BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002E14

Length=227
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011070985.1|  PREDICTED: cytochrome P450 704B1                 84.7    4e-17   Sesamum indicum [beniseed]
ref|XP_008389448.1|  PREDICTED: cytochrome P450 704B1                 79.3    3e-15   Malus domestica [apple tree]
ref|XP_004985563.1|  PREDICTED: cytochrome P450 704C1-like isofor...  76.6    3e-14   Setaria italica
ref|XP_004985564.1|  PREDICTED: cytochrome P450 704C1-like isofor...  76.6    3e-14   Setaria italica
ref|XP_002522465.1|  cytochrome P450, putative                        76.6    3e-14   Ricinus communis
ref|XP_002465796.1|  hypothetical protein SORBIDRAFT_01g045960        76.6    3e-14   Sorghum bicolor [broomcorn]
ref|XP_010102176.1|  Cytochrome P450 704C1                            76.3    4e-14   
ref|XP_003611900.1|  Cytochrome P450                                  75.1    9e-14   Medicago truncatula
ref|XP_009413465.1|  PREDICTED: cytochrome P450 704B1                 75.1    1e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001049092.2|  Os03g0168600                                     72.4    1e-13   
ref|XP_002887239.1|  oxygen binding protein                           75.1    1e-13   Arabidopsis lyrata subsp. lyrata
ref|NP_177109.3|  cytochrome P450, family 704, subfamily B, polyp...  75.1    1e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002312255.2|  cytochrome P450 family protein                   74.7    1e-13   
ref|XP_004298418.1|  PREDICTED: cytochrome P450 704B1                 74.3    2e-13   Fragaria vesca subsp. vesca
ref|XP_006391009.1|  hypothetical protein EUTSA_v10018405mg           74.3    2e-13   Eutrema salsugineum [saltwater cress]
dbj|BAK08270.1|  predicted protein                                    74.3    2e-13   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EYU28779.1|  hypothetical protein MIMGU_mgv1a004727mg              73.9    2e-13   Erythranthe guttata [common monkey flower]
ref|XP_006651077.1|  PREDICTED: cytochrome P450 704C1-like            73.2    2e-13   Oryza brachyantha
ref|XP_010651872.1|  PREDICTED: cytochrome P450 704B1                 73.9    2e-13   Vitis vinifera
ref|NP_001130648.1|  male sterile26                                   73.9    2e-13   Zea mays [maize]
gb|ACG35470.1|  cytochrome P450 CYP704B12v2                           73.9    3e-13   Zea mays [maize]
gb|KFK41374.1|  hypothetical protein AALP_AA2G122000                  73.9    3e-13   Arabis alpina [alpine rockcress]
ref|XP_010415594.1|  PREDICTED: cytochrome P450 704B1-like            73.9    3e-13   Camelina sativa [gold-of-pleasure]
ref|XP_006302101.1|  hypothetical protein CARUB_v10020091mg           73.9    3e-13   
ref|XP_011017522.1|  PREDICTED: cytochrome P450 704B1                 73.9    3e-13   Populus euphratica
ref|XP_006827309.1|  hypothetical protein AMTR_s00010p00266280        73.2    4e-13   
gb|EAZ25728.1|  hypothetical protein OsJ_09563                        73.2    5e-13   Oryza sativa Japonica Group [Japonica rice]
gb|EAY88702.1|  hypothetical protein OsI_10177                        73.2    5e-13   Oryza sativa Indica Group [Indian rice]
gb|AAL84318.1|AC073556_35  putative plant cytochrome P-450 protein    73.2    6e-13   Oryza sativa Japonica Group [Japonica rice]
gb|AJD25236.1|  cytochrome P450 CYP704B37                             72.4    7e-13   Salvia miltiorrhiza [Chinese salvia]
ref|XP_009105494.1|  PREDICTED: cytochrome P450 704B1                 72.4    8e-13   Brassica rapa
ref|XP_008778343.1|  PREDICTED: cytochrome P450 704B1                 72.4    9e-13   
gb|EPS61936.1|  hypothetical protein M569_12857                       72.4    9e-13   Genlisea aurea
ref|XP_003528679.1|  PREDICTED: cytochrome P450 704C1-like            72.4    1e-12   Glycine max [soybeans]
ref|XP_010551418.1|  PREDICTED: cytochrome P450 704B1                 72.4    1e-12   
ref|XP_003609660.1|  Cytochrome P450                                  72.0    1e-12   Medicago truncatula
ref|XP_010683141.1|  PREDICTED: cytochrome P450 704B1                 72.0    1e-12   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010258425.1|  PREDICTED: cytochrome P450 704B1                 72.0    1e-12   Nelumbo nucifera [Indian lotus]
emb|CDY40931.1|  BnaC06g30690D                                        72.0    1e-12   Brassica napus [oilseed rape]
ref|XP_007046039.1|  Cytochrome P450, family 704, subfamily B, po...  71.2    2e-12   
ref|XP_007046038.1|  Cytochrome P450, family 704, subfamily B, po...  71.2    2e-12   
ref|XP_007225718.1|  hypothetical protein PRUPE_ppa004298mg           71.2    2e-12   
ref|XP_007135410.1|  hypothetical protein PHAVU_010G126900g           70.9    3e-12   Phaseolus vulgaris [French bean]
ref|XP_008221727.1|  PREDICTED: cytochrome P450 704B1                 70.9    3e-12   Prunus mume [ume]
ref|XP_010470937.1|  PREDICTED: cytochrome P450 704B1-like            70.5    4e-12   Camelina sativa [gold-of-pleasure]
ref|XP_010511987.1|  PREDICTED: cytochrome P450 704B1                 70.5    5e-12   Camelina sativa [gold-of-pleasure]
ref|XP_009758170.1|  PREDICTED: cytochrome P450 704B1                 69.7    8e-12   Nicotiana sylvestris
ref|XP_004510551.1|  PREDICTED: cytochrome P450 704C1-like            69.7    8e-12   
ref|XP_004138991.1|  PREDICTED: cytochrome P450 704C1-like            69.3    1e-11   Cucumis sativus [cucumbers]
gb|KGN61391.1|  hypothetical protein Csa_2G108690                     69.3    1e-11   Cucumis sativus [cucumbers]
gb|KJB50631.1|  hypothetical protein B456_008G180000                  69.3    1e-11   Gossypium raimondii
emb|CDP00359.1|  unnamed protein product                              68.6    2e-11   Coffea canephora [robusta coffee]
ref|XP_010044484.1|  PREDICTED: cytochrome P450 704B1                 68.2    3e-11   Eucalyptus grandis [rose gum]
gb|EMS55452.1|  Cytochrome P450 86B1                                  67.4    4e-11   Triticum urartu
gb|KHN01450.1|  Cytochrome P450 704C1                                 67.4    4e-11   Glycine soja [wild soybean]
gb|EMT08626.1|  Cytochrome P450 704C1                                 67.4    6e-11   
ref|XP_003558727.1|  PREDICTED: cytochrome P450 704B1                 67.0    7e-11   Brachypodium distachyon [annual false brome]
gb|ADG34845.1|  cytochrome P450 protein                               65.5    3e-10   Vanda hybrid cultivar
ref|XP_009629443.1|  PREDICTED: cytochrome P450 704B1                 65.1    3e-10   Nicotiana tomentosiformis
ref|XP_002978645.1|  hypothetical protein SELMODRAFT_418431           64.3    6e-10   
gb|KDP41226.1|  hypothetical protein JCGZ_15633                       63.9    7e-10   Jatropha curcas
ref|XP_008441698.1|  PREDICTED: cytochrome P450 704B1                 63.5    1e-09   Cucumis melo [Oriental melon]
ref|XP_006475855.1|  PREDICTED: cytochrome P450 704C1-like            62.0    4e-09   
gb|KDO80235.1|  hypothetical protein CISIN_1g035880mg                 62.0    4e-09   Citrus sinensis [apfelsine]
ref|XP_006366710.1|  PREDICTED: cytochrome P450 704C1-like            59.7    2e-08   Solanum tuberosum [potatoes]
ref|XP_006450915.1|  hypothetical protein CICLE_v10010274mg           59.7    2e-08   
ref|XP_002979701.1|  hypothetical protein SELMODRAFT_111270           58.9    4e-08   
gb|ACD10924.1|  cytochrome P450                                       57.8    1e-07   Capsicum annuum
ref|XP_004228374.1|  PREDICTED: cytochrome P450 704B1                 57.8    1e-07   Solanum lycopersicum
ref|XP_002988354.1|  hypothetical protein SELMODRAFT_127881           55.8    5e-07   
ref|XP_001764611.1|  predicted protein                                52.0    1e-05   



