 bits (451),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 117/128 (91%), Positives = 122/128 (95%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            MF R+FGKPK E++AL +LDKLNETLEMLEKKEKVL KKAAAEVEKAKEFTR KNKRAAI
Sbjct  1    MFNRLFGKPKLESSALTSLDKLNETLEMLEKKEKVLVKKAAAEVEKAKEFTRGKNKRAAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGA+AMKAMQKATNID
Sbjct  61   QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGASAMKAMQKATNID  120

Query  563  DVDXTMDE  586
            DVD TMDE
Sbjct  121  DVDKTMDE  128



>ref|XP_006284502.1| hypothetical protein CARUB_v10005703mg [Capsella rubella]
 ref|XP_006284503.1| hypothetical protein CARUB_v10005703mg [Capsella rubella]
 gb|EOA17400.1| hypothetical protein CARUB_v10005703mg [Capsella rubella]
 gb|EOA17401.1| hypothetical protein CARUB_v10005703mg [Capsella rubella]
Length=218

 Score =   178 bits (451),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 113/128 (88%), Positives = 121/128 (95%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            M  R+FGKPKQE+NAL TLDKLNETLEMLEKKEKVL KKA  EVEKAKE++R+KNKRAAI
Sbjct  1    MMNRLFGKPKQESNALQTLDKLNETLEMLEKKEKVLLKKAGQEVEKAKEYSRSKNKRAAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            QCLKRKRLYEQQ+EQLGNFQLRIHDQMIMLEGAKATTETVDALR+GA+AMKAMQKATNID
Sbjct  61   QCLKRKRLYEQQVEQLGNFQLRIHDQMIMLEGAKATTETVDALRSGASAMKAMQKATNID  120

Query  563  DVDXTMDE  586
            DVD TMDE
Sbjct  121  DVDKTMDE  128



>emb|CDY47783.1| BnaC07g41770D [Brassica napus]
Length=213

 Score =   177 bits (450),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 114/128 (89%), Positives = 120/128 (94%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            M  R+FGKPK ETNAL TLDKLNETLEMLEKKEKVL KKA  EVEKAKE+TR+KNKRAAI
Sbjct  1    MMNRLFGKPKPETNALQTLDKLNETLEMLEKKEKVLLKKAGQEVEKAKEYTRSKNKRAAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            QCLKRKRLYEQQ+EQLGNFQLRIHDQMIMLEGAKATTETVDALR+GA+AMKAMQKATNID
Sbjct  61   QCLKRKRLYEQQVEQLGNFQLRIHDQMIMLEGAKATTETVDALRSGASAMKAMQKATNID  120

Query  563  DVDXTMDE  586
            DVD TMDE
Sbjct  121  DVDKTMDE  128



>gb|AFK38664.1| unknown [Medicago truncatula]
 gb|KEH27240.1| charged multivesicular body protein [Medicago truncatula]
Length=220

 Score =   177 bits (449),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 117/130 (90%), Positives = 123/130 (95%), Gaps = 2/130 (2%)
 Frame = +2

Query  203  MFTRIFGKPKQET--NALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRA  376
            MFTR+FGKPKQ+T  NALATLDKLNETLEMLEKKE VL KKAAAEVEKAKE+T+ KNK+A
Sbjct  1    MFTRVFGKPKQDTSSNALATLDKLNETLEMLEKKENVLLKKAAAEVEKAKEYTKRKNKKA  60

Query  377  AIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATN  556
            AIQCLKRKRLYEQQ+EQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAA MKAMQKATN
Sbjct  61   AIQCLKRKRLYEQQVEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAATMKAMQKATN  120

Query  557  IDDVDXTMDE  586
            IDDVD TMDE
Sbjct  121  IDDVDKTMDE  130



>ref|XP_006371957.1| SNF7 family protein [Populus trichocarpa]
 gb|ERP49754.1| SNF7 family protein [Populus trichocarpa]
Length=207

 Score =   177 bits (448),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 117/128 (91%), Positives = 122/128 (95%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            MF R+FGKPK E++AL +LDKLNETLEMLEKKEKVL KKAAAEVEKAKEFTR KNKRAAI
Sbjct  1    MFNRLFGKPKLESSALTSLDKLNETLEMLEKKEKVLVKKAAAEVEKAKEFTRGKNKRAAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGA+AMKAMQKATNID
Sbjct  61   QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGASAMKAMQKATNID  120

Query  563  DVDXTMDE  586
            DVD TMDE
Sbjct  121  DVDKTMDE  128



>emb|CDY03333.1| BnaC09g10150D [Brassica napus]
Length=212

 Score =   176 bits (447),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 114/128 (89%), Positives = 119/128 (93%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            MF R+FGKPK ETN L TLDKLNETLEMLEKKE VL KKAA EVE+AKEF++AKNKRAAI
Sbjct  1    MFNRLFGKPKVETNTLHTLDKLNETLEMLEKKEGVLLKKAAGEVERAKEFSKAKNKRAAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            QCLKRKRLYEQQ+EQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAA MKAMQKATNID
Sbjct  61   QCLKRKRLYEQQVEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAATMKAMQKATNID  120

Query  563  DVDXTMDE  586
            DVD TMDE
Sbjct  121  DVDKTMDE  128



>ref|XP_009112635.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
1-like [Brassica rapa]
 ref|XP_009112636.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
1-like [Brassica rapa]
Length=212

 Score =   176 bits (447),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 114/128 (89%), Positives = 119/128 (93%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            MF R+FGKPK ETN L TLDKLNETLEMLEKKE VL KKAA EVE+AKEF++AKNKRAAI
Sbjct  1    MFNRLFGKPKVETNTLHTLDKLNETLEMLEKKEGVLLKKAAGEVERAKEFSKAKNKRAAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            QCLKRKRLYEQQ+EQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAA MKAMQKATNID
Sbjct  61   QCLKRKRLYEQQVEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAATMKAMQKATNID  120

Query  563  DVDXTMDE  586
            DVD TMDE
Sbjct  121  DVDKTMDE  128



>emb|CDY48731.1| BnaA09g10060D [Brassica napus]
Length=212

 Score =   176 bits (447),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 114/128 (89%), Positives = 119/128 (93%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            MF R+FGKPK ETN L TLDKLNETLEMLEKKE VL KKAA EVE+AKEF++AKNKRAAI
Sbjct  1    MFNRLFGKPKVETNTLHTLDKLNETLEMLEKKEGVLLKKAAGEVERAKEFSKAKNKRAAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            QCLKRKRLYEQQ+EQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAA MKAMQKATNID
Sbjct  61   QCLKRKRLYEQQVEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAATMKAMQKATNID  120

Query  563  DVDXTMDE  586
            DVD TMDE
Sbjct  121  DVDKTMDE  128



>emb|CDY06832.1| BnaC01g09310D [Brassica napus]
Length=212

 Score =   176 bits (447),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 114/128 (89%), Positives = 119/128 (93%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            M  R+FGKPK E NAL TLDKLNETLEMLEKKEKVL KKA  EVEKAKE+TRAKNKRAAI
Sbjct  1    MMNRLFGKPKHEGNALQTLDKLNETLEMLEKKEKVLLKKAGQEVEKAKEYTRAKNKRAAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            QCLKRKRLYEQQ+EQLGNFQLRIHDQMIMLEGAKATTETVDALR+GA+AMKAMQKATNID
Sbjct  61   QCLKRKRLYEQQVEQLGNFQLRIHDQMIMLEGAKATTETVDALRSGASAMKAMQKATNID  120

Query  563  DVDXTMDE  586
            DVD TMDE
Sbjct  121  DVDKTMDE  128



>gb|KJB83083.1| hypothetical protein B456_013G228900 [Gossypium raimondii]
Length=218

 Score =   176 bits (447),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 116/128 (91%), Positives = 121/128 (95%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            MF R+F KPKQETNAL TLDKLNETLEMLEKKEKVL KKAAAEVEKAKE  +A+NKRAA+
Sbjct  1    MFNRLFRKPKQETNALTTLDKLNETLEMLEKKEKVLAKKAAAEVEKAKELAKARNKRAAV  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGA+AMKAMQKATNID
Sbjct  61   QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGASAMKAMQKATNID  120

Query  563  DVDXTMDE  586
            DVD TMDE
Sbjct  121  DVDKTMDE  128



>gb|KHG00434.1| Vacuolar sorting-associated protein 32 -like protein [Gossypium 
arboreum]
Length=219

 Score =   176 bits (447),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 114/128 (89%), Positives = 121/128 (95%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            MF R+ GKPKQE NAL +LDKL+ETLEMLEKKEKVL KKA+AEVEKAKEFT+AKNKRAAI
Sbjct  1    MFNRLLGKPKQEPNALTSLDKLHETLEMLEKKEKVLLKKASAEVEKAKEFTKAKNKRAAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE AKATTETVDALR+GA+AMKAMQKATNID
Sbjct  61   QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEAAKATTETVDALRSGASAMKAMQKATNID  120

Query  563  DVDXTMDE  586
            DVD TMDE
Sbjct  121  DVDKTMDE  128



>ref|NP_179573.1| vacuolar protein sorting-associated protein 32-1 [Arabidopsis 
thaliana]
 sp|O82197.1|VP321_ARATH RecName: Full=Vacuolar protein sorting-associated protein 32 
homolog 1; Short=AtVPS32-1; AltName: Full=Charged multivesicular 
body protein 4 homolog 1; AltName: Full=ESCRT-III complex 
subunit VPS32 homolog 1 [Arabidopsis thaliana]
 gb|AAC62133.1| copia-like retroelement pol polyprotein [Arabidopsis thaliana]
 gb|AAK76585.1| putative copia retroelement pol polyprotein [Arabidopsis thaliana]
 gb|AAL85152.1| putative copia retroelement pol polyprotein [Arabidopsis thaliana]
 gb|AEC06931.1| vacuolar protein sorting-associated protein 32-1 [Arabidopsis 
thaliana]
Length=213

 Score =   176 bits (446),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 115/129 (89%), Positives = 120/129 (93%), Gaps = 1/129 (1%)
 Frame = +2

Query  203  MF-TRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAA  379
            MF  R+FGKPKQET+ L TLDKLNETLEMLEKKE VL KKA  EVEKAKEF+RAKNKRAA
Sbjct  1    MFMNRLFGKPKQETSTLQTLDKLNETLEMLEKKENVLLKKATGEVEKAKEFSRAKNKRAA  60

Query  380  IQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNI  559
            IQCLKRKRLYEQQ+EQLGNFQLRIHDQMIMLEGAKATTETVDALRTGA+AMKAMQKATNI
Sbjct  61   IQCLKRKRLYEQQVEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGASAMKAMQKATNI  120

Query  560  DDVDXTMDE  586
            DDVD TMDE
Sbjct  121  DDVDKTMDE  129



>ref|XP_006408902.1| hypothetical protein EUTSA_v10002096mg [Eutrema salsugineum]
 gb|ESQ50355.1| hypothetical protein EUTSA_v10002096mg [Eutrema salsugineum]
Length=215

 Score =   176 bits (446),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 113/128 (88%), Positives = 118/128 (92%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            M  R+FGKPKQETN L TLDKLNETLEMLEKKE VL KKAA EVE+AKEF+R KNKRAAI
Sbjct  1    MLNRLFGKPKQETNTLQTLDKLNETLEMLEKKENVLLKKAAGEVERAKEFSRVKNKRAAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            QCLKRKRLYEQQ+EQLGNFQLRIHDQMIMLEGAKATTETVDALRTGA+ MKAMQKATNID
Sbjct  61   QCLKRKRLYEQQVEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGASTMKAMQKATNID  120

Query  563  DVDXTMDE  586
            DVD TMDE
Sbjct  121  DVDKTMDE  128



>ref|XP_009128967.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Brassica rapa]
Length=212

 Score =   176 bits (445),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 113/128 (88%), Positives = 119/128 (93%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            M  R+FGKPK E NAL TLDKLNETLEMLEKKEKVL KKA  EVEKAKE+TRAKNKR+AI
Sbjct  1    MMNRLFGKPKHEGNALQTLDKLNETLEMLEKKEKVLLKKAGQEVEKAKEYTRAKNKRSAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            QCLKRKRLYEQQ+EQLGNFQLRIHDQMIMLEGAKATTETVDALR+GA+AMKAMQKATNID
Sbjct  61   QCLKRKRLYEQQVEQLGNFQLRIHDQMIMLEGAKATTETVDALRSGASAMKAMQKATNID  120

Query  563  DVDXTMDE  586
            DVD TMDE
Sbjct  121  DVDKTMDE  128



>ref|NP_194645.1| vacuolar protein sorting-associated protein 32-2 [Arabidopsis 
thaliana]
 ref|NP_001078468.1| vacuolar protein sorting-associated protein 32-2 [Arabidopsis 
thaliana]
 sp|Q9SZE4.1|VP322_ARATH RecName: Full=Vacuolar protein sorting-associated protein 32 
homolog 2; Short=AtVPS32-2; AltName: Full=Charged multivesicular 
body protein 4 homolog 2; AltName: Full=ESCRT-III complex 
subunit VPS32 homolog 2 [Arabidopsis thaliana]
 emb|CAB43930.1| putative protein [Arabidopsis thaliana]
 emb|CAB79674.1| putative protein [Arabidopsis thaliana]
 gb|AAK68793.1| putative protein [Arabidopsis thaliana]
 gb|AAL66905.1| putative protein [Arabidopsis thaliana]
 gb|AEE85593.1| vacuolar protein sorting-associated protein 32-2 [Arabidopsis 
thaliana]
 gb|AEE85595.1| vacuolar protein sorting-associated protein 32-2 [Arabidopsis 
thaliana]
Length=219

 Score =   175 bits (444),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 114/128 (89%), Positives = 120/128 (94%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            M  R+FGKPKQE NAL TLDKLNETLEMLEKKEKVL KKA AEVEKAKE++RAKNKRAAI
Sbjct  1    MMNRLFGKPKQEANALQTLDKLNETLEMLEKKEKVLLKKAGAEVEKAKEYSRAKNKRAAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            QCLKRKRLYE Q+EQLGNFQLRIHDQMIMLEGAKATTETVDALR+GA+AMKAMQKATNID
Sbjct  61   QCLKRKRLYEGQVEQLGNFQLRIHDQMIMLEGAKATTETVDALRSGASAMKAMQKATNID  120

Query  563  DVDXTMDE  586
            DVD TMDE
Sbjct  121  DVDKTMDE  128



>ref|XP_010526425.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Tarenaya hassleriana]
 ref|XP_010526426.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Tarenaya hassleriana]
 ref|XP_010526428.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Tarenaya hassleriana]
 ref|XP_010526429.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Tarenaya hassleriana]
 ref|XP_010526430.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Tarenaya hassleriana]
Length=220

 Score =   175 bits (444),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 117/129 (91%), Positives = 122/129 (95%), Gaps = 1/129 (1%)
 Frame = +2

Query  203  MFT-RIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAA  379
            MF  R+FGKPK E+NAL TLDKLNETLEMLEKKEKVL KKA+AEVEKAKEFTR KNKRAA
Sbjct  1    MFVNRLFGKPKPESNALQTLDKLNETLEMLEKKEKVLLKKASAEVEKAKEFTRLKNKRAA  60

Query  380  IQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNI  559
            IQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALR+GA+AMKAMQKATNI
Sbjct  61   IQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRSGASAMKAMQKATNI  120

Query  560  DDVDXTMDE  586
            DDVD TMDE
Sbjct  121  DDVDKTMDE  129



>gb|ACJ85894.1| unknown [Medicago truncatula]
Length=206

 Score =   174 bits (442),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 116/130 (89%), Positives = 123/130 (95%), Gaps = 2/130 (2%)
 Frame = +2

Query  203  MFTRIFGKPKQET--NALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRA  376
            MFTR+FGKPKQ+T  NALATLDKLNETLEMLEKKE VL KKAAAEVEKAKE+T+ KNK+A
Sbjct  1    MFTRVFGKPKQDTSSNALATLDKLNETLEMLEKKENVLLKKAAAEVEKAKEYTKRKNKKA  60

Query  377  AIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATN  556
            AIQCLKRKRLYEQQ+EQLGNFQLRI+DQMIMLEGAKATTETVDALRTGAA MKAMQKATN
Sbjct  61   AIQCLKRKRLYEQQVEQLGNFQLRIYDQMIMLEGAKATTETVDALRTGAATMKAMQKATN  120

Query  557  IDDVDXTMDE  586
            IDDVD TMDE
Sbjct  121  IDDVDKTMDE  130



>gb|ABK23499.1| unknown [Picea sitchensis]
Length=155

 Score =   171 bits (434),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 110/128 (86%), Positives = 121/128 (95%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            MF+R+FG+PK+E N ++TLDKLNETLEMLEKKEKVLQKK  AEVEKA++FTRAKNK+AAI
Sbjct  2    MFSRLFGRPKEEANPISTLDKLNETLEMLEKKEKVLQKKIQAEVEKARDFTRAKNKKAAI  61

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            QCLKRKRLYE QIEQLGN+QLRIHDQMIMLEGAKATTETV ALRTGA+AMKAMQKATNID
Sbjct  62   QCLKRKRLYEVQIEQLGNYQLRIHDQMIMLEGAKATTETVAALRTGASAMKAMQKATNID  121

Query  563  DVDXTMDE  586
            DVD TMDE
Sbjct  122  DVDKTMDE  129



>gb|AAM66053.1| copia-like retroelement pol polyprotein [Arabidopsis thaliana]
Length=218

 Score =   173 bits (438),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 113/127 (89%), Positives = 119/127 (94%), Gaps = 0/127 (0%)
 Frame = +2

Query  206  FTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAIQ  385
              R+FGKPKQE NAL TLDKLNETLEMLEKKEKVL KKA AEVEKAKE++RAKNKRAAIQ
Sbjct  1    MNRLFGKPKQEANALQTLDKLNETLEMLEKKEKVLLKKAGAEVEKAKEYSRAKNKRAAIQ  60

Query  386  CLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNIDD  565
            CLKRKRLYE Q+EQLGNFQLRIHDQMIMLEGAKATTETVDALR+GA+AMKAMQKATNIDD
Sbjct  61   CLKRKRLYEGQVEQLGNFQLRIHDQMIMLEGAKATTETVDALRSGASAMKAMQKATNIDD  120

Query  566  VDXTMDE  586
            VD TMDE
Sbjct  121  VDKTMDE  127



>gb|ABK25827.1| unknown [Picea sitchensis]
 gb|ACN40190.1| unknown [Picea sitchensis]
 gb|ACN40855.1| unknown [Picea sitchensis]
Length=217

 Score =   172 bits (436),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 110/128 (86%), Positives = 121/128 (95%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            MF+R+FG+PK+E N ++TLDKLNETLEMLEKKEKVLQKK  AEVEKA++FTRAKNK+AAI
Sbjct  2    MFSRLFGRPKEEANPISTLDKLNETLEMLEKKEKVLQKKIQAEVEKARDFTRAKNKKAAI  61

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            QCLKRKRLYE QIEQLGN+QLRIHDQMIMLEGAKATTETV ALRTGA+AMKAMQKATNID
Sbjct  62   QCLKRKRLYEVQIEQLGNYQLRIHDQMIMLEGAKATTETVAALRTGASAMKAMQKATNID  121

Query  563  DVDXTMDE  586
            DVD TMDE
Sbjct  122  DVDKTMDE  129



>ref|XP_010489126.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
1 [Camelina sativa]
Length=214

 Score =   172 bits (435),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 114/129 (88%), Positives = 118/129 (91%), Gaps = 1/129 (1%)
 Frame = +2

Query  203  MF-TRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAA  379
            MF  R+FGKPK E N L TLDKLNETLEMLEKKE VL KKAA EVEKAKEF+R KNKRAA
Sbjct  1    MFMNRLFGKPKPEANTLQTLDKLNETLEMLEKKEGVLLKKAAGEVEKAKEFSRVKNKRAA  60

Query  380  IQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNI  559
            IQCLKRKRLYEQQ+EQLGNFQLRIHDQMIMLEGAKATTETVDALRTGA+AMKAMQKATNI
Sbjct  61   IQCLKRKRLYEQQVEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGASAMKAMQKATNI  120

Query  560  DDVDXTMDE  586
            DDVD TMDE
Sbjct  121  DDVDKTMDE  129



>ref|XP_010416624.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
1-like [Camelina sativa]
Length=214

 Score =   172 bits (435),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 114/129 (88%), Positives = 118/129 (91%), Gaps = 1/129 (1%)
 Frame = +2

Query  203  MF-TRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAA  379
            MF  R+FGKPK E N L TLDKLNETLEMLEKKE VL KKAA EVEKAKEF+R KNKRAA
Sbjct  1    MFMNRLFGKPKPEANTLQTLDKLNETLEMLEKKEGVLLKKAAGEVEKAKEFSRVKNKRAA  60

Query  380  IQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNI  559
            IQCLKRKRLYEQQ+EQLGNFQLRIHDQMIMLEGAKATTETVDALRTGA+AMKAMQKATNI
Sbjct  61   IQCLKRKRLYEQQVEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGASAMKAMQKATNI  120

Query  560  DDVDXTMDE  586
            DDVD TMDE
Sbjct  121  DDVDKTMDE  129



>ref|XP_010467924.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
1-like [Camelina sativa]
Length=214

 Score =   171 bits (434),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 114/129 (88%), Positives = 118/129 (91%), Gaps = 1/129 (1%)
 Frame = +2

Query  203  MF-TRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAA  379
            MF  R+FGKPK E N L TLDKLNETLEMLEKKE VL KKAA EVEKAKEF+R KNKRAA
Sbjct  1    MFMNRLFGKPKPEANTLQTLDKLNETLEMLEKKEGVLIKKAAGEVEKAKEFSRVKNKRAA  60

Query  380  IQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNI  559
            IQCLKRKRLYEQQ+EQLGNFQLRIHDQMIMLEGAKATTETVDALRTGA+AMKAMQKATNI
Sbjct  61   IQCLKRKRLYEQQVEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGASAMKAMQKATNI  120

Query  560  DDVDXTMDE  586
            DDVD TMDE
Sbjct  121  DDVDKTMDE  129



>ref|XP_011094781.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Sesamum indicum]
 ref|XP_011094857.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Sesamum indicum]
 ref|XP_011094936.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Sesamum indicum]
Length=214

 Score =   170 bits (431),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 125/128 (98%), Positives = 126/128 (98%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            MFTRIFGKPKQETNALATLDKLNETLEMLEKKEKVL KKAAAEVEKAKEFTRAKNKRAAI
Sbjct  1    MFTRIFGKPKQETNALATLDKLNETLEMLEKKEKVLLKKAAAEVEKAKEFTRAKNKRAAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            QCLKRKRLYEQQ+EQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID
Sbjct  61   QCLKRKRLYEQQVEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  120

Query  563  DVDXTMDE  586
            DVD TMDE
Sbjct  121  DVDKTMDE  128



>ref|XP_011093673.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Sesamum indicum]
Length=218

 Score =   170 bits (431),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 112/128 (88%), Positives = 119/128 (93%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            M  R+ GKPKQE NALATLDKLNETLEMLEKKE VLQKKA+AEVEKAKE+T+AKNKRAAI
Sbjct  1    MIARLLGKPKQEANALATLDKLNETLEMLEKKEGVLQKKASAEVEKAKEYTKAKNKRAAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            QCLKRKRLYE+QI QL NFQLRIHDQ+IMLEGAKATTETVDALR+GAAAMKAMQK TNID
Sbjct  61   QCLKRKRLYEEQIGQLANFQLRIHDQVIMLEGAKATTETVDALRSGAAAMKAMQKVTNID  120

Query  563  DVDXTMDE  586
            DVD TMDE
Sbjct  121  DVDKTMDE  128



>gb|EYU20388.1| hypothetical protein MIMGU_mgv1a013694mg [Erythranthe guttata]
 gb|EYU20389.1| hypothetical protein MIMGU_mgv1a013694mg [Erythranthe guttata]
Length=213

 Score =   170 bits (430),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 125/128 (98%), Positives = 125/128 (98%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            MFTRIFGKPKQETNALATLDKLNETLEMLEKKEKVL KKA AEVEKAKEFTRAKNKRAAI
Sbjct  1    MFTRIFGKPKQETNALATLDKLNETLEMLEKKEKVLLKKAGAEVEKAKEFTRAKNKRAAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID
Sbjct  61   QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  120

