BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002E13

Length=516
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006343784.1|  PREDICTED: methionine gamma-lyase-like             221   1e-66   Solanum tuberosum [potatoes]
ref|XP_009625576.1|  PREDICTED: methionine gamma-lyase                  221   2e-66   Nicotiana tomentosiformis
gb|KDP25202.1|  hypothetical protein JCGZ_20358                         221   2e-66   Jatropha curcas
ref|XP_009796885.1|  PREDICTED: methionine gamma-lyase-like             220   3e-66   Nicotiana sylvestris
ref|XP_004245457.1|  PREDICTED: methionine gamma-lyase                  219   5e-66   Solanum lycopersicum
ref|XP_009631114.1|  PREDICTED: methionine gamma-lyase-like             219   7e-66   Nicotiana tomentosiformis
ref|XP_009785770.1|  PREDICTED: methionine gamma-lyase-like             216   1e-64   Nicotiana sylvestris
gb|KCW77319.1|  hypothetical protein EUGRSUZ_D01681                     213   3e-64   Eucalyptus grandis [rose gum]
ref|XP_010251592.1|  PREDICTED: methionine gamma-lyase                  214   9e-64   Nelumbo nucifera [Indian lotus]
ref|XP_010053068.1|  PREDICTED: methionine gamma-lyase                  213   2e-63   
ref|XP_011026788.1|  PREDICTED: methionine gamma-lyase                  211   1e-62   Populus euphratica
ref|XP_002299428.1|  Cys/Met metabolism pyridoxal-phosphate-depen...    210   3e-62   Populus trichocarpa [western balsam poplar]
ref|XP_008374119.1|  PREDICTED: methionine gamma-lyase-like             210   4e-62   
ref|XP_011101902.1|  PREDICTED: methionine gamma-lyase-like             207   2e-61   Sesamum indicum [beniseed]
ref|XP_011070383.1|  PREDICTED: methionine gamma-lyase                  207   3e-61   Sesamum indicum [beniseed]
gb|EYU33474.1|  hypothetical protein MIMGU_mgv1a006470mg                207   3e-61   Erythranthe guttata [common monkey flower]
emb|CAN83499.1|  hypothetical protein VITISV_026969                     205   7e-61   Vitis vinifera
ref|XP_002518910.1|  cystathionine gamma-synthase, putative             206   8e-61   Ricinus communis
ref|XP_002280162.1|  PREDICTED: methionine gamma-lyase                  205   2e-60   Vitis vinifera
ref|XP_006476291.1|  PREDICTED: methionine gamma-lyase-like             204   3e-60   Citrus sinensis [apfelsine]
ref|XP_006439223.1|  hypothetical protein CICLE_v10020136mg             204   3e-60   Citrus clementina [clementine]
gb|KJB52368.1|  hypothetical protein B456_008G258500                    203   1e-59   Gossypium raimondii
ref|XP_010544898.1|  PREDICTED: methionine gamma-lyase                  203   1e-59   Tarenaya hassleriana [spider flower]
ref|XP_004309539.1|  PREDICTED: methionine gamma-lyase                  203   2e-59   Fragaria vesca subsp. vesca
ref|XP_004495508.1|  PREDICTED: methionine gamma-lyase-like             202   2e-59   Cicer arietinum [garbanzo]
ref|XP_010676903.1|  PREDICTED: methionine gamma-lyase                  202   3e-59   Beta vulgaris subsp. vulgaris [field beet]
gb|AGF70153.1|  methionine gamma-lyase                                  201   7e-59   Cucumis melo [Oriental melon]
ref|XP_006352296.1|  PREDICTED: methionine gamma-lyase-like             200   1e-58   
ref|XP_004146134.1|  PREDICTED: methionine gamma-lyase-like             201   1e-58   Cucumis sativus [cucumbers]
ref|XP_007039394.1|  Methionine gamma-lyase                             199   3e-58   Theobroma cacao [chocolate]
gb|KDO76719.1|  hypothetical protein CISIN_1g013079mg                   199   4e-58   Citrus sinensis [apfelsine]
ref|XP_008448562.1|  PREDICTED: methionine gamma-lyase-like             198   9e-58   
gb|KFK32962.1|  hypothetical protein AALP_AA6G312200                    197   1e-57   Arabis alpina [alpine rockcress]
ref|XP_007151964.1|  hypothetical protein PHAVU_004G090200g             197   2e-57   Phaseolus vulgaris [French bean]
gb|KJB37456.1|  hypothetical protein B456_006G205800                    197   3e-57   Gossypium raimondii
gb|ADN33936.1|  cystathionine gamma-synthase                            195   5e-57   Cucumis melo subsp. melo
ref|XP_010430614.1|  PREDICTED: methionine gamma-lyase isoform X3       196   7e-57   Camelina sativa [gold-of-pleasure]
ref|XP_004244654.1|  PREDICTED: methionine gamma-lyase-like             194   1e-56   
ref|XP_010473731.1|  PREDICTED: methionine gamma-lyase-like isofo...    194   3e-56   Camelina sativa [gold-of-pleasure]
ref|XP_002891507.1|  predicted protein                                  194   3e-56   Arabidopsis lyrata subsp. lyrata
ref|XP_010430612.1|  PREDICTED: methionine gamma-lyase isoform X1       194   4e-56   Camelina sativa [gold-of-pleasure]
ref|XP_004502061.1|  PREDICTED: methionine gamma-lyase-like             193   5e-56   Cicer arietinum [garbanzo]
ref|NP_176647.1|  methionine gamma-lyase                                193   7e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006302266.1|  hypothetical protein CARUB_v10020309mg             192   2e-55   Capsella rubella
ref|XP_003542155.1|  PREDICTED: methionine gamma-lyase-like             192   2e-55   Glycine max [soybeans]
ref|XP_009358710.1|  PREDICTED: methionine gamma-lyase-like             192   2e-55   Pyrus x bretschneideri [bai li]
gb|KEH42908.1|  cystathionine beta-lyase/cystathionine gamma-synt...    191   4e-55   Medicago truncatula
ref|XP_009112857.1|  PREDICTED: methionine gamma-lyase                  191   4e-55   Brassica rapa
ref|XP_008239227.1|  PREDICTED: methionine gamma-lyase                  191   9e-55   Prunus mume [ume]
ref|XP_008390270.1|  PREDICTED: methionine gamma-lyase-like             190   1e-54   Malus domestica [apple tree]
ref|XP_008791621.1|  PREDICTED: methionine gamma-lyase                  190   1e-54   Phoenix dactylifera
ref|XP_009382322.1|  PREDICTED: methionine gamma-lyase-like             190   1e-54   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007209123.1|  hypothetical protein PRUPE_ppa005470mg             190   1e-54   Prunus persica
emb|CDY53903.1|  BnaA09g53100D                                          189   2e-54   Brassica napus [oilseed rape]
ref|XP_003601451.1|  Cystathionine gamma-lyase                          188   4e-54   Medicago truncatula
ref|XP_009359544.1|  PREDICTED: methionine gamma-lyase-like             188   9e-54   Pyrus x bretschneideri [bai li]
gb|ABK27101.1|  unknown                                                 187   1e-53   Picea sitchensis
ref|XP_006849146.1|  hypothetical protein AMTR_s00027p00096610          185   8e-53   
ref|XP_009411481.1|  PREDICTED: methionine gamma-lyase-like             185   1e-52   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003520012.1|  PREDICTED: methionine gamma-lyase-like             184   2e-52   Glycine max [soybeans]
gb|KFK21963.1|  hypothetical protein AALP_AAs48252U001300               174   3e-52   Arabis alpina [alpine rockcress]
ref|XP_010919347.1|  PREDICTED: methionine gamma-lyase                  183   6e-52   Elaeis guineensis
ref|XP_003536171.1|  PREDICTED: methionine gamma-lyase                  180   6e-51   Glycine max [soybeans]
ref|XP_010100197.1|  Methionine gamma-lyase                             179   1e-50   Morus notabilis
ref|XP_007161585.1|  hypothetical protein PHAVU_001G082000g             178   4e-50   Phaseolus vulgaris [French bean]
ref|XP_008437446.1|  PREDICTED: methionine gamma-lyase-like             175   4e-49   Cucumis melo [Oriental melon]
ref|XP_001751901.1|  predicted protein                                  173   1e-48   
ref|XP_008366029.1|  PREDICTED: LOW QUALITY PROTEIN: methionine g...    171   3e-48   
ref|XP_004143943.1|  PREDICTED: methionine gamma-lyase-like             172   5e-48   
ref|XP_002964805.1|  hypothetical protein SELMODRAFT_82714              171   2e-47   Selaginella moellendorffii
ref|XP_002961730.1|  hypothetical protein SELMODRAFT_76894              171   2e-47   Selaginella moellendorffii
dbj|BAK03127.1|  predicted protein                                      168   4e-46   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003574196.1|  PREDICTED: methionine gamma-lyase                  167   5e-46   Brachypodium distachyon [annual false brome]
ref|XP_008646566.1|  PREDICTED: methionine gamma-lyase-like             167   6e-46   
gb|AFW68376.1|  hypothetical protein ZEAMMB73_868492                    167   6e-46   
ref|NP_001152224.1|  O-succinylhomoserine sulfhydrylase                 166   1e-45   
tpg|DAA49293.1|  TPA: O-succinylhomoserine sulfhydrylase                166   2e-45   
ref|NP_001065069.1|  Os10g0517500                                       165   5e-45   
ref|XP_002464368.1|  hypothetical protein SORBIDRAFT_01g017060          164   9e-45   Sorghum bicolor [broomcorn]
gb|EAY79213.1|  hypothetical protein OsI_34329                          163   2e-44   Oryza sativa Indica Group [Indian rice]
ref|XP_004982603.1|  PREDICTED: methionine gamma-lyase-like             162   7e-44   Setaria italica
ref|XP_001759514.1|  predicted protein                                  154   2e-41   
ref|XP_011020545.1|  PREDICTED: methionine gamma-lyase-like             149   2e-39   Populus euphratica
ref|XP_002304835.2|  hypothetical protein POPTR_0003s18600g             148   3e-39   
gb|AFT91998.1|  cystathionine gamma-synthase                            141   1e-36   Populus alba x Populus glandulosa
gb|AFT91997.1|  cystathionine gamma-synthase                            141   2e-36   Populus tomentosa [Chinese white poplar]
ref|XP_006388026.1|  hypothetical protein POPTR_0393s00210g             139   9e-36   Populus trichocarpa [western balsam poplar]
ref|XP_002304836.2|  hypothetical protein POPTR_0003s18590g             137   4e-35   
ref|XP_001756897.1|  predicted protein                                  134   6e-34   
ref|WP_022667695.1|  cystathionine beta-lyase                           129   5e-32   Desulfospira joergensenii