>ref|XP_011070985.1| PREDICTED: cytochrome P450 704B1 [Sesamum indicum]
Length=529

 Score = 84.7 bits (208),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 30/63 (48%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = +3

Query  39   SMETLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMRDWLVGYLXXS  218
            ++ T ++ L +++F W+FIHRL QR   GP++WP +GA++EQ+ NY RM DW+V YL  S
Sbjct  7    NLSTFIITLSIMLFSWIFIHRLKQRNSKGPKTWPFLGAAIEQLVNYDRMHDWMVEYLSQS  66

Query  219  YSV  227
             +V
Sbjct  67   RTV  69



>ref|XP_008389448.1| PREDICTED: cytochrome P450 704B1 [Malus domestica]
Length=531

 Score = 79.3 bits (194),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 34/64 (53%), Positives = 46/64 (72%), Gaps = 1/64 (2%)
 Frame = +3

Query  36   SSMETLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMRDWLVGYLXX  215
            SS + L + L +++  W+FIHR SQR   GP++WP++GA++EQ TNY RM DWLV YL  
Sbjct  13   SSQDGLFMVLCMVL-SWIFIHRWSQRNKKGPKTWPLVGAAIEQFTNYDRMHDWLVKYLSE  71

Query  216  SYSV  227
            S SV
Sbjct  72   SNSV  75



>ref|XP_004985563.1| PREDICTED: cytochrome P450 704C1-like isoform X1 [Setaria italica]
Length=542

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 32/57 (56%), Positives = 41/57 (72%), Gaps = 0/57 (0%)
 Frame = +3

Query  57   LALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMRDWLVGYLXXSYSV  227
            +A+ L++  W+ +H+ S RK  GPRSWPVIGA+VEQ+ NY RM DWLV YL    SV
Sbjct  22   IAIFLVLLSWILVHKWSLRKQKGPRSWPVIGATVEQLRNYHRMHDWLVEYLSKHRSV  78



>ref|XP_004985564.1| PREDICTED: cytochrome P450 704C1-like isoform X2 [Setaria italica]
Length=541

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 32/57 (56%), Positives = 41/57 (72%), Gaps = 0/57 (0%)
 Frame = +3

Query  57   LALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMRDWLVGYLXXSYSV  227
            +A+ L++  W+ +H+ S RK  GPRSWPVIGA+VEQ+ NY RM DWLV YL    SV
Sbjct  22   IAIFLVLLSWILVHKWSLRKQKGPRSWPVIGATVEQLRNYHRMHDWLVEYLSKHRSV  78



>ref|XP_002522465.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF39957.1| cytochrome P450, putative [Ricinus communis]
Length=536

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 28/53 (53%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = +3

Query  51   LVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMRDWLVGYL  209
            +VL +  ++  W+FI+R +QR   GP+SWP++GA++EQ+TNY RM DWLV YL
Sbjct  21   MVLMIACLVLSWMFIYRWTQRNKKGPKSWPIVGAAIEQLTNYDRMHDWLVEYL  73



>ref|XP_002465796.1| hypothetical protein SORBIDRAFT_01g045960 [Sorghum bicolor]
 gb|EER92794.1| hypothetical protein SORBIDRAFT_01g045960 [Sorghum bicolor]
Length=538

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 32/57 (56%), Positives = 41/57 (72%), Gaps = 0/57 (0%)
 Frame = +3

Query  57   LALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMRDWLVGYLXXSYSV  227
            +A+ L++  W  +HR S RK  GPRSWPVIGA++EQ+ NY RM DWLVGYL    +V
Sbjct  22   IAILLVVLSWALVHRWSLRKQKGPRSWPVIGATLEQLRNYHRMHDWLVGYLSRHKTV  78



>ref|XP_010102176.1| Cytochrome P450 704C1 [Morus notabilis]
 gb|EXB92426.1| Cytochrome P450 704C1 [Morus notabilis]
Length=565

 Score = 76.3 bits (186),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 30/58 (52%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = +3

Query  54   VLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMRDWLVGYLXXSYSV  227
            VL +   +  W+ IHR SQR   GP++WP++GA++EQ+TNY RM DW+V YL  S SV
Sbjct  21   VLVIACAILSWILIHRWSQRNKKGPKTWPLVGAAIEQLTNYDRMHDWIVPYLSESKSV  78