Query  563  DVDXTMDE  586
            DVD TMDE
Sbjct  121  DVDKTMDE  128



>ref|XP_010695089.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Beta vulgaris subsp. vulgaris]
 ref|XP_010695090.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Beta vulgaris subsp. vulgaris]
Length=219

 Score =   170 bits (430),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 112/129 (87%), Positives = 122/129 (95%), Gaps = 1/129 (1%)
 Frame = +2

Query  203  MFTRIFGKPKQ-ETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAA  379
            MFTR+FGKPK+  T+A+ATLDKL+ETLEMLEKKE+VL KKA AEVEKAKEFTRAKNKRAA
Sbjct  1    MFTRVFGKPKEGTTSAVATLDKLSETLEMLEKKEQVLLKKAGAEVEKAKEFTRAKNKRAA  60

Query  380  IQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNI  559
            I CLKRKRLYEQQIEQLGN QLRIHDQMI+LEGAKATTETVDALR+GA+AMKAMQKATNI
Sbjct  61   ITCLKRKRLYEQQIEQLGNMQLRIHDQMILLEGAKATTETVDALRSGASAMKAMQKATNI  120

Query  560  DDVDXTMDE  586
            D+VD TMDE
Sbjct  121  DNVDKTMDE  129



>ref|XP_006355308.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Solanum tuberosum]
Length=216

 Score =   170 bits (430),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 125/128 (98%), Positives = 126/128 (98%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            MFTR+FGKPKQETNALATLDKLNETLEMLEKKEKVL KKAAAEVEKAKEFTRAKNKRAAI
Sbjct  1    MFTRMFGKPKQETNALATLDKLNETLEMLEKKEKVLLKKAAAEVEKAKEFTRAKNKRAAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID
Sbjct  61   QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  120

Query  563  DVDXTMDE  586
            DVD TMDE
Sbjct  121  DVDKTMDE  128



>ref|XP_004245128.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Solanum lycopersicum]
Length=216

 Score =   170 bits (430),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 125/128 (98%), Positives = 126/128 (98%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            MFTR+FGKPKQETNALATLDKLNETLEMLEKKEKVL KKAAAEVEKAKEFTRAKNKRAAI
Sbjct  1    MFTRMFGKPKQETNALATLDKLNETLEMLEKKEKVLLKKAAAEVEKAKEFTRAKNKRAAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID
Sbjct  61   QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  120

Query  563  DVDXTMDE  586
            DVD TMDE
Sbjct  121  DVDKTMDE  128



>ref|XP_009784949.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Nicotiana sylvestris]
Length=219

 Score =   169 bits (429),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 123/128 (96%), Positives = 125/128 (98%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            MFTRIFGKPKQETNALATLDKLNETLEMLEKKEKVL KK AAEVEKAKEFTRAKNKRAAI
Sbjct  1    MFTRIFGKPKQETNALATLDKLNETLEMLEKKEKVLLKKTAAEVEKAKEFTRAKNKRAAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            QCLKRKRLYEQQ+EQLGNFQLRIHDQMI+LEGAKATTETVDALRTGAAAMKAMQKATNID
Sbjct  61   QCLKRKRLYEQQVEQLGNFQLRIHDQMILLEGAKATTETVDALRTGAAAMKAMQKATNID  120

Query  563  DVDXTMDE  586
            DVD TMDE
Sbjct  121  DVDKTMDE  128



>ref|XP_006298305.1| hypothetical protein CARUB_v10014370mg, partial [Capsella rubella]
 ref|XP_006298306.1| hypothetical protein CARUB_v10014370mg, partial [Capsella rubella]
 gb|EOA31203.1| hypothetical protein CARUB_v10014370mg, partial [Capsella rubella]
 gb|EOA31204.1| hypothetical protein CARUB_v10014370mg, partial [Capsella rubella]
Length=273

 Score =   170 bits (431),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 113/129 (88%), Positives = 118/129 (91%), Gaps = 1/129 (1%)
 Frame = +2

Query  203  MF-TRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAA  379
            MF  R+FGKPKQE N L TLDKLNETLEMLEKKE VL KKAA EVEKAKEF+R KNKRAA
Sbjct  60   MFMNRLFGKPKQEGNTLQTLDKLNETLEMLEKKEGVLIKKAAGEVEKAKEFSRVKNKRAA  119

Query  380  IQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNI  559
            IQCLKRKRLYEQQ+EQLGNFQLRIHDQMIMLEGAKATTETVDALRTGA+ MKAMQKATNI
Sbjct  120  IQCLKRKRLYEQQVEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGASTMKAMQKATNI  179

Query  560  DDVDXTMDE  586
            DDVD TM+E
Sbjct  180  DDVDKTMEE  188



>ref|XP_009586832.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Nicotiana tomentosiformis]
Length=218

 Score =   168 bits (426),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 123/128 (96%), Positives = 126/128 (98%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            MFT+IFGKPKQETNALATLDKLNETLEMLEKKEKVL KKAAAEVEKAKEFTRAKNKRAAI
Sbjct  1    MFTKIFGKPKQETNALATLDKLNETLEMLEKKEKVLLKKAAAEVEKAKEFTRAKNKRAAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            QCLKRKRLYEQQ+EQLGNFQLRIHDQMI+LEGAKATTETVDALRTGAAAMKAMQKATNID
Sbjct  61   QCLKRKRLYEQQVEQLGNFQLRIHDQMILLEGAKATTETVDALRTGAAAMKAMQKATNID  120

Query  563  DVDXTMDE  586
            DVD TMDE
Sbjct  121  DVDKTMDE  128



>ref|XP_011081721.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Sesamum indicum]
Length=214

 Score =   168 bits (425),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 124/128 (97%), Positives = 126/128 (98%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            MFTRIFGKPKQET+ALATLDKLNETLEMLEKKEKVL KKAAAEVEKAKEFTRAKNKRAAI
Sbjct  1    MFTRIFGKPKQETSALATLDKLNETLEMLEKKEKVLLKKAAAEVEKAKEFTRAKNKRAAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALR+GAAAMKAMQKATNID
Sbjct  61   QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRSGAAAMKAMQKATNID  120

Query  563  DVDXTMDE  586
            DVD TMDE
Sbjct  121  DVDKTMDE  128



>ref|XP_003577910.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like isoform X2 [Brachypodium distachyon]
 ref|XP_010237994.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like isoform X2 [Brachypodium distachyon]
Length=220

 Score =   168 bits (425),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 111/130 (85%), Positives = 121/130 (93%), Gaps = 2/130 (2%)
 Frame = +2

Query  203  MFTRIFGKPKQETNA--LATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRA  376
            MF R+FGKPK++ NA  LATLDKLNETL+MLEKKEKVL+K AAAE+E+AKEF++AKNKRA
Sbjct  1    MFNRLFGKPKEQANAGALATLDKLNETLDMLEKKEKVLEKNAAAELERAKEFSKAKNKRA  60

Query  377  AIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATN  556
            AIQ LKRK+LYEQQIEQLGNFQLRIHDQMIMLE AKATTETVDALRTGA AMKAMQKATN
Sbjct  61   AIQALKRKKLYEQQIEQLGNFQLRIHDQMIMLEAAKATTETVDALRTGAKAMKAMQKATN  120

Query  557  IDDVDXTMDE  586
            IDDVD TMDE
Sbjct  121  IDDVDKTMDE  130



>ref|XP_009610483.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Nicotiana tomentosiformis]
 ref|XP_009610484.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Nicotiana tomentosiformis]
 ref|XP_009610485.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Nicotiana tomentosiformis]
Length=216

 Score =   168 bits (425),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 123/128 (96%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            MF R+FGKPKQETNALATLDKLNETLEMLEKKEKVL KKAA EVEKAKEFTRAKNKRAAI
Sbjct  1    MFPRLFGKPKQETNALATLDKLNETLEMLEKKEKVLLKKAAGEVEKAKEFTRAKNKRAAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID
Sbjct  61   QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  120

Query  563  DVDXTMDE  586
            DVD TMDE
Sbjct  121  DVDKTMDE  128



>ref|XP_009800252.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Nicotiana sylvestris]
 ref|XP_009800253.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Nicotiana sylvestris]
Length=216

 Score =   168 bits (425),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 123/128 (96%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            MF R+FGKPKQETNALATLDKLNETLEMLEKKEKVL KKAA EVEKAKEFTRAKNKRAAI
Sbjct  1    MFPRLFGKPKQETNALATLDKLNETLEMLEKKEKVLLKKAAGEVEKAKEFTRAKNKRAAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID
Sbjct  61   QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  120

Query  563  DVDXTMDE  586
            DVD TMDE
Sbjct  121  DVDKTMDE  128



>ref|XP_002283066.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Vitis vinifera]
 emb|CAN61998.1| hypothetical protein VITISV_007873 [Vitis vinifera]
 emb|CBI27961.3| unnamed protein product [Vitis vinifera]
Length=218

 Score =   167 bits (424),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 124/128 (97%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            MFTRIFGKPKQE NAL TLDKLNETLEMLEKKEKVL KKAAAEVEKAKEFTRAKNKRAAI
Sbjct  1    MFTRIFGKPKQEANALTTLDKLNETLEMLEKKEKVLLKKAAAEVEKAKEFTRAKNKRAAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID
Sbjct  61   QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  120

Query  563  DVDXTMDE  586
            DVD TMDE
Sbjct  121  DVDQTMDE  128



>ref|XP_010047627.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Eucalyptus grandis]
 gb|KCW79566.1| hypothetical protein EUGRSUZ_C00934 [Eucalyptus grandis]
 gb|KCW79567.1| hypothetical protein EUGRSUZ_C00934 [Eucalyptus grandis]
Length=219

 Score =   167 bits (424),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 121/128 (95%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            MF R+FGKPKQETNAL TLDKLNETLEMLEKKEKVL KKA+ EVEKAKEFTRAKNKRAAI
Sbjct  1    MFNRLFGKPKQETNALTTLDKLNETLEMLEKKEKVLIKKASQEVEKAKEFTRAKNKRAAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID
Sbjct  61   QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  120

Query  563  DVDXTMDE  586
            DVD TMDE
Sbjct  121  DVDKTMDE  128



>gb|KJB27119.1| hypothetical protein B456_004G283100 [Gossypium raimondii]
Length=163

 Score =   166 bits (419),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 109/128 (85%), Positives = 117/128 (91%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            MF  IFGK K ETNAL TLDKLNETLEMLEKKE VL KK AAEVEKAKE+ + +NK+AAI
Sbjct  1    MFKGIFGKTKPETNALTTLDKLNETLEMLEKKESVLLKKTAAEVEKAKEYAKGRNKKAAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            QCLKRK+LYEQQIEQLGNFQLR+HDQMIMLEGAKATTETVDALRTGA+AMKAMQKAT+ID
Sbjct  61   QCLKRKKLYEQQIEQLGNFQLRVHDQMIMLEGAKATTETVDALRTGASAMKAMQKATSID  120

Query  563  DVDXTMDE  586
            DVD TMDE
Sbjct  121  DVDKTMDE  128



>ref|XP_010237993.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like isoform X1 [Brachypodium distachyon]
Length=304

 Score =   169 bits (429),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 112/131 (85%), Positives = 122/131 (93%), Gaps = 2/131 (2%)
 Frame = +2

Query  200  TMFTRIFGKPKQETNA--LATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKR  373
            TMF R+FGKPK++ NA  LATLDKLNETL+MLEKKEKVL+K AAAE+E+AKEF++AKNKR
Sbjct  84   TMFNRLFGKPKEQANAGALATLDKLNETLDMLEKKEKVLEKNAAAELERAKEFSKAKNKR  143

Query  374  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKAT  553
            AAIQ LKRK+LYEQQIEQLGNFQLRIHDQMIMLE AKATTETVDALRTGA AMKAMQKAT
Sbjct  144  AAIQALKRKKLYEQQIEQLGNFQLRIHDQMIMLEAAKATTETVDALRTGAKAMKAMQKAT  203

Query  554  NIDDVDXTMDE  586
            NIDDVD TMDE
Sbjct  204  NIDDVDKTMDE  214



>gb|EMS65379.1| Vacuolar protein sorting-associated protein 32-like protein 2 
[Triticum urartu]
Length=220

 Score =   167 bits (422),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 111/130 (85%), Positives = 121/130 (93%), Gaps = 2/130 (2%)
 Frame = +2

Query  203  MFTRIFGKPKQETNA--LATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRA  376
            MF R+FGKPK++ NA  LATLDKLNETL+MLEKKEKVL+KKA AE+E+AKEF++AKNKRA
Sbjct  1    MFNRLFGKPKEQANAGALATLDKLNETLDMLEKKEKVLEKKAGAELERAKEFSKAKNKRA  60

Query  377  AIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATN  556
            AIQ LKRK+LYEQQIEQLGNFQLRIHDQMIMLE AKATTETVDALRTGA AMKAMQKATN
Sbjct  61   AIQSLKRKKLYEQQIEQLGNFQLRIHDQMIMLEAAKATTETVDALRTGAKAMKAMQKATN  120

Query  557  IDDVDXTMDE  586
            IDDVD TMDE
Sbjct  121  IDDVDKTMDE  130



>dbj|BAK08135.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ89470.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=220

 Score =   167 bits (422),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 111/130 (85%), Positives = 121/130 (93%), Gaps = 2/130 (2%)
 Frame = +2

Query  203  MFTRIFGKPKQETNA--LATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRA  376
            MF R+FGKPK++ NA  LATLDKLNETL+MLEKKEKVL+KKA AE+E+AKEF++AKNKRA
Sbjct  1    MFNRLFGKPKEQANAGALATLDKLNETLDMLEKKEKVLEKKAGAELERAKEFSKAKNKRA  60

Query  377  AIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATN  556
            AIQ LKRK+LYEQQIEQLGNFQLRIHDQMIMLE AKATTETVDALRTGA AMKAMQKATN
Sbjct  61   AIQSLKRKKLYEQQIEQLGNFQLRIHDQMIMLEAAKATTETVDALRTGAKAMKAMQKATN  120

Query  557  IDDVDXTMDE  586
            IDDVD TMDE
Sbjct  121  IDDVDKTMDE  130



>gb|KJB27118.1| hypothetical protein B456_004G283100 [Gossypium raimondii]
Length=218

 Score =   167 bits (422),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 109/128 (85%), Positives = 117/128 (91%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            MF  IFGK K ETNAL TLDKLNETLEMLEKKE VL KK AAEVEKAKE+ + +NK+AAI
Sbjct  1    MFKGIFGKTKPETNALTTLDKLNETLEMLEKKESVLLKKTAAEVEKAKEYAKGRNKKAAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            QCLKRK+LYEQQIEQLGNFQLR+HDQMIMLEGAKATTETVDALRTGA+AMKAMQKAT+ID
Sbjct  61   QCLKRKKLYEQQIEQLGNFQLRVHDQMIMLEGAKATTETVDALRTGASAMKAMQKATSID  120

Query  563  DVDXTMDE  586
            DVD TMDE
Sbjct  121  DVDKTMDE  128



>ref|XP_003564850.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Brachypodium distachyon]
 ref|XP_010232698.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Brachypodium distachyon]
Length=220

 Score =   167 bits (422),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 111/130 (85%), Positives = 122/130 (94%), Gaps = 2/130 (2%)
 Frame = +2

Query  203  MFTRIFGKPKQETNA--LATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRA  376
            MF R+FGKPK++ NA  LATLDKLNETL+MLEKKEKVL+KKAAAE+E+AK+F++AKNKRA
Sbjct  1    MFNRLFGKPKEQANAGALATLDKLNETLDMLEKKEKVLEKKAAAELERAKDFSKAKNKRA  60

Query  377  AIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATN  556
            AIQ LKRK+LYEQQIEQLGNFQLRIHDQMIMLE AKATTETVDALRTGA AMKAMQKATN
Sbjct  61   AIQALKRKKLYEQQIEQLGNFQLRIHDQMIMLEAAKATTETVDALRTGAKAMKAMQKATN  120

Query  557  IDDVDXTMDE  586
            IDDVD TMDE
Sbjct  121  IDDVDKTMDE  130



>ref|XP_009394690.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Musa acuminata subsp. malaccensis]
Length=218

 Score =   166 bits (421),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 107/128 (84%), Positives = 117/128 (91%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            M  R+FGKPK++ NALATLDKLNETLEMLEKKEKVL KK A EVEKAKEFT+ KNKRAAI
Sbjct  1    MLGRLFGKPKEQPNALATLDKLNETLEMLEKKEKVLLKKMATEVEKAKEFTKVKNKRAAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            QCLKRKRLYEQ++EQLGNFQLRIHDQMIMLEGAKATTETVDA+R G AA+KA+QKATNID
Sbjct  61   QCLKRKRLYEQEVEQLGNFQLRIHDQMIMLEGAKATTETVDAMRVGTAALKALQKATNID  120

Query  563  DVDXTMDE  586
            DVD T+ E
Sbjct  121  DVDKTLSE  128



>ref|XP_008242449.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Prunus mume]
Length=218

 Score =   166 bits (421),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 123/128 (96%), Positives = 125/128 (98%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            MFTR+FGKPKQE NAL TLDKLNETLEMLEKKEKVLQKKAAAEVE+AKEFTRAKNKRAAI
Sbjct  1    MFTRLFGKPKQEGNALTTLDKLNETLEMLEKKEKVLQKKAAAEVERAKEFTRAKNKRAAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID
Sbjct  61   QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  120

Query  563  DVDXTMDE  586
            DVD TMDE
Sbjct  121  DVDKTMDE  128



>ref|XP_007202552.1| hypothetical protein PRUPE_ppa011232mg [Prunus persica]
 ref|XP_007202553.1| hypothetical protein PRUPE_ppa011232mg [Prunus persica]
 gb|EMJ03751.1| hypothetical protein PRUPE_ppa011232mg [Prunus persica]
 gb|EMJ03752.1| hypothetical protein PRUPE_ppa011232mg [Prunus persica]
Length=218

 Score =   166 bits (421),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 123/128 (96%), Positives = 125/128 (98%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            MFTR+FGKPKQE NAL TLDKLNETLEMLEKKEKVLQKKAAAEVE+AKEFTRAKNKRAAI
Sbjct  1    MFTRLFGKPKQEGNALTTLDKLNETLEMLEKKEKVLQKKAAAEVERAKEFTRAKNKRAAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID
Sbjct  61   QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  120

Query  563  DVDXTMDE  586
            DVD TMDE
Sbjct  121  DVDKTMDE  128



>ref|XP_006572922.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like isoform X1 [Glycine max]
 ref|XP_006572923.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like isoform X2 [Glycine max]
 gb|KHN32901.1| Vacuolar protein sorting-associated protein 32 like 2 [Glycine 
soja]
Length=218

 Score =   166 bits (420),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 121/128 (95%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            MF+R+FGKPKQETNA+ATLDKLNETLEMLEKKEKVL KK AAEVEKAKEFTR KNKRAAI
Sbjct  1    MFSRMFGKPKQETNAVATLDKLNETLEMLEKKEKVLLKKVAAEVEKAKEFTRGKNKRAAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID
Sbjct  61   QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  120

Query  563  DVDXTMDE  586
            DVD TMDE
Sbjct  121  DVDKTMDE  128



>ref|XP_009352595.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Pyrus x bretschneideri]
 ref|XP_009352596.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Pyrus x bretschneideri]
Length=221

 Score =   166 bits (420),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 121/129 (94%), Positives = 126/129 (98%), Gaps = 0/129 (0%)
 Frame = +2

Query  200  TMFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAA  379
            TMFTRIFGKPKQE +AL TLDKLNETLEMLEKKEKVLQKKAAAEV++AK+FT+AKNKRAA
Sbjct  3    TMFTRIFGKPKQENSALTTLDKLNETLEMLEKKEKVLQKKAAAEVDRAKDFTKAKNKRAA  62

Query  380  IQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNI  559
            IQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNI
Sbjct  63   IQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNI  122

Query  560  DDVDXTMDE  586
            DDVD TMDE
Sbjct  123  DDVDKTMDE  131



>gb|ADE77819.1| unknown [Picea sitchensis]
Length=223

 Score =   166 bits (420),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 107/128 (84%), Positives = 118/128 (92%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            MF ++F KPK+ET+ALAT+DKLNETLEMLEKKEKVLQKK + E+EKAKEFTR KNKRAAI
Sbjct  1    MFNKLFKKPKEETSALATIDKLNETLEMLEKKEKVLQKKISVEIEKAKEFTRRKNKRAAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            QCLKRK+LYE Q+EQLGNFQLRIHDQMIMLEGAKATTETVDALRTGA AMK +QKA NID
Sbjct  61   QCLKRKKLYETQVEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGALAMKTIQKAMNID  120

Query  563  DVDXTMDE  586
            D+D TMDE
Sbjct  121  DIDKTMDE  128



>gb|KDP33761.1| hypothetical protein JCGZ_07332 [Jatropha curcas]
Length=218

 Score =   166 bits (419),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 121/128 (95%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            MF R+FGKPKQETNAL TLDKLNETLEMLEKKEKVL KKAAAEVEKA+EFTRA+NKRAAI
Sbjct  1    MFNRLFGKPKQETNALTTLDKLNETLEMLEKKEKVLIKKAAAEVEKAREFTRARNKRAAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID
Sbjct  61   QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  120

Query  563  DVDXTMDE  586
            DVD TMDE
Sbjct  121  DVDKTMDE  128



>emb|CBI35999.3| unnamed protein product [Vitis vinifera]
Length=205

 Score =   165 bits (418),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 110/130 (85%), Positives = 121/130 (93%), Gaps = 2/130 (2%)
 Frame = +2

Query  203  MFTRIF--GKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRA  376
            MF+R+F  GK + +TNA+ATLDKLNETLEMLEKKE+VL KKA+AEVEKAKE+T+AKNKRA
Sbjct  1    MFSRVFRKGKEQSQTNAVATLDKLNETLEMLEKKERVLIKKASAEVEKAKEYTKAKNKRA  60

Query  377  AIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATN  556
            AIQCLKRKRLYEQQIEQLGNFQLRIHDQMI+LEGAKATTETVDALRTGAAAMK M K TN
Sbjct  61   AIQCLKRKRLYEQQIEQLGNFQLRIHDQMILLEGAKATTETVDALRTGAAAMKTMHKTTN  120

Query  557  IDDVDXTMDE  586
            IDD+D TMDE
Sbjct  121  IDDLDKTMDE  130



>ref|XP_006381690.1| hypothetical protein POPTR_0006s15890g [Populus trichocarpa]
 gb|ERP59487.1| hypothetical protein POPTR_0006s15890g [Populus trichocarpa]
Length=160

 Score =   164 bits (414),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 122/128 (95%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            MF R+FGKPKQETNAL TLDKLNETLEMLEKKEKVL KKAAAEVEKAKEFTR KNKRAAI
Sbjct  1    MFNRLFGKPKQETNALTTLDKLNETLEMLEKKEKVLLKKAAAEVEKAKEFTRGKNKRAAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID
Sbjct  61   QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  120

Query  563  DVDXTMDE  586
            DVD TMDE
Sbjct  121  DVDKTMDE  128



>gb|KHG10442.1| Uncharacterized protein F383_09141 [Gossypium arboreum]
Length=218

 Score =   166 bits (419),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 109/128 (85%), Positives = 116/128 (91%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            MF  IFGK K ETNAL TLDKLNETLEMLEKKE VL KK AAEVEKAKE+ + +NK+AAI
Sbjct  1    MFKGIFGKTKPETNALTTLDKLNETLEMLEKKESVLLKKTAAEVEKAKEYAKGRNKKAAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            QCLKRK+LYEQQIEQLGNFQLR+HDQMIMLEGAKATTETVDALRTGA AMKAMQKAT+ID
Sbjct  61   QCLKRKKLYEQQIEQLGNFQLRVHDQMIMLEGAKATTETVDALRTGATAMKAMQKATSID  120

Query  563  DVDXTMDE  586
            DVD TMDE
Sbjct  121  DVDKTMDE  128



>ref|XP_002514179.1| Charged multivesicular body protein 4b, putative [Ricinus communis]
 gb|EEF48133.1| Charged multivesicular body protein 4b, putative [Ricinus communis]
Length=218