ref|WP_024333343.1|  cystathionine beta-lyase                           126   4e-31   Desulfotignum balticum
ref|WP_006964281.1|  cystathionine gamma-lyase CysA                     126   4e-31   Desulfotignum phosphitoxidans
ref|WP_027709412.1|  cystathionine beta-lyase                           124   2e-30   
ref|XP_005848305.1|  hypothetical protein CHLNCDRAFT_35132              125   2e-30   Chlorella variabilis
ref|XP_010497416.1|  PREDICTED: methionine gamma-lyase-like             119   4e-30   Camelina sativa [gold-of-pleasure]
ref|XP_002955875.1|  hypothetical protein VOLCADRAFT_66358              117   5e-28   Volvox carteri f. nagariensis
gb|KHN47224.1|  Cystathionine gamma-lyase                               106   2e-24   Glycine soja [wild soybean]
ref|XP_005651025.1|  cystathionine gamma-synthase                       107   2e-24   Coccomyxa subellipsoidea C-169
ref|XP_006385806.1|  hypothetical protein POPTR_0003s14660g             102   3e-23   
ref|WP_025865695.1|  cystathionine beta-lyase                         93.6    2e-19   Prolixibacter bellariivorans
ref|WP_038562571.1|  cystathionine beta-lyase                         90.9    1e-18   Draconibacterium orientale
gb|KJF42319.1|  cystathionine beta-lyase                              90.5    3e-18   Draconibacterium sediminis
ref|WP_027075614.1|  cystathionine beta-lyase                         88.6    2e-17   Maribacter antarcticus
ref|WP_014561543.1|  cystathionine beta-lyase                         86.3    8e-17   Ignavibacterium album
ref|WP_044633542.1|  cystathionine beta-lyase                         86.3    9e-17   Tamlana sedimentorum
ref|WP_027311134.1|  cystathionine beta-lyase                         86.3    1e-16   
ref|WP_031444038.1|  cystathionine beta-lyase                         86.3    1e-16   Arenibacter
ref|WP_026775536.1|  cystathionine beta-lyase                         85.9    1e-16   Polaribacter sp. Hel_I_88
ref|WP_027066687.1|  cystathionine beta-lyase                         85.9    1e-16   Maribacter sp. Hel_I_7
ref|WP_027126595.1|  cystathionine beta-lyase                         85.5    1e-16   Gelidibacter mesophilus
ref|WP_041327761.1|  cystathionine beta-lyase                         85.9    2e-16   Robiginitalea biformata
gb|EAR15507.1|  cystathionine beta-lyase                              85.5    2e-16   Robiginitalea biformata HTCC2501
ref|WP_020897041.1|  O-acetylhomoserine sulfhydrylase                 85.5    2e-16   Winogradskyella psychrotolerans
ref|WP_028584498.1|  cystathionine beta-lyase                         85.5    2e-16   Desulfobulbus mediterraneus
ref|WP_020214240.1|  cystathionine beta-lyase                         85.5    2e-16   Flavobacterium rivuli
ref|WP_007093497.1|  cystathionine beta-lyase                         85.1    2e-16   Kordia algicida
ref|WP_038264494.1|  cystathionine beta-lyase                         85.1    2e-16   Zhouia amylolytica
ref|WP_035664548.1|  cystathionine beta-lyase                         85.1    2e-16   
ref|WP_007138646.1|  cystathionine beta-lyase                         85.1    3e-16   Flavobacterium frigoris
ref|WP_039118922.1|  cystathionine beta-lyase                         85.1    3e-16   Flavobacterium sp. JRM
ref|WP_026992162.1|  cystathionine beta-lyase                         85.1    3e-16   Flavobacterium subsaxonicum
ref|WP_019669934.1|  cystathionine beta-lyase                         85.1    3e-16   Eudoraea adriatica
ref|WP_026815273.1|  cystathionine beta-lyase                         84.7    3e-16   Arenibacter certesii
ref|WP_039107807.1|  cystathionine beta-lyase                         84.7    3e-16   Flavobacterium sp. AED
ref|WP_039113897.1|  cystathionine beta-lyase                         84.7    3e-16   Flavobacterium sp. KMS
ref|WP_035626372.1|  cystathionine beta-lyase                         84.7    3e-16   Flavobacterium hydatis
ref|WP_036123108.1|  cystathionine beta-lyase                         84.7    3e-16   Mangrovimonas yunxiaonensis
ref|WP_031453699.1|  cystathionine beta-lyase                         84.7    3e-16   Flavobacterium chungangense
ref|WP_011710043.1|  cystathionine beta-lyase                         84.7    4e-16   Gramella forsetii
ref|WP_036153848.1|  cystathionine beta-lyase                         84.7    4e-16   Maribacter forsetii
ref|WP_024980967.1|  cystathionine beta-lyase                         84.7    4e-16   Flavobacterium succinicans
ref|WP_027878816.1|  cystathionine beta-lyase                         84.7    4e-16   Mesoflavibacter zeaxanthinifaciens
ref|WP_008634437.1|  cystathionine beta-lyase                         84.3    4e-16   Bizionia argentinensis
dbj|GAL77579.1|  O-acetylhomoserine sulfhydrylase                     84.0    4e-16   Algibacter lectus
ref|WP_036827174.1|  cystathionine beta-lyase                         84.3    4e-16   Polaribacter sp. Hel1_85
ref|WP_008615133.1|  cystathionine beta-lyase                         84.3    4e-16   Joostella marina
ref|WP_042244621.1|  cystathionine beta-lyase                         84.3    4e-16   Jejuia pallidilutea
ref|WP_042506508.1|  cystathionine beta-lyase                         84.3    4e-16   Algibacter lectus
ref|WP_042719927.1|  cystathionine beta-lyase                         84.3    5e-16   Flavobacterium sp. B17
ref|WP_014387952.1|  cystathionine beta-lyase                         84.3    5e-16   Flavobacterium indicum
ref|WP_007646642.1|  O-acetylhomoserine sulfhydrylase                 84.3    5e-16   Xanthomarina gelatinilytica
ref|WP_037324572.1|  cystathionine beta-lyase                         84.3    5e-16   Salinimicrobium terrae
ref|WP_035130855.1|  cystathionine beta-lyase                         84.0    6e-16   Flavobacterium beibuense
ref|WP_027377153.1|  cystathionine beta-lyase                         84.0    6e-16   Chryseobacterium palustre
ref|WP_019387558.1|  cystathionine beta-lyase                         84.0    6e-16   Arenitalea lutea
ref|WP_026915592.1|  cystathionine beta-lyase                         84.0    6e-16   Gramella portivictoriae
ref|WP_013870851.1|  cystathionine beta-lyase                         84.0    6e-16   Lacinutrix sp. 5H-3-7-4
ref|WP_008991878.1|  cystathionine beta-lyase                         84.0    6e-16   Galbibacter marinus
ref|WP_026704856.1|  cystathionine beta-lyase                         84.0    6e-16   Flavobacterium soli
ref|WP_028290818.1|  cystathionine beta-lyase                         84.0    7e-16   Olleya sp. VCSA23
ref|WP_035671447.1|  cystathionine beta-lyase                         84.0    7e-16   Flavobacterium sp. 83
ref|WP_028606171.1|  cystathionine beta-lyase                         83.6    7e-16   Olleya
ref|WP_044639103.1|  cystathionine beta-lyase                         83.6    7e-16   Siansivirga zeaxanthinifaciens
ref|WP_044048288.1|  cystathionine beta-lyase                         83.6    8e-16   
ref|WP_037320529.1|  cystathionine beta-lyase                         83.6    8e-16   Salegentibacter sp. Hel_I_6
ref|WP_004569139.1|  cystathionine beta-lyase                         83.6    8e-16   Polaribacter irgensii
ref|WP_015480967.1|  cystathionine beta-lyase                         83.6    8e-16   Polaribacter sp. MED152
ref|WP_041519168.1|  cystathionine beta-lyase                         83.6    9e-16   Flavobacterium hibernum
ref|WP_035666777.1|  cystathionine beta-lyase                         83.6    9e-16   
ref|WP_026708059.1|  cystathionine beta-lyase                         83.6    9e-16   Flavobacterium frigidarium
gb|ABQ05159.1|  Cystathionine gamma-synthase                          83.6    9e-16   Flavobacterium johnsoniae UW101
ref|WP_017495491.1|  cystathionine beta-lyase                         83.6    9e-16   Flavobacterium sp. WG21
ref|WP_026811643.1|  cystathionine beta-lyase                         83.6    9e-16   Arenibacter latericius
ref|WP_035128700.1|  cystathionine beta-lyase                         83.6    9e-16   Flavobacterium aquatile
ref|WP_026728807.1|  cystathionine beta-lyase                         83.6    9e-16   Flavobacterium denitrificans
ref|WP_029294450.1|  cystathionine beta-lyase                         83.6    9e-16   Chryseobacterium hispalense
ref|WP_026985975.1|  cystathionine beta-lyase                         83.6    1e-15   Flavobacterium sp. URHB0058
ref|WP_035684485.1|  cystathionine beta-lyase                         83.2    1e-15   Flavobacterium reichenbachii
gb|KIX21419.1|  cystathionine beta-lyase                              83.2    1e-15   Flavobacterium sp. 316
ref|WP_026716030.1|  cystathionine beta-lyase                         83.2    1e-15   Flavobacterium gelidilacus
ref|WP_011963843.1|  cystathionine beta-lyase                         83.2    1e-15   Flavobacterium psychrophilum
ref|WP_042566587.1|  cystathionine beta-lyase                         83.2    1e-15   Flavobacterium sp. MEB061
ref|WP_035649238.1|  cystathionine beta-lyase                         83.2    1e-15   Flavobacterium sp. Fl
ref|WP_007804337.1|  cystathionine beta-lyase                         83.2    1e-15   Flavobacterium sp. CF136
ref|WP_026976217.1|  cystathionine beta-lyase                         83.2    1e-15   Flavobacterium tegetincola
ref|WP_034045025.1|  cystathionine beta-lyase                         83.2    1e-15   Flaviramulus ichthyoenteri
ref|WP_039353474.1|  cystathionine beta-lyase                         83.2    1e-15   Chryseobacterium jeonii
ref|WP_036385279.1|  cystathionine beta-lyase                         83.2    1e-15   Muricauda sp. MAR_2010_75
ref|WP_013307125.1|  cystathionine beta-lyase                         83.2    1e-15   Maribacter sp. HTCC2170
ref|WP_027137507.1|  cystathionine beta-lyase                         83.2    1e-15   Gaetbulibacter saemankumensis
ref|WP_029035905.1|  cystathionine beta-lyase                         83.2    1e-15   Salinimicrobium xinjiangense
