BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002E15

Length=571
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004251806.1|  PREDICTED: F-box/LRR-repeat MAX2 homolog A-like    234   6e-69   Solanum lycopersicum
ref|XP_006350026.1|  PREDICTED: F-box/LRR-repeat MAX2 homolog A-like    229   3e-67   
ref|XP_009623891.1|  PREDICTED: F-box/LRR-repeat MAX2 homolog A         229   6e-67   Nicotiana tomentosiformis
ref|XP_011083007.1|  PREDICTED: F-box/LRR-repeat MAX2 homolog A         223   7e-65   Sesamum indicum [beniseed]
ref|XP_009767168.1|  PREDICTED: F-box/LRR-repeat MAX2 homolog A         223   9e-65   Nicotiana sylvestris
ref|XP_006348874.1|  PREDICTED: F-box/LRR-repeat MAX2 homolog A-like    222   1e-64   Solanum tuberosum [potatoes]
ref|XP_009766305.1|  PREDICTED: F-box/LRR-repeat MAX2 homolog A-like    221   3e-64   Nicotiana sylvestris
ref|XP_009629725.1|  PREDICTED: F-box/LRR-repeat MAX2 homolog A-like    219   1e-63   Nicotiana tomentosiformis
gb|AEB97385.1|  MAX2B                                                   218   4e-63   Petunia x hybrida [garden petunia]
ref|XP_004243284.1|  PREDICTED: F-box/LRR-repeat MAX2 homolog A-like    218   5e-63   Solanum lycopersicum
sp|I1SSI5.1|MAX2A_PETHY  RecName: Full=F-box/LRR-repeat MAX2 homo...    215   5e-62   Petunia x hybrida [garden petunia]
gb|AGP26193.1|  F-box protein                                           207   7e-59   Striga hermonthica [purple witchweed]
gb|EYU41123.1|  hypothetical protein MIMGU_mgv1a002106mg                205   2e-58   Erythranthe guttata [common monkey flower]
emb|CDP21512.1|  unnamed protein product                                204   6e-58   Coffea canephora [robusta coffee]
emb|CDP15938.1|  unnamed protein product                                201   7e-57   Coffea canephora [robusta coffee]
ref|XP_008455299.1|  PREDICTED: F-box/LRR-repeat MAX2 homolog A         196   3e-55   Cucumis melo [Oriental melon]
ref|XP_010657042.1|  PREDICTED: F-box/LRR-repeat MAX2 homolog A         196   3e-55   Vitis vinifera
emb|CBI21987.3|  unnamed protein product                                196   4e-55   Vitis vinifera
ref|XP_004137031.1|  PREDICTED: F-box protein ORE9-like                 196   7e-55   Cucumis sativus [cucumbers]
ref|XP_004155515.1|  PREDICTED: F-box protein ORE9-like                 195   8e-55   
gb|AFZ99010.1|  F-box protein MAX2c                                     193   5e-54   Chrysanthemum x morifolium [florist's chrysanthemum]
gb|AFZ99006.1|  F-box protein MAX2                                      191   2e-53   Chrysanthemum x morifolium [florist's chrysanthemum]
gb|EPS66557.1|  hypothetical protein M569_08217                         190   6e-53   Genlisea aurea
gb|AFZ99008.1|  F-box protein MAX2b                                     189   1e-52   Chrysanthemum x morifolium [florist's chrysanthemum]
gb|AIM41254.1|  F-box/LRR family protein                                186   2e-51   Gossypium hirsutum [American cotton]
gb|AIM41255.1|  F-box/LRR family protein                                186   2e-51   Gossypium hirsutum [American cotton]
ref|XP_002528551.1|  F-box/leucine rich repeat protein, putative        185   4e-51   Ricinus communis
gb|KDP21100.1|  hypothetical protein JCGZ_21571                         184   1e-50   Jatropha curcas
gb|KJB49050.1|  hypothetical protein B456_008G099500                    184   1e-50   Gossypium raimondii
gb|KDP37749.1|  hypothetical protein JCGZ_05239                         183   1e-50   Jatropha curcas
ref|XP_007025368.1|  RNI superfamily protein                            182   3e-50   
gb|KJB66814.1|  hypothetical protein B456_010G159500                    181   8e-50   Gossypium raimondii
ref|XP_007048696.1|  RNI-like superfamily protein                       180   2e-49   
ref|XP_011466958.1|  PREDICTED: F-box/LRR-repeat MAX2 homolog A         179   3e-49   Fragaria vesca subsp. vesca
gb|KJB69731.1|  hypothetical protein B456_011G039300                    178   9e-49   Gossypium raimondii
gb|AEB37324.1|  more axillary branches 2                                167   1e-47   Helianthus exilis
ref|XP_007214985.1|  hypothetical protein PRUPE_ppa002017mg             176   1e-47   Prunus persica
gb|ACJ09168.1|  MAX2-like protein                                       169   1e-47   Citrus trifoliata [hardy orange]
gb|AEB37372.1|  more axillary branches 2                                166   2e-47   Helianthus annuus
gb|AEB37370.1|  more axillary branches 2                                166   2e-47   Helianthus annuus
gb|AEB37348.1|  more axillary branches 2                                166   2e-47   Helianthus annuus
gb|AEB37411.1|  more axillary branches 2                                166   2e-47   Helianthus annuus
gb|AEB37376.1|  more axillary branches 2                                166   2e-47   Helianthus annuus
gb|AEB37414.1|  more axillary branches 2                                166   2e-47   Helianthus annuus
gb|AEB37356.1|  more axillary branches 2                                166   2e-47   Helianthus annuus
gb|AEB37346.1|  more axillary branches 2                                166   2e-47   Helianthus annuus
gb|AEB37392.1|  more axillary branches 2                                166   3e-47   Helianthus annuus
gb|AEB37362.1|  more axillary branches 2                                166   3e-47   Helianthus annuus
gb|AEB37382.1|  more axillary branches 2                                166   3e-47   Helianthus annuus
gb|AEB37335.1|  more axillary branches 2                                165   4e-47   Helianthus tuberosus [Jerusalem artichoke]
gb|AEB37318.1|  more axillary branches 2                                165   5e-47   Helianthus petiolaris
gb|AEB37322.1|  more axillary branches 2                                165   5e-47   Helianthus petiolaris
gb|AEB37323.1|  more axillary branches 2                                165   6e-47   Helianthus petiolaris
gb|AEB37336.1|  more axillary branches 2                                164   6e-47   Helianthus tuberosus [Jerusalem artichoke]
gb|AEB37321.1|  more axillary branches 2                                165   7e-47   Helianthus petiolaris
gb|AEB37320.1|  more axillary branches 2                                165   7e-47   Helianthus petiolaris
gb|AEB37328.1|  more axillary branches 2                                164   7e-47   Helianthus exilis
gb|AEB37326.1|  more axillary branches 2                                164   8e-47   Helianthus exilis
gb|AEB37330.1|  more axillary branches 2                                164   8e-47   Helianthus exilis
gb|AEB37338.1|  more axillary branches 2                                163   2e-46   Helianthus argophyllus
ref|XP_010277014.1|  PREDICTED: F-box/LRR-repeat MAX2 homolog A         172   2e-46   Nelumbo nucifera [Indian lotus]
ref|XP_008229121.1|  PREDICTED: F-box/LRR-repeat MAX2 homolog A-like    171   4e-46   
ref|XP_006446795.1|  hypothetical protein CICLE_v10014472mg             170   7e-46   Citrus clementina [clementine]
ref|XP_011033739.1|  PREDICTED: F-box protein MAX2                      169   2e-45   Populus euphratica
gb|AEB37345.1|  more axillary branches 2                                160   2e-45   Helianthus argophyllus
ref|XP_011039437.1|  PREDICTED: F-box/LRR-repeat MAX2 homolog A-like    169   3e-45   Populus euphratica
ref|XP_006468201.1|  PREDICTED: F-box/LRR-repeat MAX2 homolog A-like    168   4e-45   Citrus sinensis [apfelsine]
ref|XP_010920116.1|  PREDICTED: F-box/LRR-repeat MAX2 homolog A-like    168   4e-45   Elaeis guineensis
ref|XP_002317419.1|  hypothetical protein POPTR_0011s07320g             168   4e-45   
gb|AEB37344.1|  more axillary branches 2                                160   5e-45   Helianthus argophyllus
ref|XP_009370527.1|  PREDICTED: F-box/LRR-repeat MAX2 homolog A         167   5e-45   
ref|XP_006469010.1|  PREDICTED: F-box/LRR-repeat MAX2 homolog A-like    167   6e-45   Citrus sinensis [apfelsine]
gb|KDO77865.1|  hypothetical protein CISIN_1g044164mg                   167   1e-44   Citrus sinensis [apfelsine]
gb|AEB37352.1|  more axillary branches 2                                159   1e-44   Helianthus annuus
ref|XP_006449508.1|  hypothetical protein CICLE_v10017759mg             166   2e-44   
ref|XP_010035860.1|  PREDICTED: F-box/LRR-repeat MAX2 homolog A         164   7e-44   Eucalyptus grandis [rose gum]
ref|XP_010104395.1|  hypothetical protein L484_010347                   164   1e-43   Morus notabilis
ref|XP_010524067.1|  PREDICTED: F-box protein MAX2                      164   1e-43   Tarenaya hassleriana [spider flower]
gb|AIN41159.1|  MAX2-like protein                                       162   4e-43   Malus baccata [shan jing zi]
gb|AIN41156.1|  MAX2-like protein                                       162   4e-43   Malus hupehensis
emb|CDY50814.1|  BnaC04g52510D                                          162   4e-43   Brassica napus [oilseed rape]
gb|AIN41157.1|  MAX2-like protein                                       162   4e-43   Malus baccata [shan jing zi]
ref|XP_008353853.1|  PREDICTED: F-box/LRR-repeat MAX2 homolog A-like    162   5e-43   
ref|XP_008343110.1|  PREDICTED: F-box/LRR-repeat MAX2 homolog A-like    162   6e-43   
ref|XP_008381214.1|  PREDICTED: F-box/LRR-repeat MAX2 homolog A         162   7e-43   Malus domestica [apple tree]
ref|XP_002320412.1|  ORESARA 9 family protein                           160   2e-42   
gb|AEB37340.1|  more axillary branches 2                                152   2e-42   Helianthus argophyllus
gb|AEB37350.1|  more axillary branches 2                                152   2e-42   Helianthus annuus
ref|XP_007132849.1|  hypothetical protein PHAVU_011G129700g             159   6e-42   Phaseolus vulgaris [French bean]
ref|XP_010925635.1|  PREDICTED: F-box/LRR-repeat MAX2 homolog A-like    158   1e-41   Elaeis guineensis
gb|AIN41158.1|  MAX2-like protein                                       157   2e-41   Malus hupehensis
ref|XP_010279132.1|  PREDICTED: F-box/LRR-repeat MAX2 homolog A-like    156   9e-41   Nelumbo nucifera [Indian lotus]
dbj|BAJ33992.1|  unnamed protein product                                155   2e-40   Eutrema halophilum
ref|XP_002879997.1|  hypothetical protein ARALYDRAFT_903635             154   3e-40   Arabidopsis lyrata subsp. lyrata
ref|XP_009142077.1|  PREDICTED: F-box protein MAX2                      153   9e-40   Brassica rapa
ref|XP_010517801.1|  PREDICTED: F-box protein MAX2                      152   2e-39   Camelina sativa [gold-of-pleasure]
ref|XP_010689839.1|  PREDICTED: F-box/LRR-repeat MAX2 homolog A         152   2e-39   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006296114.1|  hypothetical protein CARUB_v10025265mg             152   2e-39   Capsella rubella
ref|XP_008812427.1|  PREDICTED: LOW QUALITY PROTEIN: F-box/LRR-re...    152   3e-39   
ref|XP_010508545.1|  PREDICTED: F-box protein MAX2-like                 151   4e-39   Camelina sativa [gold-of-pleasure]
gb|AEB37334.1|  more axillary branches 2                                143   6e-39   Helianthus tuberosus [Jerusalem artichoke]
gb|AEB37366.1|  more axillary branches 2                                143   7e-39   Helianthus annuus
gb|AEB37354.1|  more axillary branches 2                                143   7e-39   Helianthus annuus
gb|AEB37342.1|  more axillary branches 2                                143   7e-39   Helianthus argophyllus
gb|AEB37332.1|  more axillary branches 2                                143   9e-39   Helianthus exilis
ref|XP_008812067.1|  PREDICTED: F-box protein MAX2-like                 150   1e-38   Phoenix dactylifera
ref|NP_565979.1|  F-box leucine-rich repeat family protein MAX2         150   1e-38   Arabidopsis thaliana [mouse-ear cress]
gb|KFK37113.1|  hypothetical protein AALP_AA4G214500                    150   1e-38   Arabis alpina [alpine rockcress]
gb|ABD67495.1|  RAMOSUS4                                                150   1e-38   Pisum sativum [garden pea]
ref|XP_010506098.1|  PREDICTED: F-box protein MAX2-like isoform X1      149   3e-38   Camelina sativa [gold-of-pleasure]
ref|XP_010506100.1|  PREDICTED: F-box protein MAX2-like isoform X3      149   3e-38   Camelina sativa [gold-of-pleasure]
ref|XP_003607592.1|  F-box protein ORE9                                 149   3e-38   Medicago truncatula
ref|XP_003540983.1|  PREDICTED: F-box/LRR-repeat MAX2 homolog A-like    147   2e-37   Glycine max [soybeans]
ref|XP_004505491.1|  PREDICTED: F-box/LRR-repeat MAX2 homolog A-like    146   4e-37   Cicer arietinum [garbanzo]
ref|XP_010539206.1|  PREDICTED: LOW QUALITY PROTEIN: F-box/LRR-re...    145   6e-37   Tarenaya hassleriana [spider flower]
ref|XP_009383235.1|  PREDICTED: F-box/LRR-repeat MAX2 homolog           144   2e-36   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABR16482.1|  unknown                                                 143   1e-35   Picea sitchensis
ref|XP_009390668.1|  PREDICTED: F-box/LRR-repeat MAX2 homolog           140   6e-35   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002968649.1|  hypothetical protein SELMODRAFT_90091              131   7e-32   
ref|XP_002989898.1|  hypothetical protein SELMODRAFT_130722             131   1e-31   
ref|XP_001772278.1|  predicted protein                                  127   3e-30   
ref|XP_006852409.1|  hypothetical protein AMTR_s00021p00041390          121   3e-28   Amborella trichopoda
gb|AFW85799.1|  hypothetical protein ZEAMMB73_480130                    116   2e-26   
ref|XP_004964817.1|  PREDICTED: F-box/LRR-repeat MAX2 homolog           116   2e-26   Setaria italica
ref|XP_003564315.1|  PREDICTED: F-box/LRR-repeat MAX2 homolog           112   5e-25   Brachypodium distachyon [annual false brome]
ref|NP_001174608.1|  Os06g0154200                                       103   4e-22   
ref|XP_002436499.1|  hypothetical protein SORBIDRAFT_10g003790          103   5e-22   Sorghum bicolor [broomcorn]
ref|XP_006411529.1|  hypothetical protein EUTSA_v10017925mg           80.5    5e-14   
ref|XP_006656655.1|  PREDICTED: F-box/LRR-repeat MAX2 homolog         73.6    9e-12   
ref|XP_002534413.1|  hypothetical protein RCOM_0438600                63.9    4e-10   
ref|XP_004301055.1|  PREDICTED: F-box/LRR-repeat MAX2 homolog A-like  63.9    9e-10   Fragaria vesca subsp. vesca
ref|XP_009335455.1|  PREDICTED: F-box protein MAX2-like               61.6    4e-08   Pyrus x bretschneideri [bai li]
dbj|BAD67717.1|  hypothetical protein                                 60.8    5e-08   Oryza sativa Japonica Group [Japonica rice]
gb|KDO71172.1|  hypothetical protein CISIN_1g039096mg                 58.2    8e-07   Citrus sinensis [apfelsine]
ref|XP_002301562.2|  hypothetical protein POPTR_0002s22680g           54.3    1e-05   
ref|XP_008390798.1|  PREDICTED: F-box/LRR-repeat protein 4            50.1    4e-04   
ref|XP_007154190.1|  hypothetical protein PHAVU_003G097600g           49.3    6e-04   Phaseolus vulgaris [French bean]



>ref|XP_004251806.1| PREDICTED: F-box/LRR-repeat MAX2 homolog A-like [Solanum lycopersicum]
Length=722

 Score =   234 bits (596),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 116/158 (73%), Positives = 129/158 (82%), Gaps = 0/158 (0%)
 Frame = +3

Query  96   LHAPTNIHDLPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIM  275
            L  PT I+DLPDVILSN+IAA+S  R+RN+AALVCRKWLVLERATRT LTLRGN+RDL M
Sbjct  4    LARPTIINDLPDVILSNIIAAVSDVRSRNTAALVCRKWLVLERATRTSLTLRGNIRDLFM  63

Query  276  LPTCFRSVTHLDLSLLSPWGHPLLSHANSDAAIATDPALIAHLLRHAFPSVTSLKLYARN  455
            LPTCFRSVTHLDLSL+SPWGHPLLS   + ++   D  LIAHLLRHAFP VTSL +YARN
Sbjct  64   LPTCFRSVTHLDLSLVSPWGHPLLSPRATASSDDADSVLIAHLLRHAFPIVTSLIVYARN  123

Query  456  PSTLQLLAAQWPQLMKITLVRWHQRPQLAAGEELGSFF  569
            P TLQ L  QWPQL  I LVRWHQRPQLA+G+E    F
Sbjct  124  PHTLQFLPVQWPQLKYIKLVRWHQRPQLASGDEFNLLF  161



>ref|XP_006350026.1| PREDICTED: F-box/LRR-repeat MAX2 homolog A-like [Solanum tuberosum]
Length=724

 Score =   229 bits (585),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 115/160 (72%), Positives = 129/160 (81%), Gaps = 2/160 (1%)
 Frame = +3

Query  96   LHAPTNIHDLPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIM  275
            L  PT I+DLPDVILSN+IAA+S  R+RN+AALVCRKWLVLER+TR+ LTLRGN+RDL M
Sbjct  4    LARPTIINDLPDVILSNIIAAVSDVRSRNAAALVCRKWLVLERSTRSSLTLRGNIRDLFM  63

Query  276  LPTCFRSVTHLDLSLLSPWGHPLLS--HANSDAAIATDPALIAHLLRHAFPSVTSLKLYA  449
            LPTCFRSVTHLDLSL+SPWGHPLLS   A+SD     D  LIAHLLRHAFP VTSL +YA
Sbjct  64   LPTCFRSVTHLDLSLVSPWGHPLLSPRAASSDGGDDADSILIAHLLRHAFPIVTSLIVYA  123

Query  450  RNPSTLQLLAAQWPQLMKITLVRWHQRPQLAAGEELGSFF  569
            R+P TLQ L  QWP L  I LVRWHQRPQLA+G+E    F
Sbjct  124  RSPHTLQFLPVQWPHLKYIKLVRWHQRPQLASGDEFNLLF  163



>ref|XP_009623891.1| PREDICTED: F-box/LRR-repeat MAX2 homolog A [Nicotiana tomentosiformis]
Length=724

 Score =   229 bits (583),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 116/163 (71%), Positives = 129/163 (79%), Gaps = 1/163 (1%)
 Frame = +3

Query  81   ASTVRLHAPTNIHDLPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGNV  260
            A+  +L   T I+DLPDVILSN+IAAIS  R+RNSAALVCRK LV ER+TR  LTLRGNV
Sbjct  2    ATATQLTCSTIINDLPDVILSNIIAAISDVRSRNSAALVCRKCLVFERSTRVSLTLRGNV  61

Query  261  RDLIMLPTCFRSVTHLDLSLLSPWGHPLLSHANSDAAIATDPALIAHLLRHAFPSVTSLK  440
            RDL MLPTCFRSVTHLDLSL+SPWGHPLLS  +   A A DP+LIAHLLRHAFPSVTSL 
Sbjct  62   RDLFMLPTCFRSVTHLDLSLISPWGHPLLSSVDGAGAEA-DPSLIAHLLRHAFPSVTSLV  120

Query  441  LYARNPSTLQLLAAQWPQLMKITLVRWHQRPQLAAGEELGSFF  569
            +Y R+P TLQLL   WP L +I LVRWHQRPQLA G+E    F
Sbjct  121  VYTRHPFTLQLLPPLWPHLKEIKLVRWHQRPQLATGDEFNMLF  163



>ref|XP_011083007.1| PREDICTED: F-box/LRR-repeat MAX2 homolog A [Sesamum indicum]
Length=720

 Score =   223 bits (568),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 129/157 (82%), Gaps = 7/157 (4%)
 Frame = +3

Query  102  APTNIHDLPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIMLP  281
            A T +HDLPDVILSN+IAA+S  R+RN AALVCR+W +LERATR+ LTLRGN+R+L M+P
Sbjct  2    AATTLHDLPDVILSNIIAAVSDVRSRNCAALVCRRWYLLERATRSALTLRGNLRELFMVP  61

Query  282  TCFRSVTHLDLSLLSPWGHPLLSHANSDAAIATDPALIAHLLRHAFPSVTSLKLYARNPS  461
            TCF S++HLDLSLLSPWGHPL S      A A+D ALIAHLLRHAFPSVTSL  YARNPS
Sbjct  62   TCFSSISHLDLSLLSPWGHPLTS------ASASDSALIAHLLRHAFPSVTSLTFYARNPS  115

Query  462  TLQLLAAQWPQLMKITLVRWHQRPQL-AAGEELGSFF  569
            T+QL+A QWP L ++ LVRWHQRPQ+ AAG+EL   F
Sbjct  116  TIQLVAPQWPNLERVKLVRWHQRPQIAAAGDELKILF  152



>ref|XP_009767168.1| PREDICTED: F-box/LRR-repeat MAX2 homolog A [Nicotiana sylvestris]
Length=724

 Score =   223 bits (567),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 114/163 (70%), Positives = 128/163 (79%), Gaps = 1/163 (1%)
 Frame = +3

Query  81   ASTVRLHAPTNIHDLPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGNV  260
            A+  +L   T I+DLPDVILSN+IAAIS  R+ NSAALV RKWLVLER+TR  LTLRGNV
Sbjct  2    ATATQLTCSTIINDLPDVILSNIIAAISDVRSCNSAALVSRKWLVLERSTRVSLTLRGNV  61

Query  261  RDLIMLPTCFRSVTHLDLSLLSPWGHPLLSHANSDAAIATDPALIAHLLRHAFPSVTSLK  440
            RDL MLPTCFRS+THLDLSL+SPWGHPLLS   S AA   DP+LIAHLLRHAFPSVTSL 
Sbjct  62   RDLFMLPTCFRSITHLDLSLISPWGHPLLSPV-SGAAAGADPSLIAHLLRHAFPSVTSLV  120

Query  441  LYARNPSTLQLLAAQWPQLMKITLVRWHQRPQLAAGEELGSFF  569
            +Y R+P TL+LL   WP L +  LVRWHQRPQLA G+E    F
Sbjct  121  VYTRHPFTLRLLPPLWPHLKETKLVRWHQRPQLATGDEFNMLF  163



>ref|XP_006348874.1| PREDICTED: F-box/LRR-repeat MAX2 homolog A-like [Solanum tuberosum]
Length=711

 Score =   222 bits (566),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 113/159 (71%), Positives = 127/159 (80%), Gaps = 5/159 (3%)
 Frame = +3

Query  93   RLHAPTNIHDLPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGNVRDLI  272
            +L   T I DLPDVILSN+IAA+S  R+RNS +LVCRKWLVLER+TR+ LTLRGNVRDL 
Sbjct  4    QLTCITTISDLPDVILSNIIAAVSDVRSRNSTSLVCRKWLVLERSTRSSLTLRGNVRDLF  63