 Score =   166 bits (419),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 120/128 (94%), Positives = 122/128 (95%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            MF R+FGKPKQETNAL TLDKLNETLEMLEKKEKVL KKA AEVE+AKEFTR KNKRAAI
Sbjct  1    MFNRLFGKPKQETNALTTLDKLNETLEMLEKKEKVLSKKAIAEVERAKEFTRTKNKRAAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID
Sbjct  61   QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  120

Query  563  DVDXTMDE  586
            DVD TMDE
Sbjct  121  DVDKTMDE  128



>ref|XP_007160256.1| hypothetical protein PHAVU_002G305900g [Phaseolus vulgaris]
 ref|XP_007160257.1| hypothetical protein PHAVU_002G305900g [Phaseolus vulgaris]
 gb|ESW32250.1| hypothetical protein PHAVU_002G305900g [Phaseolus vulgaris]
 gb|ESW32251.1| hypothetical protein PHAVU_002G305900g [Phaseolus vulgaris]
Length=218

 Score =   166 bits (419),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 121/128 (95%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            MFTRIFGKPKQE N L TLDKLNETLEMLEKKEKVL KKAAAEVE+AK+FTRAKNKRAAI
Sbjct  1    MFTRIFGKPKQEANTLTTLDKLNETLEMLEKKEKVLLKKAAAEVERAKDFTRAKNKRAAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID
Sbjct  61   QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  120

Query  563  DVDXTMDE  586
            DVD TMDE
Sbjct  121  DVDKTMDE  128



>ref|XP_010942547.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Elaeis guineensis]
 ref|XP_010942548.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Elaeis guineensis]
Length=218

 Score =   166 bits (419),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 121/128 (95%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            MF RIFGKPK++TNALATLDKLNETLEMLEKKEKVL KK AAEVEKAKEFTRAKNKRAAI
Sbjct  1    MFGRIFGKPKEQTNALATLDKLNETLEMLEKKEKVLLKKVAAEVEKAKEFTRAKNKRAAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            QCLKRKRLYEQQ+EQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID
Sbjct  61   QCLKRKRLYEQQVEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  120

Query  563  DVDXTMDE  586
            DVD TMDE
Sbjct  121  DVDKTMDE  128



>ref|XP_011016035.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Populus euphratica]
Length=215

 Score =   165 bits (418),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 122/128 (95%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            MF R+FGKPKQETNAL TLDKLNETLEMLEKKEKVL KKAAAEVEKAKEFTR KNKRAAI
Sbjct  1    MFNRLFGKPKQETNALTTLDKLNETLEMLEKKEKVLLKKAAAEVEKAKEFTRGKNKRAAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID
Sbjct  61   QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  120

Query  563  DVDXTMDE  586
            DVD TMDE
Sbjct  121  DVDKTMDE  128



>ref|XP_006381691.1| hypothetical protein POPTR_0006s15890g [Populus trichocarpa]
 ref|XP_006381692.1| hypothetical protein POPTR_0006s15890g [Populus trichocarpa]
 gb|ERP59488.1| hypothetical protein POPTR_0006s15890g [Populus trichocarpa]
 gb|ERP59489.1| hypothetical protein POPTR_0006s15890g [Populus trichocarpa]
Length=212

 Score =   165 bits (418),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 122/128 (95%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            MF R+FGKPKQETNAL TLDKLNETLEMLEKKEKVL KKAAAEVEKAKEFTR KNKRAAI
Sbjct  1    MFNRLFGKPKQETNALTTLDKLNETLEMLEKKEKVLLKKAAAEVEKAKEFTRGKNKRAAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID
Sbjct  61   QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  120

Query  563  DVDXTMDE  586
            DVD TMDE
Sbjct  121  DVDKTMDE  128



>ref|XP_002281551.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Vitis vinifera]
 ref|XP_010654573.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Vitis vinifera]
 ref|XP_010654574.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Vitis vinifera]
 ref|XP_010654575.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Vitis vinifera]
 emb|CAN76335.1| hypothetical protein VITISV_021984 [Vitis vinifera]
Length=220

 Score =   165 bits (418),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 110/130 (85%), Positives = 121/130 (93%), Gaps = 2/130 (2%)
 Frame = +2

Query  203  MFTRIF--GKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRA  376
            MF+R+F  GK + +TNA+ATLDKLNETLEMLEKKE+VL KKA+AEVEKAKE+T+AKNKRA
Sbjct  1    MFSRVFRKGKEQSQTNAVATLDKLNETLEMLEKKERVLIKKASAEVEKAKEYTKAKNKRA  60

Query  377  AIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATN  556
            AIQCLKRKRLYEQQIEQLGNFQLRIHDQMI+LEGAKATTETVDALRTGAAAMK M K TN
Sbjct  61   AIQCLKRKRLYEQQIEQLGNFQLRIHDQMILLEGAKATTETVDALRTGAAAMKTMHKTTN  120

Query  557  IDDVDXTMDE  586
            IDD+D TMDE
Sbjct  121  IDDLDKTMDE  130



>ref|XP_009398754.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Musa acuminata subsp. malaccensis]
 ref|XP_009398755.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Musa acuminata subsp. malaccensis]
 ref|XP_009398756.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Musa acuminata subsp. malaccensis]
 ref|XP_009398757.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Musa acuminata subsp. malaccensis]
Length=218

 Score =   165 bits (418),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 120/128 (94%), Positives = 126/128 (98%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            MF+R+FGKPK++TNA+ATLDKLNETLEMLEKKEKVL KKAAAEVEKAKEFTRAKNKRAAI
Sbjct  1    MFSRLFGKPKEQTNAVATLDKLNETLEMLEKKEKVLLKKAAAEVEKAKEFTRAKNKRAAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            QCLKRKRLYEQQ+EQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID
Sbjct  61   QCLKRKRLYEQQVEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  120

Query  563  DVDXTMDE  586
            DVD TMDE
Sbjct  121  DVDKTMDE  128



>ref|XP_004251182.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Solanum lycopersicum]
 ref|XP_010313446.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Solanum lycopersicum]
 ref|XP_010313447.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Solanum lycopersicum]
Length=218

 Score =   165 bits (417),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 118/128 (92%), Positives = 122/128 (95%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            MF R+ GKPKQETNALATLDKLNETLEMLEKKE VL KKA AEVE+AKEFTRAKNKRAAI
Sbjct  1    MFKRLLGKPKQETNALATLDKLNETLEMLEKKESVLLKKATAEVERAKEFTRAKNKRAAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            QCLKRKRLYEQQ+EQLGNFQLRIHDQMI+LEGAKATTETVDALRTGAAAMKAMQKATNID
Sbjct  61   QCLKRKRLYEQQVEQLGNFQLRIHDQMILLEGAKATTETVDALRTGAAAMKAMQKATNID  120

Query  563  DVDXTMDE  586
            DVD TMDE
Sbjct  121  DVDKTMDE  128



>ref|XP_006340250.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Solanum tuberosum]
Length=218

 Score =   165 bits (417),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 118/128 (92%), Positives = 122/128 (95%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            MF R+ GKPKQETNALATLDKLNETLEMLEKKE VL KKA AEVE+AKEFTRAKNKRAAI
Sbjct  1    MFKRLLGKPKQETNALATLDKLNETLEMLEKKESVLLKKATAEVERAKEFTRAKNKRAAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            QCLKRKRLYEQQ+EQLGNFQLRIHDQMI+LEGAKATTETVDALRTGAAAMKAMQKATNID
Sbjct  61   QCLKRKRLYEQQVEQLGNFQLRIHDQMILLEGAKATTETVDALRTGAAAMKAMQKATNID  120

Query  563  DVDXTMDE  586
            DVD TMDE
Sbjct  121  DVDKTMDE  128



>ref|XP_006583569.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Glycine max]
Length=218

 Score =   164 bits (416),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 120/128 (94%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            MF+R+FGKPKQETNA+ATLDKLNETLEMLEKKEKVL KK AAEVEKAKEFTR KNKRAAI
Sbjct  1    MFSRMFGKPKQETNAVATLDKLNETLEMLEKKEKVLLKKVAAEVEKAKEFTRGKNKRAAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            QCLKRKRLYEQQIEQLGNFQLRIHDQMI+LEGAKATTETVDALRTGAAAMKAMQKATNID
Sbjct  61   QCLKRKRLYEQQIEQLGNFQLRIHDQMILLEGAKATTETVDALRTGAAAMKAMQKATNID  120

Query  563  DVDXTMDE  586
            DVD TMDE
Sbjct  121  DVDKTMDE  128



>ref|XP_008337624.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Malus domestica]
 ref|XP_008337625.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Malus domestica]
 ref|XP_008337626.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Malus domestica]
Length=221

 Score =   165 bits (417),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 120/129 (93%), Positives = 126/129 (98%), Gaps = 0/129 (0%)
 Frame = +2

Query  200  TMFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAA  379
            TMFTRIFGKPKQE +AL TLDKLNETLEMLEKKEKVLQKKAAAEV++AK+FT+AKNK+AA
Sbjct  3    TMFTRIFGKPKQENSALTTLDKLNETLEMLEKKEKVLQKKAAAEVDRAKDFTKAKNKKAA  62

Query  380  IQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNI  559
            IQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNI
Sbjct  63   IQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNI  122

Query  560  DDVDXTMDE  586
            DDVD TMDE
Sbjct  123  DDVDKTMDE  131



>dbj|BAJ86054.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=222

 Score =   164 bits (416),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 104/130 (80%), Positives = 119/130 (92%), Gaps = 2/130 (2%)
 Frame = +2

Query  203  MFTRIFGKPKQET--NALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRA  376
            +F R+FGK K+++  +ALA++DKL+ETLEMLEKKE +L KKA  EVEKAK FT+AKNK+A
Sbjct  4    VFGRVFGKSKEQSQASALASIDKLSETLEMLEKKENLLMKKANLEVEKAKAFTKAKNKKA  63

Query  377  AIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATN  556
            AIQCLKRKRLYEQQ+EQLGNFQLRIHDQMIMLEGAKATTETVDALRTGA+AMKAM K+TN
Sbjct  64   AIQCLKRKRLYEQQVEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGASAMKAMHKSTN  123

Query  557  IDDVDXTMDE  586
            IDDVD TMDE
Sbjct  124  IDDVDKTMDE  133



>dbj|BAJ98801.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=222

 Score =   164 bits (416),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 103/130 (79%), Positives = 119/130 (92%), Gaps = 2/130 (2%)
 Frame = +2

Query  203  MFTRIFGKPKQET--NALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRA  376
            +F R+FGK K+++  +ALA++DKL+ETLEMLEKK+ +L KKA  EVEKAK FT+AKNK+A
Sbjct  4    VFGRVFGKSKEQSQASALASIDKLSETLEMLEKKKNLLMKKANLEVEKAKAFTKAKNKKA  63

Query  377  AIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATN  556
            AIQCLKRKRLYEQQ+EQLGNFQLRIHDQMIMLEGAKATTETVDALRTGA+AMKAM K+TN
Sbjct  64   AIQCLKRKRLYEQQVEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGASAMKAMHKSTN  123

Query  557  IDDVDXTMDE  586
            IDDVD TMDE
Sbjct  124  IDDVDKTMDE  133



>ref|XP_009395523.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Musa acuminata subsp. malaccensis]
 ref|XP_009395524.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Musa acuminata subsp. malaccensis]
 ref|XP_009395525.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Musa acuminata subsp. malaccensis]
 ref|XP_009395526.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Musa acuminata subsp. malaccensis]
Length=218

 Score =   164 bits (415),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 104/128 (81%), Positives = 120/128 (94%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            MF+ +F +P+++ +  +T+DKLN+TL MLEKKE+VL KKAAAEVEKAKEFTRAKNKRAAI
Sbjct  1    MFSMLFWRPREQPHTFSTIDKLNKTLAMLEKKEQVLLKKAAAEVEKAKEFTRAKNKRAAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            QCLKRKRLYEQQ+EQLGNFQLR+HDQ+IMLEGAK+TTETVDALRTGAAAMKA+QKATNID
Sbjct  61   QCLKRKRLYEQQVEQLGNFQLRLHDQIIMLEGAKSTTETVDALRTGAAAMKAIQKATNID  120

Query  563  DVDXTMDE  586
            DVD TMDE
Sbjct  121  DVDKTMDE  128



>ref|XP_003563642.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Brachypodium distachyon]
 ref|XP_010227519.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Brachypodium distachyon]
 ref|XP_010227520.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Brachypodium distachyon]
 ref|XP_010227521.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Brachypodium distachyon]
 ref|XP_010227522.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Brachypodium distachyon]
Length=222

 Score =   164 bits (415),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 104/130 (80%), Positives = 119/130 (92%), Gaps = 2/130 (2%)
 Frame = +2

Query  203  MFTRIFGKPKQET--NALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRA  376
            +F R+FGK K+++  +ALA++DKL+ETLEMLEKKE +L KKA  EVEKAK FT+AKNK+A
Sbjct  4    VFGRVFGKSKEQSQASALASIDKLSETLEMLEKKENLLMKKANLEVEKAKAFTKAKNKKA  63

Query  377  AIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATN  556
            AIQCLKRKRLYEQQ+EQLGNFQLRIHDQMIMLEGAKATTETVDALRTGA+AMKAM K+TN
Sbjct  64   AIQCLKRKRLYEQQVEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGASAMKAMHKSTN  123

Query  557  IDDVDXTMDE  586
            IDDVD TMDE
Sbjct  124  IDDVDKTMDE  133



>ref|XP_004135686.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Cucumis sativus]
 gb|KGN66200.1| hypothetical protein Csa_1G575160 [Cucumis sativus]
Length=220

 Score =   164 bits (415),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 117/130 (90%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +2

Query  197  FTMFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRA  376
             +MF ++FGKPKQE+NALATLDKLNETLEMLEKKEKVL KKA+ EVEKAK++TRAKNKRA
Sbjct  1    MSMFNKLFGKPKQESNALATLDKLNETLEMLEKKEKVLLKKASTEVEKAKDYTRAKNKRA  60

Query  377  AIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATN  556
            AIQCLKRKRLYEQQIEQLGNFQLRIHDQMI+LEGAKATTETVDALRTGAAAMKAMQKATN
Sbjct  61   AIQCLKRKRLYEQQIEQLGNFQLRIHDQMILLEGAKATTETVDALRTGAAAMKAMQKATN  120

Query  557  IDDVDXTMDE  586
            IDDVD TMDE
Sbjct  121  IDDVDKTMDE  130



>ref|XP_008387512.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Malus domestica]
Length=218

 Score =   164 bits (415),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 119/128 (93%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            MFTRIFGKP+QE +AL TLDKLNETLEMLEKKEKVLQKKAA EV++AK+FTRAKNKRAAI
Sbjct  1    MFTRIFGKPRQENSALTTLDKLNETLEMLEKKEKVLQKKAAGEVDRAKDFTRAKNKRAAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID
Sbjct  61   QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  120

Query  563  DVDXTMDE  586
            DVD TMDE
Sbjct  121  DVDKTMDE  128



>gb|EMT22613.1| Vacuolar protein sorting-associated 32-1-like protein [Aegilops 
tauschii]
Length=222

 Score =   164 bits (415),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 104/129 (81%), Positives = 118/129 (91%), Gaps = 2/129 (2%)
 Frame = +2

Query  206  FTRIFGKPKQET--NALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAA  379
            F R+FGK K+++  +ALA++DKL+ETLEMLEKKE +L KKA  EVEKAK FT+AKNK+AA
Sbjct  5    FGRVFGKSKEQSQASALASIDKLSETLEMLEKKENLLMKKANLEVEKAKAFTKAKNKKAA  64

Query  380  IQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNI  559
            IQCLKRKRLYEQQ+EQLGNFQLRIHDQMIMLEGAKATTETVDALRTGA+AMKAM K+TNI
Sbjct  65   IQCLKRKRLYEQQVEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGASAMKAMHKSTNI  124

Query  560  DDVDXTMDE  586
            DDVD TMDE
Sbjct  125  DDVDKTMDE  133



>ref|XP_004287507.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Fragaria vesca subsp. vesca]
Length=218

 Score =   164 bits (414),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 121/128 (95%), Positives = 125/128 (98%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            MFTRIFGKPK ET+AL TLDKLNETLEMLEKKEKVLQKKAAAEVE+AKEFTRAKNKR+AI
Sbjct  1    MFTRIFGKPKTETSALTTLDKLNETLEMLEKKEKVLQKKAAAEVERAKEFTRAKNKRSAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            QCLKRK+LYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID
Sbjct  61   QCLKRKKLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  120

Query  563  DVDXTMDE  586
            DVD TMDE
Sbjct  121  DVDKTMDE  128



>ref|NP_001058040.1| Os06g0608500 [Oryza sativa Japonica Group]
 dbj|BAD35619.1| SNF7 protein-like [Oryza sativa Japonica Group]
 dbj|BAF19954.1| Os06g0608500 [Oryza sativa Japonica Group]
 gb|EAZ01625.1| hypothetical protein OsI_23660 [Oryza sativa Indica Group]
 gb|EAZ37600.1| hypothetical protein OsJ_21933 [Oryza sativa Japonica Group]
 dbj|BAG92085.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87318.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|ACN85161.1| charged multivesicular body protein 4b [Oryza nivara]
Length=220

 Score =   164 bits (414),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 106/130 (82%), Positives = 117/130 (90%), Gaps = 2/130 (2%)
 Frame = +2

Query  203  MFTRIFGKPKQET--NALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRA  376
            +F ++FGK K ++   ALA++DKL+ETLEMLEKKE +L KKA  EVEKAK FT+AKNKRA
Sbjct  4    VFGKVFGKSKAQSQATALASIDKLSETLEMLEKKENLLVKKANLEVEKAKTFTKAKNKRA  63

Query  377  AIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATN  556
            AIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGA+AMKAM KATN
Sbjct  64   AIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGASAMKAMHKATN  123

Query  557  IDDVDXTMDE  586
            IDDVD TMDE
Sbjct  124  IDDVDKTMDE  133



>ref|XP_004965917.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Setaria italica]
Length=224

 Score =   164 bits (414),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 107/130 (82%), Positives = 117/130 (90%), Gaps = 2/130 (2%)
 Frame = +2

Query  203  MFTRIFGKPKQET--NALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRA  376
            +F ++FGK KQ++   ALA+LDKLNETLEMLEKKE +L KKA  EVEKAK FT+AKNKRA
Sbjct  4    VFGKVFGKSKQQSQATALASLDKLNETLEMLEKKENLLVKKANLEVEKAKNFTKAKNKRA  63

Query  377  AIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATN  556
            AIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE AKATTETVDALRTGA+AMKAM K+TN
Sbjct  64   AIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEAAKATTETVDALRTGASAMKAMHKSTN  123

Query  557  IDDVDXTMDE  586
            IDDVD TMDE
Sbjct  124  IDDVDKTMDE  133



>ref|XP_006656230.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Oryza brachyantha]
 gb|ACN85311.1| charged multivesicular body protein 4b [Oryza brachyantha]
Length=221

 Score =   163 bits (413),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 106/130 (82%), Positives = 117/130 (90%), Gaps = 2/130 (2%)
 Frame = +2

Query  203  MFTRIFGKPKQET--NALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRA  376
            +F ++FGK K ++   ALA++DKL+ETLEMLEKKE +L KKA  EVEKAK FT+AKNKRA
Sbjct  4    VFGKVFGKSKAQSQATALASIDKLSETLEMLEKKENLLVKKANLEVEKAKGFTKAKNKRA  63

Query  377  AIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATN  556
            AIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGA+AMKAM KATN
Sbjct  64   AIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGASAMKAMHKATN  123

Query  557  IDDVDXTMDE  586
            IDDVD TMDE
Sbjct  124  IDDVDKTMDE  133



>gb|ACN85265.1| charged multivesicular body protein 4b [Oryza alta]
Length=220

 Score =   163 bits (413),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 106/130 (82%), Positives = 117/130 (90%), Gaps = 2/130 (2%)
 Frame = +2

Query  203  MFTRIFGKPKQET--NALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRA  376
            +F ++FGK K ++   ALA++DKL+ETLEMLEKKE +L KKA  EVEKAK FT+AKNKRA
Sbjct  4    VFGKVFGKSKAQSQATALASIDKLSETLEMLEKKENLLVKKANLEVEKAKGFTKAKNKRA  63

Query  377  AIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATN  556
            AIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGA+AMKAM KATN
Sbjct  64   AIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGASAMKAMHKATN  123

Query  557  IDDVDXTMDE  586
            IDDVD TMDE
Sbjct  124  IDDVDKTMDE  133



>ref|NP_001152491.1| charged multivesicular body protein 4b [Zea mays]
 gb|ACG47853.1| charged multivesicular body protein 4b [Zea mays]
 gb|AFW87249.1| putative SNF domain containing family protein [Zea mays]
Length=226

 Score =   163 bits (413),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 107/130 (82%), Positives = 117/130 (90%), Gaps = 2/130 (2%)
 Frame = +2

Query  203  MFTRIFGKPKQET--NALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRA  376
            +F R+FGK K+++   ALA+LDKLNETLEMLEKKE +L KKA  EVEKAK FT+AKNKRA
Sbjct  4    VFGRVFGKSKEQSQATALASLDKLNETLEMLEKKENLLVKKANLEVEKAKNFTKAKNKRA  63

Query  377  AIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATN  556
            AIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE AKATTETVDALRTGA+AMKAM K+TN
Sbjct  64   AIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEAAKATTETVDALRTGASAMKAMHKSTN  123

Query  557  IDDVDXTMDE  586
            IDDVD TMDE
Sbjct  124  IDDVDKTMDE  133



>ref|XP_009102133.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
1 [Brassica rapa]
Length=215

 Score =   163 bits (412),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 105/129 (81%), Positives = 120/129 (93%), Gaps = 1/129 (1%)
 Frame = +2

Query  203  MFTRIFGKPKQ-ETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAA  379
            MFTR+F KPK+ ET+ L TL+KLNETL+MLEKKE +L K+AA EVE+AKEFTRAKNKRAA
Sbjct  1    MFTRLFRKPKKKETDTLQTLEKLNETLDMLEKKESLLLKRAAQEVERAKEFTRAKNKRAA  60

Query  380  IQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNI  559
            +QCLKRKR+YEQQ+EQLGN+QLRIHDQMIMLEG+KATTETVDALR+GA+AMKAMQKATNI
Sbjct  61   MQCLKRKRVYEQQVEQLGNYQLRIHDQMIMLEGSKATTETVDALRSGASAMKAMQKATNI  120

Query  560  DDVDXTMDE  586
             DVD TMDE
Sbjct  121  HDVDKTMDE  129



>ref|XP_008812733.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Phoenix dactylifera]
Length=218

 Score =   163 bits (412),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 118/128 (92%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            MF+RIFGKPK++ NALATLDKLNETLEMLEKKE+VL KK AAEVEKAKEFTRAKNKRAAI
Sbjct  1    MFSRIFGKPKEQANALATLDKLNETLEMLEKKERVLLKKVAAEVEKAKEFTRAKNKRAAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            QCLKRKRLYEQQ+EQLGNFQLRIHDQMIMLEGAKATTETV ALRTGAAAMKAMQKATNID
Sbjct  61   QCLKRKRLYEQQVEQLGNFQLRIHDQMIMLEGAKATTETVGALRTGAAAMKAMQKATNID  120

Query  563  DVDXTMDE  586
            DVD TMDE
Sbjct  121  DVDKTMDE  128



>ref|XP_002437263.1| hypothetical protein SORBIDRAFT_10g023830 [Sorghum bicolor]
 gb|EER88630.1| hypothetical protein SORBIDRAFT_10g023830 [Sorghum bicolor]
Length=224

 Score =   162 bits (410),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 107/130 (82%), Positives = 116/130 (89%), Gaps = 2/130 (2%)
 Frame = +2

Query  203  MFTRIFGKPKQET--NALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRA  376
            +F R+FGK K ++   ALA+LDKLNETLEMLEKKE +L KKA  EVEKAK FT+AKNKRA
Sbjct  4    VFGRVFGKSKAQSQATALASLDKLNETLEMLEKKENLLVKKANLEVEKAKNFTKAKNKRA  63