ref|WP_008272189.1|  cystathionine beta-lyase                         83.2    1e-15   Flavobacteriales bacterium ALC-1
ref|WP_036783245.1|  cystathionine beta-lyase                         82.8    1e-15   Polaribacter
ref|WP_008257661.1|  cystathionine beta-lyase                         82.8    1e-15   Flavobacteria bacterium BAL38
ref|WP_034719601.1|  cystathionine beta-lyase                         82.8    2e-15   Chryseobacterium antarcticum
ref|WP_022827196.1|  cystathionine beta-lyase                         82.8    2e-15   Flavobacterium antarcticum
ref|WP_026451516.1|  cystathionine beta-lyase                         82.8    2e-15   Aequorivita capsosiphonis
ref|WP_040280051.1|  cystathionine beta-lyase                         82.8    2e-15   Psychroserpens damuponensis
ref|WP_023572328.1|  cystathionine beta-lyase                         82.8    2e-15   Flavobacterium enshiense
ref|WP_034891363.1|  cystathionine beta-lyase                         82.4    2e-15   Gillisia sp. Hel_I_29
ref|WP_026981459.1|  cystathionine beta-lyase                         82.4    2e-15   Flavobacterium suncheonense
ref|WP_039366244.1|  cystathionine beta-lyase                         82.4    2e-15   Chryseobacterium taiwanense
ref|WP_027386160.1|  cystathionine beta-lyase                         82.4    2e-15   Chryseobacterium gregarium
ref|WP_038530974.1|  cystathionine beta-lyase                         82.4    2e-15   Formosa agariphila
gb|KFF74221.1|  cystathionine beta-lyase                              82.4    2e-15   Chryseobacterium sp. P1-3
ref|WP_002980746.1|  cystathionine beta-lyase                         82.4    2e-15   Chryseobacterium gleum
ref|WP_034678770.1|  cystathionine beta-lyase                         82.4    2e-15   Chryseobacterium formosense
ref|WP_008239835.1|  cystathionine beta-lyase                         82.4    3e-15   Imtechella halotolerans
ref|WP_034711020.1|  cystathionine beta-lyase                         82.4    3e-15   Chryseobacterium soli
ref|WP_040995836.1|  cystathionine beta-lyase                         82.4    3e-15   Chryseobacterium oranimense
ref|WP_044624939.1|  cystathionine beta-lyase                         82.0    3e-15   Tamlana nanhaiensis
ref|WP_023576634.1|  cystathionine beta-lyase                         82.0    3e-15   Flavobacterium saliperosum
ref|WP_023579261.1|  cystathionine beta-lyase                         82.0    3e-15   Flavobacterium limnosediminis
ref|WP_034704868.1|  cystathionine beta-lyase                         82.0    3e-15   Chryseobacterium luteum
ref|WP_013749695.1|  cystathionine beta-lyase                         82.0    3e-15   Dokdonia sp. 4H-3-7-5
ref|WP_014783742.1|  cystathionine beta-lyase                         82.0    3e-15   Aequorivita sublithincola
ref|WP_041802134.1|  cystathionine beta-lyase                         82.0    4e-15   Muricauda ruestringensis
ref|WP_034059175.1|  cystathionine beta-lyase                         81.6    4e-15   Lacinutrix jangbogonensis
ref|WP_023571459.1|  cystathionine beta-lyase                         81.6    4e-15   Flavobacterium cauense
ref|WP_026726694.1|  cystathionine beta-lyase                         81.6    4e-15   Flavobacterium sasangense
ref|WP_034726484.1|  cystathionine beta-lyase                         81.6    4e-15   Chryseobacterium
ref|WP_034743007.1|  cystathionine beta-lyase                         81.6    4e-15   Chryseobacterium vrystaatense
ref|WP_013188250.1|  cystathionine beta-lyase                         81.6    4e-15   Croceibacter atlanticus
dbj|BAO77673.1|  O-acetylhomoserine sulfhydrylase                     81.6    5e-15   Winogradskyella sp. PG-2
ref|WP_040506325.1|  cystathionine beta-lyase                         81.3    5e-15   Gillisia limnaea
dbj|BAP30620.1|  putative methionine gamma-lyase                      81.3    5e-15   Chryseobacterium sp. StRB126
gb|AEM72292.1|  Cystathionine gamma-lyase                             81.6    5e-15   Muricauda ruestringensis DSM 13258
ref|WP_013552336.1|  cystathionine beta-lyase                         81.3    6e-15   Cellulophaga algicola
ref|WP_034685460.1|  cystathionine beta-lyase                         81.3    6e-15   Chryseobacterium piperi
ref|WP_007842611.1|  MULTISPECIES: cystathionine beta-lyase           81.3    6e-15   Chryseobacterium
gb|EHQ04475.1|  Cys/Met metabolism pyridoxal-phosphate-dependent ...  81.3    6e-15   Gillisia limnaea DSM 15749
ref|WP_039346486.1|  cystathionine beta-lyase                         81.3    7e-15   Chryseobacterium solincola
ref|WP_040253833.1|  cystathionine beta-lyase                         81.3    7e-15   Psychroserpens mesophilus
ref|WP_034695275.1|  cystathionine beta-lyase                         80.9    8e-15   Chryseobacterium sp. CF365
ref|WP_034733845.1|  cystathionine beta-lyase                         80.9    8e-15   Chryseobacterium indologenes
ref|WP_027373193.1|  cystathionine beta-lyase                         80.9    8e-15   Chryseobacterium
ref|XP_006662513.1|  PREDICTED: LOW QUALITY PROTEIN: methionine g...  79.7    9e-15   Oryza brachyantha
ref|WP_027378279.1|  cystathionine beta-lyase                         80.9    9e-15   Chryseobacterium daeguense
ref|WP_025615136.1|  cystathionine beta-lyase                         80.9    1e-14   Cellulophaga baltica
ref|WP_024480783.1|  cystathionine beta-lyase                         80.5    1e-14   Cellulophaga baltica
ref|WP_028281947.1|  cystathionine beta-lyase                         80.5    1e-14   Olleya marilimosa
emb|CCF99963.1|  methionine gamma-lyase                               80.5    1e-14   uncultured Flavobacteriia bacterium
ref|WP_029446484.1|  cystathionine beta-lyase                         80.5    1e-14   Cellulophaga baltica
ref|WP_029449234.1|  cystathionine beta-lyase                         80.5    1e-14   Cellulophaga baltica
ref|WP_034666996.1|  cystathionine beta-lyase                         80.5    1e-14   Cellulophaga sp. E6(2014)
ref|WP_021778620.1|  Cys/Met metabolism PLP-dependent enzyme          80.5    1e-14   Dokdonia sp. MED134
ref|WP_020081610.1|  cystathionine beta-lyase                         80.5    1e-14   
ref|WP_035334044.1|  cystathionine beta-lyase                         80.5    1e-14   Dokdonia sp. PRO95
ref|WP_035325087.1|  cystathionine beta-lyase                         80.5    1e-14   Dokdonia donghaensis
ref|WP_028891291.1|  cystathionine beta-lyase                         80.1    2e-14   Tenacibaculum sp. 47A_GOM-205m
ref|WP_028887221.1|  cystathionine beta-lyase                         79.7    2e-14   Tenacibaculum ovolyticum
ref|WP_010231094.1|  cystathionine beta-lyase                         79.7    2e-14   Gillisia marina
ref|WP_026711287.1|  cystathionine beta-lyase                         79.7    2e-14   Flavobacterium filum
ref|WP_026839051.1|  cystathionine beta-lyase                         79.3    3e-14   Gillisia sp. JM1
ref|WP_010516575.1|  cystathionine beta-lyase                         79.3    3e-14   Croceivirga radicis
ref|WP_026934033.1|  cystathionine beta-lyase                         79.0    4e-14   Gramella echinicola
ref|WP_034920606.1|  cystathionine beta-lyase                         78.6    5e-14   Gillisia sp. CAL575
gb|EDM43122.1|  probable Methionine gamma-lyase                       78.6    6e-14   unidentified eubacterium SCB49
ref|WP_042336387.1|  cystathionine beta-lyase                         77.8    1e-13   
ref|WP_034939616.1|  cystathionine beta-lyase                         77.4    1e-13   
ref|WP_034893309.1|  cystathionine beta-lyase                         76.6    1e-13   
ref|WP_008462050.1|  cystathionine beta-lyase                         77.0    2e-13   Flavobacterium sp. F52
ref|WP_034945820.1|  cystathionine beta-lyase                         75.9    4e-13   
ref|WP_041496344.1|  cystathionine beta-lyase                         75.9    4e-13   Nonlabens marinus
ref|WP_034929922.1|  cystathionine beta-lyase                         75.9    4e-13   
ref|WP_043567506.1|  cystathionine beta-lyase                         75.5    6e-13   
ref|WP_028499129.1|  O-succinylhomoserine sulfhydrylase               75.5    6e-13   Microvirgula
ref|WP_034257843.1|  cystathionine beta-lyase                         75.1    8e-13   Altibacter lentus
ref|WP_034916156.1|  cystathionine beta-lyase                         74.7    1e-12   
ref|WP_012806995.1|  cystathionine beta-lyase                         74.7    1e-12   Candidatus Accumulibacter phosphatis
gb|EXI92773.1|  Methionine gamma-lyase                                74.3    2e-12   Candidatus Accumulibacter sp. BA-94
ref|WP_008867821.1|  cystathionine beta-lyase                         73.2    4e-12   Flavobacteria bacterium MS024-3C
ref|WP_035744923.1|  O-succinylhomoserine sulfhydrylase               72.0    1e-11   Haematobacter missouriensis
ref|WP_035708234.1|  O-succinylhomoserine sulfhydrylase               72.0    1e-11   Haematobacter massiliensis
ref|WP_017509154.1|  O-succinylhomoserine sulfhydrylase               71.2    2e-11   beta proteobacterium L13
ref|WP_026285309.1|  O-succinylhomoserine sulfhydrylase               71.2    2e-11   Thiomonas sp. FB-6
ref|WP_024588507.1|  O-succinylhomoserine sulfhydrylase               70.9    3e-11   Aliihoeflea sp. 2WW
ref|WP_019700948.1|  MULTISPECIES: O-succinylhomoserine sulfhydry...  70.9    3e-11   Acidovorax oryzae
ref|WP_038506866.1|  cystathionine beta-lyase                         70.5    4e-11   Cellulophaga lytica
ref|WP_013622585.1|  cystathionine beta-lyase                         70.5    4e-11   Cellulophaga lytica
ref|WP_013276329.1|  methionine gamma-lyase                           70.5    4e-11   Thermosediminibacter oceani
ref|WP_034646638.1|  cystathionine beta-lyase                         70.1    5e-11   Cellulophaga geojensis
ref|WP_007119380.1|  O-succinylhomoserine sulfhydrylase               70.1    5e-11   Sulfitobacter indolifex