>ref|XP_003611900.1| Cytochrome P450 [Medicago truncatula]
 gb|AES94858.1| cytochrome P450 family protein [Medicago truncatula]
Length=531

 Score = 75.1 bits (183),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 31/66 (47%), Positives = 46/66 (70%), Gaps = 1/66 (2%)
 Frame = +3

Query  30   KVSSMETLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMRDWLVGYL  209
            + ++M  LV+ + +I F W+F+HR SQR   GP++WP +GA++EQ+ NY RM DWLV Y 
Sbjct  12   RYNNMGGLVILICMI-FSWIFLHRWSQRNKKGPKTWPFLGAAIEQLMNYDRMHDWLVQYF  70

Query  210  XXSYSV  227
              S +V
Sbjct  71   SMSKTV  76



>ref|XP_009413465.1| PREDICTED: cytochrome P450 704B1 [Musa acuminata subsp. malaccensis]
Length=519

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 30/55 (55%), Positives = 38/55 (69%), Gaps = 0/55 (0%)
 Frame = +3

Query  63   LGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMRDWLVGYLXXSYSV  227
            L L +  WVFIHR  QR    P++WPVIG+++EQ+ NY RM DWL GYL  S +V
Sbjct  15   LALFLLSWVFIHRWKQRHQRCPKTWPVIGSTIEQLKNYDRMHDWLAGYLSESKTV  69



>ref|NP_001049092.2| Os03g0168600 [Oryza sativa Japonica Group]
 dbj|BAF11006.2| Os03g0168600 [Oryza sativa Japonica Group]
Length=188

 Score = 72.4 bits (176),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = +3

Query  54   VLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMRDWLVGYLXXSYSV  227
            ++A+ L++  W+ +H+ S R   GPRSWP+IGA+VEQ+ NY RM DWLV YL    +V
Sbjct  25   LIAIFLVVLSWILVHKWSLRNQKGPRSWPIIGATVEQLKNYHRMHDWLVEYLSKDRTV  82



>ref|XP_002887239.1| oxygen binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63498.1| oxygen binding protein [Arabidopsis lyrata subsp. lyrata]
Length=519

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 28/60 (47%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = +3

Query  48   TLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMRDWLVGYLXXSYSV  227
            +L L +  ++  W+F+HR  QR   GP++WP++GA++EQ+TN+ RM DWLV YL  S +V
Sbjct  2    SLCLVIACMVTSWIFLHRWGQRNKSGPKTWPLVGAAIEQLTNFDRMHDWLVEYLYNSRTV  61



>ref|NP_177109.3| cytochrome P450, family 704, subfamily B, polypeptide 1 [Arabidopsis 
thaliana]
 sp|Q9C788.1|C70B1_ARATH RecName: Full=Cytochrome P450 704B1 [Arabidopsis thaliana]
 gb|AAG60111.1|AC073178_22 cytochrome P450, putative [Arabidopsis thaliana]
 gb|AEE34933.1| cytochrome P450, family 704, subfamily B, polypeptide 1 [Arabidopsis 
thaliana]
Length=524

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 28/60 (47%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = +3

Query  48   TLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMRDWLVGYLXXSYSV  227
            +L L +  ++  W+F+HR  QR   GP++WP++GA++EQ+TN+ RM DWLV YL  S +V
Sbjct  2    SLCLVIACMVTSWIFLHRWGQRNKSGPKTWPLVGAAIEQLTNFDRMHDWLVEYLYNSRTV  61



>ref|XP_002312255.2| cytochrome P450 family protein [Populus trichocarpa]
 gb|EEE89622.2| cytochrome P450 family protein [Populus trichocarpa]
Length=482

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 27/53 (51%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = +3

Query  51   LVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMRDWLVGYL  209
            +VL L  ++  W+FIHR +QR+  GP++WP++GA++EQ  NY +M DWLV YL
Sbjct  21   MVLMLACMVLSWIFIHRWNQRQKRGPKTWPIVGAAIEQFMNYNQMHDWLVKYL  73



>ref|XP_004298418.1| PREDICTED: cytochrome P450 704B1 [Fragaria vesca subsp. vesca]
Length=538

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 30/57 (53%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = +3

Query  57   LALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMRDWLVGYLXXSYSV  227
            L L  ++  W+ IHR SQR   GP++WP++GA++EQ+ NY RM DWLV YL  S SV
Sbjct  22   LMLACMVLSWIVIHRWSQRNRKGPKTWPLVGAAIEQLVNYHRMHDWLVKYLSESNSV  78



>ref|XP_006391009.1| hypothetical protein EUTSA_v10018405mg [Eutrema salsugineum]
 gb|ESQ28295.1| hypothetical protein EUTSA_v10018405mg [Eutrema salsugineum]
Length=519

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 28/60 (47%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +3

Query  48   TLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMRDWLVGYLXXSYSV  227
            ++ + L  ++  W+F+HR  QRK  GP++WP++GA++EQ+TN+ RM DWLV YL  S +V
Sbjct  2    SIWIVLACMVTSWIFLHRWGQRKQRGPKTWPLVGAAIEQLTNFDRMHDWLVEYLYDSRTV  61



>dbj|BAK08270.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=551

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 31/57 (54%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = +3

Query  57   LALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMRDWLVGYLXXSYSV  227
            +A+ L+   W+ +HR S RK  GPRSWPVIGA++EQ+ NY RM DWLV YL    +V
Sbjct  27   MAIFLVFLSWILVHRWSLRKQKGPRSWPVIGATLEQLRNYYRMHDWLVEYLSKYRTV  83



>gb|EYU28779.1| hypothetical protein MIMGU_mgv1a004727mg [Erythranthe guttata]
Length=512

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 27/62 (44%), Positives = 47/62 (76%), Gaps = 1/62 (2%)
 Frame = +3

Query  42   METLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMRDWLVGYLXXSY  221
            M+T+ + + +++  W+ IHR++QR+G GP++WP +GA++EQ+ NY RM DW++ YL  S 
Sbjct  1    MQTIAVFVCMLL-SWILIHRMNQRRGKGPKTWPFLGAALEQLINYDRMHDWILNYLSQSR  59

Query  222  SV  227
            +V
Sbjct  60   TV  61



>ref|XP_006651077.1| PREDICTED: cytochrome P450 704C1-like [Oryza brachyantha]
Length=350

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 29/58 (50%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = +3

Query  54   VLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMRDWLVGYLXXSYSV  227
            ++A+ L++  W+ +H+ S R   GPRSWP+IGA+VEQ+ NY RM DWLV YL    +V
Sbjct  25   LIAIFLVVLSWILVHKWSLRNQKGPRSWPIIGATVEQLKNYHRMHDWLVEYLSKDRTV  82