Query  273  MLPTCFRSVTHLDLSLLSPWGHPLLSHANSDAAIATDPALIAHLLRHAFPSVTSLKLYAR  452
            MLPTCFRSVTHLDLSL+SPWGHPLLS      A+A DP LIA LL HAFPS+TSL LY R
Sbjct  64   MLPTCFRSVTHLDLSLISPWGHPLLSP----TAVA-DPFLIAQLLHHAFPSITSLVLYTR  118

Query  453  NPSTLQLLAAQWPQLMKITLVRWHQRPQLAAGEELGSFF  569
            NP TL++L   WP L +I LVRWHQRPQL+AGEEL   F
Sbjct  119  NPCTLRILPPLWPNLKEIKLVRWHQRPQLSAGEELNMLF  157



>ref|XP_009766305.1| PREDICTED: F-box/LRR-repeat MAX2 homolog A-like [Nicotiana sylvestris]
Length=726

 Score =   221 bits (564),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 115/156 (74%), Positives = 127/156 (81%), Gaps = 1/156 (1%)
 Frame = +3

Query  105  PTNIHDLPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIMLPT  284
            PT ++DLPDVILSN+IAA+S  R+RN AALVCRKWLVLER+TRT LTLRGN  DL MLPT
Sbjct  7    PTTLNDLPDVILSNIIAAVSDARSRNVAALVCRKWLVLERSTRTSLTLRGNRNDLFMLPT  66

Query  285  CFRSVTHLDLSLLSPWGHPLLS-HANSDAAIATDPALIAHLLRHAFPSVTSLKLYARNPS  461
            CFRSVTHLDLSLLSPWGHPLLS  A +D   A D  LIAHLLRHAFPSV+SL +YAR+P 
Sbjct  67   CFRSVTHLDLSLLSPWGHPLLSPRAAADNDGADDSTLIAHLLRHAFPSVSSLTVYARDPH  126

Query  462  TLQLLAAQWPQLMKITLVRWHQRPQLAAGEELGSFF  569
             LQLL  QWPQL  I LVRWHQRPQLA+G+E    F
Sbjct  127  VLQLLPIQWPQLKHIKLVRWHQRPQLASGDEFNLLF  162



>ref|XP_009629725.1| PREDICTED: F-box/LRR-repeat MAX2 homolog A-like [Nicotiana tomentosiformis]
Length=727

 Score =   219 bits (559),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 115/157 (73%), Positives = 129/157 (82%), Gaps = 2/157 (1%)
 Frame = +3

Query  105  PTNIHDLPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGNV-RDLIMLP  281
            PT ++DLPDVILSN+IAA+S  R+RN AALVCRKWLVLER+TRT LTLRGN  RD+ MLP
Sbjct  7    PTTLNDLPDVILSNIIAAVSDVRSRNVAALVCRKWLVLERSTRTSLTLRGNTTRDIFMLP  66

Query  282  TCFRSVTHLDLSLLSPWGHPLLS-HANSDAAIATDPALIAHLLRHAFPSVTSLKLYARNP  458
            TCFRSVTHLDLSLLSPWGHPLLS  A +D   A D  LIAHLLRHAFPSV+SL +YAR+P
Sbjct  67   TCFRSVTHLDLSLLSPWGHPLLSPRAAADNDGADDSTLIAHLLRHAFPSVSSLTVYARDP  126

Query  459  STLQLLAAQWPQLMKITLVRWHQRPQLAAGEELGSFF  569
              LQLL  QWPQL +I LVRWHQRPQLA+G+E    F
Sbjct  127  HALQLLPIQWPQLKQIKLVRWHQRPQLASGDEFSLLF  163



>gb|AEB97385.1| MAX2B [Petunia x hybrida]
Length=723

 Score =   218 bits (556),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 108/155 (70%), Positives = 127/155 (82%), Gaps = 2/155 (1%)
 Frame = +3

Query  108  TNIHDLPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIMLPTC  287
            T ++DLPDVILSN+IAA+S  R+RN+ ALVC KWLVLER+TRT LTLRGN+RDL MLPTC
Sbjct  9    TTLNDLPDVILSNIIAAVSDTRSRNATALVCHKWLVLERSTRTSLTLRGNIRDLFMLPTC  68

Query  288  FRSVTHLDLSLLSPWGHPLLSHANSDAAIATDPALIAHLLRHAFPSVTSLKLYARNPSTL  467
            FRS+T+LDLSL+SPWGHPLL+   +DA    D ALIAHLLRH FPSVTSL LYAR+P+T+
Sbjct  69   FRSITYLDLSLISPWGHPLLASRATDAP-DNDSALIAHLLRHTFPSVTSLTLYARDPNTI  127

Query  468  QLLAAQWPQLMK-ITLVRWHQRPQLAAGEELGSFF  569
            Q L AQW   +K I LVRWHQR QLA+G+EL   F
Sbjct  128  QFLPAQWAHTLKHIKLVRWHQRAQLASGDELNLLF  162



>ref|XP_004243284.1| PREDICTED: F-box/LRR-repeat MAX2 homolog A-like [Solanum lycopersicum]
Length=711

 Score =   218 bits (555),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 109/159 (69%), Positives = 125/159 (79%), Gaps = 5/159 (3%)
 Frame = +3

Query  93   RLHAPTNIHDLPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGNVRDLI  272
            +L   T I+DLPDVILSN+IA +S  R+RNSA+LVCRKW+VLER+TR+ LTLRGNVRDLI
Sbjct  4    QLTCVTAINDLPDVILSNIIAVVSDVRSRNSASLVCRKWMVLERSTRSSLTLRGNVRDLI  63

Query  273  MLPTCFRSVTHLDLSLLSPWGHPLLSHANSDAAIATDPALIAHLLRHAFPSVTSLKLYAR  452
            MLPTCFRSVTHLDLSL+SPWGHPLLS          DP LIA LL HAFP++TSL LY R
Sbjct  64   MLPTCFRSVTHLDLSLISPWGHPLLS-----PTAFADPFLIAQLLHHAFPAITSLVLYTR  118

Query  453  NPSTLQLLAAQWPQLMKITLVRWHQRPQLAAGEELGSFF  569
            NP  L++L   WP L +I LVRWHQRPQL+AGEEL   F
Sbjct  119  NPLILRILPPLWPNLKEIKLVRWHQRPQLSAGEELSMLF  157



>sp|I1SSI5.1|MAX2A_PETHY RecName: Full=F-box/LRR-repeat MAX2 homolog A; AltName: Full=F-box 
and leucine-rich repeat MAX2 homolog A [Petunia x hybrida]
 gb|AEB97384.1| MAX2A [Petunia x hybrida]
Length=708

 Score =   215 bits (547),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 105/154 (68%), Positives = 120/154 (78%), Gaps = 6/154 (4%)
 Frame = +3

Query  108  TNIHDLPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIMLPTC  287
            T ++DLPDVILSN+IAA++  R+RNS + VCRKWLVLER+TR  LTLRGNVRDL MLPTC
Sbjct  3    TQLNDLPDVILSNIIAAVTDVRSRNSTSFVCRKWLVLERSTRVSLTLRGNVRDLFMLPTC  62

Query  288  FRSVTHLDLSLLSPWGHPLLSHANSDAAIATDPALIAHLLRHAFPSVTSLKLYARNPSTL  467
            FRS+THLDLSL+SPWGHPLLS          DP+L AHLL HAFP VTSL +Y R+P TL
Sbjct  63   FRSITHLDLSLISPWGHPLLS------PTTPDPSLTAHLLHHAFPFVTSLVVYTRHPFTL  116

Query  468  QLLAAQWPQLMKITLVRWHQRPQLAAGEELGSFF  569
            QLL   WPQL +I LVRWHQRPQLA G+E    F
Sbjct  117  QLLPPLWPQLKQIKLVRWHQRPQLATGDEFNMLF  150



>gb|AGP26193.1| F-box protein [Striga hermonthica]
Length=728

 Score =   207 bits (526),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 99/149 (66%), Positives = 122/149 (82%), Gaps = 7/149 (5%)
 Frame = +3

Query  114  IHDLPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIMLPTCFR  293
            ++DLPDVILSN++A +S  R+RNSA+LVC KW +LERATR+ LTLRGN+RDL MLPTCF+
Sbjct  37   LNDLPDVILSNIMAGVSDVRSRNSASLVCHKWYLLERATRSALTLRGNIRDLFMLPTCFQ  96

Query  294  SVTHLDLSLLSPWGHPLLSHANSDAAIATDPALIAHLLRHAFPSVTSLKLYARNPSTLQL  473
            S +HLDLSL+SPWGHPL S A+ D+      ALI HLLRHAFPSVTSL +YAR+PST+ +
Sbjct  97   STSHLDLSLISPWGHPLTSAADPDS------ALIGHLLRHAFPSVTSLAIYARDPSTIHI  150

Query  474  LAAQWPQLMKITLVRWHQRPQL-AAGEEL  557
            +  QWP L ++ LVRWHQRPQ  AAG+EL
Sbjct  151  VVPQWPDLERLKLVRWHQRPQTDAAGDEL  179



>gb|EYU41123.1| hypothetical protein MIMGU_mgv1a002106mg [Erythranthe guttata]
Length=713

 Score =   205 bits (522),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 107/169 (63%), Positives = 125/169 (74%), Gaps = 15/169 (9%)
 Frame = +3

Query  66   MATSPASTVRLHAPTNIHDLPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLT  245
            MA  P S       T ++DLPDVILSN+IAA+   R RNSAALVC KW  LERATR+ +T
Sbjct  1    MAAPPTSG------TTLNDLPDVILSNIIAAVVDVRGRNSAALVCSKWYALERATRSSIT  54

Query  246  LRGNVRDLIMLPTCFRSVTHLDLSLLSPWGHPLLSHANSDAAIATDPALIAHLLRHAFPS  425
            LR N+RDL M+P CFRSV+HLDLSLLSPWGHPL S        A+DPALIAHLLR AFPS
Sbjct  55   LRANLRDLFMVPNCFRSVSHLDLSLLSPWGHPLTS--------ASDPALIAHLLRLAFPS  106

Query  426  VTSLKLYARNPSTLQLLAAQWPQLMKITLVRWHQRPQL-AAGEELGSFF  569
            +TSL  YARNPST+QL+A+QW  +  + LVRWHQRPQ+  AG+EL   F
Sbjct  107  LTSLTFYARNPSTIQLVASQWHNVEHLKLVRWHQRPQVETAGDELKILF  155



>emb|CDP21512.1| unnamed protein product [Coffea canephora]
Length=709

 Score =   204 bits (519),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 106/155 (68%), Positives = 121/155 (78%), Gaps = 6/155 (4%)
 Frame = +3

Query  108  TNIHDLPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIMLPTC  287
            T ++DLPDVIL+N+IAAIS  R+RN+AALVCRKWL+ ER+TRT LTLRG +RDL  LPTC
Sbjct  6    TTVNDLPDVILTNIIAAISDVRSRNAAALVCRKWLLQERSTRTSLTLRGKIRDLFFLPTC  65

Query  288  FRSVTHLDLSLLSPWGHPLL-SHANSDAAIATDPALIAHLLRHAFPSVTSLKLYARNPST  464
            FRSVT LDLSLLSPWGHPLL  H  +  A      LIAH+L  AFP+VTSL LYARNPST
Sbjct  66   FRSVTDLDLSLLSPWGHPLLPPHIPTTTA-----TLIAHVLHQAFPAVTSLTLYARNPST  120

Query  465  LQLLAAQWPQLMKITLVRWHQRPQLAAGEELGSFF  569
            +QLLA QWP L  I LVRWHQR  L +GEEL + F
Sbjct  121  IQLLAPQWPCLKHIKLVRWHQRSPLLSGEELLALF  155



>emb|CDP15938.1| unnamed protein product [Coffea canephora]
Length=709

 Score =   201 bits (511),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 104/155 (67%), Positives = 121/155 (78%), Gaps = 6/155 (4%)
 Frame = +3

Query  108  TNIHDLPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIMLPTC  287
            T ++DLPDVIL+N+IAAIS  R+RN+AALVCRKWL+ ER+TRT LTLRG + DL  LPTC
Sbjct  6    TTVNDLPDVILTNIIAAISDVRSRNAAALVCRKWLLQERSTRTSLTLRGKILDLFFLPTC  65

Query  288  FRSVTHLDLSLLSPWGHPLL-SHANSDAAIATDPALIAHLLRHAFPSVTSLKLYARNPST  464
            FRSVT LDLSLLSPWGHPLL  H  +  A      L+A +L  AFP+VTSL LYARNPST
Sbjct  66   FRSVTDLDLSLLSPWGHPLLPPHIPTTTA-----TLMALVLHQAFPAVTSLTLYARNPST  120

Query  465  LQLLAAQWPQLMKITLVRWHQRPQLAAGEELGSFF  569
            +QLLA QWP+L  I LVRWHQRP L +GEEL + F
Sbjct  121  IQLLAPQWPRLKHIKLVRWHQRPPLGSGEELLALF  155



>ref|XP_008455299.1| PREDICTED: F-box/LRR-repeat MAX2 homolog A [Cucumis melo]
Length=715

 Score =   196 bits (499),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 99/156 (63%), Positives = 117/156 (75%), Gaps = 7/156 (4%)
 Frame = +3

Query  102  APTNIHDLPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIMLP  281
            A T+I+DLPDV+LSN++A +S  RTRNS +LVCRK+L LERATR  LTL+GN RDL  +P
Sbjct  2    ARTSINDLPDVLLSNILALVSDTRTRNSLSLVCRKFLSLERATRFSLTLKGNARDLYGIP  61

Query  282  TCFRSVTHLDLSLLSPWGHPLLSHANSDAAIATDPALIAHLLRHAFPSVTSLKLYARNPS  461
            TCFRSVTHLDLSLLSPWGH  L         + DP L+AH LR  FP VTSL +YAR P+
Sbjct  62   TCFRSVTHLDLSLLSPWGHAFLCS-------SPDPDLLAHRLRGLFPLVTSLTIYARTPT  114

Query  462  TLQLLAAQWPQLMKITLVRWHQRPQLAAGEELGSFF  569
            TLQ+LA QWP+L  + LVRWHQRPQ A GE+L   F
Sbjct  115  TLQILARQWPELRHVKLVRWHQRPQSAPGEDLAPIF  150



>ref|XP_010657042.1| PREDICTED: F-box/LRR-repeat MAX2 homolog A [Vitis vinifera]
 emb|CAN59822.1| hypothetical protein VITISV_001981 [Vitis vinifera]
Length=712

 Score =   196 bits (499),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 99/152 (65%), Positives = 117/152 (77%), Gaps = 9/152 (6%)
 Frame = +3

Query  108  TNIHDLPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGNV--RDLIMLP  281
            T IHDLPD ILS+++A+++  R RN+AALVCRKWLVLER TRT LTLRGNV   +L M+P
Sbjct  10   TTIHDLPDAILSSILASVTDTRARNAAALVCRKWLVLERGTRTSLTLRGNVVHNNLYMIP  69

Query  282  TCFRSVTHLDLSLLSPWGHPLLSHANSDAAIATDPALIAHLLRHAFPSVTSLKLYARNPS  461
            TCFR+VTHLDLSLLSPWGH L+S +       +DP L+AHLLRHAFP VTSL +YAR P+
Sbjct  70   TCFRAVTHLDLSLLSPWGHSLISPS-------SDPMLLAHLLRHAFPMVTSLTVYARTPA  122

Query  462  TLQLLAAQWPQLMKITLVRWHQRPQLAAGEEL  557
            TLQLLA QWP L  I LV+WHQR   A G + 
Sbjct  123  TLQLLAPQWPNLTHIKLVKWHQRSPSALGSDF  154



>emb|CBI21987.3| unnamed protein product [Vitis vinifera]
Length=696

 Score =   196 bits (498),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 99/152 (65%), Positives = 117/152 (77%), Gaps = 9/152 (6%)
 Frame = +3

Query  108  TNIHDLPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGNV--RDLIMLP  281
            T IHDLPD ILS+++A+++  R RN+AALVCRKWLVLER TRT LTLRGNV   +L M+P
Sbjct  16   TTIHDLPDAILSSILASVTDTRARNAAALVCRKWLVLERGTRTSLTLRGNVVHNNLYMIP  75

Query  282  TCFRSVTHLDLSLLSPWGHPLLSHANSDAAIATDPALIAHLLRHAFPSVTSLKLYARNPS  461
            TCFR+VTHLDLSLLSPWGH L+S +       +DP L+AHLLRHAFP VTSL +YAR P+
Sbjct  76   TCFRAVTHLDLSLLSPWGHSLISPS-------SDPMLLAHLLRHAFPMVTSLTVYARTPA  128

Query  462  TLQLLAAQWPQLMKITLVRWHQRPQLAAGEEL  557
            TLQLLA QWP L  I LV+WHQR   A G + 
Sbjct  129  TLQLLAPQWPNLTHIKLVKWHQRSPSALGSDF  160



>ref|XP_004137031.1| PREDICTED: F-box protein ORE9-like [Cucumis sativus]
 gb|KGN43631.1| F-box/leucine rich repeat protein [Cucumis sativus]
Length=715

 Score =   196 bits (497),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 98/156 (63%), Positives = 117/156 (75%), Gaps = 7/156 (4%)
 Frame = +3

Query  102  APTNIHDLPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIMLP  281
            A T+I+DLPDV++SN++A +S  RTRNS +LVCRK+L LERATR  L+LRGN RDL  +P
Sbjct  2    ARTSINDLPDVLVSNILALVSDTRTRNSLSLVCRKFLSLERATRFSLSLRGNARDLYGIP  61

Query  282  TCFRSVTHLDLSLLSPWGHPLLSHANSDAAIATDPALIAHLLRHAFPSVTSLKLYARNPS  461
            TCFRSVTHLDLSLLSPWGH  L         + DP L+AH LR  FP VTSL +YAR P+
Sbjct  62   TCFRSVTHLDLSLLSPWGHAFLCS-------SPDPDLLAHRLRGLFPLVTSLTVYARTPT  114

Query  462  TLQLLAAQWPQLMKITLVRWHQRPQLAAGEELGSFF  569
            TLQ+LA QWP+L  + LVRWHQRPQ A GE+L   F
Sbjct  115  TLQILARQWPELRHVKLVRWHQRPQSAPGEDLAPIF  150



>ref|XP_004155515.1| PREDICTED: F-box protein ORE9-like [Cucumis sativus]
Length=715

 Score =   195 bits (496),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 98/156 (63%), Positives = 117/156 (75%), Gaps = 7/156 (4%)
 Frame = +3

Query  102  APTNIHDLPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIMLP  281
            A T+I+DLPDV++SN++A +S  RTRNS +LVCRK+L LERATR  L+LRGN RDL  +P
Sbjct  2    ARTSINDLPDVLVSNILALVSDTRTRNSLSLVCRKFLSLERATRFSLSLRGNARDLYGIP  61

Query  282  TCFRSVTHLDLSLLSPWGHPLLSHANSDAAIATDPALIAHLLRHAFPSVTSLKLYARNPS  461
            TCFRSVTHLDLSLLSPWGH  L         + DP L+AH LR  FP VTSL +YAR P+
Sbjct  62   TCFRSVTHLDLSLLSPWGHAFLCS-------SPDPDLLAHRLRGLFPLVTSLTVYARTPT  114

Query  462  TLQLLAAQWPQLMKITLVRWHQRPQLAAGEELGSFF  569
            TLQ+LA QWP+L  + LVRWHQRPQ A GE+L   F
Sbjct  115  TLQILARQWPELRHVKLVRWHQRPQSAPGEDLAPIF  150



>gb|AFZ99010.1| F-box protein MAX2c [Chrysanthemum x morifolium]
Length=682

 Score =   193 bits (490),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 95/154 (62%), Positives = 116/154 (75%), Gaps = 8/154 (5%)
 Frame = +3

Query  108  TNIHDLPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIMLPTC  287
            T I DLPDVILSN+IAAIS+ RTRN+A+LV RKWL L+R+TRT LTLRGN RDL MLP+C
Sbjct  6    TTISDLPDVILSNIIAAISNTRTRNAASLVSRKWLFLDRSTRTSLTLRGNARDLFMLPSC  65

Query  288  FRSVTHLDLSLLSPWGHPLLSHANSDAAIATDPALIAHLLRHAFPSVTSLKLYARNPSTL  467
            FRSVTHLDLSLLSPWGHPLLS   +        AL A LL   FP+V SL +Y+RNP+ +
Sbjct  66   FRSVTHLDLSLLSPWGHPLLSGGPA--------ALFAQLLCQMFPNVVSLVIYSRNPNAI  117

Query  468  QLLAAQWPQLMKITLVRWHQRPQLAAGEELGSFF  569
            ++LA  WP + +I LVRWHQRP +  G+++   F
Sbjct  118  RVLAPHWPLIRQIKLVRWHQRPAVGPGDDISPVF  151



>gb|AFZ99006.1| F-box protein MAX2 [Chrysanthemum x morifolium]
Length=682

 Score =   191 bits (486),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 116/154 (75%), Gaps = 8/154 (5%)
 Frame = +3

Query  108  TNIHDLPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIMLPTC  287
            T I+DLPDVILSN+IAAIS+ RTRN+A+LV RKWL L+R+TR  LTLRGN RDL MLP+C
Sbjct  6    TTINDLPDVILSNIIAAISNTRTRNAASLVSRKWLFLDRSTRASLTLRGNARDLFMLPSC  65

Query  288  FRSVTHLDLSLLSPWGHPLLSHANSDAAIATDPALIAHLLRHAFPSVTSLKLYARNPSTL  467
            FRSVTHLDLSLLSPWGHPLLS   +        AL A LL   FP+V SL +Y+RNP+ +
Sbjct  66   FRSVTHLDLSLLSPWGHPLLSGGPA--------ALFAQLLSQMFPNVLSLVIYSRNPNAI  117

Query  468  QLLAAQWPQLMKITLVRWHQRPQLAAGEELGSFF  569
            ++LA  WP + +I LVRWHQRP +  G+++   F
Sbjct  118  RVLAPHWPLIRQIKLVRWHQRPVVGPGDDISPVF  151



>gb|EPS66557.1| hypothetical protein M569_08217 [Genlisea aurea]
Length=665

 Score =   190 bits (482),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 90/157 (57%), Positives = 114/157 (73%), Gaps = 9/157 (6%)
 Frame = +3

Query  102  APTNIHDLPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIMLP  281
            A T + DLPD IL+N+IAAIS  R+RNSAALVCRKW   ER TR  LTLRGN+RD+ ++P
Sbjct  2    ASTGVEDLPDAILTNIIAAISDVRSRNSAALVCRKWCRTERGTRASLTLRGNLRDIFLVP  61

Query  282  TCFRSVTHLDLSLLSPWGHPLLSHANSDAAIATDPALIAHLLRHAFPSVTSLKLYARNPS  461
            TCF+S+ HLD+S++SPWG+ L S        A DP    H+LR AFP + SL +YARNPS
Sbjct  62   TCFQSIAHLDMSMISPWGYALAS--------AADPDFTGHILRRAFPDIRSLTVYARNPS  113

Query  462  TLQLLAAQWPQLMKITLVRWHQRPQL-AAGEELGSFF  569
            T++L+A  WP +  + LVRWHQRPQ+ AAG+EL   F
Sbjct  114  TMRLIAPVWPNIEGVKLVRWHQRPQISAAGDELKILF  150



>gb|AFZ99008.1| F-box protein MAX2b [Chrysanthemum x morifolium]
Length=682

 Score =   189 bits (480),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 93/154 (60%), Positives = 115/154 (75%), Gaps = 8/154 (5%)
 Frame = +3

Query  108  TNIHDLPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIMLPTC  287
            T I DLPDVILSN+IAAIS+ R+RN+A+LV RKWL L+R+TRT LTLRGN RDL MLP+C
Sbjct  6    TTISDLPDVILSNIIAAISNTRSRNAASLVSRKWLFLDRSTRTSLTLRGNARDLFMLPSC  65

Query  288  FRSVTHLDLSLLSPWGHPLLSHANSDAAIATDPALIAHLLRHAFPSVTSLKLYARNPSTL  467
            FR VTHLDLSLLSPWGHPLLS   +        AL A LL   FP+V SL +Y+RNP+ +
Sbjct  66   FRPVTHLDLSLLSPWGHPLLSGGPA--------ALFAQLLSQMFPNVLSLVIYSRNPNAI  117