ref|WP_021099971.1|  O-acetylhomoserine sulfhydrylase                 69.7    7e-11   Litoreibacter arenae
ref|WP_018688081.1|  methionine gamma-lyase                           69.3    1e-10   Ahrensia kielensis
ref|WP_043580699.1|  O-succinylhomoserine sulfhydrylase               68.9    1e-10   Chromobacterium
ref|WP_026481510.1|  methionine gamma-lyase                           68.9    1e-10   Ahrensia sp. 13_GOM-1096m
ref|WP_041848026.1|  methionine gamma-lyase                           68.9    1e-10   Bacillus thermoamylovorans
ref|WP_019102940.1|  O-succinylhomoserine sulfhydrylase               68.9    1e-10   Chromobacterium sp. C-61
ref|WP_043590576.1|  O-succinylhomoserine sulfhydrylase               68.9    1e-10   
ref|WP_043631554.1|  O-succinylhomoserine sulfhydrylase               68.9    1e-10   
ref|WP_013960983.1|  O-succinylhomoserine sulfhydrylase               68.6    1e-10   
ref|WP_009813240.1|  O-succinylhomoserine sulfhydrylase               68.6    1e-10   
ref|WP_010141748.1|  O-succinylhomoserine sulfhydrylase               68.6    1e-10   
ref|WP_012697580.1|  O-succinylhomoserine sulfhydrylase               68.6    1e-10   
ref|WP_034793891.1|  methionine gamma-lyase                           68.6    1e-10   
ref|WP_036271375.1|  O-succinylhomoserine sulfhydrylase               68.6    1e-10   
ref|WP_009221544.1|  MULTISPECIES: methionine gamma-lyase             68.6    1e-10   
ref|WP_007255014.1|  O-succinylhomoserine sulfhydrylase               68.6    2e-10   
ref|WP_008062474.1|  O-succinylhomoserine sulfhydrylase               68.6    2e-10   
ref|WP_025053437.1|  O-succinylhomoserine sulfhydrylase               68.6    2e-10   
ref|WP_020404638.1|  hypothetical protein                             68.2    2e-10   
ref|WP_011568164.1|  O-succinylhomoserine sulfhydrylase               68.2    2e-10   
ref|WP_030059798.1|  MULTISPECIES: cystathionine gamma-synthase       68.2    2e-10   
ref|WP_026224351.1|  O-succinylhomoserine sulfhydrylase               68.2    2e-10   
ref|WP_007814589.1|  O-succinylhomoserine sulfhydrylase               68.2    2e-10   
ref|WP_026757762.1|  O-succinylhomoserine sulfhydrylase               67.8    3e-10   
ref|WP_011805891.1|  O-succinylhomoserine sulfhydrylase               67.8    3e-10   
ref|WP_011794994.1|  O-succinylhomoserine sulfhydrylase               67.8    3e-10   
ref|WP_015913659.1|  O-succinylhomoserine sulfhydrylase               67.8    3e-10   
ref|WP_036271962.1|  O-succinylhomoserine sulfhydrylase               67.8    3e-10   
ref|WP_043919224.1|  O-succinylhomoserine sulfhydrylase               67.8    3e-10   
ref|WP_043364244.1|  O-succinylhomoserine sulfhydrylase               67.8    3e-10   
ref|WP_040435711.1|  O-succinylhomoserine sulfhydrylase               67.8    3e-10   
ref|WP_022654017.1|  O-succinylhomoserine sulfhydrylase               67.4    3e-10   
ref|WP_027263953.1|  methionine gamma-lyase                           67.4    3e-10   
ref|WP_013594239.1|  O-succinylhomoserine sulfhydrylase               67.8    3e-10   
ref|WP_037211242.1|  O-succinylhomoserine sulfhydrylase               67.4    4e-10   
ref|WP_025056883.1|  O-succinylhomoserine sulfhydrylase               67.4    4e-10   
ref|WP_043550710.1|  O-succinylhomoserine sulfhydrylase               67.4    4e-10   
ref|WP_018688747.1|  O-succinylhomoserine sulfhydrylase               67.4    4e-10   
ref|WP_044374241.1|  cystathionine gamma-synthase                     67.4    4e-10   
ref|WP_034730173.1|  methionine gamma-lyase                           67.4    4e-10   
ref|WP_025045210.1|  O-succinylhomoserine sulfhydrylase               67.4    4e-10   
ref|WP_018426464.1|  O-succinylhomoserine sulfhydrylase               67.0    5e-10   
gb|KFL90188.1|  O-acetylhomoserine sulfhydrylase                      67.0    5e-10   
ref|WP_035039584.1|  O-succinylhomoserine sulfhydrylase               67.0    5e-10   
ref|WP_012561835.1|  O-succinylhomoserine sulfhydrylase               67.0    5e-10   
gb|KIX16837.1|  O-succinylhomoserine sulfhydrylase                    67.0    6e-10   
ref|WP_034772814.1|  methionine gamma-lyase                           67.0    6e-10   
ref|WP_009339625.1|  O-succinylhomoserine sulfhydrylase               67.0    6e-10   
ref|WP_027842590.1|  O-succinylhomoserine sulfhydrylase               67.0    6e-10   
ref|WP_028400786.1|  methionine gamma-lyase                           66.6    6e-10   
ref|WP_013172954.1|  methionine gamma-lyase [                         66.6    6e-10   
ref|WP_003614965.1|  O-succinylhomoserine sulfhydrylase               66.6    7e-10   
ref|WP_028466506.1|  O-succinylhomoserine sulfhydrylase               66.6    7e-10   
ref|WP_026606199.1|  O-succinylhomoserine sulfhydrylase               66.6    7e-10   
ref|WP_043121683.1|  O-succinylhomoserine sulfhydrylase               66.6    7e-10   
ref|WP_037904760.1|  O-succinylhomoserine sulfhydrylase               66.6    7e-10   
ref|WP_025048803.1|  O-succinylhomoserine sulfhydrylase               66.6    8e-10   
ref|WP_018037256.1|  O-succinylhomoserine sulfhydrylase               66.2    9e-10   
ref|WP_009464693.1|  O-succinylhomoserine sulfhydrylase               66.2    9e-10   
ref|WP_040753691.1|  O-succinylhomoserine sulfhydrylase               66.2    9e-10   
ref|WP_035311335.1|  methionine gamma-lyase                           66.2    9e-10   
ref|WP_027833869.1|  O-succinylhomoserine sulfhydrylase               66.2    9e-10   
ref|WP_018408119.1|  O-succinylhomoserine sulfhydrylase               66.2    9e-10   
ref|WP_029651473.1|  O-succinylhomoserine sulfhydrylase               66.2    1e-09   
ref|WP_042351838.1|  methionine gamma-lyase                           66.2    1e-09   
ref|WP_039810414.1|  methionine gamma-lyase                           66.2    1e-09   
gb|KGL01173.1|  O-succinylhomoserine sulfhydrylase                    66.2    1e-09   
ref|WP_026479308.1|  O-succinylhomoserine sulfhydrylase               65.9    1e-09   
ref|WP_002717413.1|  O-succinylhomoserine sulfhydrylase               65.9    1e-09   
ref|WP_042413119.1|  O-succinylhomoserine sulfhydrylase               66.2    1e-09   
ref|WP_038006667.1|  MULTISPECIES: O-succinylhomoserine sulfhydry...  65.9    1e-09   
ref|WP_026060540.1|  O-succinylhomoserine sulfhydrylase               65.9    1e-09   
ref|WP_041902508.1|  methionine gamma-lyase                           65.9    1e-09   
ref|WP_043386217.1|  O-succinylhomoserine sulfhydrylase               65.9    1e-09   
dbj|BAQ16302.1|  O-acetylhomoserine sulfhydrylase                     65.9    1e-09   
ref|WP_039531350.1|  O-succinylhomoserine sulfhydrylase               65.9    1e-09   
ref|WP_020173493.1|  O-succinylhomoserine sulfhydrylase               65.9    1e-09   
gb|EKE76285.1|  methionine gamma-lyase                                65.9    1e-09   
ref|WP_035481245.1|  methionine gamma-lyase                           65.9    1e-09   
ref|WP_043950486.1|  O-succinylhomoserine sulfhydrylase               65.9    1e-09   
ref|WP_036261931.1|  O-succinylhomoserine sulfhydrylase               65.9    1e-09   
ref|WP_025061535.1|  O-succinylhomoserine sulfhydrylase               65.9    1e-09   
ref|WP_022572027.1|  O-succinylhomoserine sulfhydrylase               65.9    1e-09   
ref|WP_039127354.1|  O-succinylhomoserine sulfhydrylase               65.5    2e-09   
ref|WP_025058030.1|  O-succinylhomoserine sulfhydrylase               65.5    2e-09   
ref|WP_026598462.1|  O-succinylhomoserine sulfhydrylase               65.5    2e-09   
ref|WP_008888401.1|  methionine gamma-lyase                           65.9    2e-09   
gb|KIN71748.1|  O-succinylhomoserine sulfhydrylase                    65.9    2e-09   
ref|WP_028449386.1|  O-succinylhomoserine sulfhydrylase               65.5    2e-09   
emb|CDO60127.1|  O-acetylhomoserine sulfhydrylase / O-succinylhom...  65.9    2e-09   
ref|WP_008835781.1|  O-succinylhomoserine sulfhydrylase               65.5    2e-09   
ref|WP_007088882.1|  methionine gamma-lyase                           65.5    2e-09   
ref|WP_008208217.1|  O-succinylhomoserine sulfhydrylase               65.5    2e-09   
ref|WP_003446136.1|  MULTISPECIES: O-succinylhomoserine sulfhydry...  65.5    2e-09   
ref|WP_037986959.1|  methionine gamma-lyase                           65.5    2e-09   
ref|WP_039251039.1|  methionine gamma-lyase                           65.5    2e-09   
ref|WP_015047500.1|  methionine gamma-lyase                           65.5    2e-09   
ref|WP_020210429.1|  O-succinylhomoserine sulfhydrylase               65.5    2e-09   
ref|WP_026695058.1|  methionine gamma-lyase                           65.5    2e-09   
ref|WP_012325702.1|  methionine gamma-lyase                           65.5    2e-09   
ref|WP_011722647.1|  methionine gamma-lyase                           65.5    2e-09   
ref|WP_035026366.1|  MULTISPECIES: O-succinylhomoserine sulfhydry...  65.5    2e-09   
ref|WP_027240963.1|  O-succinylhomoserine sulfhydrylase               65.5    2e-09   
ref|WP_009811668.1|  O-succinylhomoserine sulfhydrylase               65.1    2e-09   
ref|WP_009818224.1|  O-succinylhomoserine sulfhydrylase               65.1    2e-09   
ref|WP_028300382.1|  O-succinylhomoserine sulfhydrylase               65.1    2e-09   
ref|WP_027467565.1|  O-succinylhomoserine sulfhydrylase               65.1    2e-09   
ref|WP_036286689.1|  O-succinylhomoserine sulfhydrylase               65.1    2e-09   
ref|WP_007426364.1|  O-succinylhomoserine sulfhydrylase               65.1    2e-09   
ref|WP_018265843.1|  O-succinylhomoserine sulfhydrylase               65.1    2e-09   
ref|WP_039002581.1|  O-succinylhomoserine sulfhydrylase               65.1    2e-09   
ref|WP_036638889.1|  O-succinylhomoserine sulfhydrylase               65.1    2e-09   
ref|WP_024096505.1|  O-succinylhomoserine sulfhydrylase               65.1    2e-09   