Query  377  AIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATN  556
            AIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLE AKATTETVDALRTGA+AMKAM K+TN
Sbjct  64   AIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEAAKATTETVDALRTGASAMKAMHKSTN  123

Query  557  IDDVDXTMDE  586
            IDDVD TMDE
Sbjct  124  IDDVDKTMDE  133



>ref|XP_008450809.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Cucumis melo]
 ref|XP_008450810.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Cucumis melo]
Length=220

 Score =   162 bits (410),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 116/130 (89%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = +2

Query  197  FTMFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRA  376
             +M  ++FGKPKQE+NALATLDKLNETLEMLEKKEKVL KKA+ EVEKAK++TRAKNKRA
Sbjct  1    MSMLNKLFGKPKQESNALATLDKLNETLEMLEKKEKVLLKKASTEVEKAKDYTRAKNKRA  60

Query  377  AIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATN  556
            AIQCLKRKRLYEQQIEQLGNFQLRIHDQMI+LEGAKATTETVDALRTGAAAMKAMQKATN
Sbjct  61   AIQCLKRKRLYEQQIEQLGNFQLRIHDQMILLEGAKATTETVDALRTGAAAMKAMQKATN  120

Query  557  IDDVDXTMDE  586
            IDDVD TMDE
Sbjct  121  IDDVDKTMDE  130



>gb|AFK39612.1| unknown [Medicago truncatula]
 gb|AET05143.2| charged multivesicular body protein [Medicago truncatula]
Length=222

 Score =   162 bits (410),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 108/131 (82%), Positives = 119/131 (91%), Gaps = 2/131 (2%)
 Frame = +2

Query  200  TMFTRIFGKPKQ--ETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKR  373
            +MF+++FGK KQ  + N L+TL+KLNETL MLEKKE VL KKAAAEVE+AKEFTRAKNKR
Sbjct  4    SMFSKLFGKTKQDQQANTLSTLEKLNETLGMLEKKESVLLKKAAAEVERAKEFTRAKNKR  63

Query  374  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKAT  553
            AAIQCLKRKRLYEQQ+EQLGNFQLRIHDQMIMLEGAKATTETV ALRTGAAAMK MQ+ T
Sbjct  64   AAIQCLKRKRLYEQQVEQLGNFQLRIHDQMIMLEGAKATTETVAALRTGAAAMKTMQQET  123

Query  554  NIDDVDXTMDE  586
            NI+DVD TMDE
Sbjct  124  NINDVDATMDE  134



>gb|KJB27120.1| hypothetical protein B456_004G283100 [Gossypium raimondii]
Length=217

 Score =   161 bits (408),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 109/128 (85%), Positives = 116/128 (91%), Gaps = 1/128 (1%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            MF  IFGK K ETNAL TLDKLNETLEMLEKKE VL KK AAEVEKAKE+ + +NK+AAI
Sbjct  1    MFKGIFGKTKPETNALTTLDKLNETLEMLEKKESVLLKKTAAEVEKAKEYAKGRNKKAAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            QCLKRK+LYEQQIEQLGNFQLR+HDQMIMLEGAKATTETVDALRTGA+AMKAMQKAT ID
Sbjct  61   QCLKRKKLYEQQIEQLGNFQLRVHDQMIMLEGAKATTETVDALRTGASAMKAMQKAT-ID  119

Query  563  DVDXTMDE  586
            DVD TMDE
Sbjct  120  DVDKTMDE  127



>ref|XP_004158431.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Cucumis sativus]
Length=191

 Score =   160 bits (405),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/79 (96%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = +2

Query  350  FTRAKNKRAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAA  529
            +TRAKNKRAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMI+LEGAKATTETVDALRTGAAA
Sbjct  23   YTRAKNKRAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMILLEGAKATTETVDALRTGAAA  82

Query  530  MKAMQKATNIDDVDXTMDE  586
            MKAMQKATNIDDVD TMDE
Sbjct  83   MKAMQKATNIDDVDKTMDE  101



>ref|XP_011014015.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Populus euphratica]
 ref|XP_011014016.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Populus euphratica]
Length=215

 Score =   160 bits (406),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 121/128 (95%), Positives = 122/128 (95%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            MF R+FGKPKQETNAL TLDKLNETLEMLEKKEKVL KKAAAEVEKAKEFTR KNKRAAI
Sbjct  1    MFNRLFGKPKQETNALTTLDKLNETLEMLEKKEKVLLKKAAAEVEKAKEFTRGKNKRAAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            QCLKRKRL EQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID
Sbjct  61   QCLKRKRLDEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  120

Query  563  DVDXTMDE  586
            DVD TMDE
Sbjct  121  DVDKTMDE  128



>ref|XP_009399850.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Musa acuminata subsp. malaccensis]
 ref|XP_009399858.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Musa acuminata subsp. malaccensis]
Length=218

 Score =   160 bits (405),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 117/128 (91%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            MF R+FGKPK++T+ LATLDKLNETLEMLEKKEKVL KK +AEVEKAKEFTRAKNKRAAI
Sbjct  1    MFGRLFGKPKEQTSTLATLDKLNETLEMLEKKEKVLLKKVSAEVEKAKEFTRAKNKRAAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            QCLKRKRLYEQQ+EQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID
Sbjct  61   QCLKRKRLYEQQVEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  120

Query  563  DVDXTMDE  586
            DVD TMDE
Sbjct  121  DVDKTMDE  128



>ref|XP_006580488.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like isoform X3 [Glycine max]
Length=191

 Score =   159 bits (403),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 76/79 (96%), Positives = 77/79 (97%), Gaps = 0/79 (0%)
 Frame = +2

Query  350  FTRAKNKRAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAA  529
            FTRAKNKRAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAA
Sbjct  23   FTRAKNKRAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAA  82

Query  530  MKAMQKATNIDDVDXTMDE  586
            M+AMQK TNIDDVD TMDE
Sbjct  83   MRAMQKETNIDDVDKTMDE  101



>ref|XP_008803193.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Phoenix dactylifera]
 ref|XP_008803194.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Phoenix dactylifera]
 ref|XP_008803195.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Phoenix dactylifera]
 ref|XP_008803197.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Phoenix dactylifera]
Length=219

 Score =   160 bits (405),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 117/128 (91%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            MF R+FGKPK++ NAL TLDKL+ETLEMLEKKEKVL+KK AAEVEKAKEFTRAKNKRAAI
Sbjct  1    MFNRLFGKPKEQANALTTLDKLHETLEMLEKKEKVLEKKVAAEVEKAKEFTRAKNKRAAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETV+ALRTGAAAMKAMQKATNID
Sbjct  61   QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVEALRTGAAAMKAMQKATNID  120

Query  563  DVDXTMDE  586
            DVD TMDE
Sbjct  121  DVDKTMDE  128



>ref|XP_010540987.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Tarenaya hassleriana]
 ref|XP_010540988.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Tarenaya hassleriana]
Length=220

 Score =   160 bits (405),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 118/129 (91%), Positives = 123/129 (95%), Gaps = 1/129 (1%)
 Frame = +2

Query  203  MFT-RIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAA  379
            MF  R+FGKPKQE+NAL TLDKLNETLEMLEKKE VL KKA+AEVEKAKEFTRAKNKRAA
Sbjct  1    MFVNRLFGKPKQESNALQTLDKLNETLEMLEKKENVLLKKASAEVEKAKEFTRAKNKRAA  60

Query  380  IQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNI  559
            IQCLKRKRLYEQQ+EQLGNFQLRIHDQMIMLEGAKATTETVDALR+GAAAMKAMQKATNI
Sbjct  61   IQCLKRKRLYEQQVEQLGNFQLRIHDQMIMLEGAKATTETVDALRSGAAAMKAMQKATNI  120

Query  560  DDVDXTMDE  586
            DDVD TMDE
Sbjct  121  DDVDKTMDE  129



>emb|CDY35892.1| BnaA07g00950D [Brassica napus]
Length=215

 Score =   160 bits (404),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 104/129 (81%), Positives = 119/129 (92%), Gaps = 1/129 (1%)
 Frame = +2

Query  203  MFTRIFGKPKQ-ETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAA  379
            MFTR+F KPK+ ET+ L TL+KLNETL+MLEKKE +L K+AA EVE+AKEFTRAKNKRAA
Sbjct  1    MFTRLFRKPKKKETDTLQTLEKLNETLDMLEKKESLLLKRAAQEVERAKEFTRAKNKRAA  60

Query  380  IQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNI  559
            +QCLKRKR+YEQQ+EQLGN+QLRIHDQMIMLE +KATTETVDALR+GA+AMKAMQKATNI
Sbjct  61   MQCLKRKRVYEQQVEQLGNYQLRIHDQMIMLEDSKATTETVDALRSGASAMKAMQKATNI  120

Query  560  DDVDXTMDE  586
             DVD TMDE
Sbjct  121  HDVDKTMDE  129



>gb|KJB06748.1| hypothetical protein B456_001G010300 [Gossypium raimondii]
 gb|KJB06749.1| hypothetical protein B456_001G010300 [Gossypium raimondii]
 gb|KJB06750.1| hypothetical protein B456_001G010300 [Gossypium raimondii]
Length=218

 Score =   160 bits (404),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 118/128 (92%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            MF R+FGKPKQET+AL TLDKLNETLEMLEKKEKVL KKAAAEVEKAKEF +A+NKRAAI
Sbjct  1    MFNRLFGKPKQETSALTTLDKLNETLEMLEKKEKVLLKKAAAEVEKAKEFAKARNKRAAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            QCLKRKRLYEQQIEQLGNFQLR+HDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID
Sbjct  61   QCLKRKRLYEQQIEQLGNFQLRVHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  120

Query  563  DVDXTMDE  586
            DVD TMDE
Sbjct  121  DVDKTMDE  128



>ref|XP_009396303.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Musa acuminata subsp. malaccensis]
Length=216

 Score =   159 bits (403),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 100/128 (78%), Positives = 114/128 (89%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            MF+R+FGKP ++   L+T+DKL ETL MLEKKE+ L KK AAE+EKAKEFT+A NKRAAI
Sbjct  1    MFSRLFGKPNEKAYDLSTMDKLYETLAMLEKKEQALMKKVAAEIEKAKEFTKANNKRAAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            QCLKRKRL+EQQ+EQLGNFQLRIHDQ+IMLEGAKATTET+DALR GAAAMK +QK TNID
Sbjct  61   QCLKRKRLHEQQVEQLGNFQLRIHDQIIMLEGAKATTETIDALRIGAAAMKTIQKETNID  120

Query  563  DVDXTMDE  586
            DVD TMDE
Sbjct  121  DVDKTMDE  128



>ref|XP_010548688.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Tarenaya hassleriana]
 ref|XP_010548689.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Tarenaya hassleriana]
Length=220

 Score =   159 bits (402),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 119/129 (92%), Positives = 123/129 (95%), Gaps = 1/129 (1%)
 Frame = +2

Query  203  MF-TRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAA  379
            MF  R+FGKPKQE+NAL TLDKLNETLEMLEKKEKVL KKAA EVEKAKEFTRAKNKRAA
Sbjct  1    MFMNRLFGKPKQESNALQTLDKLNETLEMLEKKEKVLLKKAAGEVEKAKEFTRAKNKRAA  60

Query  380  IQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNI  559
            IQCLKRKRLYEQQ+EQLGNFQLRIHDQMIMLEGAKATTETVDALR+GAAAMKAMQKATNI
Sbjct  61   IQCLKRKRLYEQQVEQLGNFQLRIHDQMIMLEGAKATTETVDALRSGAAAMKAMQKATNI  120

Query  560  DDVDXTMDE  586
            DDVD TMDE
Sbjct  121  DDVDKTMDE  129



>gb|KHG25044.1| VPS32.2: Vacuolar protein sorting-associated protein 32 2 [Gossypium 
arboreum]
Length=203

 Score =   158 bits (400),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 118/128 (92%), Positives = 121/128 (95%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            MF R+FGKPKQE NAL TLDKLNETLEMLEKKEKVL KKAAAEVEKAKEF + +NKRAAI
Sbjct  1    MFNRLFGKPKQEANALTTLDKLNETLEMLEKKEKVLVKKAAAEVEKAKEFAKGRNKRAAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID
Sbjct  61   QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  120

Query  563  DVDXTMDE  586
            DVD TMDE
Sbjct  121  DVDKTMDE  128



>gb|KJB65082.1| hypothetical protein B456_010G080200 [Gossypium raimondii]
Length=218

 Score =   159 bits (401),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 118/128 (92%), Positives = 121/128 (95%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            MF R+FGKPKQE NAL TLDKLNETLEMLEKKEKVL KKAAAEVEKAKEF + +NKRAAI
Sbjct  1    MFNRLFGKPKQEANALTTLDKLNETLEMLEKKEKVLVKKAAAEVEKAKEFAKGRNKRAAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID
Sbjct  61   QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  120

Query  563  DVDXTMDE  586
            DVD TMDE
Sbjct  121  DVDKTMDE  128



>gb|KHG25043.1| VPS32.2: Vacuolar protein sorting-associated protein 32 2 [Gossypium 
arboreum]
Length=218

 Score =   159 bits (401),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 118/128 (92%), Positives = 121/128 (95%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            MF R+FGKPKQE NAL TLDKLNETLEMLEKKEKVL KKAAAEVEKAKEF + +NKRAAI
Sbjct  1    MFNRLFGKPKQEANALTTLDKLNETLEMLEKKEKVLVKKAAAEVEKAKEFAKGRNKRAAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID
Sbjct  61   QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  120

Query  563  DVDXTMDE  586
            DVD TMDE
Sbjct  121  DVDKTMDE  128



>ref|XP_010942907.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Elaeis guineensis]
Length=219

 Score =   158 bits (400),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 116/128 (91%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            MF R+FGKPK++ NAL TL+KL+ETLEMLEKKEKVL+KK AAEVEKAKEFTRAKNKRAAI
Sbjct  1    MFNRLFGKPKEQANALTTLEKLHETLEMLEKKEKVLEKKVAAEVEKAKEFTRAKNKRAAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            QCLKRKRLYEQQ+EQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID
Sbjct  61   QCLKRKRLYEQQMEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  120

Query  563  DVDXTMDE  586
            DVD TMDE
Sbjct  121  DVDKTMDE  128



>ref|XP_002883967.1| hypothetical protein ARALYDRAFT_343220 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60226.1| hypothetical protein ARALYDRAFT_343220 [Arabidopsis lyrata subsp. 
lyrata]
Length=186

 Score =   157 bits (397),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/79 (94%), Positives = 77/79 (97%), Gaps = 0/79 (0%)
 Frame = +2

Query  350  FTRAKNKRAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAA  529
            F+R KNKRAAIQCLKRKRLYEQQ+EQLGNFQLRIHDQMIMLEGAKATTETVDALRTGA+A
Sbjct  23   FSRVKNKRAAIQCLKRKRLYEQQVEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGASA  82

Query  530  MKAMQKATNIDDVDXTMDE  586
            MKAMQKATNIDDVD TMDE
Sbjct  83   MKAMQKATNIDDVDKTMDE  101



>gb|KHN40351.1| Vacuolar protein sorting-associated protein 32 like 2 [Glycine 
soja]
Length=241

 Score =   158 bits (400),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 76/79 (96%), Positives = 77/79 (97%), Gaps = 0/79 (0%)
 Frame = +2

Query  350  FTRAKNKRAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAA  529
            FTR KNKRAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMI+LEGAKATTETVDALRTGAAA
Sbjct  73   FTRGKNKRAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMILLEGAKATTETVDALRTGAAA  132

Query  530  MKAMQKATNIDDVDXTMDE  586
            MKAMQKATNIDDVD TMDE
Sbjct  133  MKAMQKATNIDDVDKTMDE  151



>gb|ACJ83886.1| unknown [Medicago truncatula]
Length=221

 Score =   157 bits (398),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 117/131 (89%), Gaps = 2/131 (2%)
 Frame = +2

Query  200  TMFTRIFGKPKQ--ETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKR  373
            +MF+++FGK KQ  + N L+ L+KLNETL +LEKKE VL KKAAAEVE+AKEFTRAKNKR
Sbjct  4    SMFSKLFGKTKQDQQANTLSILEKLNETLGILEKKESVLLKKAAAEVERAKEFTRAKNKR  63

Query  374  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKAT  553
            AAIQCLKRKRLYEQQ+EQLGNFQLRIHDQMIMLEGAKATTETV ALRTGAAAMK MQ+ T
Sbjct  64   AAIQCLKRKRLYEQQVEQLGNFQLRIHDQMIMLEGAKATTETVAALRTGAAAMKTMQQET  123

Query  554  NIDDVDXTMDE  586
            NI+D D TMDE
Sbjct  124  NINDADATMDE  134



>gb|ACU23713.1| unknown [Glycine max]
Length=164

 Score =   155 bits (392),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 117/124 (94%), Positives = 120/124 (97%), Gaps = 0/124 (0%)
 Frame = +2

Query  215  IFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAIQCLK  394
            +FGKPKQETNA+ATLDKLNETLEMLEKKEKVL KK AAEVEKAKEFTR KNKRAAIQCLK
Sbjct  1    MFGKPKQETNAVATLDKLNETLEMLEKKEKVLLKKVAAEVEKAKEFTRGKNKRAAIQCLK  60

Query  395  RKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNIDDVDX  574
            RKRLYEQQIEQLGNFQLRIHDQMI+LEGAKATTETVDALRTGAAAMKAMQKATNIDDVD 
Sbjct  61   RKRLYEQQIEQLGNFQLRIHDQMILLEGAKATTETVDALRTGAAAMKAMQKATNIDDVDK  120

Query  575  TMDE  586
            TMDE
Sbjct  121  TMDE  124



>ref|XP_011077951.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Sesamum indicum]
Length=218

 Score =   157 bits (396),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 114/128 (89%), Positives = 120/128 (94%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            MF RI GKPKQETNALATLDKLNETLEMLEKKE VLQKKA+ EVEKAK +T+AKNKRAAI
Sbjct  1    MFARILGKPKQETNALATLDKLNETLEMLEKKESVLQKKASGEVEKAKAYTKAKNKRAAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            QCLKRK+LYE+QI QL NFQLRIHDQMIMLEGAKATTETVDALR+GAAAMKAMQKATNID
Sbjct  61   QCLKRKKLYEEQIGQLANFQLRIHDQMIMLEGAKATTETVDALRSGAAAMKAMQKATNID  120

Query  563  DVDXTMDE  586
            DVD TMDE
Sbjct  121  DVDKTMDE  128



>gb|EYU30671.1| hypothetical protein MIMGU_mgv1a013622mg [Erythranthe guttata]
Length=215

 Score =   156 bits (395),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 104/129 (81%), Positives = 118/129 (91%), Gaps = 1/129 (1%)
 Frame = +2

Query  203  MFTRIFGK-PKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAA  379
            MF+RI  K PKQET+ L +LDKLNETLEMLEKKE VLQKKA AEVEKAK +T++KNK+AA
Sbjct  1    MFSRILRKQPKQETSTLTSLDKLNETLEMLEKKENVLQKKAYAEVEKAKAYTKSKNKKAA  60

Query  380  IQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNI  559
            IQCLK+K+LYE+QI QLGNFQLRIHDQMIMLEGAKATTETVDALR+GA+AMKAM K+TNI
Sbjct  61   IQCLKKKKLYEEQIAQLGNFQLRIHDQMIMLEGAKATTETVDALRSGASAMKAMNKSTNI  120

Query  560  DDVDXTMDE  586
            DD+D TMDE
Sbjct  121  DDLDKTMDE  129



>ref|XP_006451365.1| hypothetical protein CICLE_v10009534mg [Citrus clementina]
 gb|ESR64605.1| hypothetical protein CICLE_v10009534mg [Citrus clementina]
Length=200

 Score =   155 bits (392),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 73/79 (92%), Positives = 77/79 (97%), Gaps = 0/79 (0%)
 Frame = +2

Query  350  FTRAKNKRAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAA  529
            +++AKNKRAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGA+ 
Sbjct  31   YSKAKNKRAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAST  90

Query  530  MKAMQKATNIDDVDXTMDE  586
            MKAMQKATNIDDVD TMDE
Sbjct  91   MKAMQKATNIDDVDKTMDE  109



>ref|NP_974635.1| vacuolar protein sorting-associated protein 32-2 [Arabidopsis 
thaliana]
 gb|AEE85594.1| vacuolar protein sorting-associated protein 32-2 [Arabidopsis 
thaliana]
Length=192

 Score =   155 bits (391),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 72/79 (91%), Positives = 77/79 (97%), Gaps = 0/79 (0%)
 Frame = +2

Query  350  FTRAKNKRAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAA  529
            ++RAKNKRAAIQCLKRKRLYE Q+EQLGNFQLRIHDQMIMLEGAKATTETVDALR+GA+A
Sbjct  23   YSRAKNKRAAIQCLKRKRLYEGQVEQLGNFQLRIHDQMIMLEGAKATTETVDALRSGASA  82

Query  530  MKAMQKATNIDDVDXTMDE  586
            MKAMQKATNIDDVD TMDE
Sbjct  83   MKAMQKATNIDDVDKTMDE  101



>emb|CDY48599.1| BnaA01g07660D [Brassica napus]
Length=1014

 Score =   165 bits (417),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 104/119 (87%), Positives = 110/119 (92%), Gaps = 0/119 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            M  R+FGKPK E NAL TLDKLNETLEMLEKKEKVL KKA  EVEKAKE+TRAKNKR+AI
Sbjct  1    MMNRLFGKPKHEGNALQTLDKLNETLEMLEKKEKVLLKKAGQEVEKAKEYTRAKNKRSAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNI  559
            QCLKRKRLYEQQ+EQLGNFQLRIHDQMIMLEGAKATTETVDALR+GA+AMKAMQKATN 
Sbjct  61   QCLKRKRLYEQQVEQLGNFQLRIHDQMIMLEGAKATTETVDALRSGASAMKAMQKATNC  119



>gb|KJB83084.1| hypothetical protein B456_013G228900 [Gossypium raimondii]
 gb|KJB83085.1| hypothetical protein B456_013G228900 [Gossypium raimondii]
 gb|KJB83086.1| hypothetical protein B456_013G228900 [Gossypium raimondii]
 gb|KJB83087.1| hypothetical protein B456_013G228900 [Gossypium raimondii]
Length=191

 Score =   154 bits (389),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 72/79 (91%), Positives = 76/79 (96%), Gaps = 0/79 (0%)
 Frame = +2

Query  350  FTRAKNKRAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAA  529
              +A+NKRAA+QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGA+A
Sbjct  23   LAKARNKRAAVQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGASA  82

Query  530  MKAMQKATNIDDVDXTMDE  586
            MKAMQKATNIDDVD TMDE
Sbjct  83   MKAMQKATNIDDVDKTMDE  101



>ref|XP_003630667.1| Vacuolar protein sorting-associated protein-like protein [Medicago 
truncatula]
Length=227

 Score =   155 bits (391),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 114/126 (90%), Gaps = 2/126 (2%)
 Frame = +2

Query  215  IFGKPKQ--ETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAIQC  388
            +FGK KQ  + N L+TL+KLNETL MLEKKE VL KKAAAEVE+AKEFTRAKNKRAAIQC
Sbjct  14   LFGKTKQDQQANTLSTLEKLNETLGMLEKKESVLLKKAAAEVERAKEFTRAKNKRAAIQC  73

Query  389  LKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNIDDV  568
            LKRKRLYEQQ+EQLGNFQLRIHDQMIMLEGAKATTETV ALRTGAAAMK MQ+ TNI+DV
Sbjct  74   LKRKRLYEQQVEQLGNFQLRIHDQMIMLEGAKATTETVAALRTGAAAMKTMQQETNINDV  133

Query  569  DXTMDE  586
            D TMDE
Sbjct  134  DATMDE  139



>ref|XP_007227580.1| hypothetical protein PRUPE_ppa011190mg [Prunus persica]
 gb|EMJ28779.1| hypothetical protein PRUPE_ppa011190mg [Prunus persica]
Length=156

 Score =   153 bits (386),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 103/128 (80%), Positives = 115/128 (90%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            MF R+FGK KQE NAL T+ KLN+TLEMLEKKEKVL KKAAAEVEKAK+FT+A+N+ AAI
Sbjct  1    MFKRVFGKAKQEANALPTIHKLNDTLEMLEKKEKVLVKKAAAEVEKAKQFTQARNRTAAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            +CLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGA ATTETVDALR+G + MKAM KAT ID
Sbjct  61   KCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGANATTETVDALRSGTSVMKAMNKATKID  120