>ref|XP_010651872.1| PREDICTED: cytochrome P450 704B1 [Vitis vinifera]
Length=529

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 29/58 (50%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = +3

Query  54   VLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMRDWLVGYLXXSYSV  227
            +L L   +  W+ IHR SQR   GP++WP++GA++EQ+ NY RM DWLV YL  S +V
Sbjct  16   ILMLACTVLTWIAIHRWSQRHTKGPKTWPLVGAAIEQLINYDRMHDWLVKYLSKSRTV  73



>ref|NP_001130648.1| male sterile26 [Zea mays]
 gb|AAK52956.1|AF366297_1 cytochrome P450-like protein [Zea mays]
 gb|ACN29205.1| unknown [Zea mays]
 tpg|DAA43588.1| TPA: male sterile26 [Zea mays]
Length=543

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 41/57 (72%), Gaps = 0/57 (0%)
 Frame = +3

Query  57   LALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMRDWLVGYLXXSYSV  227
            +AL L++  W+ + R S RK  GPRSWPVIGA+VEQ+ NY RM DWLVGYL    +V
Sbjct  24   IALLLVVLSWILVQRWSLRKQKGPRSWPVIGATVEQLRNYHRMHDWLVGYLSRHRTV  80



>gb|ACG35470.1| cytochrome P450 CYP704B12v2 [Zea mays]
Length=542

 Score = 73.9 bits (180),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 41/57 (72%), Gaps = 0/57 (0%)
 Frame = +3

Query  57   LALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMRDWLVGYLXXSYSV  227
            +AL L++  W+ + R S RK  GPRSWPVIGA+VEQ+ NY RM DWLVGYL    +V
Sbjct  24   IALLLVVLSWILVQRWSLRKQKGPRSWPVIGATVEQLRNYHRMHDWLVGYLSRHRTV  80



>gb|KFK41374.1| hypothetical protein AALP_AA2G122000 [Arabis alpina]
Length=517

 Score = 73.9 bits (180),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 26/59 (44%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = +3

Query  51   LVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMRDWLVGYLXXSYSV  227
            +++ L  ++  W+F+HR  QR   GP++WP++GA++EQ+TN+ RM DW+V YL  S +V
Sbjct  2    MLMVLACMLISWIFLHRWGQRNKRGPKTWPLVGAAIEQLTNFDRMHDWIVEYLYDSRTV  60



>ref|XP_010415594.1| PREDICTED: cytochrome P450 704B1-like [Camelina sativa]
Length=522

 Score = 73.9 bits (180),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 27/60 (45%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = +3

Query  48   TLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMRDWLVGYLXXSYSV  227
            ++ L +  ++  W+F+HR  QR   GP++WP++GA++EQ+TN+ RM DWLV YL  S +V
Sbjct  2    SMCLVVACMVTSWIFLHRWGQRNKSGPKTWPLVGAAIEQLTNFDRMHDWLVEYLYNSRTV  61



>ref|XP_006302101.1| hypothetical protein CARUB_v10020091mg [Capsella rubella]
 gb|EOA34999.1| hypothetical protein CARUB_v10020091mg [Capsella rubella]
Length=549

 Score = 73.9 bits (180),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 29/61 (48%), Positives = 44/61 (72%), Gaps = 4/61 (7%)
 Frame = +3

Query  57   LALGLIMFC----WVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMRDWLVGYLXXSYS  224
            ++L LI+ C    W+F+HR  QR   GP++WP++GA++EQ+TN+ RM DW+V YL  S +
Sbjct  1    MSLCLIVACMVTSWIFLHRWGQRNKSGPKTWPLVGAAIEQLTNFDRMHDWIVEYLYESRT  60

Query  225  V  227
            V
Sbjct  61   V  61



>ref|XP_011017522.1| PREDICTED: cytochrome P450 704B1 [Populus euphratica]
Length=534

 Score = 73.9 bits (180),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = +3

Query  51   LVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMRDWLVGYL  209
            +VL L  ++  W+FIHR +QR+  GP++WP +GA++EQ  NY RM DWLV YL
Sbjct  19   MVLLLACMVLSWIFIHRWNQRQKKGPKTWPTVGAAIEQFMNYNRMHDWLVKYL  71



>ref|XP_006827309.1| hypothetical protein AMTR_s00010p00266280 [Amborella trichopoda]
 gb|ERM94546.1| hypothetical protein AMTR_s00010p00266280 [Amborella trichopoda]
Length=426

 Score = 73.2 bits (178),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 28/60 (47%), Positives = 40/60 (67%), Gaps = 0/60 (0%)
 Frame = +3

Query  48   TLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMRDWLVGYLXXSYSV  227
            +L LAL  +   W+ +HR  QR   GP++WPV+G+++EQ+ NY RM DWLV YL    +V
Sbjct  15   SLGLALVCVFLSWILVHRWGQRNSKGPKTWPVVGSAIEQLMNYDRMHDWLVEYLSKERTV  74



>gb|EAZ25728.1| hypothetical protein OsJ_09563 [Oryza sativa Japonica Group]
Length=521

 Score = 73.2 bits (178),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 29/58 (50%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = +3

Query  54   VLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMRDWLVGYLXXSYSV  227
            ++A+ L++  W+ +H+ S R   GPRSWP+IGA+VEQ+ NY RM DWLV YL    +V
Sbjct  21   LIAIFLVVLSWILVHKWSLRNQKGPRSWPIIGATVEQLKNYHRMHDWLVEYLSKDRTV  78



>gb|EAY88702.1| hypothetical protein OsI_10177 [Oryza sativa Indica Group]
Length=540

 Score = 73.2 bits (178),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 29/58 (50%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = +3

Query  54   VLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMRDWLVGYLXXSYSV  227
            ++A+ L++  W+ +H+ S R   GPRSWP+IGA+VEQ+ NY RM DWLV YL    +V
Sbjct  21   LIAIFLVVLSWILVHKWSLRNQKGPRSWPIIGATVEQLKNYHRMHDWLVEYLSKDRTV  78



>gb|AAL84318.1|AC073556_35 putative plant cytochrome P-450 protein [Oryza sativa Japonica 
Group]
 gb|ABF94184.1| Cytochrome P450 family protein, expressed [Oryza sativa Japonica 
Group]
Length=544

 Score = 73.2 bits (178),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 29/58 (50%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = +3