ref|WP_019430747.1|  O-succinylhomoserine sulfhydrylase               65.1    2e-09   
ref|WP_014880643.1|  O-succinylhomoserine sulfhydrylase               65.1    2e-09   
ref|WP_039227213.1|  MULTISPECIES: methionine gamma-lyase             65.1    2e-09   
ref|WP_014875255.1|  O-succinylhomoserine sulfhydrylase               65.1    2e-09   
ref|WP_034936091.1|  O-succinylhomoserine sulfhydrylase               65.1    2e-09   
ref|WP_008280329.1|  O-succinylhomoserine sulfhydrylase               65.1    2e-09   
ref|WP_020535505.1|  hypothetical protein                             65.1    2e-09   
ref|WP_037307528.1|  O-succinylhomoserine sulfhydrylase               65.1    2e-09   
ref|WP_036280212.1|  O-succinylhomoserine sulfhydrylase               65.1    2e-09   
ref|WP_019958792.1|  hypothetical protein                             65.1    2e-09   
gb|AJT42023.1|  O-succinylhomoserine sulfhydrylase                    65.1    2e-09   
ref|WP_039149817.1|  MULTISPECIES: O-succinylhomoserine sulfhydry...  65.1    2e-09   
ref|WP_027246877.1|  O-succinylhomoserine sulfhydrylase               65.1    3e-09   
ref|WP_026477946.1|  methionine gamma-lyase                           65.1    3e-09   
ref|WP_039170244.1|  O-succinylhomoserine sulfhydrylase               65.1    3e-09   
ref|WP_043112296.1|  O-succinylhomoserine sulfhydrylase               65.1    3e-09   
ref|WP_040180135.1|  O-succinylhomoserine sulfhydrylase               65.1    3e-09   
ref|WP_040449555.1|  O-succinylhomoserine sulfhydrylase               65.1    3e-09   
ref|WP_041060134.1|  methionine gamma-lyase                           65.1    3e-09   
ref|WP_013900388.1|  O-succinylhomoserine sulfhydrylase               65.1    3e-09   
ref|WP_040174091.1|  O-succinylhomoserine sulfhydrylase               65.1    3e-09   
ref|WP_037926090.1|  O-succinylhomoserine sulfhydrylase               65.1    3e-09   
ref|WP_029204875.1|  MULTISPECIES: O-succinylhomoserine sulfhydry...  65.1    3e-09   
ref|WP_039186959.1|  O-succinylhomoserine sulfhydrylase               64.7    3e-09   
ref|WP_041523488.1|  O-succinylhomoserine sulfhydrylase               65.1    3e-09   
dbj|BAP29046.1|  cys/met metabolism pyridoxal-phosphate-dependent...  64.7    3e-09   
ref|WP_008757616.1|  O-succinylhomoserine sulfhydrylase               64.7    3e-09   
ref|WP_037281724.1|  O-succinylhomoserine sulfhydrylase               64.7    3e-09   
ref|WP_027244344.1|  O-succinylhomoserine sulfhydrylase               64.7    3e-09   
ref|WP_017490384.1|  methionine gamma-lyase                           64.7    3e-09   
ref|WP_018760733.1|  O-succinylhomoserine sulfhydrylase               64.7    3e-09   
ref|WP_015938795.1|  O-succinylhomoserine sulfhydrylase               64.7    3e-09   
ref|WP_028270951.1|  O-succinylhomoserine sulfhydrylase               64.7    3e-09   
ref|WP_035130704.1|  methionine gamma-lyase                           64.7    3e-09   
ref|WP_027238239.1|  O-succinylhomoserine sulfhydrylase               64.7    3e-09   
ref|WP_011776277.1|  MULTISPECIES: O-succinylhomoserine sulfhydry...  64.7    3e-09   
gb|EJW12452.1|  O-acetylhomoserine sulfhydrylase                      64.7    3e-09   
ref|WP_009019868.1|  O-succinylhomoserine sulfhydrylase               64.7    3e-09   
ref|WP_028958189.1|  O-succinylhomoserine sulfhydrylase               64.7    3e-09   
ref|WP_022702794.1|  O-succinylhomoserine sulfhydrylase               64.7    3e-09   
ref|WP_033070564.1|  methionine gamma-lyase                           64.7    3e-09   
ref|WP_027259587.1|  O-succinylhomoserine sulfhydrylase               64.7    3e-09   
ref|WP_043485102.1|  O-succinylhomoserine sulfhydrylase               64.7    3e-09   
ref|WP_011693683.1|  O-succinylhomoserine sulfhydrylase               64.7    3e-09   
ref|WP_027371669.1|  O-succinylhomoserine sulfhydrylase               64.7    3e-09   
emb|CAL65305.1|  O-succinylhomoserine sulfhydrylase                   64.7    3e-09   
ref|WP_018778197.1|  O-succinylhomoserine sulfhydrylase               64.7    3e-09   
ref|WP_013602683.1|  O-succinylhomoserine sulfhydrylase               64.7    3e-09   
ref|WP_039243086.1|  O-succinylhomoserine sulfhydrylase               64.7    3e-09   
ref|WP_026543349.1|  O-succinylhomoserine sulfhydrylase               64.7    3e-09   
ref|WP_018774056.1|  O-succinylhomoserine sulfhydrylase               64.7    3e-09   
ref|WP_017200108.1|  O-succinylhomoserine sulfhydrylase               64.7    3e-09   
ref|WP_038308852.1|  O-succinylhomoserine sulfhydrylase               64.7    3e-09   
ref|WP_018769986.1|  O-succinylhomoserine sulfhydrylase               64.7    3e-09   
ref|WP_040619539.1|  O-succinylhomoserine sulfhydrylase               64.7    3e-09   
ref|WP_035353618.1|  O-succinylhomoserine sulfhydrylase               64.7    3e-09   
ref|WP_028275399.1|  O-succinylhomoserine sulfhydrylase               64.7    3e-09   
ref|WP_028549053.1|  cystathionine beta-lyase                         64.7    3e-09   
ref|WP_028267608.1|  O-succinylhomoserine sulfhydrylase               64.7    3e-09   
ref|WP_026538199.1|  O-succinylhomoserine sulfhydrylase               64.7    3e-09   
emb|CCQ44171.1|  O-succinylhomoserine sulfhydrylase                   64.7    3e-09   
ref|WP_005982241.1|  O-succinylhomoserine sulfhydrylase               64.7    3e-09   
ref|WP_043453686.1|  O-succinylhomoserine sulfhydrylase               64.7    3e-09   
ref|WP_024818334.1|  O-succinylhomoserine sulfhydrylase               64.7    3e-09   
ref|WP_037242618.1|  O-succinylhomoserine sulfhydrylase               64.7    3e-09   
ref|WP_011047089.1|  O-succinylhomoserine sulfhydrylase               64.7    3e-09   
ref|WP_019640982.1|  O-succinylhomoserine sulfhydrylase               64.7    3e-09   
ref|WP_029557090.1|  O-succinylhomoserine sulfhydrylase               64.7    3e-09   
ref|WP_024367058.1|  O-succinylhomoserine sulfhydrylase               64.7    3e-09   
ref|WP_035750245.1|  O-succinylhomoserine sulfhydrylase               64.7    4e-09   
ref|WP_011111321.1|  O-succinylhomoserine sulfhydrylase               64.7    4e-09   
ref|WP_009526282.1|  MULTISPECIES: methionine gamma-lyase             64.7    4e-09   
gb|ADZ71677.1|  O-succinylhomoserine (Thiol)-lyase protein            64.7    4e-09   
ref|WP_042424124.1|  O-succinylhomoserine sulfhydrylase               64.7    4e-09   
ref|WP_017329981.1|  O-succinylhomoserine sulfhydrylase               64.3    4e-09   
ref|WP_024277462.1|  O-succinylhomoserine sulfhydrylase               64.7    4e-09   
gb|EGE47690.1|  O-succinylhomoserine sulfhydrylase                    64.7    4e-09   
ref|WP_010836756.1|  O-succinylhomoserine sulfhydrylase               64.3    4e-09   
ref|WP_012346717.1|  O-succinylhomoserine sulfhydrylase               64.7    4e-09   
ref|WP_043905142.1|  methionine gamma-lyase                           64.3    4e-09   
ref|WP_039167632.1|  O-succinylhomoserine sulfhydrylase               64.3    4e-09   
ref|WP_019021780.1|  O-succinylhomoserine sulfhydrylase               64.3    4e-09   
ref|WP_043771386.1|  O-succinylhomoserine sulfhydrylase               64.3    4e-09   
ref|WP_007579607.1|  MULTISPECIES: O-succinylhomoserine sulfhydry...  64.3    4e-09   
ref|WP_019589763.1|  MULTISPECIES: O-succinylhomoserine sulfhydry...  64.3    4e-09   
ref|WP_008029981.1|  O-succinylhomoserine sulfhydrylase               64.3    4e-09   
ref|WP_011634234.1|  O-succinylhomoserine sulfhydrylase               64.3    4e-09   
ref|WP_018946851.1|  O-succinylhomoserine sulfhydrylase               64.3    4e-09   
ref|WP_030243834.1|  cystathionine gamma-synthase                     64.3    4e-09   
ref|WP_024809302.1|  O-succinylhomoserine sulfhydrylase               64.3    4e-09   
ref|WP_010439253.1|  O-succinylhomoserine sulfhydrylase               64.3    4e-09   
ref|WP_018870337.1|  MULTISPECIES: O-succinylhomoserine sulfhydry...  64.3    4e-09   
ref|WP_011628987.1|  O-succinylhomoserine sulfhydrylase               64.3    4e-09   
ref|WP_019591112.1|  O-succinylhomoserine sulfhydrylase               64.3    4e-09   
ref|WP_034734866.1|  O-succinylhomoserine sulfhydrylase               64.3    4e-09   
ref|WP_028451110.1|  O-succinylhomoserine sulfhydrylase               64.3    4e-09   
ref|WP_020680403.1|  hypothetical protein                             64.3    5e-09   
ref|WP_014889505.1|  O-succinylhomoserine sulfhydrylase               64.3    5e-09   
ref|WP_009526890.1|  MULTISPECIES: methionine gamma-lyase             64.3    5e-09   
ref|WP_024328721.1|  O-succinylhomoserine sulfhydrylase               64.3    5e-09   
ref|WP_027884527.1|  cystathionine beta-lyase                         64.3    5e-09   
ref|WP_022707763.1|  O-succinylhomoserine sulfhydrylase               64.3    5e-09   
ref|WP_026352470.1|  O-succinylhomoserine sulfhydrylase               64.3    5e-09   
ref|WP_021474071.1|  O-succinylhomoserine sulfhydrylase               64.3    5e-09   
ref|WP_011136272.1|  O-succinylhomoserine sulfhydrylase               64.3    5e-09   
ref|WP_044829616.1|  methionine gamma-lyase                           64.3    5e-09   
ref|WP_003938316.1|  O-succinylhomoserine sulfhydrylase               64.3    5e-09   
ref|WP_010593167.1|  MULTISPECIES: O-succinylhomoserine sulfhydry...  64.3    5e-09   
ref|WP_014899944.1|  O-succinylhomoserine sulfhydrylase               63.9    5e-09   
ref|WP_008230370.1|  O-succinylhomoserine sulfhydrylase               63.9    5e-09   
ref|WP_012403670.1|  O-succinylhomoserine sulfhydrylase               63.9    5e-09   
ref|WP_001089882.1|  hypothetical protein                             61.2    5e-09   
ref|WP_017680704.1|  O-succinylhomoserine sulfhydrylase               64.3    5e-09   
ref|WP_027791151.1|  O-succinylhomoserine sulfhydrylase               63.9    5e-09   