Query  563  DVDXTMDE  586
            D++ TMDE
Sbjct  121  DLEKTMDE  128



>ref|XP_008673975.1| PREDICTED: charged multivesicular body protein 4b isoform X2 
[Zea mays]
 ref|XP_008673980.1| PREDICTED: charged multivesicular body protein 4b isoform X2 
[Zea mays]
 gb|ACF83653.1| unknown [Zea mays]
Length=251

 Score =   155 bits (392),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 133/155 (86%), Gaps = 3/155 (2%)
 Frame = +2

Query  128  DPIQYSVFSGNRNFYSIY*GTL*FTMFTRIFGKPKQE--TNALATLDklnetlemlekke  301
            +P   SVF     F S+    +  +MF RIFGKPK++  +NALATLDKLNETL+MLEKKE
Sbjct  8    NPNILSVFGSEGVFESVA-SVVAMSMFNRIFGKPKEQANSNALATLDKLNETLDMLEKKE  66

Query  302  kvlqkkaaaevekakeFTRAKNKRAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGA  481
            KVL+KKA AE+E+AKEF++AKNKRAAIQ LKRK+LYEQQIEQLGNFQLRIHDQMIMLE A
Sbjct  67   KVLEKKANAELERAKEFSKAKNKRAAIQSLKRKKLYEQQIEQLGNFQLRIHDQMIMLEAA  126

Query  482  KATTETVDALRTGAAAMKAMQKATNIDDVDXTMDE  586
            KATTETVDALRTGAAAMKAMQKATNIDDVD TMDE
Sbjct  127  KATTETVDALRTGAAAMKAMQKATNIDDVDKTMDE  161



>gb|EMS60758.1| Vacuolar protein sorting-associated protein 32-like protein 1 
[Triticum urartu]
Length=374

 Score =   158 bits (400),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 116/126 (92%), Gaps = 2/126 (2%)
 Frame = +2

Query  215  IFGKPKQET--NALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAIQC  388
            +FGK K+++  +ALA++DKL+ETLEMLEKKE +L KKA  EVEKAK FT+AKNK+AAIQC
Sbjct  160  VFGKSKEQSQASALASIDKLSETLEMLEKKENLLMKKANLEVEKAKAFTKAKNKKAAIQC  219

Query  389  LKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNIDDV  568
            LKRKRLYEQQ+EQLGNFQLRIHDQMIMLEGAKATTETVDALRTGA+AMKAM K+TNIDDV
Sbjct  220  LKRKRLYEQQVEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGASAMKAMHKSTNIDDV  279

Query  569  DXTMDE  586
            D TMDE
Sbjct  280  DKTMDE  285



>ref|XP_009337137.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Pyrus x bretschneideri]
 ref|XP_009337138.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Pyrus x bretschneideri]
 ref|XP_009337139.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Pyrus x bretschneideri]
 ref|XP_009337140.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Pyrus x bretschneideri]
Length=220

 Score =   154 bits (390),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 103/128 (80%), Positives = 113/128 (88%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            MF R+FGK KQE N L T+ KLN+TLEMLEKKEKVL KKAA EVEKAK+FT+AKN+ AAI
Sbjct  1    MFKRVFGKAKQEANPLPTIHKLNDTLEMLEKKEKVLVKKAAQEVEKAKQFTQAKNRNAAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            +CLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGA ATTETVDALR+G A MKAM KAT ID
Sbjct  61   KCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGANATTETVDALRSGTAVMKAMNKATKID  120

Query  563  DVDXTMDE  586
            D++ TMDE
Sbjct  121  DLEKTMDE  128



>ref|XP_007227579.1| hypothetical protein PRUPE_ppa011190mg [Prunus persica]
 gb|EMJ28778.1| hypothetical protein PRUPE_ppa011190mg [Prunus persica]
Length=220

 Score =   153 bits (386),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 103/128 (80%), Positives = 115/128 (90%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            MF R+FGK KQE NAL T+ KLN+TLEMLEKKEKVL KKAAAEVEKAK+FT+A+N+ AAI
Sbjct  1    MFKRVFGKAKQEANALPTIHKLNDTLEMLEKKEKVLVKKAAAEVEKAKQFTQARNRTAAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            +CLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGA ATTETVDALR+G + MKAM KAT ID
Sbjct  61   KCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGANATTETVDALRSGTSVMKAMNKATKID  120

Query  563  DVDXTMDE  586
            D++ TMDE
Sbjct  121  DLEKTMDE  128



>ref|XP_008377929.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Malus domestica]
 ref|XP_008377930.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Malus domestica]
 ref|XP_008377931.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Malus domestica]
Length=220

 Score =   153 bits (386),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 102/128 (80%), Positives = 113/128 (88%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            MF R+FGK KQE N L T+ KLN+TLEMLEKKEKVL KKAA EVEKAK+FT+AKN+ AAI
Sbjct  1    MFKRVFGKAKQEANPLPTIHKLNDTLEMLEKKEKVLVKKAAQEVEKAKQFTQAKNRNAAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            +CLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGA ATTETVDALR+G A MKAM KAT I+
Sbjct  61   KCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGANATTETVDALRSGTAVMKAMNKATKIE  120

Query  563  DVDXTMDE  586
            D++ TMDE
Sbjct  121  DLEKTMDE  128



>ref|XP_008220429.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Prunus mume]
Length=220

 Score =   153 bits (386),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 102/128 (80%), Positives = 115/128 (90%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            MF R+FGK KQE NAL T+ KLN+TLEMLEKKEK+L KKAAAEVEKAK+FT+A+N+ AAI
Sbjct  1    MFKRVFGKAKQEPNALPTIHKLNDTLEMLEKKEKLLVKKAAAEVEKAKQFTQARNRTAAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            +CLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGA ATTETVDALR+G + MKAM KAT ID
Sbjct  61   KCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGANATTETVDALRSGTSVMKAMNKATKID  120

Query  563  DVDXTMDE  586
            D++ TMDE
Sbjct  121  DLEKTMDE  128



>emb|CDX82742.1| BnaC07g01240D [Brassica napus]
Length=201

 Score =   152 bits (383),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 105/129 (81%), Gaps = 14/129 (11%)
 Frame = +2

Query  203  MFTRIFGKPKQ-ETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAA  379
            MFTR+F KPK+ ET+ L TL+KLNETL+MLEKKE                FTRAKNKRAA
Sbjct  1    MFTRLFRKPKKKETDTLQTLEKLNETLDMLEKKETKE-------------FTRAKNKRAA  47

Query  380  IQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNI  559
            + CLKRK +YEQQ+EQLGN+QLRIHDQMIMLEG+KATTET+DALR+GA+AMKAMQKATNI
Sbjct  48   MLCLKRKSVYEQQVEQLGNYQLRIHDQMIMLEGSKATTETLDALRSGASAMKAMQKATNI  107

Query  560  DDVDXTMDE  586
             DVD TMDE
Sbjct  108  HDVDKTMDE  116



>ref|XP_002455955.1| hypothetical protein SORBIDRAFT_03g027900 [Sorghum bicolor]
 gb|EES01075.1| hypothetical protein SORBIDRAFT_03g027900 [Sorghum bicolor]
Length=222

 Score =   152 bits (384),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 114/132 (86%), Positives = 125/132 (95%), Gaps = 2/132 (2%)
 Frame = +2

Query  197  FTMFTRIFGKPKQE--TNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNK  370
             +MF RIFGKPK++  +NALATLDKLNETL+MLEKKEKVL+KKAAAE+E+AKEF++AKNK
Sbjct  1    MSMFNRIFGKPKEQANSNALATLDKLNETLDMLEKKEKVLEKKAAAELERAKEFSKAKNK  60

Query  371  RAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKA  550
            RAAIQ LKRK+LYEQQIEQLGNFQLRIHDQMIMLE AKATTETVDALRTGAAAMKAMQKA
Sbjct  61   RAAIQSLKRKKLYEQQIEQLGNFQLRIHDQMIMLEAAKATTETVDALRTGAAAMKAMQKA  120

Query  551  TNIDDVDXTMDE  586
            TNIDDVD TMDE
Sbjct  121  TNIDDVDKTMDE  132



>ref|NP_001241771.1| charged multivesicular body protein 4b [Zea mays]
 ref|XP_008654219.1| PREDICTED: uncharacterized protein LOC100191358 isoform X1 [Zea 
mays]
 ref|XP_008654220.1| PREDICTED: uncharacterized protein LOC100191358 isoform X1 [Zea 
mays]
 gb|ACG36930.1| charged multivesicular body protein 4b [Zea mays]
 gb|ACN31860.1| unknown [Zea mays]
 gb|AFW83261.1| putative SNF domain containing family protein isoform 1 [Zea 
mays]
 gb|AFW83262.1| putative SNF domain containing family protein isoform 2 [Zea 
mays]
 gb|AFW83263.1| putative SNF domain containing family protein isoform 3 [Zea 
mays]
Length=222

 Score =   152 bits (384),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 114/132 (86%), Positives = 125/132 (95%), Gaps = 2/132 (2%)
 Frame = +2

Query  197  FTMFTRIFGKPKQE--TNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNK  370
             +MF RIFGKPK++  +NALATLDKLNETL+MLEKKEKVL+KKAAAE+E+AKEF++AKNK
Sbjct  1    MSMFNRIFGKPKEQANSNALATLDKLNETLDMLEKKEKVLEKKAAAELERAKEFSKAKNK  60

Query  371  RAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKA  550
            RAAIQ LKRK+LYEQQIEQLGNFQLRIHDQMIMLE AKATTETVDALRTGAAAMKAMQKA
Sbjct  61   RAAIQSLKRKKLYEQQIEQLGNFQLRIHDQMIMLEAAKATTETVDALRTGAAAMKAMQKA  120

Query  551  TNIDDVDXTMDE  586
            TNIDDVD TMDE
Sbjct  121  TNIDDVDKTMDE  132



>ref|XP_004969169.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Setaria italica]
Length=221

 Score =   152 bits (384),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 114/132 (86%), Positives = 125/132 (95%), Gaps = 2/132 (2%)
 Frame = +2

Query  197  FTMFTRIFGKPKQE--TNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNK  370
             +MF RIFGKPK++  +NALATLDKLNETL+MLEKKEKVL+KKAAAE+E+AKEF++AKNK
Sbjct  1    MSMFNRIFGKPKEQANSNALATLDKLNETLDMLEKKEKVLEKKAAAELERAKEFSKAKNK  60

Query  371  RAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKA  550
            RAAIQ LKRK+LYEQQIEQLGNFQLRIHDQMIMLE AKATTETVDALRTGAAAMKAMQKA
Sbjct  61   RAAIQSLKRKKLYEQQIEQLGNFQLRIHDQMIMLEAAKATTETVDALRTGAAAMKAMQKA  120

Query  551  TNIDDVDXTMDE  586
            TNIDDVD TMDE
Sbjct  121  TNIDDVDKTMDE  132



>dbj|BAJ91819.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=182

 Score =   150 bits (380),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 72/79 (91%), Positives = 75/79 (95%), Gaps = 0/79 (0%)
 Frame = +2

Query  350  FTRAKNKRAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAA  529
            F++AKNKRAAIQ LKRK+LYEQQIEQLGNFQLRIHDQMIMLE AKATTETVDALRTGA A
Sbjct  14   FSKAKNKRAAIQSLKRKKLYEQQIEQLGNFQLRIHDQMIMLEAAKATTETVDALRTGAKA  73

Query  530  MKAMQKATNIDDVDXTMDE  586
            MKAMQKATNIDDVD TMDE
Sbjct  74   MKAMQKATNIDDVDKTMDE  92



>ref|NP_001130288.1| uncharacterized protein LOC100191382 [Zea mays]
 ref|XP_008672012.1| PREDICTED: uncharacterized protein LOC100191382 isoform X1 [Zea 
mays]
 ref|XP_008672013.1| PREDICTED: uncharacterized protein LOC100191382 isoform X1 [Zea 
mays]
 ref|XP_008672014.1| PREDICTED: uncharacterized protein LOC100191382 isoform X1 [Zea 
mays]
 gb|ACF78462.1| unknown [Zea mays]
Length=222

 Score =   151 bits (382),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 114/132 (86%), Positives = 123/132 (93%), Gaps = 2/132 (2%)
 Frame = +2

Query  197  FTMFTRIFGKPKQETN--ALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNK  370
             +MF RIFGKPK++ N  ALATLDKLNETL+MLEKKEKVL KKAAAE+E+AKEF++AKNK
Sbjct  1    MSMFNRIFGKPKEQANSSALATLDKLNETLDMLEKKEKVLDKKAAAELERAKEFSKAKNK  60

Query  371  RAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKA  550
            RAAIQ LKRK+LYEQQIEQLGNFQLRIHDQMIMLE AKATTETVDALRTGAAAMKAMQKA
Sbjct  61   RAAIQSLKRKKLYEQQIEQLGNFQLRIHDQMIMLEAAKATTETVDALRTGAAAMKAMQKA  120

Query  551  TNIDDVDXTMDE  586
            TNIDDVD TMDE
Sbjct  121  TNIDDVDKTMDE  132



>ref|NP_001147424.1| charged multivesicular body protein 4b [Zea mays]
 ref|XP_008673987.1| PREDICTED: charged multivesicular body protein 4b isoform X1 
[Zea mays]
 ref|XP_008673991.1| PREDICTED: charged multivesicular body protein 4b isoform X1 
[Zea mays]
 gb|ACF81163.1| unknown [Zea mays]
 gb|ACF87539.1| unknown [Zea mays]
 gb|ACG27468.1| charged multivesicular body protein 4b [Zea mays]
 gb|ACN28696.1| unknown [Zea mays]
Length=222

 Score =   151 bits (382),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 113/132 (86%), Positives = 124/132 (94%), Gaps = 2/132 (2%)
 Frame = +2

Query  197  FTMFTRIFGKPKQE--TNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNK  370
             +MF RIFGKPK++  +NALATLDKLNETL+MLEKKEKVL+KKA AE+E+AKEF++AKNK
Sbjct  1    MSMFNRIFGKPKEQANSNALATLDKLNETLDMLEKKEKVLEKKANAELERAKEFSKAKNK  60

Query  371  RAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKA  550
            RAAIQ LKRK+LYEQQIEQLGNFQLRIHDQMIMLE AKATTETVDALRTGAAAMKAMQKA
Sbjct  61   RAAIQSLKRKKLYEQQIEQLGNFQLRIHDQMIMLEAAKATTETVDALRTGAAAMKAMQKA  120

Query  551  TNIDDVDXTMDE  586
            TNIDDVD TMDE
Sbjct  121  TNIDDVDKTMDE  132



>gb|ACG30556.1| charged multivesicular body protein 4b [Zea mays]
Length=208

 Score =   151 bits (381),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 113/132 (86%), Positives = 123/132 (93%), Gaps = 2/132 (2%)
 Frame = +2

Query  197  FTMFTRIFGKPKQETN--ALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNK  370
             +MF RIFGKPK++ N  ALATLDKLN+TL+MLEKKEKVL KKAAAE+E+AKEF++AKNK
Sbjct  1    MSMFNRIFGKPKEQANSSALATLDKLNDTLDMLEKKEKVLDKKAAAELERAKEFSKAKNK  60

Query  371  RAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKA  550
            RAAIQ LKRK+LYEQQIEQLGNFQLRIHDQMIMLE AKATTETVDALRTGAAAMKAMQKA
Sbjct  61   RAAIQSLKRKKLYEQQIEQLGNFQLRIHDQMIMLEAAKATTETVDALRTGAAAMKAMQKA  120

Query  551  TNIDDVDXTMDE  586
            TNIDDVD TMDE
Sbjct  121  TNIDDVDKTMDE  132



>ref|XP_001769849.1| predicted protein [Physcomitrella patens]
 gb|EDQ65411.1| predicted protein [Physcomitrella patens]
Length=189

 Score =   150 bits (378),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/79 (89%), Positives = 75/79 (95%), Gaps = 0/79 (0%)
 Frame = +2

Query  350  FTRAKNKRAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAA  529
            FT  KNKRAAIQCLKRK+LYE Q+EQLGNFQLRIHDQMIMLEGAKATTETVDALR+GA+A
Sbjct  23   FTSLKNKRAAIQCLKRKKLYEVQVEQLGNFQLRIHDQMIMLEGAKATTETVDALRSGASA  82

Query  530  MKAMQKATNIDDVDXTMDE  586
            MKA+QKATNIDDVD TMDE
Sbjct  83   MKAIQKATNIDDVDKTMDE  101



>ref|XP_006660479.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Oryza brachyantha]
Length=218

 Score =   150 bits (378),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 113/130 (87%), Positives = 123/130 (95%), Gaps = 2/130 (2%)
 Frame = +2

Query  203  MFTRIFGKPKQETNA--LATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRA  376
            MF RIFGKPK++ NA  LATLDKLNETL+MLEKKEKVL+KKAAAE+E+AK+F++AKNKRA
Sbjct  1    MFNRIFGKPKEQANASALATLDKLNETLDMLEKKEKVLEKKAAAELERAKDFSKAKNKRA  60

Query  377  AIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATN  556
            AIQ LKRK+LYEQQIEQLGNFQLRIHDQMIMLE AKATTETVDALRTGAAAMKAMQKATN
Sbjct  61   AIQSLKRKKLYEQQIEQLGNFQLRIHDQMIMLEAAKATTETVDALRTGAAAMKAMQKATN  120

Query  557  IDDVDXTMDE  586
            IDDVD TMDE
Sbjct  121  IDDVDKTMDE  130



>gb|ACJ86115.1| unknown [Medicago truncatula]
 gb|AFK44534.1| unknown [Medicago truncatula]
Length=221

 Score =   150 bits (378),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 102/129 (79%), Positives = 112/129 (87%), Gaps = 0/129 (0%)
 Frame = +2

Query  200  TMFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAA  379
            T+ TR+ GKPK + +A  T+ KLNETLEMLEKKE VL KKA AEVEKAKEFTR+KNKRAA
Sbjct  4    TLLTRLLGKPKPKVSAQETIAKLNETLEMLEKKETVLLKKAGAEVEKAKEFTRSKNKRAA  63

Query  380  IQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNI  559
            IQCLKRKRLY+QQ+EQLGNFQLRIHDQMIMLEGA+ATTETVDALRTGA AMK MQ   N+
Sbjct  64   IQCLKRKRLYDQQVEQLGNFQLRIHDQMIMLEGAQATTETVDALRTGAFAMKRMQTEFNL  123

Query  560  DDVDXTMDE  586
            DDVD  MDE
Sbjct  124  DDVDNIMDE  132



>ref|XP_009418535.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Musa acuminata subsp. malaccensis]
Length=218

 Score =   150 bits (378),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 95/128 (74%), Positives = 115/128 (90%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            MF+ +FGK K++ N LATL++LNE L+MLEK+E+ L KK AAEVEKAKEFTR  NKRAAI
Sbjct  2    MFSWLFGKRKEQPNTLATLEELNEKLKMLEKREQFLLKKMAAEVEKAKEFTRENNKRAAI  61

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            QCL+RK+L+EQ++E+LGN+QLRIHDQ+I+LEGAK+TTETVDALRTGAAAMKAM K TNID
Sbjct  62   QCLRRKKLHEQEVERLGNYQLRIHDQIILLEGAKSTTETVDALRTGAAAMKAMLKDTNID  121

Query  563  DVDXTMDE  586
            DVD T+DE
Sbjct  122  DVDKTLDE  129



>ref|XP_009361474.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Pyrus x bretschneideri]
 ref|XP_009361482.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Pyrus x bretschneideri]
Length=223

 Score =   149 bits (376),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 99/128 (77%), Positives = 110/128 (86%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            MF R FGK KQE   L T+ KLN+TL+MLEKKEKVL KKAA E EKAK+FT+AKN+ AAI
Sbjct  1    MFKRAFGKAKQEAGPLPTIHKLNDTLDMLEKKEKVLVKKAAQETEKAKQFTQAKNRNAAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            +CLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGA ATTETVDALR+G + MKAM KAT ID
Sbjct  61   KCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGANATTETVDALRSGTSVMKAMNKATKID  120

Query  563  DVDXTMDE  586
            D++ TMDE
Sbjct  121  DLEKTMDE  128



>ref|XP_008393670.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Malus domestica]
Length=223

 Score =   149 bits (376),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 99/128 (77%), Positives = 111/128 (87%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            MF R FGK KQE + L T+ KLN+TL+MLEKKEKVL KKAA E EKAK+FT+AKN+ AAI
Sbjct  1    MFKRAFGKAKQEASPLPTIHKLNDTLDMLEKKEKVLVKKAAQETEKAKQFTQAKNRNAAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            +CLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGA ATTETVDALR+G + MKAM KAT ID
Sbjct  61   KCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGANATTETVDALRSGTSVMKAMNKATKID  120

Query  563  DVDXTMDE  586
            D++ TMDE
Sbjct  121  DLEKTMDE  128



>ref|NP_001062723.1| Os09g0267600 [Oryza sativa Japonica Group]
 dbj|BAF24637.1| Os09g0267600 [Oryza sativa Japonica Group]
 dbj|BAG89645.1| unnamed protein product [Oryza sativa Japonica Group]
Length=220

 Score =   149 bits (376),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 113/130 (87%), Positives = 123/130 (95%), Gaps = 2/130 (2%)
 Frame = +2

Query  203  MFTRIFGKPKQETNA--LATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRA  376
            MF R+FGKPK++ NA  LATLDKLNETL+MLEKKEKVL+KKAAAE+E+AKEF++AKNKRA
Sbjct  1    MFNRLFGKPKEQANASALATLDKLNETLDMLEKKEKVLEKKAAAELERAKEFSKAKNKRA  60

Query  377  AIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATN  556
            AIQ LKRK+LYEQQIEQLGNFQLRIHDQMIMLE AKATTETVDALRTGAAAMKAMQKATN
Sbjct  61   AIQSLKRKKLYEQQIEQLGNFQLRIHDQMIMLEAAKATTETVDALRTGAAAMKAMQKATN  120

Query  557  IDDVDXTMDE  586
            IDDVD TMDE
Sbjct  121  IDDVDKTMDE  130



>ref|XP_010690124.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
1-like [Beta vulgaris subsp. vulgaris]
Length=224

 Score =   149 bits (375),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 70/79 (89%), Positives = 76/79 (96%), Gaps = 0/79 (0%)
 Frame = +2

Query  350  FTRAKNKRAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAA  529
            FTRAKNKRAAIQCLKRKRLYEQQ+EQ+GNFQLRIHDQ+IML+ AKATTETV ALR+GA+A
Sbjct  58   FTRAKNKRAAIQCLKRKRLYEQQVEQVGNFQLRIHDQIIMLDSAKATTETVAALRSGASA  117

Query  530  MKAMQKATNIDDVDXTMDE  586
            MKAMQKATNIDDVD TMDE
Sbjct  118  MKAMQKATNIDDVDKTMDE  136



>ref|XP_004291010.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Fragaria vesca subsp. vesca]
Length=220

 Score =   147 bits (371),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 100/128 (78%), Positives = 113/128 (88%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            MF ++FGK KQ+  AL TL KLNETLEMLEKKEK+L KKAAAEVEKAK+FT+AKN+ +AI
Sbjct  1    MFRKVFGKTKQDAKALPTLHKLNETLEMLEKKEKLLGKKAAAEVEKAKQFTQAKNRSSAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            +CLKRK+LYEQQIEQLGNFQLRIHDQMIMLE A ATTETVDALR+G A MKAM K TNID
Sbjct  61   KCLKRKKLYEQQIEQLGNFQLRIHDQMIMLESANATTETVDALRSGTAVMKAMNKTTNID  120

Query  563  DVDXTMDE  586
            D++ TMDE
Sbjct  121  DLERTMDE  128



>gb|KJB65080.1| hypothetical protein B456_010G080200 [Gossypium raimondii]
Length=170

 Score =   145 bits (367),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 70/71 (99%), Positives = 70/71 (99%), Gaps = 0/71 (0%)
 Frame = +2

Query  374  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKAT  553
            AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKAT
Sbjct  10   AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKAT  69