Query  468  QLLAAQWPQLMKITLVRWHQRPQLAAGEELGSFF  569
            ++LA  WP + +I LVRWHQRP +  G+++   F
Sbjct  118  RVLAPHWPLIRQIKLVRWHQRPVVGPGDDISPVF  151



>gb|AIM41254.1| F-box/LRR family protein [Gossypium hirsutum]
Length=702

 Score =   186 bits (472),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 91/139 (65%), Positives = 111/139 (80%), Gaps = 4/139 (3%)
 Frame = +3

Query  114  IHDLPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIMLPTCFR  293
            I+D+PDVILSN+ A+IS  RTRNS +LV RK+++L+RATR  LTLRGN RDL M+PTCFR
Sbjct  4    INDIPDVILSNIFASISDTRTRNSLSLVSRKFMLLDRATRVSLTLRGNARDLFMIPTCFR  63

Query  294  SVTHLDLSLLSPWGHPLLSHANSDAAIATDPALIAHLLRHAFPSVTSLKLYARNPSTLQL  473
            SV+ LDLS LSPWGHPLLS   SD    TDP L+AH LR AFP+VTSL +YAR+P T+++
Sbjct  64   SVSDLDLSFLSPWGHPLLSSPLSD----TDPQLLAHRLRVAFPAVTSLTVYARSPLTIKI  119

Query  474  LAAQWPQLMKITLVRWHQR  530
            L  QWP L ++ LVRWHQR
Sbjct  120  LVQQWPGLKRVKLVRWHQR  138



>gb|AIM41255.1| F-box/LRR family protein [Gossypium hirsutum]
Length=702

 Score =   186 bits (471),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 91/139 (65%), Positives = 110/139 (79%), Gaps = 4/139 (3%)
 Frame = +3

Query  114  IHDLPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIMLPTCFR  293
            I+D+PDVILSN+ A+IS  RTRNS +LV RK+++L+RATR  LTLRGN RDL M+PTCFR
Sbjct  4    INDIPDVILSNIFASISDTRTRNSLSLVSRKFMLLDRATRVSLTLRGNARDLFMIPTCFR  63

Query  294  SVTHLDLSLLSPWGHPLLSHANSDAAIATDPALIAHLLRHAFPSVTSLKLYARNPSTLQL  473
            SVT LDLS LSPWGH LLS   SD    TDP L+AH LR AFP+VTSL +YAR+P T+++
Sbjct  64   SVTDLDLSFLSPWGHSLLSSPFSD----TDPQLLAHRLRRAFPAVTSLTVYARSPLTIEI  119

Query  474  LAAQWPQLMKITLVRWHQR  530
            L  QWP L ++ LVRWHQR
Sbjct  120  LVQQWPGLKRVKLVRWHQR  138



>ref|XP_002528551.1| F-box/leucine rich repeat protein, putative [Ricinus communis]
 gb|EEF33863.1| F-box/leucine rich repeat protein, putative [Ricinus communis]
Length=695

 Score =   185 bits (469),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 96/152 (63%), Positives = 116/152 (76%), Gaps = 8/152 (5%)
 Frame = +3

Query  114  IHDLPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIMLPTCFR  293
            I+DLPDVILSN+IA+IS  RTRNS +LV RK+L LER TRT LTLRGN RDL M+PTCFR
Sbjct  9    INDLPDVILSNIIASISDTRTRNSLSLVNRKFLTLERTTRTSLTLRGNARDLYMIPTCFR  68

Query  294  SVTHLDLSLLSPWGHPLLSHANSDAAIATDPALIAHLLRHAFPSVTSLKLYARNPSTLQL  473
            SVTHLDLSLLSPWGH LL+     +++ +DP L+AH L  AFP VTSL +YAR+P TL +
Sbjct  69   SVTHLDLSLLSPWGHSLLA-----SSLPSDPLLLAHRLGIAFPLVTSLTVYARSPCTLHV  123

Query  474  LAAQWPQLMKITLVRWHQRPQLAAGEELGSFF  569
            L  QWP L  + L+RWHQRP   +  +LG+ F
Sbjct  124  LIPQWPLLSHVKLIRWHQRP---SSSQLGADF  152



>gb|KDP21100.1| hypothetical protein JCGZ_21571 [Jatropha curcas]
Length=687

 Score =   184 bits (466),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 93/157 (59%), Positives = 110/157 (70%), Gaps = 9/157 (6%)
 Frame = +3

Query  105  PTNIH--DLPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIML  278
            PTN+H  D+PD IL N+ + I   R+RNS +LVC KW ++ER TRT LTLRGN+RDL +L
Sbjct  5    PTNVHFHDIPDAILFNIFSLILDTRSRNSMSLVCVKWHLIERLTRTSLTLRGNLRDLFLL  64

Query  279  PTCFRSVTHLDLSLLSPWGHPLLSHANSDAAIATDPALIAHLLRHAFPSVTSLKLYARNP  458
            PTCFRSVT+LDLSLLSPWGHP+          + DP LIA L+R AFP V SL +YARNP
Sbjct  65   PTCFRSVTNLDLSLLSPWGHPIFDS-------SPDPLLIAQLIRRAFPCVVSLTVYARNP  117

Query  459  STLQLLAAQWPQLMKITLVRWHQRPQLAAGEELGSFF  569
             TLQLLA QWP L  + LVRWH RP    G +  S F
Sbjct  118  LTLQLLAPQWPALTNVKLVRWHTRPPAPPGSDFVSLF  154



>gb|KJB49050.1| hypothetical protein B456_008G099500 [Gossypium raimondii]
Length=702

 Score =   184 bits (466),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 91/139 (65%), Positives = 110/139 (79%), Gaps = 4/139 (3%)
 Frame = +3

Query  114  IHDLPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIMLPTCFR  293
            I+D+PDVILSN+ A+IS  RTRNS +LV RK+++L+RATR  LTLRGN RDL M+PTCFR
Sbjct  4    INDIPDVILSNIFASISDTRTRNSLSLVSRKFMLLDRATRVSLTLRGNARDLFMIPTCFR  63

Query  294  SVTHLDLSLLSPWGHPLLSHANSDAAIATDPALIAHLLRHAFPSVTSLKLYARNPSTLQL  473
            SVT LDLS LSPWGH LLS   SD    TDP L+AH LR AFP+VTSL +YAR+P T+++
Sbjct  64   SVTDLDLSFLSPWGHSLLSSPLSD----TDPQLLAHRLRVAFPAVTSLTVYARSPLTIKI  119

Query  474  LAAQWPQLMKITLVRWHQR  530
            L  QWP L ++ LVRWHQR
Sbjct  120  LVQQWPGLKRVKLVRWHQR  138



>gb|KDP37749.1| hypothetical protein JCGZ_05239 [Jatropha curcas]
Length=689

 Score =   183 bits (465),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 97/154 (63%), Positives = 117/154 (76%), Gaps = 9/154 (6%)
 Frame = +3

Query  108  TNIHDLPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIMLPTC  287
            T I+DLPDVILSN+ A+IS  RTRNS +LV RK+L L+RATRT LTLRGNVRDL M+P C
Sbjct  5    TTINDLPDVILSNIFASISDTRTRNSLSLVNRKFLSLDRATRTSLTLRGNVRDLYMIPNC  64

Query  288  FRSVTHLDLSLLSPWGHPLLSHANSDAAIATDPALIAHLLRHAFPSVTSLKLYARNPSTL  467
            FRSVTHLDLSLLSPWGH LL+     + + +DP L+AH L  AFP VTSL +YAR+PSTL
Sbjct  65   FRSVTHLDLSLLSPWGHSLLA-----SPVPSDPILLAHRLSVAFPLVTSLTVYARSPSTL  119

Query  468  QLLAAQWPQLMKITLVRWHQRPQLAAGEELGSFF  569
            Q+L  QWP L  + ++RWHQRP   +   LG+ F
Sbjct  120  QIL-LQWPGLCSVKIIRWHQRP---SSSHLGADF  149



>ref|XP_007025368.1| RNI superfamily protein [Theobroma cacao]
 gb|EOY27990.1| RNI superfamily protein [Theobroma cacao]
Length=698

 Score =   182 bits (462),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 88/152 (58%), Positives = 110/152 (72%), Gaps = 7/152 (5%)
 Frame = +3

Query  114  IHDLPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIMLPTCFR  293
             HD+PDVILSN+ + ++  RTRN+ +LVC KW +LER+TR  LTLRGN+RDL +LPTCFR
Sbjct  14   FHDIPDVILSNIFSLVTDTRTRNAVSLVCLKWHLLERSTRKSLTLRGNIRDLFLLPTCFR  73

Query  294  SVTHLDLSLLSPWGHPLLSHANSDAAIATDPALIAHLLRHAFPSVTSLKLYARNPSTLQL  473
            +VT+LDLS LSPWGHPLL         + +P L+A LLR+AFPSV SL +Y RNPSTL L
Sbjct  74   AVTNLDLSFLSPWGHPLLDS-------SPNPVLLAQLLRNAFPSVVSLTVYVRNPSTLHL  126

Query  474  LAAQWPQLMKITLVRWHQRPQLAAGEELGSFF  569
            LAA WP L  + L+RWHQR     G +  + F
Sbjct  127  LAALWPNLRDVKLIRWHQRLPTPIGSDFIALF  158



>gb|KJB66814.1| hypothetical protein B456_010G159500 [Gossypium raimondii]
Length=701

 Score =   181 bits (460),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 89/155 (57%), Positives = 112/155 (72%), Gaps = 8/155 (5%)
 Frame = +3

Query  108  TNIHDLPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIMLPTC  287
             + HD+PDV+L+ + + ++  RTRN  +LVC KW +LER+TR  LTLRGN+RDL +LPTC
Sbjct  8    VHFHDIPDVVLAIIFSLVADTRTRNVMSLVCLKWHLLERSTRKSLTLRGNIRDLFLLPTC  67

Query  288  FRSVTHLDLSLLSPWGHPLLSHANSDAAIATDPALIAHLLRHAFPSVTSLKLYARNPSTL  467
            FR+VTHLDLSLLSPWGHPLL         +++P L+A LLRHAFPSV SL +Y RNPSTL
Sbjct  68   FRAVTHLDLSLLSPWGHPLLDS-------SSNPLLLAQLLRHAFPSVVSLVVYIRNPSTL  120

Query  468  QLLAAQWPQLMKITLVRWHQR-PQLAAGEELGSFF  569
             LLA QWP L  + L+RWHQR P    G +  + F
Sbjct  121  HLLAPQWPNLRHVKLIRWHQRLPTEPLGSDFTALF  155



>ref|XP_007048696.1| RNI-like superfamily protein [Theobroma cacao]
 gb|EOX92853.1| RNI-like superfamily protein [Theobroma cacao]
Length=711

 Score =   180 bits (457),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 89/139 (64%), Positives = 110/139 (79%), Gaps = 5/139 (4%)
 Frame = +3

Query  114  IHDLPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIMLPTCFR  293
            IHD+PDVILSN+ A+IS  R+RNS +LV RK+++LERATR  LTLRGN +DL M+PTCFR
Sbjct  4    IHDIPDVILSNIFASISDTRSRNSLSLVSRKFMLLERATRFSLTLRGNAKDLFMIPTCFR  63

Query  294  SVTHLDLSLLSPWGHPLLSHANSDAAIATDPALIAHLLRHAFPSVTSLKLYARNPSTLQL  473
            SVT LDLSLLSPWGH LLS ++       DP L+AH LR AFP+V SL +YAR+PST+Q+
Sbjct  64   SVTRLDLSLLSPWGHSLLSSSH-----LPDPQLLAHRLRVAFPAVRSLTVYARSPSTIQM  118

Query  474  LAAQWPQLMKITLVRWHQR  530
            L  QWP L ++ LVRWH+R
Sbjct  119  LVHQWPGLKRVKLVRWHRR  137



>ref|XP_011466958.1| PREDICTED: F-box/LRR-repeat MAX2 homolog A [Fragaria vesca subsp. 
vesca]
Length=723

 Score =   179 bits (455),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 93/158 (59%), Positives = 117/158 (74%), Gaps = 4/158 (3%)
 Frame = +3

Query  96   LHAPTNIHDLPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIM  275
            + A   I+DLP+ IL+ +IA +S  RTRNS ALV RK+  LER TRT LTLRGN RDL +
Sbjct  1    MTAAAPINDLPEAILTTIIALLSDTRTRNSVALVSRKFRTLERTTRTSLTLRGNARDLHL  60

Query  276  LPTCFRSVTHLDLSLLSPWGHPLLSHANSDAAIATDPALIAHLLRHAFPSVTSLKLYARN  455
            +PTCF SVT LDLSLLSPWGH LLS + S    +TDPAL+AH LR AFPSVTSL +Y+R+
Sbjct  61   IPTCFSSVTDLDLSLLSPWGHALLSPSAS----STDPALLAHRLRLAFPSVTSLTVYSRS  116

Query  456  PSTLQLLAAQWPQLMKITLVRWHQRPQLAAGEELGSFF  569
             ST++++A+ WP+L ++ LVRWHQRPQ   G +    F
Sbjct  117  SSTVEIVASLWPRLRRVKLVRWHQRPQSNLGADFDPLF  154



>gb|KJB69731.1| hypothetical protein B456_011G039300 [Gossypium raimondii]
Length=650

 Score =   178 bits (451),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 93/169 (55%), Positives = 114/169 (67%), Gaps = 14/169 (8%)
 Frame = +3

Query  66   MATSPASTVRLHAPTNIHDLPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLT  245
            MA   +S V LH      D+PDVILSN+ +  +  RTRN+ +LVC KWL+LER+TR  LT
Sbjct  1    MAAGTSSNVHLH------DIPDVILSNIFSLETETRTRNAMSLVCLKWLLLERSTRKSLT  54

Query  246  LRGNVRDLIMLPTCFRSVTHLDLSLLSPWGHPLLSHANSDAAIATDPALIAHLLRHAFPS  425
            LRGN+R+L +LPTCFR+VTHLDLS LSPWG+PLL          ++P ++A  LRHAFPS
Sbjct  55   LRGNIRNLFLLPTCFRAVTHLDLSFLSPWGYPLLDS-------FSNPLVLAQFLRHAFPS  107

Query  426  VTSLKLYARNPSTLQLLAAQWPQLMKITLVRWHQR-PQLAAGEELGSFF  569
            V SL  Y RNP TL LLA+QWP L  + LVRWHQ  P    G +L   F
Sbjct  108  VVSLIAYVRNPLTLHLLASQWPNLQHVKLVRWHQLWPAAPVGSDLVPLF  156



>gb|AEB37324.1| more axillary branches 2, partial [Helianthus exilis]
 gb|AEB37325.1| more axillary branches 2, partial [Helianthus exilis]
Length=235

 Score =   167 bits (423),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 82/121 (68%), Positives = 96/121 (79%), Gaps = 5/121 (4%)
 Frame = +3

Query  171  RTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIMLPTCFRSVTHLDLSLLSPWGHPLLS  350
            R+RNSA+LV +KWL +ER+TR+ LTLRGN RDL MLP+CFRSVTHLDLSLLSPWGHPLLS
Sbjct  3    RSRNSASLVSKKWLCVERSTRSSLTLRGNARDLFMLPSCFRSVTHLDLSLLSPWGHPLLS  62

Query  351  HANSDAAIATDPALIAHLLRHAFPSVTSLKLYARNPSTLQLLAAQWPQLMKITLVRWHQR  530
             ++       DPAL A LLRH+FP + SL LY+RNP+ +QLLA  WP L  I LVRWHQR
Sbjct  63   SSS-----PPDPALFAQLLRHSFPHLHSLILYSRNPTAIQLLAPHWPTLTHIKLVRWHQR  117

Query  531  P  533
            P
Sbjct  118  P  118



>ref|XP_007214985.1| hypothetical protein PRUPE_ppa002017mg [Prunus persica]
 gb|EMJ16184.1| hypothetical protein PRUPE_ppa002017mg [Prunus persica]
Length=729

 Score =   176 bits (445),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 109/154 (71%), Gaps = 2/154 (1%)
 Frame = +3

Query  108  TNIHDLPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIMLPTC  287
            T I+DLPD ILS +I  +S  RTRNS +L CRK+   ERATRT LTLRGN RDL  LP C
Sbjct  5    TTINDLPDAILSTIIGMVSGTRTRNSLSLACRKFRSTERATRTSLTLRGNARDLPDLPLC  64

Query  288  FRSVTHLDLSLLSPWGHPLLSHANSDAAIATDPALIAHLLRHAFPSVTSLKLYARNPSTL  467
            F +VTHLDLSLLSPWGH LLS   S AA  TDP L+A  LR AFP V SL +Y+R+PST+
Sbjct  65   FAAVTHLDLSLLSPWGHSLLSP--SAAANDTDPLLLAQRLRAAFPFVDSLIVYSRSPSTV  122

Query  468  QLLAAQWPQLMKITLVRWHQRPQLAAGEELGSFF  569
            Q+++  WP L ++ LVRWHQRPQ   G +    F
Sbjct  123  QIVSHLWPGLRRVKLVRWHQRPQSPPGADFDPLF  156



>gb|ACJ09168.1| MAX2-like protein [Citrus trifoliata]
Length=323

 Score =   169 bits (428),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 91/156 (58%), Positives = 106/156 (68%), Gaps = 5/156 (3%)
 Frame = +3

Query  102  APTNIHDLPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIMLP  281
            A T I+DLPDVILSN+ AAIS  R RNS +LV RK+  LERATR  +TLRGN R L M+P
Sbjct  2    AATTINDLPDVILSNICAAISDTRARNSLSLVNRKFHSLERATRNSITLRGNARYLHMIP  61

Query  282  TCFRSVTHLDLSLLSPWGHPLLSHANSDAAIATDPALIAHLLRHAFPSVTSLKLYARNPS  461
             CFRSVT LD+S LSPWGHPLL+         +DP L+AH LR AFP  TSL +Y R P 
Sbjct  62   ICFRSVTDLDISNLSPWGHPLLT-----LPAPSDPLLLAHRLRQAFPLTTSLTIYCRIPL  116

Query  462  TLQLLAAQWPQLMKITLVRWHQRPQLAAGEELGSFF  569
            TL++L  QWP+L  + LVRWHQR Q   G E    F
Sbjct  117  TLEILLPQWPELRHVKLVRWHQRLQAPLGAEFIPLF  152



>gb|AEB37372.1| more axillary branches 2, partial [Helianthus annuus]
Length=228

 Score =   166 bits (420),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 82/121 (68%), Positives = 95/121 (79%), Gaps = 5/121 (4%)
 Frame = +3

Query  171  RTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIMLPTCFRSVTHLDLSLLSPWGHPLLS  350
            R+RNSAALV +KWL +ER+TR+ LTLRGN RDL MLP+CFRSVTHLDLSLLSPWGHPLLS
Sbjct  3    RSRNSAALVSKKWLCVERSTRSSLTLRGNARDLFMLPSCFRSVTHLDLSLLSPWGHPLLS  62

Query  351  HANSDAAIATDPALIAHLLRHAFPSVTSLKLYARNPSTLQLLAAQWPQLMKITLVRWHQR  530
             ++       DPAL A LLRH+FP + SL LY+RNP+ + LLA  WP L  I LVRWHQR
Sbjct  63   SSS-----PPDPALFAQLLRHSFPHLHSLILYSRNPTAIHLLAPHWPTLTHIKLVRWHQR  117

Query  531  P  533
            P
Sbjct  118  P  118



>gb|AEB37370.1| more axillary branches 2, partial [Helianthus annuus]
 gb|AEB37371.1| more axillary branches 2, partial [Helianthus annuus]
 gb|AEB37386.1| more axillary branches 2, partial [Helianthus annuus]
 gb|AEB37387.1| more axillary branches 2, partial [Helianthus annuus]
 gb|AEB37394.1| more axillary branches 2, partial [Helianthus annuus]
 gb|AEB37395.1| more axillary branches 2, partial [Helianthus annuus]
 gb|AEB37396.1| more axillary branches 2, partial [Helianthus annuus]
 gb|AEB37397.1| more axillary branches 2, partial [Helianthus annuus]
 gb|AEB37398.1| more axillary branches 2, partial [Helianthus annuus]
 gb|AEB37399.1| more axillary branches 2, partial [Helianthus annuus]
 gb|AEB37402.1| more axillary branches 2, partial [Helianthus annuus]
 gb|AEB37403.1| more axillary branches 2, partial [Helianthus annuus]
 gb|AEB37404.1| more axillary branches 2, partial [Helianthus annuus]
 gb|AEB37405.1| more axillary branches 2, partial [Helianthus annuus]
Length=219

 Score =   166 bits (419),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 82/121 (68%), Positives = 95/121 (79%), Gaps = 5/121 (4%)
 Frame = +3

Query  171  RTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIMLPTCFRSVTHLDLSLLSPWGHPLLS  350
            R+RNSAALV +KWL +ER+TR+ LTLRGN RDL MLP+CFRSVTHLDLSLLSPWGHPLLS
Sbjct  3    RSRNSAALVSKKWLCVERSTRSSLTLRGNARDLFMLPSCFRSVTHLDLSLLSPWGHPLLS  62

Query  351  HANSDAAIATDPALIAHLLRHAFPSVTSLKLYARNPSTLQLLAAQWPQLMKITLVRWHQR  530
             ++       DPAL A LLRH+FP + SL LY+RNP+ + LLA  WP L  I LVRWHQR
Sbjct  63   SSS-----PPDPALFAQLLRHSFPHLHSLILYSRNPTAIHLLAPHWPTLTHIKLVRWHQR  117

Query  531  P  533
            P
Sbjct  118  P  118



>gb|AEB37348.1| more axillary branches 2, partial [Helianthus annuus]
 gb|AEB37349.1| more axillary branches 2, partial [Helianthus annuus]
 gb|AEB37368.1| more axillary branches 2, partial [Helianthus annuus]
 gb|AEB37369.1| more axillary branches 2, partial [Helianthus annuus]
 gb|AEB37390.1| more axillary branches 2, partial [Helianthus annuus]
 gb|AEB37391.1| more axillary branches 2, partial [Helianthus annuus]
Length=222

 Score =   166 bits (419),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 82/121 (68%), Positives = 95/121 (79%), Gaps = 5/121 (4%)
 Frame = +3

Query  171  RTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIMLPTCFRSVTHLDLSLLSPWGHPLLS  350
            R+RNSAALV +KWL +ER+TR+ LTLRGN RDL MLP+CFRSVTHLDLSLLSPWGHPLLS
Sbjct  3    RSRNSAALVSKKWLCVERSTRSSLTLRGNARDLFMLPSCFRSVTHLDLSLLSPWGHPLLS  62

Query  351  HANSDAAIATDPALIAHLLRHAFPSVTSLKLYARNPSTLQLLAAQWPQLMKITLVRWHQR  530
             ++       DPAL A LLRH+FP + SL LY+RNP+ + LLA  WP L  I LVRWHQR
Sbjct  63   SSS-----PPDPALFAQLLRHSFPHLHSLILYSRNPTAIHLLAPHWPTLTHIKLVRWHQR  117

Query  531  P  533
            P
Sbjct  118  P  118



>gb|AEB37411.1| more axillary branches 2, partial [Helianthus annuus]
Length=221

 Score =   166 bits (419),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 82/121 (68%), Positives = 95/121 (79%), Gaps = 5/121 (4%)
 Frame = +3

Query  171  RTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIMLPTCFRSVTHLDLSLLSPWGHPLLS  350
            R+RNSAALV +KWL +ER+TR+ LTLRGN RDL MLP+CFRSVTHLDLSLLSPWGHPLLS
Sbjct  3    RSRNSAALVSKKWLCVERSTRSSLTLRGNARDLFMLPSCFRSVTHLDLSLLSPWGHPLLS  62