Query  54   VLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMRDWLVGYLXXSYSV  227
            ++A+ L++  W+ +H+ S R   GPRSWP+IGA+VEQ+ NY RM DWLV YL    +V
Sbjct  25   LIAIFLVVLSWILVHKWSLRNQKGPRSWPIIGATVEQLKNYHRMHDWLVEYLSKDRTV  82



>gb|AJD25236.1| cytochrome P450 CYP704B37 [Salvia miltiorrhiza]
Length=506

 Score = 72.4 bits (176),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 29/62 (47%), Positives = 45/62 (73%), Gaps = 1/62 (2%)
 Frame = +3

Query  42   METLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMRDWLVGYLXXSY  221
            M+ LV+++  ++F W+FIHR+ QR   GP++WP +GA+VEQ+ NY  M DW++ YL  S 
Sbjct  1    MQILVISV-CMLFAWLFIHRVKQRGCKGPKTWPFLGAAVEQLMNYNVMHDWILNYLTASR  59

Query  222  SV  227
            +V
Sbjct  60   TV  61



>ref|XP_009105494.1| PREDICTED: cytochrome P450 704B1 [Brassica rapa]
 emb|CDX95930.1| BnaA07g28010D [Brassica napus]
Length=519

 Score = 72.4 bits (176),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 27/60 (45%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = +3

Query  48   TLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMRDWLVGYLXXSYSV  227
            ++ + L  ++  W+F+HR  QR   GP++WP++GA++EQ+TN+ RM DWLV YL  S +V
Sbjct  2    SMWIVLACMLTSWIFLHRWGQRNKRGPKTWPLVGAAIEQLTNFDRMHDWLVEYLYDSRTV  61



>ref|XP_008778343.1| PREDICTED: cytochrome P450 704B1 [Phoenix dactylifera]
Length=513

 Score = 72.4 bits (176),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 26/53 (49%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +3

Query  69   LIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMRDWLVGYLXXSYSV  227
            +++  W+ IHR SQR   GP++WP+IGA++EQ+ NY RM DWL  YL  S ++
Sbjct  1    MVVLSWILIHRWSQRNHKGPKTWPIIGAAIEQLRNYDRMHDWLAEYLSVSKTI  53



>gb|EPS61936.1| hypothetical protein M569_12857, partial [Genlisea aurea]
Length=502

 Score = 72.4 bits (176),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 30/53 (57%), Positives = 38/53 (72%), Gaps = 1/53 (2%)
 Frame = +3

Query  72   IMFC-WVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMRDWLVGYLXXSYSV  227
            I FC W+ IHRL QR    P++WP+IGA++EQ+ NY RM DWLV YL  S +V
Sbjct  2    IFFCSWILIHRLKQRNSKHPKTWPLIGAAIEQLLNYHRMHDWLVRYLAESSTV  54



>ref|XP_003528679.1| PREDICTED: cytochrome P450 704C1-like [Glycine max]
Length=515

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 29/57 (51%), Positives = 39/57 (68%), Gaps = 4/57 (7%)
 Frame = +3

Query  69   LIMFC----WVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMRDWLVGYLXXSYSV  227
            +I+ C    W+FIHR SQR   GP++WP  GA++EQ+ NY RM DWLV YL  S ++
Sbjct  5    MILICMVVSWMFIHRWSQRNKKGPKTWPFFGAAIEQLMNYDRMHDWLVNYLSKSKTI  61



>ref|XP_010551418.1| PREDICTED: cytochrome P450 704B1 [Tarenaya hassleriana]
 ref|XP_010551419.1| PREDICTED: cytochrome P450 704B1 [Tarenaya hassleriana]
Length=519

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 29/62 (47%), Positives = 43/62 (69%), Gaps = 1/62 (2%)
 Frame = +3

Query  42   METLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMRDWLVGYLXXSY  221
            M   V+   ++M  W+F+HR SQR   GP++WP++GA++EQ+ N+ RM DWLV YL  S 
Sbjct  1    MSVFVVVACMVM-SWLFLHRWSQRNKKGPKTWPLVGAAIEQLINFDRMHDWLVEYLKVSR  59

Query  222  SV  227
            +V
Sbjct  60   TV  61



>ref|XP_003609660.1| Cytochrome P450 [Medicago truncatula]
 gb|AES91857.1| cytochrome P450 family protein [Medicago truncatula]
Length=516

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 30/62 (48%), Positives = 43/62 (69%), Gaps = 1/62 (2%)
 Frame = +3

Query  42   METLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMRDWLVGYLXXSY  221
            M  LV+ + +I+  W+F+HR SQR   GP++WP +GA++EQ+ NY RM DWLV Y   S 
Sbjct  1    MGGLVILICMIV-SWIFLHRWSQRNKKGPKTWPFLGAAIEQLMNYDRMHDWLVQYFSMSK  59

Query  222  SV  227
            +V
Sbjct  60   TV  61



>ref|XP_010683141.1| PREDICTED: cytochrome P450 704B1 [Beta vulgaris subsp. vulgaris]
Length=539

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 29/50 (58%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +3

Query  78   FCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMRDWLVGYLXXSYSV  227
            F W+FIHRLSQR   GP++WP+IGA++EQ  NY  M DWLV YL    +V
Sbjct  33   FSWLFIHRLSQRNKLGPKTWPLIGAALEQFMNYDNMHDWLVEYLSKCRTV  82



>ref|XP_010258425.1| PREDICTED: cytochrome P450 704B1 [Nelumbo nucifera]
Length=534

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 29/67 (43%), Positives = 44/67 (66%), Gaps = 3/67 (4%)
 Frame = +3

Query  9    SVKSNPLKVSSMETLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMR  188
            S+ S+P   S    + + +   +  WVF+HR +QR   GP++WP++GA++EQ+ NY RM 
Sbjct  8    SISSSPTGYSKGMVVFICM---LISWVFVHRWNQRNMKGPKTWPLVGAAIEQLMNYNRMH  64

Query  189  DWLVGYL  209
            DWLV YL
Sbjct  65   DWLVEYL  71



>emb|CDY40931.1| BnaC06g30690D [Brassica napus]
Length=519

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 27/60 (45%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = +3

Query  48   TLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMRDWLVGYLXXSYSV  227
            ++ + L  ++  W+F+HR  QR   GP++WP++GA++EQ+TN+ RM DWLV YL  S +V
Sbjct  2    SMWIVLACMVTSWIFLHRWGQRNKRGPKTWPLVGAAIEQLTNFDRMHDWLVEYLYDSRTV  61