Query  554  NIDDVDXTMDE  586
            NIDDVD TMDE
Sbjct  70   NIDDVDKTMDE  80



>ref|XP_009620038.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Nicotiana tomentosiformis]
Length=217

 Score =   147 bits (370),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 98/128 (77%), Positives = 110/128 (86%), Gaps = 1/128 (1%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            MF R+ GKPK+E N LATL+KLNE LE LEKKEKV  KK + EVEKAKEFT+AKNKRAAI
Sbjct  1    MF-RLLGKPKEEPNILATLEKLNEHLENLEKKEKVFLKKVSVEVEKAKEFTKAKNKRAAI  59

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            QCLK+K+LYEQ+IE+LG+ QLRIHDQMI+LE AKATTET+DALR  AA MKAMQKA  ID
Sbjct  60   QCLKKKKLYEQEIERLGSSQLRIHDQMIILESAKATTETLDALRISAATMKAMQKAMKID  119

Query  563  DVDXTMDE  586
            DVD TMDE
Sbjct  120  DVDKTMDE  127



>ref|XP_007152943.1| hypothetical protein PHAVU_004G173400g [Phaseolus vulgaris]
 gb|ESW24937.1| hypothetical protein PHAVU_004G173400g [Phaseolus vulgaris]
Length=215

 Score =   145 bits (366),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 96/128 (75%), Positives = 104/128 (81%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            MF   FGK K E N +A LDKLN+TLE+LEKKE VL KK  AE EKA EF R KNKR A 
Sbjct  1    MFRNFFGKSKPEHNPIAVLDKLNQTLELLEKKEDVLLKKVNAEKEKAIEFIRGKNKRGAA  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            QC+KRK+LYEQQIEQLGNFQLRIHDQMIMLEGA  TT+TV ALR GAAAMKA+QKAT ID
Sbjct  61   QCVKRKKLYEQQIEQLGNFQLRIHDQMIMLEGATVTTDTVAALRIGAAAMKAVQKATKID  120

Query  563  DVDXTMDE  586
            DVD TM+E
Sbjct  121  DVDKTMEE  128



>ref|XP_006842643.1| hypothetical protein AMTR_s00077p00189740 [Amborella trichopoda]
 gb|ERN04318.1| hypothetical protein AMTR_s00077p00189740 [Amborella trichopoda]
Length=218

 Score =   145 bits (366),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 94/128 (73%), Positives = 113/128 (88%), Gaps = 0/128 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            MF ++F K K+  + L+T+DKLNETLEMLEKKE VLQ+K ++E++KAK+FTR KNKRAAI
Sbjct  1    MFEKLFKKSKETLSPLSTIDKLNETLEMLEKKENVLQRKMSSEIQKAKDFTRMKNKRAAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNID  562
            QCLKRK+LYE QIEQLGNFQLRIHDQMI LEGAKATT+TV ALRTGAAAMKA+Q + N+D
Sbjct  61   QCLKRKKLYEAQIEQLGNFQLRIHDQMITLEGAKATTDTVYALRTGAAAMKAIQHSMNVD  120

Query  563  DVDXTMDE  586
            D+D TM+E
Sbjct  121  DIDKTMEE  128



>ref|XP_008782995.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Phoenix dactylifera]
Length=171

 Score =   142 bits (358),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 67/71 (94%), Positives = 70/71 (99%), Gaps = 0/71 (0%)
 Frame = +2

Query  374  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKAT  553
            AAIQCLKRKRLYEQQ+EQLGNFQLR+HDQMIMLEGAKATTETVDALRTGA+AMKAMQKAT
Sbjct  11   AAIQCLKRKRLYEQQVEQLGNFQLRLHDQMIMLEGAKATTETVDALRTGASAMKAMQKAT  70

Query  554  NIDDVDXTMDE  586
            NIDDVD TMDE
Sbjct  71   NIDDVDKTMDE  81



>ref|XP_006853757.1| hypothetical protein AMTR_s00056p00189660 [Amborella trichopoda]
 gb|ERN15224.1| hypothetical protein AMTR_s00056p00189660 [Amborella trichopoda]
Length=117

 Score =   138 bits (348),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 97/106 (92%), Positives = 101/106 (95%), Gaps = 0/106 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            MF ++FGKPKQ+T  LATLDKLNETLEMLEKKEKVLQKK AAEVEKAKEFTRAKNKRAAI
Sbjct  1    MFNKLFGKPKQDTTPLATLDKLNETLEMLEKKEKVLQKKVAAEVEKAKEFTRAKNKRAAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTG  520
            QCLKRKRLYE Q+EQLGNFQLRIHDQMIMLEGAKATTETVDALRTG
Sbjct  61   QCLKRKRLYEAQVEQLGNFQLRIHDQMIMLEGAKATTETVDALRTG  106



>gb|EAZ08368.1| hypothetical protein OsI_30625 [Oryza sativa Indica Group]
Length=990

 Score =   148 bits (374),  Expect = 2e-37, Method: Composition-based stats.
 Identities = 113/130 (87%), Positives = 123/130 (95%), Gaps = 2/130 (2%)
 Frame = +2

Query  203  MFTRIFGKPKQETNA--LATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRA  376
            MF R+FGKPK++ NA  LATLDKLNETL+MLEKKEKVL+KKAAAE+E+AKEF++AKNKRA
Sbjct  771  MFNRLFGKPKEQANASALATLDKLNETLDMLEKKEKVLEKKAAAELERAKEFSKAKNKRA  830

Query  377  AIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATN  556
            AIQ LKRK+LYEQQIEQLGNFQLRIHDQMIMLE AKATTETVDALRTGAAAMKAMQKATN
Sbjct  831  AIQSLKRKKLYEQQIEQLGNFQLRIHDQMIMLEAAKATTETVDALRTGAAAMKAMQKATN  890

Query  557  IDDVDXTMDE  586
            IDDVD TMDE
Sbjct  891  IDDVDKTMDE  900



>gb|EEE69315.1| hypothetical protein OsJ_28603 [Oryza sativa Japonica Group]
Length=1003

 Score =   148 bits (373),  Expect = 3e-37, Method: Composition-based stats.
 Identities = 113/130 (87%), Positives = 123/130 (95%), Gaps = 2/130 (2%)
 Frame = +2

Query  203  MFTRIFGKPKQETNA--LATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRA  376
            MF R+FGKPK++ NA  LATLDKLNETL+MLEKKEKVL+KKAAAE+E+AKEF++AKNKRA
Sbjct  784  MFNRLFGKPKEQANASALATLDKLNETLDMLEKKEKVLEKKAAAELERAKEFSKAKNKRA  843

Query  377  AIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATN  556
            AIQ LKRK+LYEQQIEQLGNFQLRIHDQMIMLE AKATTETVDALRTGAAAMKAMQKATN
Sbjct  844  AIQSLKRKKLYEQQIEQLGNFQLRIHDQMIMLEAAKATTETVDALRTGAAAMKAMQKATN  903

Query  557  IDDVDXTMDE  586
            IDDVD TMDE
Sbjct  904  IDDVDKTMDE  913



>ref|XP_010931425.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like isoform X2 [Elaeis guineensis]
Length=216

 Score =   137 bits (345),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 116/129 (90%), Gaps = 1/129 (1%)
 Frame = +2

Query  203  MFTRIFGKPK-QETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAA  379
            M  R+  KPK Q  +AL+TLD+L+ETLEMLEKKE VLQKK + EVEKAK++T+AKNK+AA
Sbjct  1    MLKRLLTKPKKQPPSALSTLDRLHETLEMLEKKEHVLQKKISGEVEKAKDYTKAKNKKAA  60

Query  380  IQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNI  559
            IQCLK+K+LYE QIEQLGNFQLR+HDQMI+LEGAKATT+T+DALRTG++A+K++Q++ +I
Sbjct  61   IQCLKKKKLYEAQIEQLGNFQLRVHDQMIVLEGAKATTDTIDALRTGSSAVKSIQQSLSI  120

Query  560  DDVDXTMDE  586
            DD++ TM++
Sbjct  121  DDIEKTMEQ  129



>gb|EMT15574.1| Vacuolar protein sorting-associated 32-2-like protein [Aegilops 
tauschii]
Length=186

 Score =   135 bits (341),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 66/74 (89%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +2

Query  365  NKRAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQ  544
            +K+ AIQ LKRK+LYEQQIEQLGNFQLRIHDQMIMLE AKATTETVDALRTGA AMKAMQ
Sbjct  23   HKQTAIQSLKRKKLYEQQIEQLGNFQLRIHDQMIMLEAAKATTETVDALRTGAKAMKAMQ  82

Query  545  KATNIDDVDXTMDE  586
            KATNIDDVD TMDE
Sbjct  83   KATNIDDVDKTMDE  96



>gb|ABK25790.1| unknown [Picea sitchensis]
Length=108

 Score =   133 bits (334),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            MF+R+FG+PK+E N ++TLDKLNETLEMLEKKEKVLQKK  AEVEKA++FTRAKNK+AAI
Sbjct  2    MFSRLFGRPKEEANPISTLDKLNETLEMLEKKEKVLQKKIQAEVEKARDFTRAKNKKAAI  61

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGA  523
            QCLKRKRLYE QIEQLGN+QLRIHDQMIMLEGAKATTETV ALRTG+
Sbjct  62   QCLKRKRLYEVQIEQLGNYQLRIHDQMIMLEGAKATTETVAALRTGS  108



>gb|EYU29306.1| hypothetical protein MIMGU_mgv1a014523mg [Erythranthe guttata]
Length=186

 Score =   134 bits (338),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 75/79 (95%), Positives = 77/79 (97%), Gaps = 0/79 (0%)
 Frame = +2

Query  350  FTRAKNKRAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAA  529
            FTRAKNKRAAIQCLKRK+LYEQQIEQLGN QLRIHDQMIM+EGAKATTETVDALRTGAAA
Sbjct  23   FTRAKNKRAAIQCLKRKKLYEQQIEQLGNSQLRIHDQMIMIEGAKATTETVDALRTGAAA  82

Query  530  MKAMQKATNIDDVDXTMDE  586
            MKAMQKATNIDDVD TMDE
Sbjct  83   MKAMQKATNIDDVDKTMDE  101



>ref|NP_001130264.1| uncharacterized protein LOC100191358 [Zea mays]
 gb|ACF78433.1| unknown [Zea mays]
Length=196

 Score =   132 bits (333),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 73/79 (92%), Positives = 76/79 (96%), Gaps = 0/79 (0%)
 Frame = +2

Query  350  FTRAKNKRAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAA  529
            F++AKNKRAAIQ LKRK+LYEQQIEQLGNFQLRIHDQMIMLE AKATTETVDALRTGAAA
Sbjct  28   FSKAKNKRAAIQSLKRKKLYEQQIEQLGNFQLRIHDQMIMLEAAKATTETVDALRTGAAA  87

Query  530  MKAMQKATNIDDVDXTMDE  586
            MKAMQKATNIDDVD TMDE
Sbjct  88   MKAMQKATNIDDVDKTMDE  106



>ref|XP_002466250.1| hypothetical protein SORBIDRAFT_01g004370 [Sorghum bicolor]
 gb|EER93248.1| hypothetical protein SORBIDRAFT_01g004370 [Sorghum bicolor]
Length=191

 Score =   132 bits (332),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 73/79 (92%), Positives = 76/79 (96%), Gaps = 0/79 (0%)
 Frame = +2

Query  350  FTRAKNKRAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAA  529
            F++AKNKRAAIQ LKRK+LYEQQIEQLGNFQLRIHDQMIMLE AKATTETVDALRTGAAA
Sbjct  23   FSKAKNKRAAIQALKRKKLYEQQIEQLGNFQLRIHDQMIMLEAAKATTETVDALRTGAAA  82

Query  530  MKAMQKATNIDDVDXTMDE  586
            MKAMQKATNIDDVD TMDE
Sbjct  83   MKAMQKATNIDDVDKTMDE  101



>ref|XP_008788033.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Phoenix dactylifera]
Length=216

 Score =   132 bits (333),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 114/129 (88%), Gaps = 1/129 (1%)
 Frame = +2

Query  203  MFTRIFGKPKQET-NALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAA  379
            M  R+  KPK+E  +AL+TLD+L+ETLEMLEKKE VLQKK + EVEKAK+ T+AKNK+AA
Sbjct  1    MLKRLLTKPKKEPPSALSTLDRLHETLEMLEKKEHVLQKKISIEVEKAKDCTKAKNKKAA  60

Query  380  IQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNI  559
            IQCLK+K+LYE QIEQLGNFQLR+HDQMI+LEGAKATT+ +DAL+ G++A+K+MQ++ +I
Sbjct  61   IQCLKKKKLYEAQIEQLGNFQLRVHDQMIVLEGAKATTDVIDALQAGSSAVKSMQQSLSI  120

Query  560  DDVDXTMDE  586
            DDV+ TM++
Sbjct  121  DDVEKTMEQ  129



>ref|XP_010049157.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like isoform X1 [Eucalyptus grandis]
 gb|KCW81634.1| hypothetical protein EUGRSUZ_C02996 [Eucalyptus grandis]
 gb|KCW81635.1| hypothetical protein EUGRSUZ_C02996 [Eucalyptus grandis]
Length=219

 Score =   130 bits (327),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 113/129 (88%), Gaps = 1/129 (1%)
 Frame = +2

Query  203  MFTRIFGKPKQET-NALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAA  379
            MF ++F K K+ T +A+ T+DKLNETLEMLEKKE  L KKAAAEVE+AK +T+AK K AA
Sbjct  1    MFQKMFTKKKESTASAITTIDKLNETLEMLEKKENFLAKKAAAEVERAKTYTKAKKKNAA  60

Query  380  IQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNI  559
            IQCLK+K++YE QIEQLG++QLRIHDQMIMLEGAKATTETVDALR+GAA MKAM KATNI
Sbjct  61   IQCLKKKKMYETQIEQLGSYQLRIHDQMIMLEGAKATTETVDALRSGAATMKAMHKATNI  120

Query  560  DDVDXTMDE  586
            DD+D TMDE
Sbjct  121  DDLDRTMDE  129



>ref|XP_010049158.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like isoform X2 [Eucalyptus grandis]
Length=191

 Score =   129 bits (324),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/71 (85%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = +2

Query  374  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKAT  553
            AAIQCLK+K++YE QIEQLG++QLRIHDQMIMLEGAKATTETVDALR+GAA MKAM KAT
Sbjct  31   AAIQCLKKKKMYETQIEQLGSYQLRIHDQMIMLEGAKATTETVDALRSGAATMKAMHKAT  90

Query  554  NIDDVDXTMDE  586
            NIDD+D TMDE
Sbjct  91   NIDDLDRTMDE  101



>gb|AET05142.2| charged multivesicular body protein [Medicago truncatula]
Length=205

 Score =   127 bits (319),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 84/129 (65%), Positives = 93/129 (72%), Gaps = 16/129 (12%)
 Frame = +2

Query  200  TMFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAA  379
            T+ TR+ GKPK + +A  T+ KLNETLEMLEKKE VL                 K    A
Sbjct  4    TLLTRLLGKPKPKVSAQETIAKLNETLEMLEKKETVLL----------------KKGWTA  47

Query  380  IQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNI  559
            IQCLKRKRLY+QQ+EQLGNFQLRIHDQMIMLEGA+ATTETVDALRTGA AMK MQ   N+
Sbjct  48   IQCLKRKRLYDQQVEQLGNFQLRIHDQMIMLEGAQATTETVDALRTGAFAMKRMQTEFNL  107

Query  560  DDVDXTMDE  586
            DDVD  MDE
Sbjct  108  DDVDNIMDE  116



>ref|XP_010922839.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Elaeis guineensis]
Length=217

 Score =   127 bits (319),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 75/79 (95%), Gaps = 0/79 (0%)
 Frame = +2

Query  350  FTRAKNKRAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAA  529
            +T+ KNK+AAIQCLK+K+LYE QIEQLGNFQLR+HDQMI+LEGAKATT+T+DALRTG++A
Sbjct  52   YTKMKNKKAAIQCLKKKKLYEAQIEQLGNFQLRVHDQMIVLEGAKATTDTIDALRTGSSA  111

Query  530  MKAMQKATNIDDVDXTMDE  586
            +K++Q++ ++DD++ TM++
Sbjct  112  VKSIQQSLSVDDIEKTMEQ  130



>ref|XP_008804654.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Phoenix dactylifera]
Length=216

 Score =   127 bits (318),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 111/129 (86%), Gaps = 1/129 (1%)
 Frame = +2

Query  203  MFTRIFGKPKQE-TNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAA  379
            M  R+  K K++  +AL+TLD+L+E LE LEKKE VLQKK + EVEKAK++T+ KNK+AA
Sbjct  1    MLKRLLTKSKKKAPSALSTLDRLHELLETLEKKEHVLQKKISIEVEKAKDYTKVKNKKAA  60

Query  380  IQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNI  559
            IQCLK+K+LYE QIEQLG FQLR+HDQMI LEGAKATT+T+DALRTG++A+K++Q++ ++
Sbjct  61   IQCLKKKKLYEAQIEQLGKFQLRVHDQMITLEGAKATTDTIDALRTGSSAVKSIQQSLSV  120

Query  560  DDVDXTMDE  586
            DD++ TM++
Sbjct  121  DDIEKTMEQ  129



>ref|XP_003630666.1| Vacuolar protein sorting-associated protein-like protein [Medicago 
truncatula]
Length=230

 Score =   127 bits (319),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 84/129 (65%), Positives = 93/129 (72%), Gaps = 16/129 (12%)
 Frame = +2

Query  200  TMFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAA  379
            T+ TR+ GKPK + +A  T+ KLNETLEMLEKKE VL                 K    A
Sbjct  4    TLLTRLLGKPKPKVSAQETIAKLNETLEMLEKKETVLL----------------KKGWTA  47

Query  380  IQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNI  559
            IQCLKRKRLY+QQ+EQLGNFQLRIHDQMIMLEGA+ATTETVDALRTGA AMK MQ   N+
Sbjct  48   IQCLKRKRLYDQQVEQLGNFQLRIHDQMIMLEGAQATTETVDALRTGAFAMKRMQTEFNL  107

Query  560  DDVDXTMDE  586
            DDVD  MDE
Sbjct  108  DDVDNIMDE  116



>ref|XP_009767750.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Nicotiana sylvestris]
Length=219

 Score =   125 bits (315),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 81/130 (62%), Positives = 95/130 (73%), Gaps = 3/130 (2%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetle--mlekkekvlqkkaaaevekakeFTRAKNKRA  376
            MF R+ GKPK+E N LATL+KLNE LE    ++K  + +     E  + KEF       A
Sbjct  1    MF-RLLGKPKEEPNILATLEKLNEHLEDLEKKEKVFLKKVSVEVEKLRIKEFNYRSFIVA  59

Query  377  AIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATN  556
            AIQCLKRK+LYEQ+IE+LG+ QLRIHDQMI+LE AKATTET+DALR  AA MKAMQKA  
Sbjct  60   AIQCLKRKKLYEQEIERLGSSQLRIHDQMIILESAKATTETLDALRISAATMKAMQKAKK  119

Query  557  IDDVDXTMDE  586
            IDDVD TMDE
Sbjct  120  IDDVDKTMDE  129



>ref|XP_008679351.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Zea mays]
 ref|XP_008679352.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Zea mays]
 ref|XP_008679353.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Zea mays]
 ref|XP_008679354.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Zea mays]
Length=223

 Score =   125 bits (314),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 72/79 (91%), Gaps = 0/79 (0%)
 Frame = +2

Query  350  FTRAKNKRAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAA  529
            +T+AKNK AAIQCLK+K+LYE QIEQL NFQLR+HDQ+IMLE AKATT+TVDALR+G++A
Sbjct  56   YTKAKNKNAAIQCLKKKKLYETQIEQLSNFQLRVHDQIIMLESAKATTDTVDALRSGSSA  115

Query  530  MKAMQKATNIDDVDXTMDE  586
            +KAMQ++ N+DD++  ++E
Sbjct  116  VKAMQQSVNVDDIEKAIEE  134



>ref|XP_010931424.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like isoform X1 [Elaeis guineensis]
Length=236

 Score =   124 bits (312),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 116/149 (78%), Gaps = 21/149 (14%)
 Frame = +2

Query  203  MFTRIFGKPK-QETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKR--  373
            M  R+  KPK Q  +AL+TLD+L+ETLEMLEKKE VLQKK + EVEKAK++T+AKNK+  
Sbjct  1    MLKRLLTKPKKQPPSALSTLDRLHETLEMLEKKEHVLQKKISGEVEKAKDYTKAKNKKVQ  60

Query  374  ------------------AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTET  499
                              +AIQCLK+K+LYE QIEQLGNFQLR+HDQMI+LEGAKATT+T
Sbjct  61   HQLAYDKGLIKPVMDLTSSAIQCLKKKKLYEAQIEQLGNFQLRVHDQMIVLEGAKATTDT  120

Query  500  VDALRTGAAAMKAMQKATNIDDVDXTMDE  586
            +DALRTG++A+K++Q++ +IDD++ TM++
Sbjct  121  IDALRTGSSAVKSIQQSLSIDDIEKTMEQ  149



>ref|XP_004978491.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Setaria italica]
Length=219

 Score =   124 bits (310),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 72/79 (91%), Gaps = 0/79 (0%)
 Frame = +2

Query  350  FTRAKNKRAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAA  529
            +T++KNK AAIQCLK+K+LYE QIEQL NFQLR+HDQ+IMLE AKATT+TVDALR+G++A
Sbjct  56   YTKSKNKNAAIQCLKKKKLYETQIEQLSNFQLRVHDQIIMLESAKATTDTVDALRSGSSA  115

Query  530  MKAMQKATNIDDVDXTMDE  586
            +K++Q++ NIDD++  +DE
Sbjct  116  VKSIQQSLNIDDIENAIDE  134



>ref|XP_003579007.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Brachypodium distachyon]
 ref|XP_010238790.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Brachypodium distachyon]
 ref|XP_010238791.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Brachypodium distachyon]
 ref|XP_010238792.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Brachypodium distachyon]
Length=219

 Score =   122 bits (307),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 72/79 (91%), Gaps = 0/79 (0%)
 Frame = +2

Query  350  FTRAKNKRAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAA  529
            +T+AKNK AAIQCLK+K+LYE QIEQL NFQLR+HDQ+IMLE AKATT+TVDALR+G++A
Sbjct  56   YTKAKNKNAAIQCLKKKKLYETQIEQLSNFQLRVHDQIIMLENAKATTDTVDALRSGSSA  115

Query  530  MKAMQKATNIDDVDXTMDE  586
            +KA+Q++ +IDD++  ++E
Sbjct  116  VKAIQQSLSIDDIENVIEE  134



>ref|XP_002450174.1| hypothetical protein SORBIDRAFT_05g001480 [Sorghum bicolor]
 gb|EES09162.1| hypothetical protein SORBIDRAFT_05g001480 [Sorghum bicolor]
Length=220

 Score =   122 bits (305),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 72/79 (91%), Gaps = 0/79 (0%)
 Frame = +2

Query  350  FTRAKNKRAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAA  529
            +T++KNK AAIQCLK+K+LYE QIEQL NFQLR+HDQ+IMLE AKATT+TVDALR+G++A
Sbjct  56   YTKSKNKNAAIQCLKKKKLYETQIEQLSNFQLRVHDQIIMLESAKATTDTVDALRSGSSA  115

Query  530  MKAMQKATNIDDVDXTMDE  586
            +KA+Q++ +IDD++  ++E
Sbjct  116  VKAIQQSVSIDDIESAIEE  134



>ref|NP_001065616.1| Os11g0123500 [Oryza sativa Japonica Group]
 gb|ABA91256.1| SNF7 family protein, expressed [Oryza sativa Japonica Group]
 gb|ABA91257.1| SNF7 family protein, expressed [Oryza sativa Japonica Group]
 dbj|BAF27461.1| Os11g0123500 [Oryza sativa Japonica Group]
 gb|EEE51554.1| hypothetical protein OsJ_32766 [Oryza sativa Japonica Group]
Length=216

 Score =   121 bits (304),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 71/79 (90%), Gaps = 0/79 (0%)
 Frame = +2

Query  350  FTRAKNKRAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAA  529
            +T+AKNK AAIQCLK+K+LYE QIEQL NFQLR+HDQ+IMLE AKATT+TVDALR+G++A
Sbjct  55   YTKAKNKSAAIQCLKKKKLYETQIEQLANFQLRVHDQIIMLESAKATTDTVDALRSGSSA  114