Query  351  HANSDAAIATDPALIAHLLRHAFPSVTSLKLYARNPSTLQLLAAQWPQLMKITLVRWHQR  530
             ++       DPAL A LLRH+FP + SL LY+RNP+ + LLA  WP L  I LVRWHQR
Sbjct  63   SSS-----PPDPALFAQLLRHSFPHLHSLILYSRNPTAIHLLAPHWPTLTHIKLVRWHQR  117

Query  531  P  533
            P
Sbjct  118  P  118



>gb|AEB37376.1| more axillary branches 2, partial [Helianthus annuus]
 gb|AEB37377.1| more axillary branches 2, partial [Helianthus annuus]
 gb|AEB37378.1| more axillary branches 2, partial [Helianthus annuus]
 gb|AEB37379.1| more axillary branches 2, partial [Helianthus annuus]
 gb|AEB37407.1| more axillary branches 2, partial [Helianthus annuus]
 gb|AEB37408.1| more axillary branches 2, partial [Helianthus annuus]
 gb|AEB37412.1| more axillary branches 2, partial [Helianthus annuus]
Length=221

 Score =   166 bits (419),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 82/121 (68%), Positives = 95/121 (79%), Gaps = 5/121 (4%)
 Frame = +3

Query  171  RTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIMLPTCFRSVTHLDLSLLSPWGHPLLS  350
            R+RNSAALV +KWL +ER+TR+ LTLRGN RDL MLP+CFRSVTHLDLSLLSPWGHPLLS
Sbjct  3    RSRNSAALVSKKWLCVERSTRSSLTLRGNARDLFMLPSCFRSVTHLDLSLLSPWGHPLLS  62

Query  351  HANSDAAIATDPALIAHLLRHAFPSVTSLKLYARNPSTLQLLAAQWPQLMKITLVRWHQR  530
             ++       DPAL A LLRH+FP + SL LY+RNP+ + LLA  WP L  I LVRWHQR
Sbjct  63   SSS-----PPDPALFAQLLRHSFPHLHSLILYSRNPTAIHLLAPHWPTLTHIKLVRWHQR  117

Query  531  P  533
            P
Sbjct  118  P  118



>gb|AEB37414.1| more axillary branches 2, partial [Helianthus annuus]
Length=228

 Score =   166 bits (420),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 82/121 (68%), Positives = 95/121 (79%), Gaps = 5/121 (4%)
 Frame = +3

Query  171  RTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIMLPTCFRSVTHLDLSLLSPWGHPLLS  350
            R+RNSAALV +KWL +ER+TR+ LTLRGN RDL MLP+CFRSVTHLDLSLLSPWGHPLLS
Sbjct  3    RSRNSAALVSKKWLCVERSTRSSLTLRGNARDLFMLPSCFRSVTHLDLSLLSPWGHPLLS  62

Query  351  HANSDAAIATDPALIAHLLRHAFPSVTSLKLYARNPSTLQLLAAQWPQLMKITLVRWHQR  530
             ++       DPAL A LLRH+FP + SL LY+RNP+ + LLA  WP L  I LVRWHQR
Sbjct  63   SSS-----PPDPALFAQLLRHSFPHLHSLILYSRNPTAIHLLAPHWPTLTHIKLVRWHQR  117

Query  531  P  533
            P
Sbjct  118  P  118



>gb|AEB37356.1| more axillary branches 2, partial [Helianthus annuus]
 gb|AEB37357.1| more axillary branches 2, partial [Helianthus annuus]
 gb|AEB37358.1| more axillary branches 2, partial [Helianthus annuus]
 gb|AEB37359.1| more axillary branches 2, partial [Helianthus annuus]
 gb|AEB37360.1| more axillary branches 2, partial [Helianthus annuus]
 gb|AEB37361.1| more axillary branches 2, partial [Helianthus annuus]
 gb|AEB37364.1| more axillary branches 2, partial [Helianthus annuus]
 gb|AEB37365.1| more axillary branches 2, partial [Helianthus annuus]
 gb|AEB37373.1| more axillary branches 2, partial [Helianthus annuus]
 gb|AEB37374.1| more axillary branches 2, partial [Helianthus annuus]
 gb|AEB37375.1| more axillary branches 2, partial [Helianthus annuus]
 gb|AEB37380.1| more axillary branches 2, partial [Helianthus annuus]
 gb|AEB37381.1| more axillary branches 2, partial [Helianthus annuus]
 gb|AEB37388.1| more axillary branches 2, partial [Helianthus annuus]
 gb|AEB37389.1| more axillary branches 2, partial [Helianthus annuus]
 gb|AEB37400.1| more axillary branches 2, partial [Helianthus annuus]
 gb|AEB37401.1| more axillary branches 2, partial [Helianthus annuus]
 gb|AEB37406.1| more axillary branches 2, partial [Helianthus annuus]
 gb|AEB37409.1| more axillary branches 2, partial [Helianthus annuus]
 gb|AEB37410.1| more axillary branches 2, partial [Helianthus annuus]
 gb|AEB37413.1| more axillary branches 2, partial [Helianthus annuus]
 gb|AEB37415.1| more axillary branches 2, partial [Helianthus annuus]
 gb|AEB37416.1| more axillary branches 2, partial [Helianthus annuus]
 gb|AEB37417.1| more axillary branches 2, partial [Helianthus annuus]
 gb|AEB37418.1| more axillary branches 2, partial [Helianthus annuus]
 gb|AEB37419.1| more axillary branches 2, partial [Helianthus annuus]
 gb|AEB37420.1| more axillary branches 2, partial [Helianthus annuus]
 gb|AEB37421.1| more axillary branches 2, partial [Helianthus annuus]
 gb|AEB37422.1| more axillary branches 2, partial [Helianthus annuus]
Length=228

 Score =   166 bits (419),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 82/121 (68%), Positives = 95/121 (79%), Gaps = 5/121 (4%)
 Frame = +3

Query  171  RTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIMLPTCFRSVTHLDLSLLSPWGHPLLS  350
            R+RNSAALV +KWL +ER+TR+ LTLRGN RDL MLP+CFRSVTHLDLSLLSPWGHPLLS
Sbjct  3    RSRNSAALVSKKWLCVERSTRSSLTLRGNARDLFMLPSCFRSVTHLDLSLLSPWGHPLLS  62

Query  351  HANSDAAIATDPALIAHLLRHAFPSVTSLKLYARNPSTLQLLAAQWPQLMKITLVRWHQR  530
             ++       DPAL A LLRH+FP + SL LY+RNP+ + LLA  WP L  I LVRWHQR
Sbjct  63   SSS-----PPDPALFAQLLRHSFPHLHSLILYSRNPTAIHLLAPHWPTLTHIKLVRWHQR  117

Query  531  P  533
            P
Sbjct  118  P  118



>gb|AEB37346.1| more axillary branches 2, partial [Helianthus annuus]
 gb|AEB37347.1| more axillary branches 2, partial [Helianthus annuus]
Length=226

 Score =   166 bits (419),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 82/121 (68%), Positives = 95/121 (79%), Gaps = 5/121 (4%)
 Frame = +3

Query  171  RTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIMLPTCFRSVTHLDLSLLSPWGHPLLS  350
            R+RNSAALV +KWL +ER+TR+ LTLRGN RDL MLP+CFRSVTHLDLSLLSPWGHPLLS
Sbjct  3    RSRNSAALVSKKWLCVERSTRSSLTLRGNARDLFMLPSCFRSVTHLDLSLLSPWGHPLLS  62

Query  351  HANSDAAIATDPALIAHLLRHAFPSVTSLKLYARNPSTLQLLAAQWPQLMKITLVRWHQR  530
             ++       DPAL A LLRH+FP + SL LY+RNP+ + LLA  WP L  I LVRWHQR
Sbjct  63   SSS-----PPDPALFAQLLRHSFPHLHSLILYSRNPTAIHLLAPHWPTLTHIKLVRWHQR  117

Query  531  P  533
            P
Sbjct  118  P  118



>gb|AEB37392.1| more axillary branches 2, partial [Helianthus annuus]
 gb|AEB37393.1| more axillary branches 2, partial [Helianthus annuus]
Length=225

 Score =   166 bits (419),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 82/121 (68%), Positives = 95/121 (79%), Gaps = 5/121 (4%)
 Frame = +3

Query  171  RTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIMLPTCFRSVTHLDLSLLSPWGHPLLS  350
            R+RNSAALV +KWL +ER+TR+ LTLRGN RDL MLP+CFRSVTHLDLSLLSPWGHPLLS
Sbjct  3    RSRNSAALVSKKWLCVERSTRSSLTLRGNARDLFMLPSCFRSVTHLDLSLLSPWGHPLLS  62

Query  351  HANSDAAIATDPALIAHLLRHAFPSVTSLKLYARNPSTLQLLAAQWPQLMKITLVRWHQR  530
             ++       DPAL A LLRH+FP + SL LY+RNP+ + LLA  WP L  I LVRWHQR
Sbjct  63   SSS-----PPDPALFAQLLRHSFPHLHSLILYSRNPTAIHLLAPHWPTLTHIKLVRWHQR  117

Query  531  P  533
            P
Sbjct  118  P  118



>gb|AEB37362.1| more axillary branches 2, partial [Helianthus annuus]
 gb|AEB37363.1| more axillary branches 2, partial [Helianthus annuus]
Length=233

 Score =   166 bits (420),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 82/121 (68%), Positives = 95/121 (79%), Gaps = 5/121 (4%)
 Frame = +3

Query  171  RTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIMLPTCFRSVTHLDLSLLSPWGHPLLS  350
            R+RNSAALV +KWL +ER+TR+ LTLRGN RDL MLP+CFRSVTHLDLSLLSPWGHPLLS
Sbjct  3    RSRNSAALVSKKWLCVERSTRSSLTLRGNARDLFMLPSCFRSVTHLDLSLLSPWGHPLLS  62

Query  351  HANSDAAIATDPALIAHLLRHAFPSVTSLKLYARNPSTLQLLAAQWPQLMKITLVRWHQR  530
             ++       DPAL A LLRH+FP + SL LY+RNP+ + LLA  WP L  I LVRWHQR
Sbjct  63   SSS-----PPDPALFAQLLRHSFPHLHSLILYSRNPTAIHLLAPHWPTLTHIKLVRWHQR  117

Query  531  P  533
            P
Sbjct  118  P  118



>gb|AEB37382.1| more axillary branches 2, partial [Helianthus annuus]
 gb|AEB37383.1| more axillary branches 2, partial [Helianthus annuus]
 gb|AEB37384.1| more axillary branches 2, partial [Helianthus annuus]
 gb|AEB37385.1| more axillary branches 2, partial [Helianthus annuus]
Length=246

 Score =   166 bits (420),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 82/121 (68%), Positives = 95/121 (79%), Gaps = 5/121 (4%)
 Frame = +3

Query  171  RTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIMLPTCFRSVTHLDLSLLSPWGHPLLS  350
            R+RNSAALV +KWL +ER+TR+ LTLRGN RDL MLP+CFRSVTHLDLSLLSPWGHPLLS
Sbjct  3    RSRNSAALVSKKWLCVERSTRSSLTLRGNARDLFMLPSCFRSVTHLDLSLLSPWGHPLLS  62

Query  351  HANSDAAIATDPALIAHLLRHAFPSVTSLKLYARNPSTLQLLAAQWPQLMKITLVRWHQR  530
             ++       DPAL A LLRH+FP + SL LY+RNP+ + LLA  WP L  I LVRWHQR
Sbjct  63   SSS-----PPDPALFAQLLRHSFPHLHSLILYSRNPTAIHLLAPHWPTLTHIKLVRWHQR  117

Query  531  P  533
            P
Sbjct  118  P  118



>gb|AEB37335.1| more axillary branches 2, partial [Helianthus tuberosus]
Length=217

 Score =   165 bits (417),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 81/121 (67%), Positives = 96/121 (79%), Gaps = 5/121 (4%)
 Frame = +3

Query  171  RTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIMLPTCFRSVTHLDLSLLSPWGHPLLS  350
            R+RNSA+LV +KWL +ER+TR+ LTLRGN RDL MLP+CFRSVTHLDLSLLSPWGHPLLS
Sbjct  3    RSRNSASLVSKKWLCVERSTRSSLTLRGNARDLFMLPSCFRSVTHLDLSLLSPWGHPLLS  62

Query  351  HANSDAAIATDPALIAHLLRHAFPSVTSLKLYARNPSTLQLLAAQWPQLMKITLVRWHQR  530
             ++       DPAL+A LLRH+FP + SL LY+RNP+ + LLA  WP L  I LVRWHQR
Sbjct  63   SSS-----PPDPALLAQLLRHSFPHLHSLILYSRNPTAIHLLAPHWPTLTHIKLVRWHQR  117

Query  531  P  533
            P
Sbjct  118  P  118



>gb|AEB37318.1| more axillary branches 2, partial [Helianthus petiolaris]
 gb|AEB37319.1| more axillary branches 2, partial [Helianthus petiolaris]
Length=239

 Score =   165 bits (418),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 81/121 (67%), Positives = 95/121 (79%), Gaps = 5/121 (4%)
 Frame = +3

Query  171  RTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIMLPTCFRSVTHLDLSLLSPWGHPLLS  350
            R+RNSA+LV +KWL +ER+TR+ LTLRGN RDL MLP+CFRSVTHLDLSLLSPWGHPLLS
Sbjct  3    RSRNSASLVSKKWLYVERSTRSSLTLRGNARDLFMLPSCFRSVTHLDLSLLSPWGHPLLS  62

Query  351  HANSDAAIATDPALIAHLLRHAFPSVTSLKLYARNPSTLQLLAAQWPQLMKITLVRWHQR  530
             ++       DPAL A LLRH+FP + SL LY+RNP+ + LLA  WP L  I LVRWHQR
Sbjct  63   SSS-----PPDPALFAQLLRHSFPHLHSLILYSRNPTAIHLLAPHWPTLTHIKLVRWHQR  117

Query  531  P  533
            P
Sbjct  118  P  118



>gb|AEB37322.1| more axillary branches 2, partial [Helianthus petiolaris]
Length=228

 Score =   165 bits (417),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 81/121 (67%), Positives = 95/121 (79%), Gaps = 5/121 (4%)
 Frame = +3

Query  171  RTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIMLPTCFRSVTHLDLSLLSPWGHPLLS  350
            R+RNSA+LV +KWL +ER+TR+ LTLRGN RDL MLP+CFRSVTHLDLSLLSPWGHPLLS
Sbjct  3    RSRNSASLVSKKWLYVERSTRSSLTLRGNARDLFMLPSCFRSVTHLDLSLLSPWGHPLLS  62

Query  351  HANSDAAIATDPALIAHLLRHAFPSVTSLKLYARNPSTLQLLAAQWPQLMKITLVRWHQR  530
             ++       DPAL A LLRH+FP + SL LY+RNP+ + LLA  WP L  I LVRWHQR
Sbjct  63   SSS-----PPDPALFAQLLRHSFPHLHSLILYSRNPTAIHLLAPHWPTLTHIKLVRWHQR  117

Query  531  P  533
            P
Sbjct  118  P  118



>gb|AEB37323.1| more axillary branches 2, partial [Helianthus petiolaris]
Length=228

 Score =   165 bits (417),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 81/121 (67%), Positives = 95/121 (79%), Gaps = 5/121 (4%)
 Frame = +3

Query  171  RTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIMLPTCFRSVTHLDLSLLSPWGHPLLS  350
            R+RNSA+LV +KWL +ER+TR+ LTLRGN RDL MLP+CFRSVTHLDLSLLSPWGHPLLS
Sbjct  3    RSRNSASLVSKKWLYVERSTRSSLTLRGNARDLFMLPSCFRSVTHLDLSLLSPWGHPLLS  62

Query  351  HANSDAAIATDPALIAHLLRHAFPSVTSLKLYARNPSTLQLLAAQWPQLMKITLVRWHQR  530
             ++       DPAL A LLRH+FP + SL LY+RNP+ + LLA  WP L  I LVRWHQR
Sbjct  63   SSS-----PPDPALFAQLLRHSFPHLHSLILYSRNPTAIHLLAPHWPXLTHIKLVRWHQR  117

Query  531  P  533
            P
Sbjct  118  P  118



>gb|AEB37336.1| more axillary branches 2, partial [Helianthus tuberosus]
 gb|AEB37337.1| more axillary branches 2, partial [Helianthus tuberosus]
Length=228

 Score =   164 bits (416),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 81/121 (67%), Positives = 96/121 (79%), Gaps = 5/121 (4%)
 Frame = +3

Query  171  RTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIMLPTCFRSVTHLDLSLLSPWGHPLLS  350
            R+RNSA+LV +KWL +ER+TR+ LTLRGN RDL MLP+CFRSVTHLDLSLLSPWGHPLLS
Sbjct  3    RSRNSASLVSKKWLCVERSTRSSLTLRGNARDLFMLPSCFRSVTHLDLSLLSPWGHPLLS  62

Query  351  HANSDAAIATDPALIAHLLRHAFPSVTSLKLYARNPSTLQLLAAQWPQLMKITLVRWHQR  530
             ++       DPAL+A LLRH+FP + SL LY+RNP+ + LLA  WP L  I LVRWHQR
Sbjct  63   SSS-----PPDPALLAQLLRHSFPHLHSLILYSRNPTAIHLLAPHWPTLTHIKLVRWHQR  117

Query  531  P  533
            P
Sbjct  118  P  118



>gb|AEB37321.1| more axillary branches 2, partial [Helianthus petiolaris]
Length=235

 Score =   165 bits (417),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 81/121 (67%), Positives = 95/121 (79%), Gaps = 5/121 (4%)
 Frame = +3

Query  171  RTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIMLPTCFRSVTHLDLSLLSPWGHPLLS  350
            R+RNSA+LV +KWL +ER+TR+ LTLRGN RDL MLP+CFRSVTHLDLSLLSPWGHPLLS
Sbjct  3    RSRNSASLVSKKWLYVERSTRSSLTLRGNARDLFMLPSCFRSVTHLDLSLLSPWGHPLLS  62

Query  351  HANSDAAIATDPALIAHLLRHAFPSVTSLKLYARNPSTLQLLAAQWPQLMKITLVRWHQR  530
             ++       DPAL A LLRH+FP + SL LY+RNP+ + LLA  WP L  I LVRWHQR
Sbjct  63   SSS-----PPDPALFAQLLRHSFPHLHSLILYSRNPTAIHLLAPHWPTLTHIKLVRWHQR  117

Query  531  P  533
            P
Sbjct  118  P  118



>gb|AEB37320.1| more axillary branches 2, partial [Helianthus petiolaris]
Length=235

 Score =   165 bits (417),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 81/121 (67%), Positives = 95/121 (79%), Gaps = 5/121 (4%)
 Frame = +3

Query  171  RTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIMLPTCFRSVTHLDLSLLSPWGHPLLS  350
            R+RNSA+LV +KWL +ER+TR+ LTLRGN RDL MLP+CFRSVTHLDLSLLSPWGHPLLS
Sbjct  3    RSRNSASLVSKKWLYVERSTRSSLTLRGNARDLFMLPSCFRSVTHLDLSLLSPWGHPLLS  62

Query  351  HANSDAAIATDPALIAHLLRHAFPSVTSLKLYARNPSTLQLLAAQWPQLMKITLVRWHQR  530
             ++       DPAL A LLRH+FP + SL LY+RNP+ + LLA  WP L  I LVRWHQR
Sbjct  63   SSS-----PPDPALFAQLLRHSFPHLHSLILYSRNPTAIHLLAPHWPTLTHIKLVRWHQR  117

Query  531  P  533
            P
Sbjct  118  P  118



>gb|AEB37328.1| more axillary branches 2, partial [Helianthus exilis]
 gb|AEB37329.1| more axillary branches 2, partial [Helianthus exilis]
Length=226

 Score =   164 bits (416),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 81/121 (67%), Positives = 95/121 (79%), Gaps = 5/121 (4%)
 Frame = +3

Query  171  RTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIMLPTCFRSVTHLDLSLLSPWGHPLLS  350
            R+RNSA+LV +KWL +ER+TR+ LTLRGN RDL MLP+CFRSVTHLDLSLLSPWGHPLLS
Sbjct  3    RSRNSASLVSKKWLCVERSTRSSLTLRGNARDLFMLPSCFRSVTHLDLSLLSPWGHPLLS  62

Query  351  HANSDAAIATDPALIAHLLRHAFPSVTSLKLYARNPSTLQLLAAQWPQLMKITLVRWHQR  530
             ++       DPAL A LLRH+FP + SL LY+RNP+ + LLA  WP L  I LVRWHQR
Sbjct  63   SSS-----PPDPALFAQLLRHSFPHLHSLILYSRNPTAIHLLAPHWPTLTHIKLVRWHQR  117

Query  531  P  533
            P
Sbjct  118  P  118



>gb|AEB37326.1| more axillary branches 2, partial [Helianthus exilis]
 gb|AEB37327.1| more axillary branches 2, partial [Helianthus exilis]
Length=228

 Score =   164 bits (416),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 81/121 (67%), Positives = 95/121 (79%), Gaps = 5/121 (4%)
 Frame = +3

Query  171  RTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIMLPTCFRSVTHLDLSLLSPWGHPLLS  350
            R+RNSA+LV +KWL +ER+TR+ LTLRGN RDL MLP+CFRSVTHLDLSLLSPWGHPLLS
Sbjct  3    RSRNSASLVSKKWLCVERSTRSSLTLRGNARDLFMLPSCFRSVTHLDLSLLSPWGHPLLS  62

Query  351  HANSDAAIATDPALIAHLLRHAFPSVTSLKLYARNPSTLQLLAAQWPQLMKITLVRWHQR  530
             ++       DPAL A LLRH+FP + SL LY+RNP+ + LLA  WP L  I LVRWHQR
Sbjct  63   SSS-----PPDPALFAQLLRHSFPHLHSLILYSRNPTAIHLLAPHWPTLTHIKLVRWHQR  117

Query  531  P  533
            P
Sbjct  118  P  118



>gb|AEB37330.1| more axillary branches 2, partial [Helianthus exilis]
 gb|AEB37331.1| more axillary branches 2, partial [Helianthus exilis]
Length=225

 Score =   164 bits (416),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 81/121 (67%), Positives = 95/121 (79%), Gaps = 5/121 (4%)
 Frame = +3

Query  171  RTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIMLPTCFRSVTHLDLSLLSPWGHPLLS  350
            R+RNSA+LV +KWL +ER+TR+ LTLRGN RDL MLP+CFRSVTHLDLSLLSPWGHPLLS
Sbjct  3    RSRNSASLVSKKWLCVERSTRSSLTLRGNARDLFMLPSCFRSVTHLDLSLLSPWGHPLLS  62

Query  351  HANSDAAIATDPALIAHLLRHAFPSVTSLKLYARNPSTLQLLAAQWPQLMKITLVRWHQR  530
             ++       DPAL A LLRH+FP + SL LY+RNP+ + LLA  WP L  I LVRWHQR
Sbjct  63   SSS-----PPDPALFAQLLRHSFPHLHSLILYSRNPTAIHLLAPHWPTLTHIKLVRWHQR  117

Query  531  P  533
            P
Sbjct  118  P  118



>gb|AEB37338.1| more axillary branches 2, partial [Helianthus argophyllus]
 gb|AEB37339.1| more axillary branches 2, partial [Helianthus argophyllus]
Length=228

 Score =   163 bits (413),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 95/121 (79%), Gaps = 5/121 (4%)
 Frame = +3

Query  171  RTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIMLPTCFRSVTHLDLSLLSPWGHPLLS  350
            R+RNSA+LV +KWL +ER+TR+ LTLRGN RDL MLP+CFRSV+HLDLSLLSPWGHPLLS
Sbjct  3    RSRNSASLVSKKWLCVERSTRSSLTLRGNARDLFMLPSCFRSVSHLDLSLLSPWGHPLLS  62