>ref|XP_006343784.1| PREDICTED: methionine gamma-lyase-like [Solanum tuberosum]
Length=451

 Score =   221 bits (563),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 112/153 (73%), Positives = 129/153 (84%), Gaps = 7/153 (5%)
 Frame = +2

Query  71   MAETIHQNVNV--SNKRRP-GSEEWER--DDMMKAKKGGKPAVQMWEDPAAALASARHEF  235
            MA+T++QN N+  SNK+R  GS+E +   D    +KK  K  V  WEDPAAALA+ARHEF
Sbjct  1    MADTLNQNTNIVASNKKRSSGSDECDHHDDSFFVSKKQSKSLV--WEDPAAALANARHEF  58

Query  236  GEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAME  415
            GEHGGVNMSIEASATFTVMEPE++RRMF+GELGPD D+FIYSRHFNPTVLN+ RLMAA+E
Sbjct  59   GEHGGVNMSIEASATFTVMEPETMRRMFAGELGPDRDFFIYSRHFNPTVLNLGRLMAALE  118

Query  416  GTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            GTEAAYCTASGMSAISSVM QL SSG HVVA++
Sbjct  119  GTEAAYCTASGMSAISSVMLQLCSSGGHVVASQ  151



>ref|XP_009625576.1| PREDICTED: methionine gamma-lyase [Nicotiana tomentosiformis]
Length=443

 Score =   221 bits (562),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 127/149 (85%), Gaps = 2/149 (1%)
 Frame = +2

Query  71   MAETIHQNVNVSNKRRPGSEEWER-DDMMKAKKGGKPAVQMWEDPAAALASARHEFGEHG  247
            MA+ + QN  VSNK+   S+E +  DD++ AKK  K  + +W+DPAAALA+ARHEFGEHG
Sbjct  1    MADKLQQNAVVSNKKLSASDERDHCDDVIVAKKPTKHHL-IWDDPAAALANARHEFGEHG  59

Query  248  GVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGTEA  427
            GVNMSIEASATFTVM+PE L RMF+GELGPD D+FIYSRHFNPTVLN+ RLMAA+EGTEA
Sbjct  60   GVNMSIEASATFTVMDPEILSRMFAGELGPDRDFFIYSRHFNPTVLNLGRLMAALEGTEA  119

Query  428  AYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            AYCT+SGMSAI+SVM QL SSGDHVVA+R
Sbjct  120  AYCTSSGMSAIASVMLQLCSSGDHVVASR  148



>gb|KDP25202.1| hypothetical protein JCGZ_20358 [Jatropha curcas]
Length=453

 Score =   221 bits (562),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 109/150 (73%), Positives = 127/150 (85%), Gaps = 2/150 (1%)
 Frame = +2

Query  71   MAETIHQNVNV-SNKRRPGSEEWERDDMMKAKKGGKP-AVQMWEDPAAALASARHEFGEH  244
            MAET   NV V S K+R G ++++ DD++KAKK   P A+   +DP AALA+ARHEFGEH
Sbjct  1    MAETKTNNVFVPSGKKRTGQDDFDGDDVIKAKKSMLPSALSFGDDPVAALAAARHEFGEH  60

Query  245  GGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGTE  424
            GGVNMSIEASATFTVMEP+++RRMFSGELGPD D+FIYSRHFNPTVLN+ R MAA+EGTE
Sbjct  61   GGVNMSIEASATFTVMEPDTMRRMFSGELGPDRDFFIYSRHFNPTVLNLGRQMAALEGTE  120

Query  425  AAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            AAYCTASGMSAISSV+ QL SSG HVVA+R
Sbjct  121  AAYCTASGMSAISSVLLQLCSSGGHVVASR  150



>ref|XP_009796885.1| PREDICTED: methionine gamma-lyase-like [Nicotiana sylvestris]
Length=448

 Score =   220 bits (561),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 110/150 (73%), Positives = 127/150 (85%), Gaps = 4/150 (3%)
 Frame = +2

Query  71   MAETIHQNVNV-SNKRRPGSEEWER-DDMMKAKKGGKPAVQMWEDPAAALASARHEFGEH  244
            MA+T++QN  + S+K+R GS+E +  DD    KK  K  +  WEDPAAALA+ARH FGEH
Sbjct  1    MADTLNQNNMIFSSKKRSGSDEKDHHDDFFVTKKQTKSLI--WEDPAAALANARHVFGEH  58

Query  245  GGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGTE  424
            GGVNMSIEASATFTVMEPE++RRMFSGELGPD D+FIYSRHFNPTVLN+ RLMAA+EGTE
Sbjct  59   GGVNMSIEASATFTVMEPETMRRMFSGELGPDRDFFIYSRHFNPTVLNLGRLMAALEGTE  118

Query  425  AAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            AAYCTASGMSAISSV+ QL SSG HVVA+R
Sbjct  119  AAYCTASGMSAISSVLLQLCSSGGHVVASR  148



>ref|XP_004245457.1| PREDICTED: methionine gamma-lyase [Solanum lycopersicum]
Length=444

 Score =   219 bits (559),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 108/150 (72%), Positives = 126/150 (84%), Gaps = 4/150 (3%)
 Frame = +2

Query  71   MAETIHQNVNVSNKRRPGSEEWERDD--MMKAKKGGKPAVQMWEDPAAALASARHEFGEH  244
            MA+T++QN   + KR  GS++ +  D  +  +KK  K  V  WEDPAAALA+ARHEFGEH
Sbjct  1    MADTLNQNTFSNKKRSSGSDDCDHHDDTLFVSKKQSKSLV--WEDPAAALANARHEFGEH  58

Query  245  GGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGTE  424
            GGVNMSIEASATFTVMEPE++RRMF+GELGPD D+FIYSRHFNPTVLN+ RLMAA+EGTE
Sbjct  59   GGVNMSIEASATFTVMEPETMRRMFAGELGPDRDFFIYSRHFNPTVLNLGRLMAALEGTE  118

Query  425  AAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            AAYCTASGMSAISSVM QL SSG HVVA++
Sbjct  119  AAYCTASGMSAISSVMLQLCSSGGHVVASQ  148



>ref|XP_009631114.1| PREDICTED: methionine gamma-lyase-like [Nicotiana tomentosiformis]
Length=445

 Score =   219 bits (558),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 107/138 (78%), Positives = 119/138 (86%), Gaps = 3/138 (2%)
 Frame = +2

Query  104  SNKRRPGSEEWER-DDMMKAKKGGKPAVQMWEDPAAALASARHEFGEHGGVNMSIEASAT  280
            SNK+R GS+E +  DD    KK  K  +  WEDPAAALA+ARHEFGEHGGVNMSIEASAT
Sbjct  10   SNKKRSGSDEKDHHDDFFVTKKQTKSLI--WEDPAAALANARHEFGEHGGVNMSIEASAT  67

Query  281  FTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGTEAAYCTASGMSAI  460
            FTVMEPE++RRMFSGELGPD D+FIYSRHFNPTVLN+ RLMAA+EGTEAAYCTASGMSAI
Sbjct  68   FTVMEPETMRRMFSGELGPDRDFFIYSRHFNPTVLNLGRLMAALEGTEAAYCTASGMSAI  127

Query  461  SSVMFQLLSSGDHVVAAR  514
            SSV+ QL SSG HVVA+R
Sbjct  128  SSVLLQLCSSGGHVVASR  145



>ref|XP_009785770.1| PREDICTED: methionine gamma-lyase-like [Nicotiana sylvestris]
Length=436

 Score =   216 bits (549),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 104/148 (70%), Positives = 120/148 (81%), Gaps = 7/148 (5%)
 Frame = +2

Query  71   MAETIHQNVNVSNKRRPGSEEWERDDMMKAKKGGKPAVQMWEDPAAALASARHEFGEHGG  250
            MA+ + QN  VSN++R  S+E +  D  K          +WEDPAAALA  RHEFGEHGG
Sbjct  1    MADKLQQNAIVSNQKRSASDEHDHRDDFKHH-------LIWEDPAAALADIRHEFGEHGG  53

Query  251  VNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGTEAA  430
            VNMSIEASATFTVM+PE+L RMF+GELGPD D+FIYSRHFNPTVLN+ RLMAA+EGTEAA
Sbjct  54   VNMSIEASATFTVMDPETLSRMFAGELGPDRDFFIYSRHFNPTVLNLGRLMAALEGTEAA  113

Query  431  YCTASGMSAISSVMFQLLSSGDHVVAAR  514
            YCT+SGMSAI+SVM QL SSGDHVVA+R
Sbjct  114  YCTSSGMSAIASVMLQLCSSGDHVVASR  141



>gb|KCW77319.1| hypothetical protein EUGRSUZ_D01681 [Eucalyptus grandis]
Length=371

 Score =   213 bits (542),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 123/152 (81%), Gaps = 4/152 (3%)
 Frame = +2

Query  71   MAETIHQNVNVSNKRRPGSEEWE--RDDMMKAKKG--GKPAVQMWEDPAAALASARHEFG  238
            MAE        ++K+RPGS++ +   D M+ AKK     P   +WEDPAAALA ARHEFG
Sbjct  1    MAEARAHGFVYASKKRPGSDDADGGEDAMVVAKKQMISGPVAGVWEDPAAALAGARHEFG  60

Query  239  EHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEG  418
            EHGGVNMSIEASATFTVMEPE++RRMF+GELGPD D+FIYSRHFNPTVLN+ R MAA+EG
Sbjct  61   EHGGVNMSIEASATFTVMEPETMRRMFTGELGPDRDFFIYSRHFNPTVLNLGRQMAALEG  120

Query  419  TEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            TEAAYCTASGMSAISSV+ QL SSG H+VA++
Sbjct  121  TEAAYCTASGMSAISSVLMQLCSSGGHIVASQ  152



>ref|XP_010251592.1| PREDICTED: methionine gamma-lyase [Nelumbo nucifera]
Length=446

 Score =   214 bits (544),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 103/148 (70%), Positives = 123/148 (83%), Gaps = 4/148 (3%)
 Frame = +2