Query  530  MKAMQKATNIDDVDXTMDE  586
            +KA+ ++ +IDD++  ++E
Sbjct  115  VKAIHQSVSIDDIENAIEE  133



>gb|EEC67568.1| hypothetical protein OsI_34912 [Oryza sativa Indica Group]
Length=216

 Score =   121 bits (304),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 71/79 (90%), Gaps = 0/79 (0%)
 Frame = +2

Query  350  FTRAKNKRAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAA  529
            +T+AKNK AAIQCLK+K+LYE QIEQL NFQLR+HDQ+IMLE AKATT+TVDALR+G++A
Sbjct  55   YTKAKNKSAAIQCLKKKKLYETQIEQLANFQLRVHDQIIMLESAKATTDTVDALRSGSSA  114

Query  530  MKAMQKATNIDDVDXTMDE  586
            +KA+ ++ +IDD++  ++E
Sbjct  115  VKAIHQSVSIDDIENAIEE  133



>ref|XP_006663763.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Oryza brachyantha]
Length=217

 Score =   121 bits (303),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 71/79 (90%), Gaps = 0/79 (0%)
 Frame = +2

Query  350  FTRAKNKRAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAA  529
            +T+AKNK AAIQCLK+K+LYE QIEQL NFQLR+HDQ+IMLE AKATT+TVDALR+G++A
Sbjct  56   YTKAKNKSAAIQCLKKKKLYETQIEQLSNFQLRVHDQIIMLESAKATTDTVDALRSGSSA  115

Query  530  MKAMQKATNIDDVDXTMDE  586
            +KA+ ++ +IDD++  ++E
Sbjct  116  VKAIHQSVSIDDIENAIEE  134



>ref|NP_001066025.2| Os12g0121400 [Oryza sativa Japonica Group]
 gb|ABA95683.2| SNF7 family protein, expressed [Oryza sativa Japonica Group]
 gb|EEC68756.1| hypothetical protein OsI_37279 [Oryza sativa Indica Group]
 gb|EEE52665.1| hypothetical protein OsJ_35039 [Oryza sativa Japonica Group]
 dbj|BAF29044.2| Os12g0121400 [Oryza sativa Japonica Group]
Length=216

 Score =   121 bits (303),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 71/79 (90%), Gaps = 0/79 (0%)
 Frame = +2

Query  350  FTRAKNKRAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAA  529
            +T+AKNK AAIQCLK+K+LYE QIEQL NFQLR+HDQ+IMLE AKATT+TVDALR+G++A
Sbjct  56   YTKAKNKSAAIQCLKKKKLYETQIEQLANFQLRVHDQIIMLESAKATTDTVDALRSGSSA  115

Query  530  MKAMQKATNIDDVDXTMDE  586
            +KA+ ++ +IDD++  ++E
Sbjct  116  VKAIHQSVSIDDIENAIEE  134



>dbj|BAJ97352.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=218

 Score =   121 bits (303),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 72/79 (91%), Gaps = 0/79 (0%)
 Frame = +2

Query  350  FTRAKNKRAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAA  529
            +T+AKNK AAIQCLK+K+LYE QIEQL NFQLR+HDQ+IMLE AKATT+TVDALR+G++A
Sbjct  56   YTKAKNKNAAIQCLKKKKLYETQIEQLSNFQLRVHDQIIMLENAKATTDTVDALRSGSSA  115

Query  530  MKAMQKATNIDDVDXTMDE  586
            +KA+Q++ +IDD++  ++E
Sbjct  116  VKAIQQSLSIDDIENAIEE  134



>gb|EMS66152.1| Vacuolar protein sorting-associated protein 32-like protein 1 
[Triticum urartu]
Length=278

 Score =   121 bits (304),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 72/79 (91%), Gaps = 0/79 (0%)
 Frame = +2

Query  350  FTRAKNKRAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAA  529
            +T+AKNK AAIQCLK+K+LYE QIEQL NFQLR+HDQ+IMLE AKATT+TVDALR+G++A
Sbjct  116  YTKAKNKNAAIQCLKKKKLYETQIEQLSNFQLRVHDQIIMLENAKATTDTVDALRSGSSA  175

Query  530  MKAMQKATNIDDVDXTMDE  586
            +KA+Q++ +IDD++  ++E
Sbjct  176  VKAIQQSLSIDDIENAIEE  194



>gb|EMT02888.1| Vacuolar protein sorting-associated 32-1-like protein [Aegilops 
tauschii]
Length=306

 Score =   122 bits (305),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 72/79 (91%), Gaps = 0/79 (0%)
 Frame = +2

Query  350  FTRAKNKRAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAA  529
            +T+AKNK AAIQCLK+K+LYE QIEQL NFQLR+HDQ+IMLE AKATT+TVDALR+G++A
Sbjct  145  YTKAKNKNAAIQCLKKKKLYETQIEQLSNFQLRVHDQIIMLENAKATTDTVDALRSGSSA  204

Query  530  MKAMQKATNIDDVDXTMDE  586
            +KA+Q++ +IDD++  ++E
Sbjct  205  VKAIQQSLSIDDIENAIEE  223



>ref|XP_006662688.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like isoform X2 [Oryza brachyantha]
Length=184

 Score =   117 bits (293),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +2

Query  350  FTRAKNKRAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAA  529
            +T+AKNK AAIQCLK+K+LYE QIEQL NFQLR+HDQ+IMLE AKATT+ VDALR+G++A
Sbjct  23   YTKAKNKSAAIQCLKKKKLYETQIEQLSNFQLRVHDQIIMLESAKATTDIVDALRSGSSA  82

Query  530  MKAMQKATNIDDVDXTMDE  586
            +KA+ ++ +IDD++  + E
Sbjct  83   VKAIHQSVSIDDIENAIGE  101



>ref|XP_006662687.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like isoform X1 [Oryza brachyantha]
Length=195

 Score =   117 bits (292),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +2

Query  350  FTRAKNKRAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAA  529
            +T+AKNK AAIQCLK+K+LYE QIEQL NFQLR+HDQ+IMLE AKATT+ VDALR+G++A
Sbjct  23   YTKAKNKSAAIQCLKKKKLYETQIEQLSNFQLRVHDQIIMLESAKATTDIVDALRSGSSA  82

Query  530  MKAMQKATNIDDVDXTMDE  586
            +KA+ ++ +IDD++  + E
Sbjct  83   VKAIHQSVSIDDIENAIGE  101



>ref|XP_006662689.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like isoform X3 [Oryza brachyantha]
Length=217

 Score =   117 bits (294),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +2

Query  350  FTRAKNKRAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAA  529
            +T+AKNK AAIQCLK+K+LYE QIEQL NFQLR+HDQ+IMLE AKATT+ VDALR+G++A
Sbjct  56   YTKAKNKSAAIQCLKKKKLYETQIEQLSNFQLRVHDQIIMLESAKATTDIVDALRSGSSA  115

Query  530  MKAMQKATNIDDVDXTMDE  586
            +KA+ ++ +IDD++  + E
Sbjct  116  VKAIHQSVSIDDIENAIGE  134



>gb|KCW44187.1| hypothetical protein EUGRSUZ_L02392 [Eucalyptus grandis]
Length=206

 Score =   115 bits (287),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 67/79 (85%), Positives = 71/79 (90%), Gaps = 0/79 (0%)
 Frame = +2

Query  350  FTRAKNKRAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAA  529
             +RA  KRAAIQCLKRKRLYEQ+IEQL  FQL I DQ+IMLEGAKATTETVDALRTGAAA
Sbjct  51   LSRANIKRAAIQCLKRKRLYEQRIEQLRYFQLPIRDQIIMLEGAKATTETVDALRTGAAA  110

Query  530  MKAMQKATNIDDVDXTMDE  586
            MKAMQKATNIDD+D TMDE
Sbjct  111  MKAMQKATNIDDLDKTMDE  129



>gb|ADD22150.1| copia-like retroelement pol polyprotein, partial [Oryza barthii]
 gb|ADD22151.1| copia-like retroelement pol polyprotein, partial [Oryza barthii]
 gb|ADD22152.1| copia-like retroelement pol polyprotein, partial [Oryza barthii]
 gb|ADD22153.1| copia-like retroelement pol polyprotein, partial [Oryza barthii]
 gb|ADD22154.1| copia-like retroelement pol polyprotein, partial [Oryza barthii]
 gb|ADD22156.1| copia-like retroelement pol polyprotein, partial [Oryza barthii]
 gb|ADD22157.1| copia-like retroelement pol polyprotein, partial [Oryza barthii]
 gb|ADD22158.1| copia-like retroelement pol polyprotein, partial [Oryza barthii]
 gb|ADD22159.1| copia-like retroelement pol polyprotein, partial [Oryza barthii]
 gb|ADD22160.1| copia-like retroelement pol polyprotein, partial [Oryza barthii]
 gb|ADD22161.1| copia-like retroelement pol polyprotein, partial [Oryza barthii]
 gb|ADD22162.1| copia-like retroelement pol polyprotein, partial [Oryza barthii]
 gb|ADD22163.1| copia-like retroelement pol polyprotein, partial [Oryza barthii]
 gb|ADD22164.1| copia-like retroelement pol polyprotein, partial [Oryza barthii]
 gb|ADD22165.1| copia-like retroelement pol polyprotein, partial [Oryza barthii]
 gb|ADD22166.1| copia-like retroelement pol polyprotein, partial [Oryza barthii]
 gb|ADD22167.1| copia-like retroelement pol polyprotein, partial [Oryza barthii]
 gb|ADD22168.1| copia-like retroelement pol polyprotein, partial [Oryza barthii]
 gb|ADD22169.1| copia-like retroelement pol polyprotein, partial [Oryza barthii]
 gb|ADD22170.1| copia-like retroelement pol polyprotein, partial [Oryza glaberrima]
 gb|ADD22171.1| copia-like retroelement pol polyprotein, partial [Oryza glaberrima]
 gb|ADD22172.1| copia-like retroelement pol polyprotein, partial [Oryza glaberrima]
 gb|ADD22173.1| copia-like retroelement pol polyprotein, partial [Oryza glaberrima]
 gb|ADD22174.1| copia-like retroelement pol polyprotein, partial [Oryza glaberrima]
 gb|ADD22175.1| copia-like retroelement pol polyprotein, partial [Oryza glaberrima]
 gb|ADD22176.1| copia-like retroelement pol polyprotein, partial [Oryza glaberrima]
 gb|ADD22177.1| copia-like retroelement pol polyprotein, partial [Oryza glaberrima]
 gb|ADD22178.1| copia-like retroelement pol polyprotein, partial [Oryza glaberrima]
 gb|ADD22179.1| copia-like retroelement pol polyprotein, partial [Oryza glaberrima]
 gb|ADD22180.1| copia-like retroelement pol polyprotein, partial [Oryza glaberrima]
 gb|ADD22181.1| copia-like retroelement pol polyprotein, partial [Oryza glaberrima]
 gb|ADD22182.1| copia-like retroelement pol polyprotein, partial [Oryza glaberrima]
 gb|ADD22183.1| copia-like retroelement pol polyprotein, partial [Oryza glaberrima]
 gb|ADD22184.1| copia-like retroelement pol polyprotein, partial [Oryza glaberrima]
 gb|ADD22185.1| copia-like retroelement pol polyprotein, partial [Oryza glaberrima]
 gb|ADD22186.1| copia-like retroelement pol polyprotein, partial [Oryza glaberrima]
 gb|ADD22187.1| copia-like retroelement pol polyprotein, partial [Oryza glaberrima]
 gb|ADD22188.1| copia-like retroelement pol polyprotein, partial [Oryza glaberrima]
 gb|ADD22189.1| copia-like retroelement pol polyprotein, partial [Oryza glaberrima]
 gb|ADD22190.1| copia-like retroelement pol polyprotein, partial [Oryza nivara]
Length=83

 Score =   109 bits (272),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 54/56 (96%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +2

Query  419  IEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNIDDVDXTMDE  586
            IEQLGNFQLRIHDQMIMLE AKATTETVDALRTGAAAMKAMQKATNIDDVD TMDE
Sbjct  1    IEQLGNFQLRIHDQMIMLEAAKATTETVDALRTGAAAMKAMQKATNIDDVDKTMDE  56



>gb|EYU27236.1| hypothetical protein MIMGU_mgv1a019968mg [Erythranthe guttata]
Length=207

 Score =   112 bits (281),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 100/129 (78%), Positives = 110/129 (85%), Gaps = 11/129 (9%)
 Frame = +2

Query  203  MFTRIFGKPKQE-TNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAA  379
            MFTR+ GKPKQE  NALATLDKLNETLEMLEKKE VLQKKA+AE++KAKE T+AKNKRAA
Sbjct  1    MFTRLLGKPKQEEANALATLDKLNETLEMLEKKEGVLQKKASAELDKAKEHTKAKNKRAA  60

Query  380  IQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNI  559
            IQCLK+K+LYE+QI QL NFQ          +GAKATTETVDALR+ AAAMKAMQKATNI
Sbjct  61   IQCLKKKKLYEEQIGQLANFQ----------QGAKATTETVDALRSAAAAMKAMQKATNI  110

Query  560  DDVDXTMDE  586
            DDVD TMDE
Sbjct  111  DDVDKTMDE  119



>ref|XP_006837368.1| hypothetical protein AMTR_s00111p00112330 [Amborella trichopoda]
 gb|ERN00222.1| hypothetical protein AMTR_s00111p00112330 [Amborella trichopoda]
Length=227

 Score =   112 bits (280),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 76/129 (59%), Positives = 99/129 (77%), Gaps = 3/129 (2%)
 Frame = +2

Query  197  FTMFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRA  376
              M  ++F KPK+     +TLDKL +T+ +LE+KE  LQ K AAEVE+AKEF R KNKRA
Sbjct  15   IVMLVKLFMKPKRLP---STLDKLTQTIRVLEEKECALQNKIAAEVERAKEFIRTKNKRA  71

Query  377  AIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATN  556
             IQCLKRKRL+E+Q+EQL +FQ RIH Q++MLEGAKA +ET+DAL+ GA +M+++Q+  N
Sbjct  72   TIQCLKRKRLFEEQVEQLRDFQYRIHIQILMLEGAKAASETLDALKIGALSMQSIQRGMN  131

Query  557  IDDVDXTMD  583
            ID V  TMD
Sbjct  132  IDGVKETMD  140



>ref|XP_010042633.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like, partial [Eucalyptus grandis]
Length=86

 Score =   108 bits (270),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 80/86 (93%), Positives = 82/86 (95%), Gaps = 0/86 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            MF R+FGKPKQETNAL TLDKLNETLEMLEKKEKVL KKA+ EVEKAKEFTRAKNKRAAI
Sbjct  1    MFNRLFGKPKQETNALTTLDKLNETLEMLEKKEKVLIKKASQEVEKAKEFTRAKNKRAAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQ  460
            QCLKRKRLYEQQIEQLGNFQLRIHDQ
Sbjct  61   QCLKRKRLYEQQIEQLGNFQLRIHDQ  86



>gb|ABG21860.1| SNF7 family protein, expressed [Oryza sativa Japonica Group]
Length=162

 Score =   109 bits (272),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
 Frame = +2

Query  374  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKAT  553
            AAIQCLK+K+LYE QIEQL NFQLR+HDQ+IMLE AKATT+TVDALR+G++A+KA+ ++ 
Sbjct  10   AAIQCLKKKKLYETQIEQLANFQLRVHDQIIMLESAKATTDTVDALRSGSSAVKAIHQSV  69

Query  554  NIDDVDXTMDE  586
            +IDD++  ++E
Sbjct  70   SIDDIENAIEE  80



>ref|XP_008660967.1| PREDICTED: uncharacterized protein LOC103640100 [Zea mays]
Length=519

 Score =   114 bits (284),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 65/71 (92%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = +2

Query  374  AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKAT  553
            A IQ LKRK+LYEQQIEQLGNFQLRIHDQMIMLE  KATTETVDALRTGAAAMKAMQKAT
Sbjct  393  ATIQSLKRKKLYEQQIEQLGNFQLRIHDQMIMLEAPKATTETVDALRTGAAAMKAMQKAT  452

Query  554  NIDDVDXTMDE  586
            NIDDVD TMDE
Sbjct  453  NIDDVDKTMDE  463



>gb|AFM35785.1| hypothetical protein, partial [Oryza eichingeri]
Length=95

 Score =   106 bits (264),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 62/65 (95%), Positives = 63/65 (97%), Gaps = 0/65 (0%)
 Frame = +2

Query  392  KRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNIDDVD  571
            KRK+LYEQQIEQLGNFQLRIHDQMIMLE AKATTETVDALRTGAAAMKAMQKATNIDDVD
Sbjct  1    KRKKLYEQQIEQLGNFQLRIHDQMIMLEAAKATTETVDALRTGAAAMKAMQKATNIDDVD  60

Query  572  XTMDE  586
             TMDE
Sbjct  61   KTMDE  65



>gb|KCW44188.1| hypothetical protein EUGRSUZ_L02392 [Eucalyptus grandis]
Length=213

 Score =   107 bits (267),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 67/86 (78%), Positives = 71/86 (83%), Gaps = 7/86 (8%)
 Frame = +2

Query  350  FTRAKNKR-------AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDA  508
             +RA  KR       AAIQCLKRKRLYEQ+IEQL  FQL I DQ+IMLEGAKATTETVDA
Sbjct  51   LSRANIKRGCAVGNAAAIQCLKRKRLYEQRIEQLRYFQLPIRDQIIMLEGAKATTETVDA  110

Query  509  LRTGAAAMKAMQKATNIDDVDXTMDE  586
            LRTGAAAMKAMQKATNIDD+D TMDE
Sbjct  111  LRTGAAAMKAMQKATNIDDLDKTMDE  136



>gb|KHN40354.1| Vacuolar protein sorting-associated protein 32 like 2 [Glycine 
soja]
Length=124

 Score =   102 bits (255),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = +2

Query  395  RKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNIDDVDX  574
            RK+LYE  IEQL NFQ+RIHDQMIMLEGAKATT+ +DALRTGA AMKAMQKA  ID VD 
Sbjct  2    RKKLYENHIEQLRNFQMRIHDQMIMLEGAKATTKMIDALRTGATAMKAMQKAMKIDVVDK  61

Query  575  TMDE  586
             MDE
Sbjct  62   IMDE  65



>ref|XP_007512667.1| predicted protein [Bathycoccus prasinos]
 emb|CCO17267.1| predicted protein [Bathycoccus prasinos]
Length=208

 Score =   103 bits (257),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 62/79 (78%), Gaps = 0/79 (0%)
 Frame = +2

Query  350  FTRAKNKRAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAA  529
            F R+ NKRAA+QCLKRK+LYE Q E + N QL++ +QMI+LEG+KAT ET +AL++GA A
Sbjct  23   FNRSGNKRAALQCLKRKKLYESQCEVVANQQLKLQEQMIVLEGSKATAETFNALKSGAGA  82

Query  530  MKAMQKATNIDDVDXTMDE  586
            MK + K T++D VD  MDE
Sbjct  83   MKQLAKETDVDKVDKVMDE  101



>ref|XP_011462899.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Fragaria vesca subsp. vesca]
Length=244

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 91/133 (68%), Positives = 109/133 (82%), Gaps = 4/133 (3%)
 Frame = +2

Query  200  TMFTRIFGKPKQETNALA----TLDklnetlemlekkekvlqkkaaaevekakeFTRAKN  367
            TMFTR+ GK K++ +  A    +L KLNE L+MLE++EKVL++KAAAE+EKAK F  AKN
Sbjct  18   TMFTRLLGKHKKDESHGALTRKSLKKLNEQLQMLEQQEKVLERKAAAELEKAKTFNNAKN  77

Query  368  KRAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQK  547
            ++AA++CLK K+ YE+QIE   N QLRIHDQMI+LEGAKATTETV ALRTGAAAMKAMQK
Sbjct  78   RKAALRCLKMKKRYEEQIEIQANTQLRIHDQMILLEGAKATTETVGALRTGAAAMKAMQK  137

Query  548  ATNIDDVDXTMDE  586
            AT IDDVD  MDE
Sbjct  138  ATKIDDVDKVMDE  150



>ref|XP_010047642.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Eucalyptus grandis]
 ref|XP_010047643.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Eucalyptus grandis]
Length=195

 Score =   102 bits (253),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 60/77 (78%), Gaps = 0/77 (0%)
 Frame = +2

Query  356  RAKNKRAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMK  535
            RA+++ AA  CLKRK LYEQQIE LGN Q +I + +I LEG K TTETVDAL+ GAAAM+
Sbjct  57   RARDRGAANLCLKRKSLYEQQIELLGNSQFQIEELIIKLEGVKTTTETVDALKIGAAAMQ  116

Query  536  AMQKATNIDDVDXTMDE  586
             MQKATNIDD D  MDE
Sbjct  117  EMQKATNIDDGDKNMDE  133



>ref|XP_010041560.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
1-like isoform X2 [Eucalyptus grandis]
Length=218

 Score = 99.4 bits (246),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 63/80 (79%), Gaps = 1/80 (1%)
 Frame = +2

Query  350  FTRAKNKRAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAA  529
             +RA  KR AI CLKRKRLYEQ+IEQL  FQL I DQ+IMLEGAKA T TVDALRT AAA
Sbjct  73   LSRANIKRVAILCLKRKRLYEQRIEQLRYFQLPIRDQIIMLEGAKARTMTVDALRTRAAA  132

Query  530  MKAMQKATN-IDDVDXTMDE  586
            MKAMQ+A + I++ + TM +
Sbjct  133  MKAMQEAMDTINEQNETMKQ  152



>gb|EPS70822.1| hypothetical protein M569_03937, partial [Genlisea aurea]
Length=86

 Score = 95.9 bits (237),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 73/86 (85%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = +2

Query  203  MFTRIFGKPKQETNALATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAI  382
            MF+RIFGKPKQET ALATL+KL ETLEMLEKKEK+L KK A EVEKAKE T+AKNK AAI
Sbjct  1    MFSRIFGKPKQETTALATLEKLTETLEMLEKKEKLLMKKVAEEVEKAKEHTKAKNKTAAI  60

Query  383  QCLKRKRLYEQQIEQLGNFQLRIHDQ  460
            +CLKRKRLYEQQIE LGNFQLRIHDQ
Sbjct  61   RCLKRKRLYEQQIENLGNFQLRIHDQ  86



>gb|KCW79570.1| hypothetical protein EUGRSUZ_C00937 [Eucalyptus grandis]
Length=228

 Score = 99.8 bits (247),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 88/174 (51%), Positives = 114/174 (66%), Gaps = 14/174 (8%)
 Frame = +2

Query  74   TIGLSVIGSFGKRRI*IIDPIQYSVFSGNRNFYSIY*GTL*FTMF-TRIFGKPKQETNA-  247
            +I LSV    G+R          +VF G R F+ +   ++ F+ +    FGK K +T+A 
Sbjct  24   SISLSVRSLAGRRP-------PPAVFRGYREFF-LGPSSIMFSGWKCWTFGKGKLKTDAQ  75

Query  248  -LATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAIQCLKRKRLYEQQIE  424
             L  +DKL +T  MLE+KEK  ++KA+ EVEK+KE TRAK++  A + LK+KRLYEQQ+E
Sbjct  76   LLTAMDKLGKTSLMLEEKEKEFKEKASQEVEKSKELTRAKDEAVARRSLKKKRLYEQQLE  135

Query  425  QLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNIDDVDXTMDE  586
             LGN QL+I  QMIMLEGAKA TET DALRTGAA MK MQ+  N+  V   MDE
Sbjct  136  PLGNSQLQIAGQMIMLEGAKAATETADALRTGAAVMKTMQEKANMFVV---MDE  186



>ref|XP_010047632.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
1-like [Eucalyptus grandis]
 gb|KCW79571.1| hypothetical protein EUGRSUZ_C00937 [Eucalyptus grandis]
Length=227

 Score = 99.4 bits (246),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 88/174 (51%), Positives = 114/174 (66%), Gaps = 14/174 (8%)
 Frame = +2