Query  351  HANSDAAIATDPALIAHLLRHAFPSVTSLKLYARNPSTLQLLAAQWPQLMKITLVRWHQR  530
             ++       DPAL A LLRH+FP + SL LY+RNP+ + LLA  WP L  I LVRWHQR
Sbjct  63   SSS-----PPDPALFAQLLRHSFPHLHSLILYSRNPTAIHLLAPHWPTLTHIKLVRWHQR  117

Query  531  P  533
            P
Sbjct  118  P  118



>ref|XP_010277014.1| PREDICTED: F-box/LRR-repeat MAX2 homolog A [Nelumbo nucifera]
Length=696

 Score =   172 bits (435),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 88/139 (63%), Positives = 101/139 (73%), Gaps = 10/139 (7%)
 Frame = +3

Query  114  IHDLPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIMLPTCFR  293
             HDLPDVILSN+ A +   RTRN+ +LVCRKWL+LER+TRT +TLRG VRDL ++PT FR
Sbjct  8    FHDLPDVILSNIFALVVDTRTRNAMSLVCRKWLLLERSTRTSITLRGKVRDLFLIPTSFR  67

Query  294  SVTHLDLSLLSPWGHPLLSHANSDAAIATDPALIAHLLRHAFPSVTSLKLYARNPSTLQL  473
            +VTHLDLSLLSPWG   L  +           L+A LLR AFP VTSL LYAR PSTL L
Sbjct  68   AVTHLDLSLLSPWGQSPLDSS----------PLLAQLLRQAFPLVTSLTLYARTPSTLLL  117

Query  474  LAAQWPQLMKITLVRWHQR  530
            LA QWP L  + LVRWHQR
Sbjct  118  LAPQWPSLRHVKLVRWHQR  136



>ref|XP_008229121.1| PREDICTED: F-box/LRR-repeat MAX2 homolog A-like [Prunus mume]
Length=796

 Score =   171 bits (434),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 107/154 (69%), Gaps = 2/154 (1%)
 Frame = +3

Query  108  TNIHDLPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIMLPTC  287
            T I+DLPD ILS +I  +S  RTRNS +L CRK+   ERATRT LTLRGN RDL  LP C
Sbjct  70   TTINDLPDAILSTIIGIVSDTRTRNSLSLACRKFRSTERATRTSLTLRGNARDLPYLPLC  129

Query  288  FRSVTHLDLSLLSPWGHPLLSHANSDAAIATDPALIAHLLRHAFPSVTSLKLYARNPSTL  467
            F +VTHLDLSL SPWGH LL    S AA  TDP L+A  LR AFP V SL +Y+R+PST+
Sbjct  130  FAAVTHLDLSLPSPWGHSLL--FPSAAANDTDPLLLAQRLRAAFPFVDSLIVYSRSPSTV  187

Query  468  QLLAAQWPQLMKITLVRWHQRPQLAAGEELGSFF  569
            Q+++  WP L ++ LVRWHQRPQ   G +    F
Sbjct  188  QIVSHLWPGLRRVKLVRWHQRPQSPPGADFDPLF  221



>ref|XP_006446795.1| hypothetical protein CICLE_v10014472mg [Citrus clementina]
 gb|ESR60035.1| hypothetical protein CICLE_v10014472mg [Citrus clementina]
Length=694

 Score =   170 bits (431),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 92/156 (59%), Positives = 107/156 (69%), Gaps = 5/156 (3%)
 Frame = +3

Query  102  APTNIHDLPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIMLP  281
            A T I++LPDVILSN+ AAIS  R RNS +LV RK+  LERATRT +TLRGN R L M+P
Sbjct  2    AATTINNLPDVILSNICAAISDTRARNSLSLVNRKFHSLERATRTSITLRGNARYLHMIP  61

Query  282  TCFRSVTHLDLSLLSPWGHPLLSHANSDAAIATDPALIAHLLRHAFPSVTSLKLYARNPS  461
             CFRSVT LD+S LSPWGHPLL+         +DP L+AH LR AFP  TSL +Y R PS
Sbjct  62   ICFRSVTDLDISNLSPWGHPLLT-----LPTPSDPLLLAHRLRQAFPLTTSLTIYCRIPS  116

Query  462  TLQLLAAQWPQLMKITLVRWHQRPQLAAGEELGSFF  569
            TL++L  QWP L  + LVRWHQR Q   G E    F
Sbjct  117  TLEILLPQWPGLRHVKLVRWHQRLQAPLGAEFIPLF  152



>ref|XP_011033739.1| PREDICTED: F-box protein MAX2 [Populus euphratica]
Length=701

 Score =   169 bits (428),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 89/140 (64%), Positives = 107/140 (76%), Gaps = 7/140 (5%)
 Frame = +3

Query  114  IHDLPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIMLPTCFR  293
            ++DLPDVILS + +A+S  RTRNS +LV RK+L LER+TRT LTLRG  RD+ M+PTCFR
Sbjct  12   MNDLPDVILSIIFSAVSDTRTRNSLSLVNRKFLALERSTRTSLTLRGKARDIYMIPTCFR  71

Query  294  SVTHLDLSLLSPWGHP-LLSHANSDAAIATDPALIAHLLRHAFPSVTSLKLYARNPSTLQ  470
            SVTHLDLSLLSPWG   LLS A+S      DP L+A+ LR AFP VTSL +YAR+PSTL 
Sbjct  72   SVTHLDLSLLSPWGRSDLLSTASS------DPFLLAYRLRLAFPLVTSLTVYARSPSTLH  125

Query  471  LLAAQWPQLMKITLVRWHQR  530
            +L  QWP L  + L+RWHQR
Sbjct  126  ILLPQWPNLSHVKLIRWHQR  145



>gb|AEB37345.1| more axillary branches 2, partial [Helianthus argophyllus]
Length=225

 Score =   160 bits (406),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/120 (66%), Positives = 93/120 (78%), Gaps = 5/120 (4%)
 Frame = +3

Query  174  TRNSAALVCRKWLVLERATRTCLTLRGNVRDLIMLPTCFRSVTHLDLSLLSPWGHPLLSH  353
            +RNSA LV +KWL +ER+TR+ LTLRGN RDL MLP+CFRSV+HLDLSLLSPWGHPLLS 
Sbjct  1    SRNSAXLVSKKWLCVERSTRSSLTLRGNARDLFMLPSCFRSVSHLDLSLLSPWGHPLLSS  60

Query  354  ANSDAAIATDPALIAHLLRHAFPSVTSLKLYARNPSTLQLLAAQWPQLMKITLVRWHQRP  533
            ++       DPAL A LLRH+FP + SL LY+RNP+ + LLA  WP L  I LVRWHQRP
Sbjct  61   SS-----PPDPALFAQLLRHSFPHLHSLILYSRNPTAIHLLAPHWPTLTHIKLVRWHQRP  115



>ref|XP_011039437.1| PREDICTED: F-box/LRR-repeat MAX2 homolog A-like [Populus euphratica]
Length=693

 Score =   169 bits (427),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 80/152 (53%), Positives = 108/152 (71%), Gaps = 7/152 (5%)
 Frame = +3

Query  114  IHDLPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIMLPTCFR  293
             HD+P+ ILS++ + I+  R+RN+ +LVC KW ++ER+TRTCL+LRGN+RDL +LPTCFR
Sbjct  11   FHDIPEAILSSIFSLITDTRSRNAMSLVCLKWHLMERSTRTCLSLRGNIRDLFLLPTCFR  70

Query  294  SVTHLDLSLLSPWGHPLLSHANSDAAIATDPALIAHLLRHAFPSVTSLKLYARNPSTLQL  473
            SVT+LDLSL+SPWG P+L         + +  L+A +L   FPSV +L +YARNPS L L
Sbjct  71   SVTNLDLSLVSPWGRPILDS-------SPNTTLLAQVLHCTFPSVVTLTVYARNPSILHL  123

Query  474  LAAQWPQLMKITLVRWHQRPQLAAGEELGSFF  569
            LA QWP L +I LVRWH+R     G +  + F
Sbjct  124  LAPQWPNLRQIKLVRWHKRSPTTLGSDFLALF  155



>ref|XP_006468201.1| PREDICTED: F-box/LRR-repeat MAX2 homolog A-like [Citrus sinensis]
Length=714

 Score =   168 bits (426),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 84/164 (51%), Positives = 111/164 (68%), Gaps = 9/164 (5%)
 Frame = +3

Query  81   ASTVRLHAPTNIHD-LPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGN  257
            A+T  +  P N HD LPD I+SN+ + I+  RTRN+ +LVC KW  LER+TR  L LRGN
Sbjct  2    AATTVIKVP-NFHDILPDAIMSNIFSLITDTRTRNAMSLVCLKWCKLERSTRKSLALRGN  60

Query  258  VRDLIMLPTCFRSVTHLDLSLLSPWGHPLLSHANSDAAIATDPALIAHLLRHAFPSVTSL  437
            +RDL  +P CF+++ +LDLS LSPWGHPLL         +++P+L+A LL HAFPSV SL
Sbjct  61   IRDLNQVPVCFQAINNLDLSCLSPWGHPLLES-------SSNPSLLAKLLSHAFPSVVSL  113

Query  438  KLYARNPSTLQLLAAQWPQLMKITLVRWHQRPQLAAGEELGSFF  569
             +YAR+P TL  LA +WP+L  + LVRWHQR     G +  + F
Sbjct  114  TIYARSPLTLHFLAPEWPKLSHVKLVRWHQRFNAPIGYDFFALF  157



>ref|XP_010920116.1| PREDICTED: F-box/LRR-repeat MAX2 homolog A-like [Elaeis guineensis]
Length=738

 Score =   168 bits (426),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 89/152 (59%), Positives = 102/152 (67%), Gaps = 7/152 (5%)
 Frame = +3

Query  99   HAPTNIHDLPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIML  278
               T++HDLP+ ILSN+ A +   RTRN  ALVCR+W  LER TR+ L LRGNVRDL +L
Sbjct  4    EGETHLHDLPEAILSNLFALVEDTRTRNRMALVCRRWYTLERFTRSSLCLRGNVRDLFLL  63

Query  279  PTCFRSVTHLDLSLLSPWGHPLL-------SHANSDAAIATDPALIAHLLRHAFPSVTSL  437
            PTCF SVTHLDLS LSPWGHP L          +  A       LIA LL  AFP++TSL
Sbjct  64   PTCFASVTHLDLSHLSPWGHPFLLHHHHHHQREHPTAEEQQQHHLIALLLCRAFPNLTSL  123

Query  438  KLYARNPSTLQLLAAQWPQLMKITLVRWHQRP  533
             +YAR+PSTLQ LA QWP L    LVRWHQRP
Sbjct  124  TVYARHPSTLQALAPQWPALRHAKLVRWHQRP  155



>ref|XP_002317419.1| hypothetical protein POPTR_0011s07320g [Populus trichocarpa]
 gb|EEE98031.1| hypothetical protein POPTR_0011s07320g [Populus trichocarpa]
Length=671

 Score =   168 bits (425),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 111/159 (70%), Gaps = 7/159 (4%)
 Frame = +3

Query  93   RLHAPTNIHDLPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGNVRDLI  272
            + +   + HD+PD ILS++ + I+  R+RN+ +LVC KW ++ER+TRTCL+LRGN+RDL 
Sbjct  4    KFNTNVHFHDIPDAILSSIFSLITDTRSRNAMSLVCLKWHLIERSTRTCLSLRGNIRDLF  63

Query  273  MLPTCFRSVTHLDLSLLSPWGHPLLSHANSDAAIATDPALIAHLLRHAFPSVTSLKLYAR  452
            +LPTCFR+V++LDLSL+SPWG P+L         + +  L+A +L   FPSV +L +YAR
Sbjct  64   LLPTCFRAVSNLDLSLVSPWGRPILDS-------SPNTTLLAQVLHCTFPSVVTLTVYAR  116

Query  453  NPSTLQLLAAQWPQLMKITLVRWHQRPQLAAGEELGSFF  569
            NPS L LLA QWP L +I LVRWH+R     G +  + F
Sbjct  117  NPSILHLLAPQWPNLRQIKLVRWHKRSPTTLGSDFLALF  155



>gb|AEB37344.1| more axillary branches 2, partial [Helianthus argophyllus]
Length=225

 Score =   160 bits (404),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 79/120 (66%), Positives = 92/120 (77%), Gaps = 5/120 (4%)
 Frame = +3

Query  174  TRNSAALVCRKWLVLERATRTCLTLRGNVRDLIMLPTCFRSVTHLDLSLLSPWGHPLLSH  353
            +RNSA LV +KWL +ER+TR+ LTLRGN RDL MLP+CFRSV HLDLSLLSPWGHPLLS 
Sbjct  1    SRNSAXLVSKKWLCVERSTRSSLTLRGNARDLFMLPSCFRSVXHLDLSLLSPWGHPLLSS  60

Query  354  ANSDAAIATDPALIAHLLRHAFPSVTSLKLYARNPSTLQLLAAQWPQLMKITLVRWHQRP  533
            ++       DPAL A LLRH+FP + SL LY+RNP+ + LLA  WP L  I LVRWHQRP
Sbjct  61   SS-----PPDPALFAQLLRHSFPHLHSLILYSRNPTAIHLLAPHWPTLTHIKLVRWHQRP  115



>ref|XP_009370527.1| PREDICTED: F-box/LRR-repeat MAX2 homolog A [Pyrus x bretschneideri]
Length=713

 Score =   167 bits (424),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 86/154 (56%), Positives = 107/154 (69%), Gaps = 4/154 (3%)
 Frame = +3

Query  108  TNIHDLPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIMLPTC  287
            T I+DLP+VILS +I  +S  RTRNS +LVC+K+  +ERATR  LTLRGN RDL  +P C
Sbjct  3    TTINDLPEVILSAIITLVSDTRTRNSLSLVCKKFRSMERATRASLTLRGNARDLHRIPIC  62

Query  288  FRSVTHLDLSLLSPWGHPLLSHANSDAAIATDPALIAHLLRHAFPSVTSLKLYARNPSTL  467
            F +V  LDLSLLSPWGH LLS     +A  TDP L+A  LR AFPSVTSL +Y+R+P T+
Sbjct  63   FTAVDQLDLSLLSPWGHALLSP----SAATTDPLLLAQCLREAFPSVTSLTVYSRSPYTV  118

Query  468  QLLAAQWPQLMKITLVRWHQRPQLAAGEELGSFF  569
            Q ++  WP L ++ LVRWHQRP    G +    F
Sbjct  119  QNVSRLWPGLRRVKLVRWHQRPHSPPGADFVPLF  152



>ref|XP_006469010.1| PREDICTED: F-box/LRR-repeat MAX2 homolog A-like [Citrus sinensis]
Length=694

 Score =   167 bits (424),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 91/156 (58%), Positives = 106/156 (68%), Gaps = 5/156 (3%)
 Frame = +3

Query  102  APTNIHDLPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIMLP  281
            A T I++LPDVILSN+ AAIS  R RNS +LV RK+  LERATRT +TLRGN R L M+P
Sbjct  2    AATTINNLPDVILSNICAAISDTRARNSLSLVNRKFHSLERATRTSITLRGNARYLHMIP  61

Query  282  TCFRSVTHLDLSLLSPWGHPLLSHANSDAAIATDPALIAHLLRHAFPSVTSLKLYARNPS  461
             CFRSVT LD+S LSPWGHPLL+         +DP L+AH LR AFP  TSL +Y R P 
Sbjct  62   ICFRSVTDLDISNLSPWGHPLLT-----LPTPSDPLLLAHRLRQAFPLTTSLTIYCRIPL  116

Query  462  TLQLLAAQWPQLMKITLVRWHQRPQLAAGEELGSFF  569
            TL++L  QWP L  + LVRWHQR Q   G E    F
Sbjct  117  TLEILLPQWPGLRHVKLVRWHQRLQAPLGAEFIPLF  152



>gb|KDO77865.1| hypothetical protein CISIN_1g044164mg [Citrus sinensis]
Length=714

 Score =   167 bits (422),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 81/154 (53%), Positives = 106/154 (69%), Gaps = 8/154 (5%)
 Frame = +3

Query  111  NIHD-LPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIMLPTC  287
            N HD LPD I+SN+ + I+  RTRN+ +LVC KW  LER+TR  L LRGN+RDL  +P C
Sbjct  11   NFHDILPDAIMSNIFSLITDTRTRNAMSLVCLKWCKLERSTRKSLALRGNIRDLNQVPVC  70

Query  288  FRSVTHLDLSLLSPWGHPLLSHANSDAAIATDPALIAHLLRHAFPSVTSLKLYARNPSTL  467
            F+++ +LDLS LSPWGHPLL         +++P+L+A LL HAFPSV SL +YAR+P TL
Sbjct  71   FQAINNLDLSCLSPWGHPLLES-------SSNPSLLAKLLSHAFPSVVSLTIYARSPLTL  123

Query  468  QLLAAQWPQLMKITLVRWHQRPQLAAGEELGSFF  569
              LA +WP+L  + LVRWHQR     G +  + F
Sbjct  124  HFLAPEWPKLSHVKLVRWHQRFNAPIGYDFFALF  157



>gb|AEB37352.1| more axillary branches 2, partial [Helianthus annuus]
 gb|AEB37353.1| more axillary branches 2, partial [Helianthus annuus]
Length=227

 Score =   159 bits (401),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 79/117 (68%), Positives = 91/117 (78%), Gaps = 5/117 (4%)
 Frame = +3

Query  183  SAALVCRKWLVLERATRTCLTLRGNVRDLIMLPTCFRSVTHLDLSLLSPWGHPLLSHANS  362
            SAALV +KWL +ER+TR+ LTLRGN RDL MLP+CFRSVTHLDLSLLSPWGHPLLS ++ 
Sbjct  1    SAALVSKKWLCVERSTRSSLTLRGNARDLFMLPSCFRSVTHLDLSLLSPWGHPLLSSSS-  59

Query  363  DAAIATDPALIAHLLRHAFPSVTSLKLYARNPSTLQLLAAQWPQLMKITLVRWHQRP  533
                  DPAL A LLRH+FP + SL LY+RNP+ + LLA  WP L  I LVRWHQRP
Sbjct  60   ----PPDPALFAQLLRHSFPHLHSLILYSRNPTAIHLLAPHWPTLTHIKLVRWHQRP  112



>ref|XP_006449508.1| hypothetical protein CICLE_v10017759mg [Citrus clementina]
 gb|ESR62748.1| hypothetical protein CICLE_v10017759mg [Citrus clementina]
Length=690

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 80/154 (52%), Positives = 106/154 (69%), Gaps = 8/154 (5%)
 Frame = +3

Query  111  NIHD-LPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIMLPTC  287
            N HD LPD I+SN+ + ++  RTRN+ +LVC KW  LER+TR  L LRGN+RDL  +P C
Sbjct  11   NFHDMLPDAIMSNIFSLVTDTRTRNAMSLVCLKWCKLERSTRKSLALRGNIRDLNQVPVC  70

Query  288  FRSVTHLDLSLLSPWGHPLLSHANSDAAIATDPALIAHLLRHAFPSVTSLKLYARNPSTL  467
            F+++ +LDLS LSPWGHPLL         +++P+L+A LL HAFPSV SL +YAR+P TL
Sbjct  71   FQAINNLDLSCLSPWGHPLLES-------SSNPSLLAKLLSHAFPSVVSLTIYARSPLTL  123

Query  468  QLLAAQWPQLMKITLVRWHQRPQLAAGEELGSFF  569
              LA +WP+L  + LVRWHQR     G +  + F
Sbjct  124  HFLAPEWPKLSHVKLVRWHQRFNAPIGYDFFALF  157



>ref|XP_010035860.1| PREDICTED: F-box/LRR-repeat MAX2 homolog A [Eucalyptus grandis]
 gb|KCW47343.1| hypothetical protein EUGRSUZ_K01130 [Eucalyptus grandis]
Length=697

 Score =   164 bits (416),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 107/156 (69%), Gaps = 7/156 (4%)
 Frame = +3

Query  102  APTNIHDLPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIMLP  281
            + T+I DLPD ILS +   ++  R RN+ +LVCRK+L LERATR  LTLRG V DL  +P
Sbjct  6    SATDIGDLPDAILSYIFTLVTDTRARNALSLVCRKYLALERATRVDLTLRGKVCDLHRIP  65

Query  282  TCFRSVTHLDLSLLSPWGHPLLSHANSDAAIATDPALIAHLLRHAFPSVTSLKLYARNPS  461
            T FR V  LDLSLLSPWGH L       A+  +DP L+A LL  AFPSV SL +YAR+P+
Sbjct  66   TGFRRVERLDLSLLSPWGHDL-------ASSVSDPFLLAGLLGAAFPSVVSLTVYARSPA  118

Query  462  TLQLLAAQWPQLMKITLVRWHQRPQLAAGEELGSFF  569
            TL +L  QWP+L ++ LVRWHQRPQ + G +  + F
Sbjct  119  TLHVLLPQWPRLRRVKLVRWHQRPQQSLGADFVTLF  154



>ref|XP_010104395.1| hypothetical protein L484_010347 [Morus notabilis]
 gb|EXC00240.1| hypothetical protein L484_010347 [Morus notabilis]
Length=701

 Score =   164 bits (415),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 89/155 (57%), Positives = 111/155 (72%), Gaps = 5/155 (3%)
 Frame = +3

Query  108  TNIHDLPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIMLPTC  287
            T ++DLP+ I+SN+IA +S  R+RNS +LVCR++ VLERATRT L LRGN RD+ ++P C
Sbjct  7    TTLNDLPEAIVSNIIAFVSDVRSRNSISLVCRRFRVLERATRTSLALRGNARDIHLIPRC  66

Query  288  FRSVTHLDLSLLSPWGHPLLSHANSDAAIATDPALIAHLLRHAFPSVTSLKLYARNPSTL  467
            F +VT LDLSLLSPWGH LLS   S          +A  LR AFPSVTSL +Y R+ STL
Sbjct  67   FSAVTSLDLSLLSPWGHALLSSPASPLDPLL----LALRLRVAFPSVTSLTVYGRSASTL  122

Query  468  QLLAAQWPQLMKITLVRWHQRPQLAA-GEELGSFF  569
            Q+LA QWP L ++ LVRWHQRPQ +  GE+  S F
Sbjct  123  QVLAPQWPALHRVKLVRWHQRPQQSQLGEDFFSLF  157



>ref|XP_010524067.1| PREDICTED: F-box protein MAX2 [Tarenaya hassleriana]
Length=691

 Score =   164 bits (414),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 88/154 (57%), Positives = 107/154 (69%), Gaps = 8/154 (5%)
 Frame = +3

Query  108  TNIHDLPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIMLPTC  287
            T I DLPDVIL N+ A +S  RTRNS +LV RK+L LERATR  LTLRGN RDL ++P C
Sbjct  5    TTIGDLPDVILCNISALVSDSRTRNSLSLVSRKFLALERATRFSLTLRGNARDLFLVPAC  64

Query  288  FRSVTHLDLSLLSPWGHPLLSHANSDAAIATDPALIAHLLRHAFPSVTSLKLYARNPSTL  467
            FRSV+ LDLS LSPWGH LL+ + +D       +L+A  L+  FP V SL +Y+R+P+TL
Sbjct  65   FRSVSSLDLSFLSPWGHSLLASSPADHQ-----SLLARRLQACFPVVESLAVYSRSPATL  119

Query  468  QLLAAQWPQLMKITLVRWHQRPQLAAGEELGSFF  569
             LL   WP+L +I LVRWHQR   AAG  LG  F
Sbjct  120  DLLLPHWPKLRRIKLVRWHQR---AAGIPLGGDF  150



>gb|AIN41159.1| MAX2-like protein [Malus baccata]
Length=723

 Score =   162 bits (411),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 106/154 (69%), Gaps = 5/154 (3%)
 Frame = +3

Query  108  TNIHDLPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIMLPTC  287
            T I+DLP+VILS +I  +S  RTRNS +LVC+K+  +ERATR  L LRGN RDL  +P C
Sbjct  3    TTINDLPEVILSAIITLVSDTRTRNSLSLVCKKFRSMERATRASLKLRGNARDLHRIPIC  62