Query  71   MAETIHQNVNVSNKRRPGSEEWERDDMMKAKKGGKPAVQMWEDPAAALASARHEFGEHGG  250
            MAE+   +V++  K+R G +++E DD + AKK    +V    DPAA+LA ARHEFGEHGG
Sbjct  1    MAESRCLDVSLIGKKRNGKDDFENDDFVVAKK----SVVACNDPAASLAGARHEFGEHGG  56

Query  251  VNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGTEAA  430
            VNMSIEASATFTVMEPE++RRMF+GELGPD D+FIYSRHFNPTVLN+ R MAA+EGTEAA
Sbjct  57   VNMSIEASATFTVMEPETMRRMFTGELGPDQDFFIYSRHFNPTVLNLGRQMAALEGTEAA  116

Query  431  YCTASGMSAISSVMFQLLSSGDHVVAAR  514
            YCTASGMSAIS+V+ QL  SGDHVVA+R
Sbjct  117  YCTASGMSAISTVLMQLCGSGDHVVASR  144



>ref|XP_010053068.1| PREDICTED: methionine gamma-lyase [Eucalyptus grandis]
 gb|KCW77318.1| hypothetical protein EUGRSUZ_D01681 [Eucalyptus grandis]
Length=455

 Score =   213 bits (542),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 123/152 (81%), Gaps = 4/152 (3%)
 Frame = +2

Query  71   MAETIHQNVNVSNKRRPGSEEWE--RDDMMKAKKG--GKPAVQMWEDPAAALASARHEFG  238
            MAE        ++K+RPGS++ +   D M+ AKK     P   +WEDPAAALA ARHEFG
Sbjct  1    MAEARAHGFVYASKKRPGSDDADGGEDAMVVAKKQMISGPVAGVWEDPAAALAGARHEFG  60

Query  239  EHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEG  418
            EHGGVNMSIEASATFTVMEPE++RRMF+GELGPD D+FIYSRHFNPTVLN+ R MAA+EG
Sbjct  61   EHGGVNMSIEASATFTVMEPETMRRMFTGELGPDRDFFIYSRHFNPTVLNLGRQMAALEG  120

Query  419  TEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            TEAAYCTASGMSAISSV+ QL SSG H+VA++
Sbjct  121  TEAAYCTASGMSAISSVLMQLCSSGGHIVASQ  152



>ref|XP_011026788.1| PREDICTED: methionine gamma-lyase [Populus euphratica]
Length=454

 Score =   211 bits (538),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 109/154 (71%), Positives = 124/154 (81%), Gaps = 8/154 (5%)
 Frame = +2

Query  71   MAETIHQNVNV-SNKRRPGSEEWERDDMMKAKKG-----GKPAVQMWEDPAAALASARHE  232
            MAET +Q   V S K+R  + +   DD + A K      G P+  MWEDPAAALASARHE
Sbjct  1    MAETKNQQGFVFSGKKRSSTGQDGDDDFIVANKKSMLSTGLPS--MWEDPAAALASARHE  58

Query  233  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  412
            FGEHGGVNMSIEASATFTVMEPE++RRMF+GELGPD D+FIYSRHFNPTVLN+ R MAA+
Sbjct  59   FGEHGGVNMSIEASATFTVMEPETMRRMFAGELGPDRDFFIYSRHFNPTVLNLGRQMAAL  118

Query  413  EGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            EGTEAAYCTASGMSAISSV+ QL SSG H+VA+R
Sbjct  119  EGTEAAYCTASGMSAISSVLLQLCSSGGHMVASR  152



>ref|XP_002299428.1| Cys/Met metabolism pyridoxal-phosphate-dependent enzyme family 
protein [Populus trichocarpa]
 gb|EEE84233.1| Cys/Met metabolism pyridoxal-phosphate-dependent enzyme family 
protein [Populus trichocarpa]
Length=454

 Score =   210 bits (535),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 108/154 (70%), Positives = 124/154 (81%), Gaps = 8/154 (5%)
 Frame = +2

Query  71   MAETIHQNVNV-SNKRRPGSEEWERDDMMKAKKG-----GKPAVQMWEDPAAALASARHE  232
            MAET +Q   V S K+R  + +   DD + + K      G P+  MWEDPAAALASARHE
Sbjct  1    MAETKNQQGFVFSGKKRSSTGQDGDDDFIVSNKKSMLSTGLPS--MWEDPAAALASARHE  58

Query  233  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  412
            FGEHGGVNMSIEASATFTVMEPE++RRMF+GELGPD D+FIYSRHFNPTVLN+ R MAA+
Sbjct  59   FGEHGGVNMSIEASATFTVMEPETMRRMFAGELGPDRDFFIYSRHFNPTVLNLGRQMAAL  118

Query  413  EGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            EGTEAAYCTASGMSAISSV+ QL SSG H+VA+R
Sbjct  119  EGTEAAYCTASGMSAISSVLLQLCSSGGHMVASR  152



>ref|XP_008374119.1| PREDICTED: methionine gamma-lyase-like [Malus domestica]
Length=457

 Score =   210 bits (534),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 105/154 (68%), Positives = 125/154 (81%), Gaps = 6/154 (4%)
 Frame = +2

Query  71   MAETIHQNV---NVSNKRRPGSEEWERDDMMKAKKG---GKPAVQMWEDPAAALASARHE  232
            MA+T  Q +     ++K+R   ++ + +D + AKK       A   WEDPAAALASARHE
Sbjct  1    MADTKSQGLVFPPANSKKRAEHDDMDNNDYVAAKKSMLLSSAAAXAWEDPAAALASARHE  60

Query  233  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  412
            FGEHGGVNMSIEASATFTVMEPE+LR+MFSGELG D D+FIYSRHFNPTVLN+SR MAA+
Sbjct  61   FGEHGGVNMSIEASATFTVMEPETLRKMFSGELGADRDFFIYSRHFNPTVLNLSRQMAAL  120

Query  413  EGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            EGTEAAYCT+SGMSAISSV+ QL+SSG+H+VAAR
Sbjct  121  EGTEAAYCTSSGMSAISSVLLQLVSSGEHIVAAR  154



>ref|XP_011101902.1| PREDICTED: methionine gamma-lyase-like [Sesamum indicum]
Length=443

 Score =   207 bits (528),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 117/141 (83%), Gaps = 1/141 (1%)
 Frame = +2

Query  92   NVNVSNKRRPGSEEWERDDMMKAKKGGKPAVQMWEDPAAALASARHEFGEHGGVNMSIEA  271
            NVN+S  +R GS++       K  +  K A    EDPAAALA+ RHEFGEHGGVNMSIEA
Sbjct  5    NVNLSTIKRSGSDDQFASSAAKKHQINK-APPHVEDPAAALANIRHEFGEHGGVNMSIEA  63

Query  272  SATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGTEAAYCTASGM  451
            SATFTVMEP++LRRMF+GELGPD D+FIYSRHFNPTVLN+ RLMAA+EGTEAAYCTASGM
Sbjct  64   SATFTVMEPDTLRRMFAGELGPDRDFFIYSRHFNPTVLNLGRLMAALEGTEAAYCTASGM  123

Query  452  SAISSVMFQLLSSGDHVVAAR  514
            SAISSV+ QL S+GDHVVAAR
Sbjct  124  SAISSVLLQLCSAGDHVVAAR  144



>ref|XP_011070383.1| PREDICTED: methionine gamma-lyase [Sesamum indicum]
Length=456

 Score =   207 bits (527),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 119/143 (83%), Gaps = 3/143 (2%)
 Frame = +2

Query  95   VNVSNKRRPGSEEWERDDMMKAKKG---GKPAVQMWEDPAAALASARHEFGEHGGVNMSI  265
            VN+S+K+R GS + + +    AKK     K      EDPAAALA+ARHEFGEHGGVNMSI
Sbjct  11   VNMSSKKRSGSSDDQWEQFSAAKKHQVMNKTPPPHAEDPAAALANARHEFGEHGGVNMSI  70

Query  266  EASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGTEAAYCTAS  445
            EASATFTVMEPE++RRMF+GELGPD D+FIYSRHFNPTVLN+ RLMAA+EGTEAAYCTAS
Sbjct  71   EASATFTVMEPETMRRMFTGELGPDRDFFIYSRHFNPTVLNLGRLMAALEGTEAAYCTAS  130

Query  446  GMSAISSVMFQLLSSGDHVVAAR  514
            GM+AISSV+ QL SSG HVVA+R
Sbjct  131  GMAAISSVLLQLCSSGGHVVASR  153



>gb|EYU33474.1| hypothetical protein MIMGU_mgv1a006470mg [Erythranthe guttata]
 gb|EYU33475.1| hypothetical protein MIMGU_mgv1a006470mg [Erythranthe guttata]
Length=443

 Score =   207 bits (526),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 107/150 (71%), Positives = 124/150 (83%), Gaps = 4/150 (3%)
 Frame = +2

Query  71   MAET-IHQNVN-VSNKRRPGSEEWERDDMMKAKKGGKPAVQMWEDPAAALASARHEFGEH  244
            MAET  + +V+ +S K+R GS + + D    A K  + A    +DPA ALA+ARHEFGEH
Sbjct  1    MAETAFNSDVSTISAKKRSGSSDDQWDQF--AAKKHQSASNKTDDPAVALANARHEFGEH  58

Query  245  GGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGTE  424
            GGVNMSIEASATFTVMEPE++RRMF+GELGPD D+FIYSRHFNPTVLN+SRLMAAMEGTE
Sbjct  59   GGVNMSIEASATFTVMEPETMRRMFAGELGPDRDFFIYSRHFNPTVLNLSRLMAAMEGTE  118

Query  425  AAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            AAYCTASGMSAISSV+ QL SSG HVVA+R
Sbjct  119  AAYCTASGMSAISSVLLQLCSSGGHVVASR  148



>emb|CAN83499.1| hypothetical protein VITISV_026969 [Vitis vinifera]
Length=400

 Score =   205 bits (521),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 97/137 (71%), Positives = 115/137 (84%), Gaps = 2/137 (1%)
 Frame = +2

Query  104  SNKRRPGSEEWERDDMMKAKKGGKPAVQMWEDPAAALASARHEFGEHGGVNMSIEASATF  283
            + K+R G+++   D ++  K    PAV   EDP AALA ARHEFGEHGGVNMSIEASATF
Sbjct  8    AGKKRKGADD--EDHLVAKKSASLPAVAKGEDPMAALAMARHEFGEHGGVNMSIEASATF  65

Query  284  TVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGTEAAYCTASGMSAIS  463
            TVMEP+++RRMFSGELGPD D+FIYSRHFNPTVLN+SR MAA+EGTEAAYCT+SGMSAIS
Sbjct  66   TVMEPDTMRRMFSGELGPDRDFFIYSRHFNPTVLNLSRQMAALEGTEAAYCTSSGMSAIS  125

Query  464  SVMFQLLSSGDHVVAAR  514
            + + QL SSGDH+VA+R
Sbjct  126  AALLQLCSSGDHIVASR  142



>ref|XP_002518910.1| cystathionine gamma-synthase, putative [Ricinus communis]
 gb|EEF43443.1| cystathionine gamma-synthase, putative [Ricinus communis]
Length=449