>ref|XP_007046039.1| Cytochrome P450, family 704, subfamily B, polypeptide 1 isoform 
2 [Theobroma cacao]
 gb|EOY01871.1| Cytochrome P450, family 704, subfamily B, polypeptide 1 isoform 
2 [Theobroma cacao]
Length=537

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 29/58 (50%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = +3

Query  54   VLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMRDWLVGYLXXSYSV  227
            +L L  ++  W+F +R +QR   GP++WP IGAS+EQ  NY RM DWLV YL  S +V
Sbjct  21   MLMLACMVVSWIFTYRWNQRNRKGPKTWPFIGASIEQFMNYDRMHDWLVKYLSKSKTV  78



>ref|XP_007046038.1| Cytochrome P450, family 704, subfamily B, polypeptide 1 isoform 
1 [Theobroma cacao]
 gb|EOY01870.1| Cytochrome P450, family 704, subfamily B, polypeptide 1 isoform 
1 [Theobroma cacao]
Length=535

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 29/58 (50%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = +3

Query  54   VLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMRDWLVGYLXXSYSV  227
            +L L  ++  W+F +R +QR   GP++WP IGAS+EQ  NY RM DWLV YL  S +V
Sbjct  21   MLMLACMVVSWIFTYRWNQRNRKGPKTWPFIGASIEQFMNYDRMHDWLVKYLSKSKTV  78



>ref|XP_007225718.1| hypothetical protein PRUPE_ppa004298mg [Prunus persica]
 gb|EMJ26917.1| hypothetical protein PRUPE_ppa004298mg [Prunus persica]
Length=517

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 26/52 (50%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = +3

Query  72   IMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMRDWLVGYLXXSYSV  227
            ++  W+ +HR SQ+   GP++WP++GA++EQ+ NY RM DWLV YL  S SV
Sbjct  5    MVLSWIIVHRWSQKNKKGPKTWPLVGAAIEQLMNYDRMHDWLVKYLSESNSV  56



>ref|XP_007135410.1| hypothetical protein PHAVU_010G126900g [Phaseolus vulgaris]
 gb|ESW07404.1| hypothetical protein PHAVU_010G126900g [Phaseolus vulgaris]
Length=515

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = +3

Query  54   VLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMRDWLVGYLXXSYSV  227
            ++ L  ++  W+FIHR SQR   GP++WP  GA++EQ+ NY RM DWLV YL  S +V
Sbjct  4    LVVLICMVVSWMFIHRWSQRDKKGPKTWPFFGAAIEQLMNYDRMHDWLVNYLSMSKTV  61



>ref|XP_008221727.1| PREDICTED: cytochrome P450 704B1 [Prunus mume]
Length=534

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 26/52 (50%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = +3

Query  72   IMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMRDWLVGYLXXSYSV  227
            ++  W+ +HR SQ+   GP++WP++GA++EQ+ NY RM DWLV YL  S SV
Sbjct  28   MVLSWIIVHRWSQKNQKGPKTWPLVGAAIEQLMNYDRMHDWLVKYLSESNSV  79



>ref|XP_010470937.1| PREDICTED: cytochrome P450 704B1-like [Camelina sativa]
Length=521

 Score = 70.5 bits (171),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 26/60 (43%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +3

Query  48   TLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMRDWLVGYLXXSYSV  227
            ++ L +  ++  W+F+H   QR   GP++WP++GA++EQ+TN+ RM DWLV YL  S +V
Sbjct  2    SMCLVVACMVTSWIFLHIWGQRNKSGPKTWPLVGAAIEQLTNFDRMHDWLVEYLYKSRTV  61



>ref|XP_010511987.1| PREDICTED: cytochrome P450 704B1 [Camelina sativa]
Length=522

 Score = 70.5 bits (171),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 26/60 (43%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +3

Query  48   TLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMRDWLVGYLXXSYSV  227
            ++ L +  ++  W+F+H   QR   GP++WP++GA++EQ+TN+ RM DWLV YL  S +V
Sbjct  2    SMCLVVACMVTSWIFLHIWGQRNKSGPKTWPLVGAAIEQLTNFDRMHDWLVEYLYNSRTV  61



>ref|XP_009758170.1| PREDICTED: cytochrome P450 704B1 [Nicotiana sylvestris]
Length=519

 Score = 69.7 bits (169),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 33/62 (53%), Positives = 40/62 (65%), Gaps = 1/62 (2%)
 Frame = +3

Query  42   METLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMRDWLVGYLXXSY  221
            ME L L + LI+  W+FIH L QR   GP  WP+IGA +EQ  N+ RM DWLV YL  S 
Sbjct  1    MEILTLFVCLIL-SWIFIHGLRQRNRKGPIHWPIIGAGLEQWVNFDRMHDWLVKYLAQSP  59

Query  222  SV  227
            +V
Sbjct  60   TV  61



>ref|XP_004510551.1| PREDICTED: cytochrome P450 704C1-like [Cicer arietinum]
Length=533

 Score = 69.7 bits (169),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 28/63 (44%), Positives = 43/63 (68%), Gaps = 1/63 (2%)
 Frame = +3

Query  39   SMETLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMRDWLVGYLXXS  218
            +M  LV+ + +++  W+ IHR SQR   GP++WP +GA++EQ+ NY RM DWLV Y   S
Sbjct  18   NMGGLVILICMVV-SWILIHRWSQRNKKGPKTWPFLGAAIEQLMNYDRMHDWLVQYFSKS  76

Query  219  YSV  227
             ++
Sbjct  77   KTI  79



>ref|XP_004138991.1| PREDICTED: cytochrome P450 704C1-like [Cucumis sativus]
 ref|XP_004170943.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 704C1-like [Cucumis 
sativus]
Length=534

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 32/70 (46%), Positives = 49/70 (70%), Gaps = 4/70 (6%)
 Frame = +3

Query  12   VKSNPLKVSSMETLVLAL-GLIMFCWVFI-HRLSQRKG--GGPRSWPVIGASVEQMTNYG  179
            ++S+ L+ S +  LVL +  +I  CW+ I HR +QRK    GP++WP++GA++EQ  NY 
Sbjct  1    MRSSNLRRSGVVALVLVMIAIISACWIIIVHRWNQRKKMRRGPKTWPIVGAAIEQFVNYH  60

Query  180  RMRDWLVGYL  209
            RM DW++GYL
Sbjct  61   RMHDWILGYL  70



>gb|KGN61391.1| hypothetical protein Csa_2G108690 [Cucumis sativus]
Length=556

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 32/70 (46%), Positives = 49/70 (70%), Gaps = 4/70 (6%)
 Frame = +3