Query  288  FRSVTHLDLSLLSPWGHPLLSHANSDAAIATDPALIAHLLRHAFPSVTSLKLYARNPSTL  467
            F +V  LDLSLLSPWGH LLS     +A  TDP L+   LR AFPSVTSL +Y+R+PST+
Sbjct  63   FTAVDQLDLSLLSPWGHSLLSP----SAANTDPLLVQR-LRDAFPSVTSLTVYSRSPSTV  117

Query  468  QLLAAQWPQLMKITLVRWHQRPQLAAGEELGSFF  569
            Q+++  WP L +  LVRWHQRP    G +    F
Sbjct  118  QIVSRLWPGLRRFKLVRWHQRPHSPLGADFDPLF  151



>gb|AIN41156.1| MAX2-like protein [Malus hupehensis]
Length=721

 Score =   162 bits (411),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 106/154 (69%), Gaps = 5/154 (3%)
 Frame = +3

Query  108  TNIHDLPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIMLPTC  287
            T I+DLP+VILS +I  +S  RTRNS +LVC+K+  +ERATR  L LRGN RDL  +P C
Sbjct  3    TTINDLPEVILSAIITLVSDTRTRNSLSLVCKKFRSMERATRASLKLRGNARDLHRIPIC  62

Query  288  FRSVTHLDLSLLSPWGHPLLSHANSDAAIATDPALIAHLLRHAFPSVTSLKLYARNPSTL  467
            F +V  LDLSLLSPWGH LLS     +A  TDP L+   LR AFPSVTSL +Y+R+PST+
Sbjct  63   FTAVDQLDLSLLSPWGHSLLSP----SAANTDPLLVQR-LRDAFPSVTSLTVYSRSPSTV  117

Query  468  QLLAAQWPQLMKITLVRWHQRPQLAAGEELGSFF  569
            Q+++  WP L +  LVRWHQRP    G +    F
Sbjct  118  QIVSRLWPGLRRFKLVRWHQRPHSLLGADFDPLF  151



>emb|CDY50814.1| BnaC04g52510D [Brassica napus]
Length=681

 Score =   162 bits (410),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 85/155 (55%), Positives = 110/155 (71%), Gaps = 6/155 (4%)
 Frame = +3

Query  108  TNIHDLPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIMLPTC  287
            T + DLPDVILSN+ A ++  R RNS +LV RK+L LER+TR+ LTLRGN RDL +LP C
Sbjct  8    TTLSDLPDVILSNISALVTDTRARNSLSLVSRKFLALERSTRSHLTLRGNARDLHLLPGC  67

Query  288  FRSVTHLDLSLLSPWGHPLLSHANSDAAIATDPALIAHLLRHAFPSVTSLKLYARNPSTL  467
            FRS++HLDLS LSPWGH LLS   +D        L+A  LR  FPS+ SL +Y+R+P++L
Sbjct  68   FRSISHLDLSFLSPWGHSLLSSLPTDHQ-----NLLALRLRLCFPSLDSLAVYSRSPTSL  122

Query  468  QLLAAQWPQLMKITLVRWHQRP-QLAAGEELGSFF  569
            +LL  QWP++  + LVRWHQRP Q+  G +  S F
Sbjct  123  ELLLPQWPRIRHVKLVRWHQRPSQIPLGGDFVSVF  157



>gb|AIN41157.1| MAX2-like protein [Malus baccata]
 gb|AIT59884.1| MAX2 [Malus baccata]
Length=721

 Score =   162 bits (411),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 106/154 (69%), Gaps = 5/154 (3%)
 Frame = +3

Query  108  TNIHDLPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIMLPTC  287
            T I+DLP+VILS +I  +S  RTRNS +LVC+K+  +ERATR  L LRGN RDL  +P C
Sbjct  3    TTINDLPEVILSAIITLVSDTRTRNSLSLVCKKFRSMERATRASLKLRGNARDLHRIPIC  62

Query  288  FRSVTHLDLSLLSPWGHPLLSHANSDAAIATDPALIAHLLRHAFPSVTSLKLYARNPSTL  467
            F +V  LDLSLLSPWGH LLS     +A  TDP L+   LR AFPSVTSL +Y+R+PST+
Sbjct  63   FTAVDQLDLSLLSPWGHSLLSP----SAANTDPLLVQR-LRDAFPSVTSLTVYSRSPSTV  117

Query  468  QLLAAQWPQLMKITLVRWHQRPQLAAGEELGSFF  569
            Q+++  WP L +  LVRWHQRP    G +    F
Sbjct  118  QIVSRLWPGLRRFKLVRWHQRPHSLLGADFDPLF  151



>ref|XP_008353853.1| PREDICTED: F-box/LRR-repeat MAX2 homolog A-like [Malus domestica]
Length=721

 Score =   162 bits (410),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 106/154 (69%), Gaps = 5/154 (3%)
 Frame = +3

Query  108  TNIHDLPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIMLPTC  287
            T  +DLP+VILS +I  +S  RTRNS +LVC+K+  +ERATR  L LRGN RDL  +P C
Sbjct  3    TTXNDLPEVILSAIITLVSDTRTRNSLSLVCKKFRSMERATRASLKLRGNARDLHRIPIC  62

Query  288  FRSVTHLDLSLLSPWGHPLLSHANSDAAIATDPALIAHLLRHAFPSVTSLKLYARNPSTL  467
            F +V  LDLSLLSPWGH LLS     +A  TDP L+A  LR AFPSVTSL +Y+R+PST+
Sbjct  63   FTAVDQLDLSLLSPWGHSLLSP----SAANTDP-LLAQRLRDAFPSVTSLTVYSRSPSTV  117

Query  468  QLLAAQWPQLMKITLVRWHQRPQLAAGEELGSFF  569
            Q+++  WP L +  LVRWHQRP    G +    F
Sbjct  118  QIVSRLWPGLRRFKLVRWHQRPHSPLGADFDPLF  151



>ref|XP_008343110.1| PREDICTED: F-box/LRR-repeat MAX2 homolog A-like [Malus domestica]
Length=721

 Score =   162 bits (410),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 106/154 (69%), Gaps = 5/154 (3%)
 Frame = +3

Query  108  TNIHDLPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIMLPTC  287
            T  +DLP+VILS +I  +S  RTRNS +LVC+K+  +ERATR  L LRGN RDL  +P C
Sbjct  3    TTXNDLPEVILSAIITLVSDTRTRNSLSLVCKKFRSMERATRASLKLRGNARDLHRIPIC  62

Query  288  FRSVTHLDLSLLSPWGHPLLSHANSDAAIATDPALIAHLLRHAFPSVTSLKLYARNPSTL  467
            F +V  LDLSLLSPWGH LLS     +A  TDP L+A  LR AFPSVTSL +Y+R+PST+
Sbjct  63   FTAVDQLDLSLLSPWGHSLLSP----SAANTDP-LLAQRLRDAFPSVTSLTVYSRSPSTV  117

Query  468  QLLAAQWPQLMKITLVRWHQRPQLAAGEELGSFF  569
            Q+++  WP L +  LVRWHQRP    G +    F
Sbjct  118  QIVSRLWPGLRRFKLVRWHQRPHSPLGADFDPLF  151



>ref|XP_008381214.1| PREDICTED: F-box/LRR-repeat MAX2 homolog A [Malus domestica]
Length=720

 Score =   162 bits (409),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 105/154 (68%), Gaps = 4/154 (3%)
 Frame = +3

Query  108  TNIHDLPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIMLPTC  287
            T I+DLP+ ILS VI  +   RTRNS +LVC+K+  +ERATRT LTLRGN RDL  +P C
Sbjct  3    TTINDLPEPILSTVITLVFDTRTRNSLSLVCKKFRSMERATRTSLTLRGNARDLHRIPIC  62

Query  288  FRSVTHLDLSLLSPWGHPLLSHANSDAAIATDPALIAHLLRHAFPSVTSLKLYARNPSTL  467
            F +V  LDLS LSPWGH LLS     +A  TDP L+A  LR AFP VTSL +Y+R PS +
Sbjct  63   FTAVAQLDLSHLSPWGHALLSP----SAANTDPLLLAQRLRDAFPFVTSLTVYSRLPSIV  118

Query  468  QLLAAQWPQLMKITLVRWHQRPQLAAGEELGSFF  569
            Q+++  WP L ++ LVRWHQRPQ   G +    F
Sbjct  119  QIVSHLWPGLRRVKLVRWHQRPQSPLGADFDPLF  152



>ref|XP_002320412.1| ORESARA 9 family protein [Populus trichocarpa]
 gb|EEE98727.1| ORESARA 9 family protein [Populus trichocarpa]
Length=694

 Score =   160 bits (406),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 104/140 (74%), Gaps = 7/140 (5%)
 Frame = +3

Query  114  IHDLPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIMLPTCFR  293
            ++DLPDVILS + +++S  RTRNS +LV RK+L LER+TRT LTLRG  RD+ M+PTCFR
Sbjct  5    MNDLPDVILSIIFSSVSDTRTRNSLSLVNRKFLALERSTRTSLTLRGKARDIYMIPTCFR  64

Query  294  SVTHLDLSLLSPWGHP-LLSHANSDAAIATDPALIAHLLRHAFPSVTSLKLYARNPSTLQ  470
            SVTHLDLSLLSPWG   LLS A+S       P L+A  LR AFP VTSL +YAR+PSTL 
Sbjct  65   SVTHLDLSLLSPWGRSDLLSTASS------VPFLLAQRLRLAFPLVTSLTVYARSPSTLH  118

Query  471  LLAAQWPQLMKITLVRWHQR  530
            +L  QWP L  + L+RWH R
Sbjct  119  ILLPQWPNLSHVKLIRWHPR  138



>gb|AEB37340.1| more axillary branches 2, partial [Helianthus argophyllus]
 gb|AEB37341.1| more axillary branches 2, partial [Helianthus argophyllus]
Length=219

 Score =   152 bits (385),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/114 (66%), Positives = 88/114 (77%), Gaps = 5/114 (4%)
 Frame = +3

Query  192  LVCRKWLVLERATRTCLTLRGNVRDLIMLPTCFRSVTHLDLSLLSPWGHPLLSHANSDAA  371
            LV +KWL +ER+TR+ LTLRGN RDL MLP+CFRSV+HLDLSLLSPWGHPLLS ++    
Sbjct  1    LVSKKWLCVERSTRSSLTLRGNARDLFMLPSCFRSVSHLDLSLLSPWGHPLLSSSS----  56

Query  372  IATDPALIAHLLRHAFPSVTSLKLYARNPSTLQLLAAQWPQLMKITLVRWHQRP  533
               DPAL A LLRH+FP + SL LY+RNP+ + LLA  WP L  I LVRWHQRP
Sbjct  57   -PPDPALFAQLLRHSFPHLHSLILYSRNPTAIHLLAPHWPTLTHIKLVRWHQRP  109



>gb|AEB37350.1| more axillary branches 2, partial [Helianthus annuus]
 gb|AEB37351.1| more axillary branches 2, partial [Helianthus annuus]
Length=217

 Score =   152 bits (385),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 87/113 (77%), Gaps = 5/113 (4%)
 Frame = +3

Query  195  VCRKWLVLERATRTCLTLRGNVRDLIMLPTCFRSVTHLDLSLLSPWGHPLLSHANSDAAI  374
            V +KWL +ER+TR+ LTLRGN RDL MLP+CFRSVTHLDLSLLSPWGHPLLS ++     
Sbjct  1    VSKKWLCVERSTRSSLTLRGNARDLFMLPSCFRSVTHLDLSLLSPWGHPLLSSSS-----  55

Query  375  ATDPALIAHLLRHAFPSVTSLKLYARNPSTLQLLAAQWPQLMKITLVRWHQRP  533
              DPAL A LLRH+FP + SL LY+RNP+ + LLA  WP L  I LVRWHQRP
Sbjct  56   PPDPALFAQLLRHSFPHLHSLILYSRNPTAIHLLAPHWPTLTHIKLVRWHQRP  108



>ref|XP_007132849.1| hypothetical protein PHAVU_011G129700g [Phaseolus vulgaris]
 gb|ESW04843.1| hypothetical protein PHAVU_011G129700g [Phaseolus vulgaris]
Length=711

 Score =   159 bits (402),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 86/156 (55%), Positives = 105/156 (67%), Gaps = 5/156 (3%)
 Frame = +3

Query  108  TNIHDLPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIMLPTC  287
            T + +LP+ ILSNV +A+S  RTRNS +LVCR +  LER TR  LTLRGN RDL ++PT 
Sbjct  5    TTVSNLPEEILSNVFSAVSDTRTRNSLSLVCRSFFRLERKTRISLTLRGNARDLHLIPTS  64

Query  288  FRSVTHLDLSLLSPWGHPLLSHANSDAAIATDPALIAHLLRHAFPSVTSLKLYARNPSTL  467
            F  VTHLD+S LSPWGH L     S A    DP L+A  LR AFP VTSL +YAR+P+TL
Sbjct  65   FTHVTHLDISFLSPWGHALFC---SSATNTFDPRLLALRLRDAFPHVTSLAVYARDPATL  121

Query  468  Q-LLAAQWPQLMKITLVRWHQRPQLA-AGEELGSFF  569
              LL + WP+L  + LVRWHQRP  + AG +    F
Sbjct  122  HLLLLSPWPELSSVKLVRWHQRPPTSPAGSDFAVLF  157



>ref|XP_010925635.1| PREDICTED: F-box/LRR-repeat MAX2 homolog A-like [Elaeis guineensis]
Length=726

 Score =   158 bits (400),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 89/169 (53%), Positives = 105/169 (62%), Gaps = 18/169 (11%)
 Frame = +3

Query  105  PTNIHDLPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIMLPT  284
            PT+IHDLP+ IL  V A +   R+RNS ALVCRKW  LER TRT L+LRG+VR+  +LPT
Sbjct  6    PTHIHDLPEPILREVFALVKDVRSRNSVALVCRKWRSLERLTRTSLSLRGHVRNPFLLPT  65

Query  285  CFRSVTHLDLSLLSPWGHPLL-------------SHANS-----DAAIATDPALIAHLLR  410
            CF SV+HLDLSLLSPWGH L               H N+      + +     L+A  L 
Sbjct  66   CFPSVSHLDLSLLSPWGHHLFLRPSPTRLNGHPDPHPNNYNDHRHSLLDDQQLLVAQRLG  125

Query  411  HAFPSVTSLKLYARNPSTLQLLAAQWPQLMKITLVRWHQRPQLAAGEEL  557
             AFP+VTSL +YAR PSTL  LA QWP L    LVRWHQRP    G +L
Sbjct  126  QAFPNVTSLTVYAREPSTLHALAPQWPGLRHAKLVRWHQRPHHPPGTDL  174



>gb|AIN41158.1| MAX2-like protein [Malus hupehensis]
Length=717

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 83/154 (54%), Positives = 104/154 (68%), Gaps = 4/154 (3%)
 Frame = +3

Query  108  TNIHDLPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIMLPTC  287
            T I+DLP+ ILS VI  +   RTRNS +LVC+K+  +ERATR  LTLRGN RDL  +P C
Sbjct  3    TTINDLPEPILSTVITLVFDTRTRNSLSLVCKKFRSMERATRKSLTLRGNARDLHRIPIC  62

Query  288  FRSVTHLDLSLLSPWGHPLLSHANSDAAIATDPALIAHLLRHAFPSVTSLKLYARNPSTL  467
            F +V  LDLS LSPWGH LLS     +A  TDP L+A  LR AFP VTSL +Y+R+ S +
Sbjct  63   FTAVAQLDLSHLSPWGHALLSP----SAANTDPLLLAQRLRDAFPFVTSLTVYSRSRSIV  118

Query  468  QLLAAQWPQLMKITLVRWHQRPQLAAGEELGSFF  569
            Q+++  WP L ++ LVRWHQRPQ   G +    F
Sbjct  119  QIVSHLWPGLRRVKLVRWHQRPQSPLGADFEPLF  152



>ref|XP_010279132.1| PREDICTED: F-box/LRR-repeat MAX2 homolog A-like [Nelumbo nucifera]
Length=709

 Score =   156 bits (394),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 94/137 (69%), Gaps = 7/137 (5%)
 Frame = +3

Query  120  DLPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIMLPTCFRSV  299
            DLPD ILS +   +   RTRN+ +LVC KWLVLER+TRT +TLRGNVR L  +PTCFR+V
Sbjct  6    DLPDAILSIIFTLVVDTRTRNAMSLVCGKWLVLERSTRTSITLRGNVRHLFDIPTCFRAV  65

Query  300  THLDLSLLSPWGHPLLSHANSDAAIATDPALIAHLLRHAFPSVTSLKLYARNPSTLQLLA  479
            T LDLSLLSPWG  +          +  P  +AH LR AFP+V SL LYAR PS L+LLA
Sbjct  66   TQLDLSLLSPWGQSIFDS-------SPHPISLAHYLRRAFPNVISLTLYARTPSILRLLA  118

Query  480  AQWPQLMKITLVRWHQR  530
             QWP L  + LVRWH R
Sbjct  119  PQWPSLRHVKLVRWHPR  135



>dbj|BAJ33992.1| unnamed protein product [Thellungiella halophila]
Length=701

 Score =   155 bits (392),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 82/145 (57%), Positives = 105/145 (72%), Gaps = 7/145 (5%)
 Frame = +3

Query  99   HAPTNIHDLPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIML  278
            ++ T + DLPDVILSN+ A +S  R RNS +LV RK+L LER+TR+ LTLRGN RDL +L
Sbjct  4    YSTTTLSDLPDVILSNICALVSDSRARNSLSLVSRKFLALERSTRSHLTLRGNARDLHLL  63

Query  279  PTCFRSVTHLDLSLLSPWGHPLLSHANSDAAIATD-PALIAHLLRHAFPSVTSLKLYARN  455
            P CF SV+HLDLS LSPWGH LL      A++  D   L+A  L+  FPSV +L LY+R+
Sbjct  64   PGCFPSVSHLDLSFLSPWGHSLL------ASLPIDHQNLLALRLQLCFPSVDTLSLYSRS  117

Query  456  PSTLQLLAAQWPQLMKITLVRWHQR  530
            P++L+LL  QWP++  I LVRWHQR
Sbjct  118  PTSLELLLPQWPRIRHIKLVRWHQR  142



>ref|XP_002879997.1| hypothetical protein ARALYDRAFT_903635 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56256.1| hypothetical protein ARALYDRAFT_903635 [Arabidopsis lyrata subsp. 
lyrata]
Length=694

 Score =   154 bits (390),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 81/156 (52%), Positives = 107/156 (69%), Gaps = 8/156 (5%)
 Frame = +3

Query  108  TNIHDLPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIMLPTC  287
            T + DLPDVILS + + +S  R RNS +LV  K+L LER+TR+ LTLRGN RDL ++P C
Sbjct  6    TTLSDLPDVILSTIFSLVSDSRARNSLSLVSHKFLALERSTRSLLTLRGNARDLSLVPGC  65

Query  288  FRSVTHLDLSLLSPWGHPLLSHANSDAAIATD-PALIAHLLRHAFPSVTSLKLYARNPST  464
            FRS++HLDLS LSPWGH LL      A++  D   L+A  L+  FPSV SL +Y+R+PS+
Sbjct  66   FRSISHLDLSFLSPWGHTLL------ASLPIDHQNLLALRLKICFPSVVSLNVYSRSPSS  119

Query  465  LQLLAAQWPQLMKITLVRWHQR-PQLAAGEELGSFF  569
            L+LL  QWP++  I L+RWHQR  Q+  G +    F
Sbjct  120  LELLLPQWPRIRHIKLLRWHQRASQIPVGGDFAPIF  155



>ref|XP_009142077.1| PREDICTED: F-box protein MAX2 [Brassica rapa]
Length=687

 Score =   153 bits (386),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 80/157 (51%), Positives = 107/157 (68%), Gaps = 6/157 (4%)
 Frame = +3

Query  102  APTNIHDLPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIMLP  281
            A T + DLPDVILS + A ++  R RNS +LV  K+L LER+TR+ LTLRGN RDL +LP
Sbjct  2    ASTTLCDLPDVILSTISALVTDSRARNSLSLVSHKFLALERSTRSHLTLRGNARDLHLLP  61

Query  282  TCFRSVTHLDLSLLSPWGHPLLSHANSDAAIATDPALIAHLLRHAFPSVTSLKLYARNPS  461
             CFRS++HLDLS LSPWGH LL+    D        L+A  L   FPSV +L +Y+R+P+
Sbjct  62   GCFRSISHLDLSFLSPWGHSLLTSLPVDHQ-----PLLALRLHLCFPSVDALTVYSRSPT  116

Query  462  TLQLLAAQWPQLMKITLVRWHQRP-QLAAGEELGSFF  569
            +L+LL  QWP++  + L+RWHQRP Q+  G++    F
Sbjct  117  SLELLLPQWPRIRHVKLIRWHQRPSQIPQGDDFVPIF  153



>ref|XP_010517801.1| PREDICTED: F-box protein MAX2 [Camelina sativa]
Length=695

 Score =   152 bits (384),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 82/156 (53%), Positives = 108/156 (69%), Gaps = 8/156 (5%)
 Frame = +3

Query  108  TNIHDLPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIMLPTC  287
            T + DLPDVILS + + IS  R RNS +LV  K+L LER+TR+ LTLRGN RDL ++P C
Sbjct  7    TTLSDLPDVILSTISSLISDSRARNSLSLVSHKFLALERSTRSHLTLRGNARDLSLVPGC  66

Query  288  FRSVTHLDLSLLSPWGHPLLSHANSDAAIATD-PALIAHLLRHAFPSVTSLKLYARNPST  464
            FRSV+HLDLS LSPWGH LL      A++  D  +L+A  L+  FPSV SL +Y+R+P++
Sbjct  67   FRSVSHLDLSFLSPWGHTLL------ASLPLDHQSLLALRLKFCFPSVESLNVYSRSPTS  120

Query  465  LQLLAAQWPQLMKITLVRWHQR-PQLAAGEELGSFF  569
            L+LL  QWP++  I L+RWHQR  Q+  G +    F
Sbjct  121  LELLLPQWPRIRHIKLLRWHQRASQIPLGGDFVPLF  156



>ref|XP_010689839.1| PREDICTED: F-box/LRR-repeat MAX2 homolog A [Beta vulgaris subsp. 
vulgaris]
Length=703

 Score =   152 bits (384),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 84/145 (58%), Positives = 102/145 (70%), Gaps = 9/145 (6%)
 Frame = +3

Query  108  TNIHDLPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIM-LPT  284
            T IHDLPD IL+N+++ IS  R RN A+LV  KW  LER TRT LTLRGN+RDL+  LP 
Sbjct  4    TTIHDLPDAILTNILSLISDVRARNCASLVTTKWRALERLTRTHLTLRGNIRDLLFHLPN  63

Query  285  CFRSVTHLDLSLLSPWGHPLLSHANSDAAIATDPA-LIAHLLRHAFPSVTSLKLYARNPS  461
             F S+THLDLSLLSPWG  L  H         DP+ L++H LR AFPSV+SL LY+R+PS
Sbjct  64   SFTSITHLDLSLLSPWGLGLSLHIQ-------DPSFLLSHRLRLAFPSVSSLTLYSRSPS  116

Query  462  TLQLLAAQWPQLMKITLVRWHQRPQ  536
            TL LL+  +P L  + L+RWHQRP 
Sbjct  117  TLSLLSPFFPSLSHVKLIRWHQRPN  141



>ref|XP_006296114.1| hypothetical protein CARUB_v10025265mg [Capsella rubella]
 gb|EOA29012.1| hypothetical protein CARUB_v10025265mg [Capsella rubella]
Length=698

 Score =   152 bits (383),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 104/155 (67%), Gaps = 6/155 (4%)
 Frame = +3

Query  108  TNIHDLPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIMLPTC  287
            T + DLPDVILS + + +S  R RNS +LV  K+L LER+TR+ LTLRGN RDL ++P C
Sbjct  8    TTLSDLPDVILSTISSLVSDSRARNSLSLVSHKFLALERSTRSHLTLRGNARDLSLVPGC  67