Query  74   TIGLSVIGSFGKRRI*IIDPIQYSVFSGNRNFYSIY*GTL*FTMF-TRIFGKPKQETNA-  247
            +I LSV    G+R          +VF G R F+ +   ++ F+ +    FGK K +T+A 
Sbjct  24   SISLSVRSLAGRRP-------PPAVFRGYREFF-LGPSSIMFSGWKCWTFGKGKLKTDAQ  75

Query  248  -LATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRAAIQCLKRKRLYEQQIE  424
             L  +DKL +T  MLE+KEK  ++KA+ EVEK+KE TRAK++  A + LK+KRLYEQQ+E
Sbjct  76   LLTAMDKLGKTSLMLEEKEKEFKEKASQEVEKSKELTRAKDEAVARRSLKKKRLYEQQLE  135

Query  425  QLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNIDDVDXTMDE  586
             LGN QL+I  QMIMLEGAKA TET DALRTGAA MK MQ+  N+  V   MDE
Sbjct  136  PLGNSQLQIAGQMIMLEGAKAATETADALRTGAAVMKTMQEKANMFVV---MDE  186



>ref|XP_010041559.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
1-like isoform X1 [Eucalyptus grandis]
Length=237

 Score = 99.4 bits (246),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 63/80 (79%), Gaps = 1/80 (1%)
 Frame = +2

Query  350  FTRAKNKRAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAA  529
             +RA  KR AI CLKRKRLYEQ+IEQL  FQL I DQ+IMLEGAKA T TVDALRT AAA
Sbjct  92   LSRANIKRVAILCLKRKRLYEQRIEQLRYFQLPIRDQIIMLEGAKARTMTVDALRTRAAA  151

Query  530  MKAMQKATN-IDDVDXTMDE  586
            MKAMQ+A + I++ + TM +
Sbjct  152  MKAMQEAMDTINEQNETMKQ  171



>ref|XP_003064051.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH51673.1| predicted protein [Micromonas pusilla CCMP1545]
Length=252

 Score = 96.3 bits (238),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 57/78 (73%), Gaps = 0/78 (0%)
 Frame = +2

Query  350  FTRAKNKRAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAA  529
            F R K K AA+QCLK+K+LYE QIE L N QL++ +Q+I LEG+K T ET  AL+ GA A
Sbjct  64   FNRQKKKSAALQCLKKKKLYETQIENLQNHQLKLEEQVITLEGSKTTAETFSALKNGAGA  123

Query  530  MKAMQKATNIDDVDXTMD  583
            MK + + TNID++D  MD
Sbjct  124  MKQISRRTNIDNIDKVMD  141



>gb|ADD22155.1| copia-like retroelement pol polyprotein, partial [Oryza barthii]
Length=83

 Score = 87.4 bits (215),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 53/56 (95%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +2

Query  419  IEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNIDDVDXTMDE  586
            IEQLGNFQLRIHDQMIMLE AKATT+TVDALRTGAAAMKAMQKATNIDDVD TMDE
Sbjct  1    IEQLGNFQLRIHDQMIMLEAAKATTQTVDALRTGAAAMKAMQKATNIDDVDKTMDE  56



>ref|XP_003083989.1| B1008E06.13 gene product (ISS) [Ostreococcus tauri]
 emb|CAL57956.1| Snf7 [Ostreococcus tauri]
Length=253

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 59/76 (78%), Gaps = 0/76 (0%)
 Frame = +2

Query  356  RAKNKRAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMK  535
            R  NKR A+Q LK+K+LYE Q++ L   QL++ +Q+IMLEG++AT+ET  ALRTGA AM+
Sbjct  82   RKGNKRRAMQHLKKKKLYEAQLDALSTSQLKLQEQVIMLEGSRATSETYGALRTGADAMR  141

Query  536  AMQKATNIDDVDXTMD  583
             + K T+IDDVD TMD
Sbjct  142  RLAKETSIDDVDATMD  157



>ref|XP_001422047.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABP00341.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=205

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 58/76 (76%), Gaps = 0/76 (0%)
 Frame = +2

Query  356  RAKNKRAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMK  535
            R  NKR A+Q LK+K+LYE Q++ L   QL++ +Q+IMLEG+KAT+ET  ALR+GA AM+
Sbjct  37   RQGNKRRALQHLKKKKLYEAQLDALATSQLKLQEQVIMLEGSKATSETYGALRSGADAMR  96

Query  536  AMQKATNIDDVDXTMD  583
             M K T I+DVD TMD
Sbjct  97   RMVKETKIEDVDATMD  112



>ref|XP_002502293.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO63551.1| predicted protein [Micromonas sp. RCC299]
Length=258

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = +2

Query  350  FTRAKNKRAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAA  529
            F RAKNKRAA+QCLK+K+LYEQQIEQL N QL++ +Q+I LEG+K T ET  AL++GA A
Sbjct  68   FNRAKNKRAALQCLKKKKLYEQQIEQLQNQQLKLEEQVITLEGSKTTAETFTALKSGAGA  127

Query  530  MKAMQKATNIDDVDXTMDE  586
            MK + K TNID+VD  MD+
Sbjct  128  MKQIHKETNIDEVDKVMDD  146



>ref|XP_010047630.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
1-like isoform X2 [Eucalyptus grandis]
 gb|KCW79572.1| hypothetical protein EUGRSUZ_C00940 [Eucalyptus grandis]
Length=198

 Score = 82.8 bits (203),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 58/76 (76%), Gaps = 2/76 (3%)
 Frame = +2

Query  350  FTRAKNKRAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAA  529
            F RA N+ AA  CL++KRLYEQQIEQ  +++ +I +Q+I L+GAKA TETVDAL+  AAA
Sbjct  56   FIRAGNREAAKLCLRKKRLYEQQIEQFRHYEFQIGEQIIKLKGAKAKTETVDALKIAAAA  115

Query  530  MKAMQKATN--IDDVD  571
            M+ M+KA    ++++D
Sbjct  116  MQEMEKAMGKIMNEID  131



>ref|XP_010047629.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
1-like isoform X1 [Eucalyptus grandis]
 gb|KCW79573.1| hypothetical protein EUGRSUZ_C00940 [Eucalyptus grandis]
Length=202

 Score = 82.8 bits (203),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 58/76 (76%), Gaps = 2/76 (3%)
 Frame = +2

Query  350  FTRAKNKRAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAA  529
            F RA N+ AA  CL++KRLYEQQIEQ  +++ +I +Q+I L+GAKA TETVDAL+  AAA
Sbjct  56   FIRAGNREAAKLCLRKKRLYEQQIEQFRHYEFQIGEQIIKLKGAKAKTETVDALKIAAAA  115

Query  530  MKAMQKATN--IDDVD  571
            M+ M+KA    ++++D
Sbjct  116  MQEMEKAMGKIMNEID  131



>ref|XP_010047637.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like isoform X3 [Eucalyptus grandis]
Length=141

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 55/79 (70%), Gaps = 0/79 (0%)
 Frame = +2

Query  350  FTRAKNKRAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAA  529
            F RA ++RAA +C + K LY +QIE+L N QL I  ++I+LEG KA TETVDAL +G   
Sbjct  57   FRRAGDERAASRCSEMKTLYYKQIEELENAQLLIRKKIILLEGEKARTETVDALESGEEE  116

Query  530  MKAMQKATNIDDVDXTMDE  586
            +K MQ+  N DD D T+DE
Sbjct  117  LKKMQEVKNTDDGDRTVDE  135



>ref|XP_010047636.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like isoform X2 [Eucalyptus grandis]
 gb|KCW79576.1| hypothetical protein EUGRSUZ_C00942 [Eucalyptus grandis]
 gb|KCW79577.1| hypothetical protein EUGRSUZ_C00942 [Eucalyptus grandis]
 gb|KCW79578.1| hypothetical protein EUGRSUZ_C00942 [Eucalyptus grandis]
Length=163

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 55/79 (70%), Gaps = 0/79 (0%)
 Frame = +2

Query  350  FTRAKNKRAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAA  529
            F RA ++RAA +C + K LY +QIE+L N QL I  ++I+LEG KA TETVDAL +G   
Sbjct  57   FRRAGDERAASRCSEMKTLYYKQIEELENAQLLIRKKIILLEGEKARTETVDALESGEEE  116

Query  530  MKAMQKATNIDDVDXTMDE  586
            +K MQ+  N DD D T+DE
Sbjct  117  LKKMQEVKNTDDGDRTVDE  135



>gb|KCW79575.1| hypothetical protein EUGRSUZ_C00942 [Eucalyptus grandis]
Length=181

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 55/79 (70%), Gaps = 0/79 (0%)
 Frame = +2

Query  350  FTRAKNKRAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAA  529
            F RA ++RAA +C + K LY +QIE+L N QL I  ++I+LEG KA TETVDAL +G   
Sbjct  57   FRRAGDERAASRCSEMKTLYYKQIEELENAQLLIRKKIILLEGEKARTETVDALESGEEE  116

Query  530  MKAMQKATNIDDVDXTMDE  586
            +K MQ+  N DD D T+DE
Sbjct  117  LKKMQEVKNTDDGDRTVDE  135



>ref|XP_010047635.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like isoform X1 [Eucalyptus grandis]
Length=203

 Score = 80.5 bits (197),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 55/79 (70%), Gaps = 0/79 (0%)
 Frame = +2

Query  350  FTRAKNKRAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAA  529
            F RA ++RAA +C + K LY +QIE+L N QL I  ++I+LEG KA TETVDAL +G   
Sbjct  57   FRRAGDERAASRCSEMKTLYYKQIEELENAQLLIRKKIILLEGEKARTETVDALESGEEE  116

Query  530  MKAMQKATNIDDVDXTMDE  586
            +K MQ+  N DD D T+DE
Sbjct  117  LKKMQEVKNTDDGDRTVDE  135



>emb|CDX93849.1| BnaC04g20080D [Brassica napus]
 emb|CDX93851.1| BnaC04g20100D [Brassica napus]
Length=102

 Score = 77.8 bits (190),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +2

Query  443  LRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNIDDVDXTMDE  586
            L     MIMLEGAKATTETVDALRTGAA MKAMQ+A NIDDVD TMDE
Sbjct  8    LATSSSMIMLEGAKATTETVDALRTGAATMKAMQRAANIDDVDKTMDE  55



>ref|XP_011400131.1| Vacuolar protein sorting-associated protein 32-like protein 1 
[Auxenochlorella protothecoides]
 gb|KFM27164.1| Vacuolar protein sorting-associated protein 32-like protein 1 
[Auxenochlorella protothecoides]
Length=216

 Score = 79.7 bits (195),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 52/78 (67%), Gaps = 0/78 (0%)
 Frame = +2

Query  350  FTRAKNKRAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAA  529
             TRAKNKR A+  LK+K++YEQQ+EQL N   RI +Q  MLE  +A  ETVDALR+GA A
Sbjct  60   MTRAKNKRGALMALKKKKMYEQQLEQLLNQVQRIAEQKSMLENQRAVVETVDALRSGATA  119

Query  530  MKAMQKATNIDDVDXTMD  583
             K +     I DVD  +D
Sbjct  120  SKHVMTEMKIGDVDKVLD  137



>ref|XP_005850888.1| hypothetical protein CHLNCDRAFT_56887 [Chlorella variabilis]
 gb|EFN58786.1| hypothetical protein CHLNCDRAFT_56887 [Chlorella variabilis]
Length=525

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 54/79 (68%), Gaps = 0/79 (0%)
 Frame = +2

Query  350  FTRAKNKRAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAA  529
            F +  NKRAA   LK+K+LYE Q+EQ+ N  LR+++Q + LE  + T ETVDALRTGA A
Sbjct  70   FLKQNNKRAATMALKKKKLYENQLEQVENNILRVNEQQMGLENLRTTVETVDALRTGAHA  129

Query  530  MKAMQKATNIDDVDXTMDE  586
             KA  +   IDDVD  +DE
Sbjct  130  SKATMQEMKIDDVDRVLDE  148



>ref|XP_005651060.1| Snf7-domain-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE26516.1| Snf7-domain-containing protein [Coccomyxa subellipsoidea C-169]
Length=242

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 53/79 (67%), Gaps = 0/79 (0%)
 Frame = +2

Query  350  FTRAKNKRAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAA  529
            +T+A+NKRAA+  LK+K++YE Q+EQ  N  LR+++Q +MLE  + T ETV ALR  A A
Sbjct  63   YTKAQNKRAALMALKKKKMYETQLEQCENNILRVNEQQMMLENQRTTVETVTALRDAAQA  122

Query  530  MKAMQKATNIDDVDXTMDE  586
             K+      I DVD  +DE
Sbjct  123  SKSTMSEMKITDVDAVLDE  141



>ref|XP_004339619.1| Vacuolarsorting protein SNF7, putative [Acanthamoeba castellanii 
str. Neff]
 gb|ELR17606.1| Vacuolarsorting protein SNF7, putative [Acanthamoeba castellanii 
str. Neff]
Length=224

 Score = 73.6 bits (179),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = +2

Query  359  AKNKRAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKA  538
            +KNKR A+  LKRK+ YE Q+++L   ++ I  Q++ +EGA    ET++A+R GAAA++ 
Sbjct  50   SKNKRVAMMALKRKKAYEAQVQKLSGARMTIESQLMAIEGATVNLETINAMREGAAALQG  109

Query  539  MQKATNIDDVDXTMDE  586
            +  + +ID VD TMD+
Sbjct  110  IHGSMSIDTVDNTMDQ  125



>gb|ACG47769.1| hypothetical protein [Zea mays]
Length=88

 Score = 70.1 bits (170),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 61/79 (77%), Positives = 69/79 (87%), Gaps = 2/79 (3%)
 Frame = +2

Query  203  MFTRIFGKPKQETNA--LATLDklnetlemlekkekvlqkkaaaevekakeFTRAKNKRA  376
            +F R+FGK K+++ A  LA+LDKLNETLEMLEKKE +L KKA  EVEKAK FT+AKNKRA
Sbjct  4    VFGRVFGKSKEQSQATALASLDKLNETLEMLEKKENLLVKKANLEVEKAKNFTKAKNKRA  63

Query  377  AIQCLKRKRLYEQQIEQLG  433
            AIQCLKRKRLYEQQIEQLG
Sbjct  64   AIQCLKRKRLYEQQIEQLG  82



>gb|EPB89680.1| hypothetical protein HMPREF1544_03479 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=214

 Score = 70.9 bits (172),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 0/75 (0%)
 Frame = +2

Query  362  KNKRAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAM  541
            KNKRAA+  LKRK+ YE  IE++   ++ I  QM+ +E A    ET+ A+R GA AMK +
Sbjct  52   KNKRAALMALKRKKTYEANIEKINGARMTIETQMMAIENANVNLETMGAMRAGAEAMKNI  111

Query  542  QKATNIDDVDXTMDE  586
              + +ID VD TMD+
Sbjct  112  HGSMDIDKVDATMDD  126



>dbj|GAN08360.1| snf7-domain-containing protein [Mucor ambiguus]
Length=214

 Score = 70.9 bits (172),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 0/75 (0%)
 Frame = +2

Query  362  KNKRAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAM  541
            KNKRAA+  LKRK+ YE  IE++   ++ I  QM+ +E A    ET+ A+R GA AMK +
Sbjct  52   KNKRAALMALKRKKTYEANIEKINGARMTIETQMMAIENANVNLETMGAMRAGAEAMKNI  111

Query  542  QKATNIDDVDXTMDE  586
              + +ID VD TMD+
Sbjct  112  HGSMDIDKVDATMDD  126



>gb|KFH63786.1| hypothetical protein MVEG_10479 [Mortierella verticillata NRRL 
6337]
Length=206

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 50/75 (67%), Gaps = 0/75 (0%)
 Frame = +2

Query  362  KNKRAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAM  541
            KNKRAA+  LKRK+ +E QIE++   +L I  Q++ +E A    ET+ A+R GA AMK +
Sbjct  51   KNKRAALMALKRKKQFEGQIEKISGSRLTIETQVMAIENANVNLETMKAMRAGAEAMKGI  110

Query  542  QKATNIDDVDXTMDE  586
              A +I+ VD TM+E
Sbjct  111  HGAMDINKVDQTMEE  125



>emb|CEG74761.1| Putative Snf7 domain-containing protein [Rhizopus microsporus]
Length=188

 Score = 68.2 bits (165),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 48/75 (64%), Gaps = 0/75 (0%)
 Frame = +2

Query  362  KNKRAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAM  541
            KN+R A+  LKRK+ YE  IE++   ++ I  QM+ +E A    ET+ A+R GA AMK +
Sbjct  26   KNRRVALMALKRKKAYEGNIEKINGARMTIETQMMAIENANVNLETMSAMRAGAEAMKNI  85

Query  542  QKATNIDDVDXTMDE  586
              + +ID VD TMD+
Sbjct  86   HGSMDIDKVDATMDD  100



>gb|KCW79579.1| hypothetical protein EUGRSUZ_C00942 [Eucalyptus grandis]
Length=158

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 48/70 (69%), Gaps = 0/70 (0%)
 Frame = +2

Query  350  FTRAKNKRAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAA  529
            F RA ++RAA +C + K LY +QIE+L N QL I  ++I+LEG KA TETVDAL +G   
Sbjct  57   FRRAGDERAASRCSEMKTLYYKQIEELENAQLLIRKKIILLEGEKARTETVDALESGEEE  116

Query  530  MKAMQKATNI  559
            +K MQ+   +
Sbjct  117  LKKMQEVKYV  126



>gb|ETM54563.1| hypothetical protein L914_02125 [Phytophthora parasitica]
Length=255

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 49/76 (64%), Gaps = 0/76 (0%)
 Frame = +2

Query  359  AKNKRAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKA  538
            AK+KR AI  LKRK++YE ++E+L   ++ +  Q++ LE A    ET  ALR+GA  MKA
Sbjct  57   AKDKRGAIFSLKRKKMYEAEVEKLQGARMTLETQVMTLESAHVNMETFTALRSGAEQMKA  116

Query  539  MQKATNIDDVDXTMDE  586
            +    N+D VD  MD+
Sbjct  117  IHGQMNVDKVDNIMDD  132



>ref|XP_009530245.1| hypothetical protein PHYSODRAFT_513547 [Phytophthora sojae]
 gb|EGZ12816.1| hypothetical protein PHYSODRAFT_513547 [Phytophthora sojae]
Length=259

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 49/76 (64%), Gaps = 0/76 (0%)
 Frame = +2

Query  359  AKNKRAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKA  538
            AK+KR AI  LKRK++YE ++E+L   ++ +  Q++ LE A    ET  ALR+GA  MKA
Sbjct  57   AKDKRGAIFALKRKKMYEAEVEKLQGARMTLETQVMTLESAHVNMETFTALRSGAEQMKA  116

Query  539  MQKATNIDDVDXTMDE  586
            +    N+D VD  MD+
Sbjct  117  IHGQMNVDKVDNIMDD  132



>ref|XP_011463655.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Fragaria vesca subsp. vesca]
Length=173

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 49/72 (68%), Gaps = 12/72 (17%)
 Frame = +2

Query  350  FTRAKNKRAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAA  529
            F RAKN++ A+QCLKRK++ E+QIE++G+F++RI +QM++L+GA A              
Sbjct  33   FARAKNRKDALQCLKRKKVLEKQIEEVGSFRVRIRNQMMILQGANADESN----------  82

Query  530  MKAMQKATNIDD  565
              AMQKA +I D
Sbjct  83   --AMQKANSIAD  92



>gb|ETP52853.1| hypothetical protein F442_02191 [Phytophthora parasitica P10297]
Length=255

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 49/76 (64%), Gaps = 0/76 (0%)
 Frame = +2

Query  359  AKNKRAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKA  538
            AK+KR AI  LKRK++YE ++E+L   ++ +  Q++ LE A    ET  ALR+GA  MKA
Sbjct  57   AKDKRGAIFALKRKKMYEAEVEKLQGARMTLETQVMTLESAHVNMETFTALRSGAEQMKA  116

Query  539  MQKATNIDDVDXTMDE  586
            +    N+D VD  MD+
Sbjct  117  IHGQMNVDKVDNIMDD  132



>gb|ETK94880.1| hypothetical protein L915_02144 [Phytophthora parasitica]
 gb|ETL48274.1| hypothetical protein L916_02109 [Phytophthora parasitica]
 gb|ETM01368.1| hypothetical protein L917_02042 [Phytophthora parasitica]
 gb|ETO83796.1| hypothetical protein F444_02240 [Phytophthora parasitica P1976]
 gb|ETP24866.1| hypothetical protein F441_02208 [Phytophthora parasitica CJ01A1]
Length=255

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 49/76 (64%), Gaps = 0/76 (0%)
 Frame = +2

Query  359  AKNKRAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKA  538
            AK+KR AI  LKRK++YE ++E+L   ++ +  Q++ LE A    ET  ALR+GA  MKA
Sbjct  57   AKDKRGAIFALKRKKMYEAEVEKLQGARMTLETQVMTLESAHVNMETFTALRSGAEQMKA  116

Query  539  MQKATNIDDVDXTMDE  586
            +    N+D VD  MD+
Sbjct  117  IHGQMNVDKVDNIMDD  132



>gb|KDO21729.1| hypothetical protein SPRG_13145 [Saprolegnia parasitica CBS 223.65]
Length=243

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 46/72 (64%), Gaps = 0/72 (0%)
 Frame = +2

Query  371  RAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKA  550
            R AI CLKRK++YE +IE+L   ++ +  Q+I LE  +   +T  ALRTGA  MKA+   
Sbjct  61   RGAIFCLKRKKMYESEIEKLQGARMTLETQVITLESTQVNMQTFTALRTGANQMKAIHGQ  120

Query  551  TNIDDVDXTMDE  586
             N+D VD  MD+
Sbjct  121  MNVDSVDDIMDD  132



>gb|ERZ97722.1| hypothetical protein GLOINDRAFT_339995 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX71150.1| Snf7p [Rhizophagus irregularis DAOM 197198w]
Length=215

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 49/75 (65%), Gaps = 0/75 (0%)
 Frame = +2

Query  359  AKNKRAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKA  538
            A NKRAA+  LKRK+ YE QIE++   ++ I  Q++ +E A    ET+ A+  GA AMKA
Sbjct  51   ATNKRAALMALKRKKQYENQIEKISGARITIEAQVMAIENANVNLETLKAMEKGAEAMKA  110

Query  539  MQKATNIDDVDXTMD  583
            +  + +I+ VD TMD
Sbjct  111  IHGSMDINKVDDTMD  125



>ref|XP_008618112.1| hypothetical protein SDRG_13792 [Saprolegnia diclina VS20]
 gb|EQC28464.1| hypothetical protein SDRG_13792 [Saprolegnia diclina VS20]
Length=243

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 46/72 (64%), Gaps = 0/72 (0%)
 Frame = +2

Query  371  RAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKA  550
            R AI CLKRK++YE +IE+L   ++ +  Q+I LE  +   +T  ALRTGA  MKA+   
Sbjct  61   RGAIFCLKRKKMYESEIEKLQGARMTLETQVITLESTQVNMQTFTALRTGANQMKAIHGQ  120

Query  551  TNIDDVDXTMDE  586
             N+D VD  MD+
Sbjct  121  MNVDSVDDIMDD  132



>gb|KDD73593.1| Snf7-like protein, partial [Helicosporidium sp. ATCC 50920]
Length=171

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = +2

Query  350  FTRAKNKRAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAA  529
            + RAKNKR A   LK+K++YEQQ +QL +   R+ +Q  MLE  +   ETVDA+R  A A
Sbjct  46   YLRAKNKRGATLALKKKKMYEQQHQQLESQLERVSEQQSMLENQRTVVETVDAMRVAAHA  105

Query  530  MKAMQKATNIDDVDXTMD  583
             K +     I DVD  +D
Sbjct  106  SKQVMTEMRIGDVDKVLD  123



>gb|ETI55055.1| hypothetical protein F443_02236 [Phytophthora parasitica P1569]
Length=255

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 49/76 (64%), Gaps = 0/76 (0%)
 Frame = +2

Query  359  AKNKRAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKA  538
            AK+KR AI  LKRK++YE ++E+L   ++ +  Q++ LE A    ET  ALR+GA  MKA
Sbjct  57   AKDKRGAIFALKRKKMYEAEVEKLQGARMTLETQVMTLESAHVDMETFTALRSGAEQMKA  116

Query  539  MQKATNIDDVDXTMDE  586
            +    N+D VD  MD+
Sbjct  117  IHGQMNVDKVDNIMDD  132



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 737611932690