Query  12   VKSNPLKVSSMETLVLAL-GLIMFCWVFI-HRLSQRKG--GGPRSWPVIGASVEQMTNYG  179
            ++S+ L+ S +  LVL +  +I  CW+ I HR +QRK    GP++WP++GA++EQ  NY 
Sbjct  23   MRSSNLRRSGVVALVLVMIAIISACWIIIVHRWNQRKKMRRGPKTWPIVGAAIEQFVNYH  82

Query  180  RMRDWLVGYL  209
            RM DW++GYL
Sbjct  83   RMHDWILGYL  92



>gb|KJB50631.1| hypothetical protein B456_008G180000 [Gossypium raimondii]
Length=534

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 27/58 (47%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = +3

Query  54   VLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMRDWLVGYLXXSYSV  227
            ++ L  +   W+F++R +QR   GP++WP+IGA  EQ+ NY RM DWLV YL  S +V
Sbjct  19   MVMLACMFISWIFVYRWNQRNRKGPKTWPLIGAVFEQLINYDRMHDWLVEYLSASKTV  76



>emb|CDP00359.1| unnamed protein product [Coffea canephora]
Length=524

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 30/64 (47%), Positives = 45/64 (70%), Gaps = 2/64 (3%)
 Frame = +3

Query  42   METLV-LALGLIMFCWVFIHRLSQRK-GGGPRSWPVIGASVEQMTNYGRMRDWLVGYLXX  215
            ME L+ +A  +I+  WV IHRL QR   G P++WP++GA++EQ+ NY +M DW++ YL  
Sbjct  1    MEILIFVACMVILVSWVLIHRLKQRNVKGCPKTWPLVGAAIEQLLNYDQMHDWILKYLAR  60

Query  216  SYSV  227
            S +V
Sbjct  61   SRTV  64



>ref|XP_010044484.1| PREDICTED: cytochrome P450 704B1 [Eucalyptus grandis]
Length=533

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 25/52 (48%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = +3

Query  72   IMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMRDWLVGYLXXSYSV  227
            ++  W+ IHR +QR   GP++WP++GA++EQ  NY RM DWLV YL    +V
Sbjct  25   VIVSWIIIHRWNQRNKNGPKTWPLVGAAIEQFMNYERMHDWLVEYLSKMRTV  76



>gb|EMS55452.1| Cytochrome P450 86B1 [Triticum urartu]
Length=465

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = +3

Query  57   LALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMRDWLVGYLXXSYSV  227
            +A+ L+   W+ +H  S RK  GPRSWPVIGA++EQ+ NY RM DWLV YL    +V
Sbjct  25   MAIFLVFLSWILVHWWSLRKQKGPRSWPVIGATLEQLRNYYRMHDWLVEYLSKHRTV  81



>gb|KHN01450.1| Cytochrome P450 704C1 [Glycine soja]
Length=501

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 26/47 (55%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +3

Query  87   VFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMRDWLVGYLXXSYSV  227
            +FIHR SQR   GP++WP  GA++EQ+ NY RM DWLV YL  S ++
Sbjct  1    MFIHRWSQRNKKGPKTWPFFGAAIEQLMNYDRMHDWLVNYLSKSKTI  47



>gb|EMT08626.1| Cytochrome P450 704C1 [Aegilops tauschii]
Length=632

 Score = 67.4 bits (163),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = +3

Query  57   LALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMRDWLVGYLXXSYSV  227
            +A+ L+   W+ +H  S RK  GPRSWPVIGA++EQ+ NY RM DWLV YL    +V
Sbjct  24   MAIFLVFLSWILVHWWSLRKQKGPRSWPVIGATLEQLRNYYRMHDWLVEYLSKHRTV  80



>ref|XP_003558727.1| PREDICTED: cytochrome P450 704B1 [Brachypodium distachyon]
Length=557

 Score = 67.0 bits (162),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = +3

Query  57   LALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMRDWLVGYL  209
            +A+ +I+  W+ +HR S R   GP+SWPVIGA++EQ+ NY RM DWLV YL
Sbjct  26   VAIFVIVLSWILVHRWSLRNQKGPKSWPVIGATLEQLRNYYRMHDWLVEYL  76



>gb|ADG34845.1| cytochrome P450 protein [Vanda hybrid cultivar]
Length=538

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 23/53 (43%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = +3

Query  51   LVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMRDWLVGYL  209
            L+    + +  W+F+HR +QR   GP++WP+IGA++E + NY RM DW+  YL
Sbjct  14   LIAFSAIFLISWIFLHRWAQRNRRGPKTWPLIGAAIELLNNYERMHDWITDYL  66



>ref|XP_009629443.1| PREDICTED: cytochrome P450 704B1 [Nicotiana tomentosiformis]
Length=510

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 32/63 (51%), Positives = 41/63 (65%), Gaps = 2/63 (3%)
 Frame = +3

Query  42   METLVLALGLIMFCWVFIHRLSQRKG-GGPRSWPVIGASVEQMTNYGRMRDWLVGYLXXS  218
            ME L L + L++  W+FIH L Q+K   GP  WP+IGA +EQ  N+ RM DWLV YL  S
Sbjct  1    MEILTLFVCLVL-SWIFIHGLRQQKNRKGPIHWPIIGAGLEQWVNFDRMHDWLVKYLAQS  59

Query  219  YSV  227
             +V
Sbjct  60   PTV  62



>ref|XP_002978645.1| hypothetical protein SELMODRAFT_418431 [Selaginella moellendorffii]
 ref|XP_002984583.1| hypothetical protein SELMODRAFT_423745 [Selaginella moellendorffii]
 gb|EFJ14228.1| hypothetical protein SELMODRAFT_423745 [Selaginella moellendorffii]
 gb|EFJ20092.1| hypothetical protein SELMODRAFT_418431 [Selaginella moellendorffii]
Length=520

 Score = 64.3 bits (155),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = +3

Query  54   VLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMRDWLVGYL  209
            ++++ L++  WVF+HRL QR   GP++WP++G  VEQ  N+ ++ DWL+GY 
Sbjct  13   MISIALLLAWWVFLHRLRQRHLAGPKTWPLLGCIVEQARNFDKLHDWLLGYF  64



>gb|KDP41226.1| hypothetical protein JCGZ_15633 [Jatropha curcas]
Length=516

 Score = 63.9 bits (154),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +3

Query  87   VFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMRDWLVGYL  209
            +F+H+  +R   GPR+WP+IGA++EQ  NY RM DWLV YL
Sbjct  14   IFLHQWRKRNKKGPRTWPIIGAAIEQFMNYDRMHDWLVAYL  54