Query  288  FRSVTHLDLSLLSPWGHPLLSHANSDAAIATDPALIAHLLRHAFPSVTSLKLYARNPSTL  467
            FRSV+HLDLS LSPWGH LL+    D        L+A  L+  FPSV SL +Y+R+PS+L
Sbjct  68   FRSVSHLDLSFLSPWGHTLLASLPPDHQ-----NLLALRLKFCFPSVESLNVYSRSPSSL  122

Query  468  QLLAAQWPQLMKITLVRWHQR-PQLAAGEELGSFF  569
            +LL  QWP +  I L+RWHQR  Q+  G +    F
Sbjct  123  ELLLPQWPSIRHIKLLRWHQRASQIPLGGDFVPIF  157



>ref|XP_008812427.1| PREDICTED: LOW QUALITY PROTEIN: F-box/LRR-repeat MAX2 homolog 
A-like [Phoenix dactylifera]
Length=727

 Score =   152 bits (383),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 84/168 (50%), Positives = 106/168 (63%), Gaps = 18/168 (11%)
 Frame = +3

Query  108  TNIHDLPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIMLPTC  287
            T+IH+LP+ IL+ V A +   R+RNSAALVCR+W  LER +RT L+LRG+VR+  +LPTC
Sbjct  7    THIHELPESILTEVFALVKDVRSRNSAALVCRRWRSLERLSRTSLSLRGHVRNPFLLPTC  66

Query  288  FRSVTHLDLSLLSPWGH----------------PLLSHANSDAAIATDPA--LIAHLLRH  413
            F  V+HLDLSLLSPWGH                P   + N    +  D    L+A  L  
Sbjct  67   FPYVSHLDLSLLSPWGHHPFLHPSPTRLNGHPEPRPDNYNGHHHLLVDDQQLLVAQRLGQ  126

Query  414  AFPSVTSLKLYARNPSTLQLLAAQWPQLMKITLVRWHQRPQLAAGEEL  557
            AFP+VTSL +YAR+PSTL +LA +WP L    LVRWHQRP    G +L
Sbjct  127  AFPNVTSLTVYARDPSTLHVLAPRWPGLRHAKLVRWHQRPHHPLGADL  174



>ref|XP_010508545.1| PREDICTED: F-box protein MAX2-like [Camelina sativa]
Length=695

 Score =   151 bits (382),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 109/160 (68%), Gaps = 8/160 (5%)
 Frame = +3

Query  96   LHAPTNIHDLPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIM  275
            + + T + DLPDVILS + + +S  R RNS +LV  K+L LER+TR+ LTLRGN RDL +
Sbjct  1    MASSTTLSDLPDVILSTISSLVSDSRARNSLSLVSHKFLALERSTRSHLTLRGNARDLSL  60

Query  276  LPTCFRSVTHLDLSLLSPWGHPLLSHANSDAAIATD-PALIAHLLRHAFPSVTSLKLYAR  452
            +P CFRSV+HLDLS LSPWGH LL      A++  D   L+A  L+  FPSV SL +Y+R
Sbjct  61   VPGCFRSVSHLDLSFLSPWGHTLL------ASLPLDHQTLLALRLKICFPSVESLNVYSR  114

Query  453  NPSTLQLLAAQWPQLMKITLVRWHQR-PQLAAGEELGSFF  569
            +PS+L+LL  QWP++  I L+RWHQR  Q+  G +    F
Sbjct  115  SPSSLELLLPQWPRIRHIKLLRWHQRASQIPLGGDFVPIF  154



>gb|AEB37334.1| more axillary branches 2, partial [Helianthus tuberosus]
Length=205

 Score =   143 bits (361),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 71/105 (68%), Positives = 82/105 (78%), Gaps = 5/105 (5%)
 Frame = +3

Query  219  ERATRTCLTLRGNVRDLIMLPTCFRSVTHLDLSLLSPWGHPLLSHANSDAAIATDPALIA  398
            ER+TR+ LTLRGN RDL MLP+CFRSVTHLDLSLLSPWGHPLLS ++       DPAL+A
Sbjct  1    ERSTRSSLTLRGNARDLFMLPSCFRSVTHLDLSLLSPWGHPLLSSSS-----PPDPALLA  55

Query  399  HLLRHAFPSVTSLKLYARNPSTLQLLAAQWPQLMKITLVRWHQRP  533
             LLRH+FP + SL LY+RNP+ + LLA  WP L  I LVRWHQRP
Sbjct  56   QLLRHSFPHLHSLILYSRNPTAIHLLAPHWPTLTHIKLVRWHQRP  100



>gb|AEB37366.1| more axillary branches 2, partial [Helianthus annuus]
 gb|AEB37367.1| more axillary branches 2, partial [Helianthus annuus]
Length=202

 Score =   143 bits (361),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 71/105 (68%), Positives = 81/105 (77%), Gaps = 5/105 (5%)
 Frame = +3

Query  219  ERATRTCLTLRGNVRDLIMLPTCFRSVTHLDLSLLSPWGHPLLSHANSDAAIATDPALIA  398
            ER+TR+ LTLRGN RDL MLP+CFRSVTHLDLSLLSPWGHPLLS ++       DPAL A
Sbjct  1    ERSTRSSLTLRGNARDLFMLPSCFRSVTHLDLSLLSPWGHPLLSSSS-----PPDPALFA  55

Query  399  HLLRHAFPSVTSLKLYARNPSTLQLLAAQWPQLMKITLVRWHQRP  533
             LLRH+FP + SL LY+RNP+ + LLA  WP L  I LVRWHQRP
Sbjct  56   QLLRHSFPHLHSLILYSRNPTAIHLLAPHWPTLTHIKLVRWHQRP  100



>gb|AEB37354.1| more axillary branches 2, partial [Helianthus annuus]
 gb|AEB37355.1| more axillary branches 2, partial [Helianthus annuus]
Length=211

 Score =   143 bits (361),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 71/106 (67%), Positives = 82/106 (77%), Gaps = 5/106 (5%)
 Frame = +3

Query  216  LERATRTCLTLRGNVRDLIMLPTCFRSVTHLDLSLLSPWGHPLLSHANSDAAIATDPALI  395
            +ER+TR+ LTLRGN RDL MLP+CFRSVTHLDLSLLSPWGHPLLS ++       DPAL 
Sbjct  1    VERSTRSSLTLRGNARDLFMLPSCFRSVTHLDLSLLSPWGHPLLSSSS-----PPDPALF  55

Query  396  AHLLRHAFPSVTSLKLYARNPSTLQLLAAQWPQLMKITLVRWHQRP  533
            A LLRH+FP + SL LY+RNP+ + LLA  WP L  I LVRWHQRP
Sbjct  56   AQLLRHSFPHLHSLILYSRNPTAIHLLAPHWPTLTHIKLVRWHQRP  101



>gb|AEB37342.1| more axillary branches 2, partial [Helianthus argophyllus]
 gb|AEB37343.1| more axillary branches 2, partial [Helianthus argophyllus]
Length=210

 Score =   143 bits (361),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 71/108 (66%), Positives = 83/108 (77%), Gaps = 5/108 (5%)
 Frame = +3

Query  210  LVLERATRTCLTLRGNVRDLIMLPTCFRSVTHLDLSLLSPWGHPLLSHANSDAAIATDPA  389
            L +ER+TR+ LTLRGN RDL MLP+CFRSV+HLDLSLLSPWGHPLLS ++       DPA
Sbjct  1    LCVERSTRSSLTLRGNARDLFMLPSCFRSVSHLDLSLLSPWGHPLLSSSS-----PPDPA  55

Query  390  LIAHLLRHAFPSVTSLKLYARNPSTLQLLAAQWPQLMKITLVRWHQRP  533
            L A LLRH+FP + SL LY+RNP+ + LLA  WP L  I LVRWHQRP
Sbjct  56   LFAQLLRHSFPHLHSLILYSRNPTAIHLLAPHWPTLTHIKLVRWHQRP  103



>gb|AEB37332.1| more axillary branches 2, partial [Helianthus exilis]
 gb|AEB37333.1| more axillary branches 2, partial [Helianthus exilis]
Length=210

 Score =   143 bits (360),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 71/105 (68%), Positives = 81/105 (77%), Gaps = 5/105 (5%)
 Frame = +3

Query  219  ERATRTCLTLRGNVRDLIMLPTCFRSVTHLDLSLLSPWGHPLLSHANSDAAIATDPALIA  398
            ER+TR+ LTLRGN RDL MLP+CFRSVTHLDLSLLSPWGHPLLS ++       DPAL A
Sbjct  1    ERSTRSSLTLRGNARDLFMLPSCFRSVTHLDLSLLSPWGHPLLSSSS-----PPDPALFA  55

Query  399  HLLRHAFPSVTSLKLYARNPSTLQLLAAQWPQLMKITLVRWHQRP  533
             LLRH+FP + SL LY+RNP+ + LLA  WP L  I LVRWHQRP
Sbjct  56   QLLRHSFPHLHSLILYSRNPTAIHLLAPHWPTLTHIKLVRWHQRP  100



>ref|XP_008812067.1| PREDICTED: F-box protein MAX2-like [Phoenix dactylifera]
Length=735

 Score =   150 bits (380),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 81/167 (49%), Positives = 103/167 (62%), Gaps = 17/167 (10%)
 Frame = +3

Query  108  TNIHDLPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIMLPTC  287
            T++HDLP+ +LS V+  +   R+RN+ ALVCRKW  LER TRT L+LRG++R+  +LPTC
Sbjct  11   THVHDLPEAVLSQVLELVRDVRSRNAVALVCRKWRFLERLTRTSLSLRGHIRNPFLLPTC  70

Query  288  FRSVTHLDLSLLSPWG-----------------HPLLSHANSDAAIATDPALIAHLLRHA  416
            F SV+HLDLSLLSPWG                 HP   + +     A    L+A  L  A
Sbjct  71   FPSVSHLDLSLLSPWGYHPFHYLPAPTRLDGYLHPDNYNDHHHLLAADQQHLVAQRLGQA  130

Query  417  FPSVTSLKLYARNPSTLQLLAAQWPQLMKITLVRWHQRPQLAAGEEL  557
            FP+V SL +YAR+PS LQ LA  WP L    LVRWHQRPQ   G ++
Sbjct  131  FPNVMSLTVYARDPSALQALAPHWPGLRHAKLVRWHQRPQNPLGADV  177



>ref|NP_565979.1| F-box leucine-rich repeat family protein MAX2 [Arabidopsis thaliana]
 sp|Q9SIM9.2|MAX2_ARATH RecName: Full=F-box protein MAX2; AltName: Full=F-box/LRR-repeat 
protein 7; AltName: Full=Protein KARRIKIN INSENSITIVE 1; 
AltName: Full=Protein MORE AXILLARY BRANCHING 2; AltName: Full=Protein 
ORESARA 9 [Arabidopsis thaliana]
 gb|AAK97303.1|AF305597_1 F-box containing protein ORE9 [Arabidopsis thaliana]
 gb|AAD22992.2| F-box protein ORE9, AtFBL7 [Arabidopsis thaliana]
 gb|AEC10149.1| F-box leucine-rich repeat family protein MAX2 [Arabidopsis thaliana]
Length=693

 Score =   150 bits (378),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 80/158 (51%), Positives = 106/158 (67%), Gaps = 8/158 (5%)
 Frame = +3

Query  102  APTNIHDLPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIMLP  281
            A T + DLPDVILS + + +S  R RNS +LV  K+L LER+TR+ LT+RGN RDL ++P
Sbjct  2    ASTTLSDLPDVILSTISSLVSDSRARNSLSLVSHKFLALERSTRSHLTIRGNARDLSLVP  61

Query  282  TCFRSVTHLDLSLLSPWGHPLLSHANSDAAIATD-PALIAHLLRHAFPSVTSLKLYARNP  458
             CFRS++HLDLS LSPWGH LL      A++  D   L+A  L+  FP V SL +Y R+P
Sbjct  62   DCFRSISHLDLSFLSPWGHTLL------ASLPIDHQNLLALRLKFCFPFVESLNVYTRSP  115

Query  459  STLQLLAAQWPQLMKITLVRWHQR-PQLAAGEELGSFF  569
            S+L+LL  QWP++  I L+RWHQR  Q+  G +    F
Sbjct  116  SSLELLLPQWPRIRHIKLLRWHQRASQIPTGGDFVPIF  153



>gb|KFK37113.1| hypothetical protein AALP_AA4G214500 [Arabis alpina]
Length=729

 Score =   150 bits (379),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 104/155 (67%), Gaps = 6/155 (4%)
 Frame = +3

Query  108  TNIHDLPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIMLPTC  287
            T + DLPDVILS +I+ ++  R+RNS +LV  K+L LER+TR+ LTLRGN RDL ++P C
Sbjct  38   TTLSDLPDVILSTIISLVTDSRSRNSLSLVSHKFLALERSTRSHLTLRGNARDLSVVPRC  97

Query  288  FRSVTHLDLSLLSPWGHPLLSHANSDAAIATDPALIAHLLRHAFPSVTSLKLYARNPSTL  467
            FRS++HLDLS LSPWGH LL+    D        L+A  L+  FPS+ SL +Y+R P TL
Sbjct  98   FRSISHLDLSFLSPWGHSLLATLPPDHQ-----NLLALSLKLCFPSIESLTVYSRTPITL  152

Query  468  QLLAAQWPQLMKITLVRWHQRP-QLAAGEELGSFF  569
             LL  QW Q+  I LVRWHQR  Q++ G +    F
Sbjct  153  DLLLPQWLQIRHIKLVRWHQRESQISLGGDFKPIF  187



>gb|ABD67495.1| RAMOSUS4 [Pisum sativum]
Length=708

 Score =   150 bits (378),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 84/156 (54%), Positives = 101/156 (65%), Gaps = 7/156 (4%)
 Frame = +3

Query  108  TNIHDLPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIMLPTC  287
            T +  LP+ ILS V AAI+  RTRNS +LVCR +  LER TR  LTLRGN RDL  +PT 
Sbjct  4    TTVAHLPEEILSQVFAAITDTRTRNSLSLVCRSFFRLERKTRVSLTLRGNARDLYRIPTS  63

Query  288  FRSVTHLDLSLLSPWGHPLLSHANSDAAIATDPALIAHLLRHAFPSVTSLKLYARNPSTL  467
            F  VT+LD+SLLSPWGH L        A A  P+L A  LR+AFP VTSL +Y R+P TL
Sbjct  64   FAHVTNLDVSLLSPWGHALF----CSPATADSPSL-AQRLRNAFPRVTSLTVYVRDPQTL  118

Query  468  QLLA-AQWPQLMKITLVRWHQR-PQLAAGEELGSFF  569
             LL  + WP+L  + LVRWHQR P L  G +  + F
Sbjct  119  HLLLHSHWPELRDVRLVRWHQRPPDLQPGSDFAALF  154



>ref|XP_010506098.1| PREDICTED: F-box protein MAX2-like isoform X1 [Camelina sativa]
 ref|XP_010506099.1| PREDICTED: F-box protein MAX2-like isoform X2 [Camelina sativa]
 ref|XP_010506101.1| PREDICTED: F-box protein MAX2-like isoform X4 [Camelina sativa]
Length=699

 Score =   149 bits (376),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 80/154 (52%), Positives = 107/154 (69%), Gaps = 8/154 (5%)
 Frame = +3

Query  114  IHDLPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIMLPTCFR  293
            + DLPDVILS + + +S  R RNS +LV  K+L LER+TR+ LTLRGN RDL ++P CFR
Sbjct  10   LSDLPDVILSTISSLVSDSRARNSLSLVSHKFLALERSTRSHLTLRGNARDLSLVPGCFR  69

Query  294  SVTHLDLSLLSPWGHPLLSHANSDAAIATD-PALIAHLLRHAFPSVTSLKLYARNPSTLQ  470
            SV+HLDLS LSPWGH LL      A++  D  +L+A  L+  FPSV SL +Y+R+P++L+
Sbjct  70   SVSHLDLSFLSPWGHTLL------ASLPLDHQSLLALRLKICFPSVESLNVYSRSPTSLE  123

Query  471  LLAAQWPQLMKITLVRWHQR-PQLAAGEELGSFF  569
            LL  QWP++  I L+RWHQR  Q+  G +    F
Sbjct  124  LLLPQWPRIRHIKLLRWHQRASQIPLGGDFVPIF  157



>ref|XP_010506100.1| PREDICTED: F-box protein MAX2-like isoform X3 [Camelina sativa]
Length=698

 Score =   149 bits (376),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 80/154 (52%), Positives = 107/154 (69%), Gaps = 8/154 (5%)
 Frame = +3

Query  114  IHDLPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIMLPTCFR  293
            + DLPDVILS + + +S  R RNS +LV  K+L LER+TR+ LTLRGN RDL ++P CFR
Sbjct  10   LSDLPDVILSTISSLVSDSRARNSLSLVSHKFLALERSTRSHLTLRGNARDLSLVPGCFR  69

Query  294  SVTHLDLSLLSPWGHPLLSHANSDAAIATD-PALIAHLLRHAFPSVTSLKLYARNPSTLQ  470
            SV+HLDLS LSPWGH LL      A++  D  +L+A  L+  FPSV SL +Y+R+P++L+
Sbjct  70   SVSHLDLSFLSPWGHTLL------ASLPLDHQSLLALRLKICFPSVESLNVYSRSPTSLE  123

Query  471  LLAAQWPQLMKITLVRWHQR-PQLAAGEELGSFF  569
            LL  QWP++  I L+RWHQR  Q+  G +    F
Sbjct  124  LLLPQWPRIRHIKLLRWHQRASQIPLGGDFVPIF  157



>ref|XP_003607592.1| F-box protein ORE9 [Medicago truncatula]
 gb|AES89789.1| F-box protein MAX2 [Medicago truncatula]
Length=711

 Score =   149 bits (376),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 99/159 (62%), Gaps = 7/159 (4%)
 Frame = +3

Query  99   HAPTNIHDLPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIML  278
            ++ T +  LP+ ILS V   I+  RTRNS +LVC  +  LER TR  LTLRGN RDL  +
Sbjct  5    NSATTVSHLPEEILSKVFTGITDTRTRNSLSLVCHSFFKLERKTRLSLTLRGNARDLYRI  64

Query  279  PTCFRSVTHLDLSLLSPWGHPLLSHANSDAAIATDPALIAHLLRHAFPSVTSLKLYARNP  458
            PT F +VTHLD+SLLSPWGH L       +    D  L+A  LR+ FP VTSL +Y R+P
Sbjct  65   PTSFTNVTHLDVSLLSPWGHALFC-----SPAGNDSPLLAQRLRNTFPRVTSLTVYVRDP  119

Query  459  STLQLLAAQ-WPQLMKITLVRWHQRPQ-LAAGEELGSFF  569
             TL LL    WP+L  + LVRWHQRPQ L  G +  + F
Sbjct  120  HTLHLLLFNHWPELRDVRLVRWHQRPQGLQPGSDFDALF  158



>ref|XP_003540983.1| PREDICTED: F-box/LRR-repeat MAX2 homolog A-like [Glycine max]
Length=711

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 80/144 (56%), Positives = 99/144 (69%), Gaps = 4/144 (3%)
 Frame = +3

Query  123  LPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIMLPTCFRSVT  302
            LP+ IL NV +A+S  RTRN+ +LV   +  LER TRT LTLRGN RDL ++PT F+ VT
Sbjct  10   LPEEILLNVFSAVSDTRTRNALSLVSWSFYHLERKTRTSLTLRGNARDLHLIPTSFKHVT  69

Query  303  HLDLSLLSPWGHPLLSHANSDAAIATDPALIAHLLRHAFPSVTSLKLYARNPSTLQ-LLA  479
            HLDLS LSPWGH L     S +A     +L+A  LR AFP VTSL +YAR+P TL+ LL 
Sbjct  70   HLDLSFLSPWGHALFC---SSSATVGHQSLLAQHLRAAFPRVTSLAIYARDPYTLRLLLL  126

Query  480  AQWPQLMKITLVRWHQRPQLAAGE  551
            + WP+L  + LVRWHQRP  +A E
Sbjct  127  SAWPELSAVKLVRWHQRPPTSANE  150



>ref|XP_004505491.1| PREDICTED: F-box/LRR-repeat MAX2 homolog A-like [Cicer arietinum]
Length=710

 Score =   146 bits (368),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 99/155 (64%), Gaps = 9/155 (6%)
 Frame = +3

Query  108  TNIHDLPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIMLPTC  287
            T I  LP+ ILS V A I+  RTRNS +LVC+ +  LER TRT LTLRGN RDL  +PT 
Sbjct  8    TTISHLPEEILSKVFAGITDTRTRNSLSLVCQSFSRLERKTRTFLTLRGNARDLYRIPTS  67

Query  288  FRSVTHLDLSLLSPWGHPLLSHANSDAAIATDPALIAHLLRHAFPSVTSLKLYARNPSTL  467
            F  VT+LD+SLLSPWGH L       +    D  ++A  LR+AFP VTSL +Y R+P TL
Sbjct  68   FTYVTNLDVSLLSPWGHALFC-----SPTTVDSPILAQRLRNAFPRVTSLTVYVRDPETL  122

Query  468  QLLAAQ-WPQLMKITLVRWHQRPQLAAGEELGSFF  569
             LL    WP+L  + LVRWHQRP    G + GS F
Sbjct  123  HLLLFNPWPELRDVRLVRWHQRP---PGLQPGSDF  154



>ref|XP_010539206.1| PREDICTED: LOW QUALITY PROTEIN: F-box/LRR-repeat MAX2 homolog 
A-like [Tarenaya hassleriana]
Length=668

 Score =   145 bits (365),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 101/159 (64%), Gaps = 6/159 (4%)
 Frame = +3

Query  99   HAPTNIHDLPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIML  278
            +A  + +D+P+ I+S +   I   RTRNS ++VC KW VLER +R+ LTLRG VRDL ++
Sbjct  8    NAGLHFNDMPETIISGIFLCIEDTRTRNSMSVVCHKWRVLERFSRSSLTLRGTVRDLFLV  67

Query  279  PTCFRSVTHLDLSLLSPWGHPLLSHANSDAAIATDPALIAHLLRHAFPSVTSLKLYARNP  458
            PTCF  VT LD+SLLSPWG+PL        A  +   L+AHLL  AFP V SL  YARNP
Sbjct  68   PTCFCRVTRLDISLLSPWGYPLF----DPTAPPSSSHLLAHLLGKAFPLVVSLTCYARNP  123

Query  459  -STLQLLAAQWPQLMKITLVRWHQR-PQLAAGEELGSFF  569
             + L+ LA QWP L  + LVR H R P L+ G E    F
Sbjct  124  FADLRYLAPQWPCLSHVKLVRLHPRPPSLSLGHEFVPLF  162



>ref|XP_009383235.1| PREDICTED: F-box/LRR-repeat MAX2 homolog [Musa acuminata subsp. 
malaccensis]
Length=707

 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 78/148 (53%), Positives = 96/148 (65%), Gaps = 7/148 (5%)
 Frame = +3

Query  111  NIHDLPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIMLPTCF  290
            ++HDLP+ IL+N+   +S  R+RN+ AL CR+W  LERATRT L LRG+VR   +LP CF
Sbjct  10   HLHDLPESILTNIFLLVSDVRSRNAMALACRRWRSLERATRTSLDLRGHVRAPFLLPACF  69

Query  291  RSVTHLDLSLLSPWG-HPLLSHANSDAA------IATDPALIAHLLRHAFPSVTSLKLYA  449
             +V HLDLSLLSPWG HP L H            ++   AL+A  L  AFP V+SL +YA
Sbjct  70   PAVAHLDLSLLSPWGHHPFLHHQQPPQHYHHHHLLSEQAALVAARLAQAFPCVSSLAIYA  129

Query  450  RNPSTLQLLAAQWPQLMKITLVRWHQRP  533
            R+PS L  LA  WP L    LVRWHQRP
Sbjct  130  RDPSVLAALAPLWPDLRAARLVRWHQRP  157



>gb|ABR16482.1| unknown [Picea sitchensis]
Length=930

 Score =   143 bits (360),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 97/151 (64%), Gaps = 10/151 (7%)
 Frame = +3

Query  108  TNIHDLPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGNVR-DLIMLPT  284
            T+I+D+P+VI+SN+ +AI   R+RN  ALVC+KW  +ERATR  L +RGN+R +L +LP 
Sbjct  32   THINDIPEVIMSNIFSAIKETRSRNRMALVCKKWHEMERATRVYLCIRGNIRNNLYLLPM  91

Query  285  CFRSVTHLDLSLLSPWGHPLLSHANSDAAIATDPALIAHLLRHAFPSVTSLKLYARNPST  464
            CF+SVT LDLSL SPWG+P L               I H L+ AFP V  + +Y RN   
Sbjct  92   CFQSVTKLDLSLCSPWGYPPLDFTTPHG------HFIGHRLKQAFPKVNDIVIYVRNARN  145

Query  465  LQLLAAQWPQLMKITLVRWHQR---PQLAAG  548
            ++ L++ WP L  + LVRWH+R   P+ A G
Sbjct  146  IEKLSSLWPCLEHVKLVRWHRRALDPESAVG  176



>ref|XP_009390668.1| PREDICTED: F-box/LRR-repeat MAX2 homolog [Musa acuminata subsp. 
malaccensis]
Length=712

 Score =   140 bits (352),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 81/178 (46%), Positives = 105/178 (59%), Gaps = 19/178 (11%)
 Frame = +3

Query  66   MATSPASTVRLHAPTNIHDLPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLT  245
            MAT+ A+ + LH      DLP+ IL+++ + +   R+RN+ +L CR+W  LER TRT L 
Sbjct  1    MATAAATGIHLH------DLPEPILTHIFSLVCDVRSRNAMSLACRRWRTLERTTRTSLV  54

Query  246  LRGNVRDLIMLPTCFRSVTHLDLSLLSPWG-HPLLSHANSDAA-----------IATDPA  389
            LRG+VR   +LPTCF +V HLDLSLLSPWG HP L H                 +A    
Sbjct  55   LRGHVRSPFLLPTCFPAVAHLDLSLLSPWGHHPFLLHHQQPPPPPPPPQFYHHNLAEQAV  114

Query  390  LIAHLLRHAFPSVTSLKLYARNPSTLQLLAAQWPQLMKITLVRWHQR-PQLAAGEELG  560
            L+A  L   FP V+SL +YAR+PS +  LA  WP L  + LVRWHQR P L  G +L 
Sbjct  115  LVAARLAQTFPRVSSLAIYARDPSVVAALAPLWPGLRAVRLVRWHQRPPALPVGADLA  172



>ref|XP_002968649.1| hypothetical protein SELMODRAFT_90091 [Selaginella moellendorffii]
 gb|EFJ29765.1| hypothetical protein SELMODRAFT_90091 [Selaginella moellendorffii]
Length=696

 Score =   131 bits (330),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 70/142 (49%), Positives = 92/142 (65%), Gaps = 5/142 (4%)
 Frame = +3

Query  108  TNIHDLPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIMLPTC  287
            T +HD+P  IL+ +IA +   R+RN+A+LVC++W  +ERATR  L LRG+   L MLPT 
Sbjct  24   TALHDIPGSILAAIIALVPDTRSRNAASLVCKEWHAMERATRRRLCLRGSSAQLHMLPTT  83

Query  288  FRSVTHLDLSLLSPWGHPLLSHANSDAAIATDPALIAHLLRHAFPSVTSLKLYARNPSTL  467
            F +V HLD+S +SPWG  L +     A  A    L A  L  AFPSV  L +YAR+ + +
Sbjct  84   FHAVRHLDVSNVSPWGTTLYA-----AHSAVCGQLTARWLNRAFPSVVDLTVYARDGTDI  138

Query  468  QLLAAQWPQLMKITLVRWHQRP  533
            QL+AA WP L  + LVRWHQRP
Sbjct  139  QLVAASWPDLETVRLVRWHQRP  160



>ref|XP_002989898.1| hypothetical protein SELMODRAFT_130722 [Selaginella moellendorffii]
 gb|EFJ08911.1| hypothetical protein SELMODRAFT_130722 [Selaginella moellendorffii]
Length=718

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 70/142 (49%), Positives = 92/142 (65%), Gaps = 5/142 (4%)
 Frame = +3

Query  108  TNIHDLPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIMLPTC  287
            T +HD+P  IL+ +IA +   R+RN+A+LVC++W  +ERATR  L LRG+   L MLPT 
Sbjct  46   TVLHDIPGSILAAIIALVPDTRSRNAASLVCKEWHAMERATRRRLCLRGSSAQLHMLPTT  105

Query  288  FRSVTHLDLSLLSPWGHPLLSHANSDAAIATDPALIAHLLRHAFPSVTSLKLYARNPSTL  467
            F +V HLD+S +SPWG  L +     A  A    L A  L  AFPSV  L +YAR+ + +
Sbjct  106  FHAVRHLDVSNVSPWGTTLYA-----AHSAVCGQLTARWLNRAFPSVVDLTVYARDGTDI  160

Query  468  QLLAAQWPQLMKITLVRWHQRP  533
            QL+AA WP L  + LVRWHQRP
Sbjct  161  QLVAASWPDLETVRLVRWHQRP  182



>ref|XP_001772278.1| predicted protein [Physcomitrella patens]
 gb|EDQ62931.1| predicted protein [Physcomitrella patens]
Length=698

 Score =   127 bits (318),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 69/167 (41%), Positives = 98/167 (59%), Gaps = 11/167 (7%)
 Frame = +3

Query  66   MATSPASTVRLHAPTNIHDLPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLT  245
            M +SP +     A T+I DLP VIL+N+IA +S+ R RN  +L CR W  +ER TRT L+
Sbjct  1    MQSSPEAA---PAGTHISDLPSVILTNIIAYVSNPRVRNCISLACRDWYFIERQTRTELS  57

Query  246  LRGNVRDLIMLPTCFRSVTHLDLSLLSPWGHPLLSHANSDAAIATDPALIAHLLRHAFPS  425
            LRGN+  +  LPTCF+ +  LDLS  SPWG  L     +          I + LR  FP+
Sbjct  58   LRGNICVMHELPTCFQQICTLDLSQCSPWGSSLFQSTQNGEE-------IGNCLRIGFPN  110

Query  426  VTSLKLYARNPSTLQLLAAQWPQLMKITLVRWHQRP-QLAAGEELGS  563
            V +L +Y R+   +Q++A  WP L  + LVRWH R  + +  ++LG+
Sbjct  111  VVNLTVYVRDALDIQMVAWIWPDLEIVKLVRWHPRAMESSEADDLGN  157



>ref|XP_006852409.1| hypothetical protein AMTR_s00021p00041390 [Amborella trichopoda]
 gb|ERN13876.1| hypothetical protein AMTR_s00021p00041390 [Amborella trichopoda]
Length=699

 Score =   121 bits (304),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 76/145 (52%), Positives = 103/145 (71%), Gaps = 4/145 (3%)
 Frame = +3

Query  99   HAPTNIHDLPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIML  278
             A T + DLPD IL ++I  ++  R+RN+ ALVCRKW  LER++R  L+LRG+ R+L  L
Sbjct  9    EAETKVQDLPDAILGSIIGCVTETRSRNAVALVCRKWAALERSSRIHLSLRGHARELPFL  68

Query  279  PTCFRSVTHLDLSLLSPWGHPLLSHANSDAAIATDPALIAHLLRHAFPSVTSLKLYARNP  458
            PT F S++HLDLS LSPWGHPLL  +N  +++      +A LL  +FP++TSL LYAR+P
Sbjct  69   PTSFTSISHLDLSSLSPWGHPLLLTSNDPSSLLL----LARLLSSSFPNLTSLCLYARSP  124

Query  459  STLQLLAAQWPQLMKITLVRWHQRP  533
            S+L LLA  WP L+ + LVR+H RP
Sbjct  125  SSLLLLAPLWPNLVSVKLVRFHPRP  149



>gb|AFW85799.1| hypothetical protein ZEAMMB73_480130 [Zea mays]
Length=705

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 73/164 (45%), Positives = 99/164 (60%), Gaps = 16/164 (10%)
 Frame = +3

Query  114  IHDLPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGNVRD---LIMLPT  284
            I DLP+ +L +++  +   R+R+ AAL C + L  ERATR  L+LRG+ R    L + PT
Sbjct  14   ILDLPEPLLLHILGFLDDARSRHRAALACHRLLAAERATRAALSLRGDPRSNAFLFLRPT  73

Query  285  -CFRSVTHLDLSLLSPWGHPLLSHA--NSDAA--------IATDPALIAHLLRHAFPSVT  431
             CF ++  LDLSL+SPWGHP LS A  ++DA         +A   A IA  L + FP+V+
Sbjct  74   FCFPALERLDLSLVSPWGHPFLSSAAPSADAVAPSVTAEEVAEQNAFIAARLAYCFPAVS  133

Query  432  SLKLYARNPSTLQLLAAQW-PQLMKITLVRWHQR-PQLAAGEEL  557
            SL +Y R+P+TL  L   W   L  + LVRWHQR P L AG +L
Sbjct  134  SLAVYCRDPTTLASLTPHWRSGLRSVKLVRWHQRPPGLDAGADL  177



>ref|XP_004964817.1| PREDICTED: F-box/LRR-repeat MAX2 homolog [Setaria italica]
Length=706

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 69/164 (42%), Positives = 100/164 (61%), Gaps = 16/164 (10%)
 Frame = +3

Query  114  IHDLPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGNVRD---LIMLPT  284
            I DLP+ +L +++  ++  R+R+ AAL C + L  ERATR  L+LRG+ R    L++ P 
Sbjct  14   ILDLPEPLLLHILGFLTDPRSRHRAALACHRLLSAERATRAALSLRGDPRSPTFLLLGPA  73

Query  285  -CFRSVTHLDLSLLSPWGHPLLSH----------ANSDAAIATDPALIAHLLRHAFPSVT  431
             CF ++  LDLSL+SPWGHP LS            +++  +A   A IA  L + FP+V+
Sbjct  74   FCFPALERLDLSLVSPWGHPFLSEAAPAADGPAPTSTEEEVAQQNAFIAEHLANCFPAVS  133

Query  432  SLKLYARNPSTLQLLAAQW-PQLMKITLVRWHQR-PQLAAGEEL  557
            SL +Y R+P+TL  +  QW  +L  + LVRWHQR P L AG +L
Sbjct  134  SLAVYCRDPTTLDSITPQWRGRLRSVKLVRWHQRPPGLDAGADL  177



>ref|XP_003564315.1| PREDICTED: F-box/LRR-repeat MAX2 homolog [Brachypodium distachyon]
Length=709

 Score =   112 bits (280),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 73/168 (43%), Positives = 95/168 (57%), Gaps = 20/168 (12%)
 Frame = +3

Query  114  IHDLPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGNVRD--LIMLPT-  284
            I DLP+ +L  ++  +   R+R+ AAL C K L +ERATR  L+LRG+ R    + LP  
Sbjct  14   ILDLPEPLLHLILGFLHDPRSRHRAALACHKMLAVERATRAALSLRGDPRSPPFLFLPEG  73

Query  285  -CFRSVTHLDLSLLSPWGHPLLS--------------HANSDAAIATDPALIAHLLRHAF  419
             CF ++  LDLSL+SPWGHPLLS              H +    IA   A IA  L H F
Sbjct  74   FCFPALERLDLSLVSPWGHPLLSSGAPSSSSSSSSGYHPHHPEEIAEQNAYIAARLAHCF  133

Query  420  PSVTSLKLYARNPSTLQLLAAQW-PQLMKITLVRWHQR-PQLAAGEEL  557
            P+V+SL +Y R+P TL  L   W   L  + LVRWHQR P L +G +L
Sbjct  134  PAVSSLAVYCRDPFTLASLTPHWRGTLRSVKLVRWHQRPPGLPSGADL  181



>ref|NP_001174608.1| Os06g0154200 [Oryza sativa Japonica Group]
 sp|Q5VMP0.2|MAX2_ORYSJ RecName: Full=F-box/LRR-repeat MAX2 homolog; AltName: Full=F-box 
and leucine-rich repeat MAX2 homolog; AltName: Full=Protein 
DWARF-3 [Oryza sativa Japonica Group]
 dbj|BAD69288.1| F-box protein ORE9-like [Oryza sativa Japonica Group]
 dbj|BAH93336.1| Os06g0154200 [Oryza sativa Japonica Group]
Length=720

 Score =   103 bits (258),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 67/166 (40%), Positives = 93/166 (56%), Gaps = 26/166 (16%)
 Frame = +3

Query  114  IHDLPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGNVRD--LIMLPTC  287
            I DLP+ +L ++++ ++  R+R+ AAL C +    ERATR+ L+LRG+ R    + L   
Sbjct  17   ILDLPEPLLLHILSFLTDVRSRHRAALACGRMRAAERATRSELSLRGDPRSPGFLFLSHA  76

Query  288  FR--SVTHLDLSLLSPWGHPLLS---------------------HANSDAAIATDPALIA  398
            FR  ++ HLDLSL+SPWGHPLLS                     +     AI+   A IA
Sbjct  77   FRFPALEHLDLSLVSPWGHPLLSSVPPCGGGGGGAPSASSSSGMNVYHPEAISEQNAFIA  136

Query  399  HLLRHAFPSVTSLKLYARNPSTLQLLAAQW-PQLMKITLVRWHQRP  533
              L   FP+VTSL +Y R+P+TL  L   W   L ++ LVRWHQRP
Sbjct  137  ARLAGCFPAVTSLAVYCRDPTTLANLTPHWQASLRRVKLVRWHQRP  182



>ref|XP_002436499.1| hypothetical protein SORBIDRAFT_10g003790 [Sorghum bicolor]
 gb|EER87866.1| hypothetical protein SORBIDRAFT_10g003790 [Sorghum bicolor]
Length=700

 Score =   103 bits (257),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 66/155 (43%), Positives = 89/155 (57%), Gaps = 17/155 (11%)
 Frame = +3

Query  144  NVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIML----PT-CFRSVTHL  308
            +++  ++  R+R+  AL C + L  ERATR  L+LRG+ R  + L    PT CF ++  L
Sbjct  21   HILGFLTDARSRHRVALACHRLLAAERATRAALSLRGDPRSDVFLYLIRPTFCFPALERL  80

Query  309  DLSLLSPWGHPLLSHANSDAAIAT----------DPALIAHLLRHAFPSVTSLKLYARNP  458
            DLSL+SPWGHP LS A   A                ALIA  L + FP+V+SL +Y R+P
Sbjct  81   DLSLVSPWGHPFLSSAAPSADAVAPAVAAEEVAGQNALIAARLAYCFPAVSSLAVYCRDP  140

Query  459  STLQLLAAQW-PQLMKITLVRWHQR-PQLAAGEEL  557
            +TL  L   W  +L  + LVRWHQR P L AG +L
Sbjct  141  TTLASLTPHWRSRLRSVKLVRWHQRPPGLDAGADL  175



>ref|XP_006411529.1| hypothetical protein EUTSA_v10017925mg [Eutrema salsugineum]
 gb|ESQ52982.1| hypothetical protein EUTSA_v10017925mg [Eutrema salsugineum]
Length=688

 Score = 80.5 bits (197),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 49/64 (77%), Gaps = 0/64 (0%)
 Frame = +3

Query  99   HAPTNIHDLPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIML  278
            ++ T + DLPDVILSN+ A +S  R RNS +LV RK+L LER+TR+ LTLRGN RDL +L
Sbjct  4    YSTTTLSDLPDVILSNICALVSDSRARNSLSLVSRKFLALERSTRSHLTLRGNARDLHLL  63

Query  279  PTCF  290
            P CF
Sbjct  64   PGCF  67



>ref|XP_006656655.1| PREDICTED: F-box/LRR-repeat MAX2 homolog, partial [Oryza brachyantha]
Length=697

 Score = 73.6 bits (179),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 47/141 (33%), Positives = 71/141 (50%), Gaps = 1/141 (1%)
 Frame = +3

Query  114  IHDLPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIMLPTCFR  293
            I DLP+ +L ++++ ++  R+R+ AA+ C +    ERATR  L LRG+ R    L     
Sbjct  15   ILDLPEPLLLHIMSFVTDVRSRHRAAMACGRMRAAERATRGELALRGDPRSPGFLFLGPG  74

Query  294  SVTHLDLSLLSPWGHPLLSHANSDAAIATDPALIAHLLRHAFPSVTSLKLYARNPSTLQL  473
                      +      +   +    I+   A IA  L   FP+V+SL +Y R+P+TL  
Sbjct  75   LWGPAGGGGGASSSSAAVQQFHHTEVISEQNAFIAARLEGCFPAVSSLAIYCRDPTTLAN  134

Query  474  LAAQWP-QLMKITLVRWHQRP  533
            L  +W   L  + LVRWHQRP
Sbjct  135  LPPRWQGSLRGVKLVRWHQRP  155



>ref|XP_002534413.1| hypothetical protein RCOM_0438600 [Ricinus communis]
 gb|EEF27970.1| hypothetical protein RCOM_0438600 [Ricinus communis]
Length=91

 Score = 63.9 bits (154),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = +3

Query  402  LLRHAFPSVTSLKLYARNPSTLQLLAAQWPQLMKITLVRWHQRPQLAAGEELGSFF  569
            ++  AFP V SL +Y R+ STLQLLA  WP L K+ LVRWHQR  +  G +  +FF
Sbjct  1    MIHRAFPYVASLTVYVRSRSTLQLLAPLWPTLHKVKLVRWHQRSPMPPGSDFAAFF  56



>ref|XP_004301055.1| PREDICTED: F-box/LRR-repeat MAX2 homolog A-like [Fragaria vesca 
subsp. vesca]
Length=151

 Score = 63.9 bits (154),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = +3

Query  393  IAHLLRHAFPSVTSLKLYARNPSTLQLLAAQWPQLMKITLVRWHQRPQLAAGEELGSFF  569
            +AH L  AFPSVTSL +Y R+ ST++++ + WP+L ++ LVRWHQRPQ   G +    F
Sbjct  31   VAHRLCLAFPSVTSLTVYFRSSSTVEIVFSLWPRLRRLKLVRWHQRPQSNLGADFDPLF  89



>ref|XP_009335455.1| PREDICTED: F-box protein MAX2-like [Pyrus x bretschneideri]
Length=355

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 44/117 (38%), Positives = 59/117 (50%), Gaps = 15/117 (13%)
 Frame = +3

Query  213  VLERATRTCLTLRGNVRDLIMLPTCFRSVTHLD-----LSLLSPWGHPL-----LSHANS  362
            V+ R+  T   L  N    + +P  +R+V         L   SPW              +
Sbjct  3    VISRSATTSSNLNPNA--PMFVPLAYRTVEDFSAEWWALVQSSPWFQDYWLQERFQDPQN  60

Query  363  DAAIATDPALIAHLLRHAFPSVTSLKLYARNPSTLQLLAAQWPQLMKITLVRWHQRP  533
            D A  TDP L    LR AF SVTSL +Y+R+PST+Q ++  WP L ++ LVRWHQRP
Sbjct  61   DVA-NTDPLL--QRLRDAFLSVTSLTVYSRSPSTVQNVSRLWPGLRRVKLVRWHQRP  114



>dbj|BAD67717.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAD67679.1| hypothetical protein [Oryza sativa Japonica Group]
Length=313

 Score = 60.8 bits (146),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 55/115 (48%), Gaps = 21/115 (18%)
 Frame = +3

Query  252  GNVRDLIMLPT-CFRSVTHLDLSLLSPWGHPLLSHANSDA-------------------A  371
            G+   L + PT CF  +  LDLSL+S WGHPLLS                         A
Sbjct  153  GSPGFLFLSPTFCFPMLDRLDLSLVSLWGHPLLSFVRPGGGGAPSLTSTSSRMNLYHPEA  212

Query  372  IATDPALIAHLLRHAFPSVTSLKLYARNPSTLQLLAAQW-PQLMKITLVRWHQRP  533
            I+   A IA  L    P+VTSL +Y  +P+TL  L   W   L ++ LVRWHQ P
Sbjct  213  ISEQNASIAARLVGCLPAVTSLAVYCCDPTTLANLTPHWQASLYRVKLVRWHQCP  267



>gb|KDO71172.1| hypothetical protein CISIN_1g039096mg, partial [Citrus sinensis]
Length=554

 Score = 58.2 bits (139),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 46/66 (70%), Gaps = 3/66 (5%)
 Frame = +3

Query  222  RATRTCLTLRGNVRDLIMLPTCFRSVTHLDLSLLSPWGHPLLSHANSDAAIATDPALIAH  401
            RATRT +TLRGN  +L ++P CF +VT+L LS +SPWGH   S   S ++ + DP L+A 
Sbjct  2    RATRTSITLRGNACNLNIVPLCFDAVTNLQLSNISPWGH---SLLFSPSSSSMDPRLLAD  58

Query  402  LLRHAF  419
            LL+ +F
Sbjct  59   LLQMSF  64



>ref|XP_002301562.2| hypothetical protein POPTR_0002s22680g [Populus trichocarpa]
 gb|EEE80835.2| hypothetical protein POPTR_0002s22680g [Populus trichocarpa]
Length=316

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 45/78 (58%), Gaps = 7/78 (9%)
 Frame = +3

Query  273  MLPTCFRSVTHLDLSLLSPWGHP-LLSHANSDAAIATDPALIAHLLRHAFPSVTSLKLYA  449
            M+PTCF S+THLD SLLS WG   LLS A S      DP  + H L  AFP  TS+ +Y+
Sbjct  1    MIPTCFISMTHLDPSLLSRWGRSDLLSFATS------DPFPLHHRLHLAFPLATSITIYS  54

Query  450  RNPSTLQLLAAQWPQLMK  503
            R+   +  +   +P + K
Sbjct  55   RDTEHIPPVLQAYPSVSK  72



>ref|XP_008390798.1| PREDICTED: F-box/LRR-repeat protein 4 [Malus domestica]
Length=614

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 39/142 (27%), Positives = 72/142 (51%), Gaps = 11/142 (8%)
 Frame = +3

Query  123  LPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGN-VRDLI--MLPTCFR  293
            LPD ++  V   +    +R++ +LVC++WL LER +RT L +      DL+  +L   FR
Sbjct  11   LPDELIFEVFRRLDSKPSRDACSLVCKRWLALERLSRTTLRIGATGSPDLVVDLLARLFR  70

Query  294  SV--THLDLSL-LSPWGHPLLSH-----ANSDAAIATDPALIAHLLRHAFPSVTSLKLYA  449
            +V   H+D  L +S   HP+++       NS     TD A ++ +  H+      L   +
Sbjct  71   NVRTVHIDERLNISLPTHPVITQPIRSIPNSGRRRGTDIAAVSSVRLHSANGSGVLDSNS  130

Query  450  RNPSTLQLLAAQWPQLMKITLV  515
             + + +  +   +P+L K++L+
Sbjct  131  LSDAGMTAIGDGFPKLEKLSLI  152



>ref|XP_007154190.1| hypothetical protein PHAVU_003G097600g [Phaseolus vulgaris]
 gb|ESW26184.1| hypothetical protein PHAVU_003G097600g [Phaseolus vulgaris]
Length=584

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 24/64 (38%), Positives = 38/64 (59%), Gaps = 0/64 (0%)
 Frame = +3

Query  117  HDLPDVILSNVIAAISHDRTRNSAALVCRKWLVLERATRTCLTLRGNVRDLIMLPTCFRS  296
            + LPD ++  + + +    TR++ +LVCR+W  LER TRT L +      L +LPT F S
Sbjct  9    NSLPDELIVEIFSHLQSKPTRDACSLVCRRWFRLERRTRTTLRIGATHLFLDLLPTRFTS  68

Query  297  VTHL  308
            + +L
Sbjct  69   LRNL  72



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 669314531515