>ref|XP_008441698.1| PREDICTED: cytochrome P450 704B1 [Cucumis melo]
Length=556

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 31/69 (45%), Positives = 49/69 (71%), Gaps = 3/69 (4%)
 Frame = +3

Query  12   VKSNPLKVSSMETLVLALGLIMFCWVFI-HRLSQRKG--GGPRSWPVIGASVEQMTNYGR  182
            ++S+ L+ S +  LVL +  I+ CW+ I HR ++RK    GP++WP++GA++EQ  NY R
Sbjct  23   MRSSNLRRSVVVVLVLGVITIVTCWIIIVHRWNERKKMRRGPKTWPIVGAAIEQFVNYHR  82

Query  183  MRDWLVGYL  209
            M DW++GYL
Sbjct  83   MHDWILGYL  91



>ref|XP_006475855.1| PREDICTED: cytochrome P450 704C1-like [Citrus sinensis]
Length=518

 Score = 62.0 bits (149),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 25/53 (47%), Positives = 35/53 (66%), Gaps = 1/53 (2%)
 Frame = +3

Query  54   VLALGLIMFCWVF-IHRLSQRKGGGPRSWPVIGASVEQMTNYGRMRDWLVGYL  209
            +L L   +  W+  IH  SQ+   GP++WP +GA++EQ+ NY RM DWLV YL
Sbjct  3    MLMLACTVLSWILLIHWWSQKNQRGPKTWPFVGAAIEQLMNYDRMHDWLVNYL  55



>gb|KDO80235.1| hypothetical protein CISIN_1g035880mg [Citrus sinensis]
Length=530

 Score = 62.0 bits (149),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 25/53 (47%), Positives = 35/53 (66%), Gaps = 1/53 (2%)
 Frame = +3

Query  54   VLALGLIMFCWVF-IHRLSQRKGGGPRSWPVIGASVEQMTNYGRMRDWLVGYL  209
            +L L   +  W+  IH  SQ+   GP++WP +GA++EQ+ NY RM DWLV YL
Sbjct  15   MLMLACTVLSWILLIHWWSQKNQRGPKTWPFVGAAIEQLMNYDRMHDWLVNYL  67



>ref|XP_006366710.1| PREDICTED: cytochrome P450 704C1-like [Solanum tuberosum]
Length=513

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 25/59 (42%), Positives = 36/59 (61%), Gaps = 0/59 (0%)
 Frame = +3

Query  51   LVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMRDWLVGYLXXSYSV  227
            L+  L  ++  W FI+   Q+   GP +WP++GA +EQ  N+ RM DWLV YL  S +V
Sbjct  3    LLTFLACLVLSWKFINTYRQKNKKGPINWPIVGAGLEQWVNFDRMHDWLVEYLAQSPTV  61



>ref|XP_006450915.1| hypothetical protein CICLE_v10010274mg [Citrus clementina]
 gb|ESR64155.1| hypothetical protein CICLE_v10010274mg [Citrus clementina]
Length=514

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 23/46 (50%), Positives = 32/46 (70%), Gaps = 1/46 (2%)
 Frame = +3

Query  75   MFCWVF-IHRLSQRKGGGPRSWPVIGASVEQMTNYGRMRDWLVGYL  209
            +  W+  IH  SQ+   GP++WP +GA++EQ+ NY RM DWLV YL
Sbjct  6    VLSWILLIHWWSQKNQRGPKTWPFVGAAIEQLMNYDRMHDWLVNYL  51



>ref|XP_002979701.1| hypothetical protein SELMODRAFT_111270 [Selaginella moellendorffii]
 gb|EFJ19103.1| hypothetical protein SELMODRAFT_111270 [Selaginella moellendorffii]
Length=545

 Score = 58.9 bits (141),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 22/53 (42%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = +3

Query  48   TLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMRDWLVGY  206
            T ++   LI+  W+F+HR  QR   GP+SWP++G   EQ+ N+ R+  WL+ Y
Sbjct  33   TWIITWALILAWWIFLHRFRQRGLRGPKSWPLVGCLFEQIANFDRLHHWLLDY  85



>gb|ACD10924.1| cytochrome P450 [Capsicum annuum]
Length=513

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 24/48 (50%), Positives = 30/48 (63%), Gaps = 0/48 (0%)
 Frame = +3

Query  84   WVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMRDWLVGYLXXSYSV  227
            W FI    Q+   GP +WP+IGA +EQ  N+ RM DWLV YL  S +V
Sbjct  14   WTFIKTFRQKIKKGPINWPIIGAGLEQWVNFDRMHDWLVEYLSQSPTV  61



>ref|XP_004228374.1| PREDICTED: cytochrome P450 704B1 [Solanum lycopersicum]
Length=513

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +3

Query  84   WVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMRDWLVGYLXXSYSV  227
            W FI+   Q+   GP +WP++GA +EQ  N+ RM DWLV YL  S +V
Sbjct  14   WKFINTYRQKNKKGPINWPIVGAGLEQWVNFDRMHDWLVEYLAQSPTV  61



>ref|XP_002988354.1| hypothetical protein SELMODRAFT_127881 [Selaginella moellendorffii]
 gb|EFJ10444.1| hypothetical protein SELMODRAFT_127881 [Selaginella moellendorffii]
Length=546

 Score = 55.8 bits (133),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 21/53 (40%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +3

Query  48   TLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMRDWLVGY  206
            T ++   LI+  W+F+HR  Q    GP+SWP++G   EQ+ N+ R+  WL+ Y
Sbjct  34   TWIITWALILAWWIFLHRFRQGGLRGPKSWPLVGCLFEQIANFDRLHHWLLDY  86



>ref|XP_001764611.1| predicted protein [Physcomitrella patens]
 gb|EDQ70593.1| predicted protein [Physcomitrella patens]
Length=516

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 23/64 (36%), Positives = 34/64 (53%), Gaps = 3/64 (5%)
 Frame = +3

Query  18   SNPLKVSSMETLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMRDWL  197
            S P    S  T V+   +    W++I R  QR    P+ WPVIGA+VE + N+  + DW+
Sbjct  6    SVPFSTESAVTFVI---IATLSWLWIFRWQQRHRLAPKEWPVIGAAVETIRNFDDLHDWV  62

Query  198  VGYL  209
            + Y 
Sbjct  63   LSYF  66



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 570526909590