 Score =   206 bits (524),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 104/151 (69%), Positives = 122/151 (81%), Gaps = 3/151 (2%)
 Frame = +2

Query  71   MAETIHQNVNVSNKRR-PGSEEWER-DDMMKAKKGG-KPAVQMWEDPAAALASARHEFGE  241
            MA+T  Q   ++ K+R  G +E++  DD + +KK    P V   EDPAA LA++RHEFGE
Sbjct  1    MADTKTQGFLLAGKKRGAGQDEFDGGDDFIVSKKSMLPPGVAYGEDPAAGLAASRHEFGE  60

Query  242  HGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGT  421
            HGGVNMSIEASATFTVMEP+++RRMFSGELGPD D+FIYSRHFNPTVLN+ R MAA+EGT
Sbjct  61   HGGVNMSIEASATFTVMEPDTMRRMFSGELGPDRDFFIYSRHFNPTVLNLGRQMAALEGT  120

Query  422  EAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            EAAYCTASGMSAISSV  QL SSG HVVA+R
Sbjct  121  EAAYCTASGMSAISSVFLQLCSSGGHVVASR  151



>ref|XP_002280162.1| PREDICTED: methionine gamma-lyase [Vitis vinifera]
Length=438

 Score =   205 bits (521),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 97/137 (71%), Positives = 115/137 (84%), Gaps = 2/137 (1%)
 Frame = +2

Query  104  SNKRRPGSEEWERDDMMKAKKGGKPAVQMWEDPAAALASARHEFGEHGGVNMSIEASATF  283
            + K+R G+++   D ++  K    PAV   EDP AALA ARHEFGEHGGVNMSIEASATF
Sbjct  8    AGKKRKGADD--EDHLVAKKSASLPAVAKGEDPMAALAMARHEFGEHGGVNMSIEASATF  65

Query  284  TVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGTEAAYCTASGMSAIS  463
            TVMEP+++RRMFSGELGPD D+FIYSRHFNPTVLN+SR MAA+EGTEAAYCT+SGMSAIS
Sbjct  66   TVMEPDTMRRMFSGELGPDRDFFIYSRHFNPTVLNLSRQMAALEGTEAAYCTSSGMSAIS  125

Query  464  SVMFQLLSSGDHVVAAR  514
            + + QL SSGDH+VA+R
Sbjct  126  AALLQLCSSGDHIVASR  142



>ref|XP_006476291.1| PREDICTED: methionine gamma-lyase-like [Citrus sinensis]
Length=447

 Score =   204 bits (520),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 107/137 (78%), Positives = 117/137 (85%), Gaps = 0/137 (0%)
 Frame = +2

Query  104  SNKRRPGSEEWERDDMMKAKKGGKPAVQMWEDPAAALASARHEFGEHGGVNMSIEASATF  283
            S KR  G+EE + DD+ K KK        WEDPAAALASARHEFGEHGGVNMSIEASATF
Sbjct  9    SKKRSAGTEETDGDDLYKTKKSMLSTAAAWEDPAAALASARHEFGEHGGVNMSIEASATF  68

Query  284  TVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGTEAAYCTASGMSAIS  463
            TVMEPE++RRMF+GELGPD D+FIYSRHFNPTVLN+SR MAA+EGTEAAYCTASGMSAIS
Sbjct  69   TVMEPETMRRMFAGELGPDRDFFIYSRHFNPTVLNLSRQMAALEGTEAAYCTASGMSAIS  128

Query  464  SVMFQLLSSGDHVVAAR  514
            SV+ QL SSG HVVAAR
Sbjct  129  SVLMQLCSSGGHVVAAR  145



>ref|XP_006439223.1| hypothetical protein CICLE_v10020136mg [Citrus clementina]
 gb|ESR52463.1| hypothetical protein CICLE_v10020136mg [Citrus clementina]
 gb|KDO76720.1| hypothetical protein CISIN_1g013079mg [Citrus sinensis]
Length=447

 Score =   204 bits (520),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 107/137 (78%), Positives = 117/137 (85%), Gaps = 0/137 (0%)
 Frame = +2

Query  104  SNKRRPGSEEWERDDMMKAKKGGKPAVQMWEDPAAALASARHEFGEHGGVNMSIEASATF  283
            S KR  G+EE + DD+ K KK        WEDPAAALASARHEFGEHGGVNMSIEASATF
Sbjct  9    SKKRSAGTEETDGDDLYKTKKSMLSTAAAWEDPAAALASARHEFGEHGGVNMSIEASATF  68

Query  284  TVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGTEAAYCTASGMSAIS  463
            TVMEPE++RRMF+GELGPD D+FIYSRHFNPTVLN+SR MAA+EGTEAAYCTASGMSAIS
Sbjct  69   TVMEPETMRRMFAGELGPDRDFFIYSRHFNPTVLNLSRQMAALEGTEAAYCTASGMSAIS  128

Query  464  SVMFQLLSSGDHVVAAR  514
            SV+ QL SSG HVVAAR
Sbjct  129  SVLMQLCSSGGHVVAAR  145



>gb|KJB52368.1| hypothetical protein B456_008G258500 [Gossypium raimondii]
Length=452

 Score =   203 bits (517),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 103/149 (69%), Positives = 119/149 (80%), Gaps = 1/149 (1%)
 Frame = +2

Query  71   MAETIHQNVNVSNKRRPGSEEWERDD-MMKAKKGGKPAVQMWEDPAAALASARHEFGEHG  247
            MAET  + +  + K+R    +    D +  AKK   P +    DPAAALA+ARHEFGEHG
Sbjct  1    MAETQSRGLVFAGKKRGTGTDDFDGDDIFVAKKSMLPTMATESDPAAALANARHEFGEHG  60

Query  248  GVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGTEA  427
            GVNMSIEASATFTVMEPE++RRMF+GELGPD D+FIYSRHFNPTVLN+ RLMAA+EGTEA
Sbjct  61   GVNMSIEASATFTVMEPETMRRMFAGELGPDRDFFIYSRHFNPTVLNLGRLMAALEGTEA  120

Query  428  AYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            AYCTASGMSAISSV+ QL SSG HVVA+R
Sbjct  121  AYCTASGMSAISSVLLQLCSSGGHVVASR  149



>ref|XP_010544898.1| PREDICTED: methionine gamma-lyase [Tarenaya hassleriana]
Length=438

 Score =   203 bits (516),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 96/113 (85%), Positives = 105/113 (93%), Gaps = 2/113 (2%)
 Frame = +2

Query  173  KPAVQMWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYF  352
            KPA   WEDPAAALAS RHEFGEHGGVNMSIEASATFTVMEPE++RRMF+GE+GPDND++
Sbjct  31   KPAA--WEDPAAALASIRHEFGEHGGVNMSIEASATFTVMEPETMRRMFTGEIGPDNDFY  88

Query  353  IYSRHFNPTVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAA  511
            IYSRHFNPTVL +SR MAA+EGTEAAYCTASGMSAISSVM QL SSGDHVVA+
Sbjct  89   IYSRHFNPTVLALSRQMAALEGTEAAYCTASGMSAISSVMLQLCSSGDHVVAS  141



>ref|XP_004309539.1| PREDICTED: methionine gamma-lyase [Fragaria vesca subsp. vesca]
Length=455

 Score =   203 bits (516),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 108/160 (68%), Positives = 121/160 (76%), Gaps = 20/160 (13%)
 Frame = +2

Query  71   MAETIHQNVNVSNKRRPGSEEWERDDM-------MKAKKG-----GKPAVQMWEDPAAAL  214
            MAET+    N + KR       E DDM         AKK        PA   WEDPA AL
Sbjct  1    MAETLLPTNNNTKKRT------EHDDMDGQDYAASAAKKSMFLPTAAPAT--WEDPAMAL  52

Query  215  ASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVS  394
            ASARHEFGEHGGVNMSIEASATFTVMEPE+L++MFSGELG D D+FIYSRHFNPTVLN+S
Sbjct  53   ASARHEFGEHGGVNMSIEASATFTVMEPETLQKMFSGELGADRDFFIYSRHFNPTVLNLS  112

Query  395  RLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            R MAA+EGTEAAYCT+SGMSAISSV+ QL+SSGDH+VA+R
Sbjct  113  RQMAALEGTEAAYCTSSGMSAISSVLLQLVSSGDHIVASR  152



>ref|XP_004495508.1| PREDICTED: methionine gamma-lyase-like [Cicer arietinum]
Length=441

 Score =   202 bits (514),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 115/148 (78%), Gaps = 10/148 (7%)
 Frame = +2

Query  71   MAETIHQNVNVSNKRRPGSEEWERDDMMKAKKGGKPAVQMWEDPAAALASARHEFGEHGG  250
            MA+T  Q    + KR   + + E    +    G         DPAAALAS RHEFGEHGG
Sbjct  1    MADTF-QTTTTAAKRNRSNNDTEPKKKLTCGDG---------DPAAALASTRHEFGEHGG  50

Query  251  VNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGTEAA  430
            VNMSIEASATFTVMEPE++RRMF+GELGPD DYFIYSRHFNPTVLN+SRLMA++EGTEAA
Sbjct  51   VNMSIEASATFTVMEPETMRRMFTGELGPDRDYFIYSRHFNPTVLNLSRLMASLEGTEAA  110

Query  431  YCTASGMSAISSVMFQLLSSGDHVVAAR  514
            YCTASGMSAIS+V+FQL SSG HVVA+R
Sbjct  111  YCTASGMSAISAVLFQLTSSGGHVVASR  138



>ref|XP_010676903.1| PREDICTED: methionine gamma-lyase [Beta vulgaris subsp. vulgaris]
Length=454

 Score =   202 bits (513),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 116/145 (80%), Gaps = 4/145 (3%)
 Frame = +2

Query  80   TIHQNVNVSNKRRPGSEEWERDDMMKAKKGGKPAVQMWEDPAAALASARHEFGEHGGVNM  259
            +++    +  K+RPG    + D+        KP +   EDP AALASARHEFGEHGGVNM
Sbjct  10   SLNNTTTIHTKKRPG----DNDNYAPTIITKKPTMSASEDPVAALASARHEFGEHGGVNM  65

Query  260  SIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGTEAAYCT  439
            SIEASATFTVMEPE++RR+F+GELGPD D++IYSRHFNPTVLN+ RLMAA+EGTEAAYCT
Sbjct  66   SIEASATFTVMEPETMRRLFNGELGPDRDFYIYSRHFNPTVLNLGRLMAALEGTEAAYCT  125

Query  440  ASGMSAISSVMFQLLSSGDHVVAAR  514
            ASGMSAISSV+ QL+ +G H+VA++
Sbjct  126  ASGMSAISSVLLQLVGAGGHIVASQ  150



>gb|AGF70153.1| methionine gamma-lyase [Cucumis melo]
Length=449

 Score =   201 bits (511),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 119/148 (80%), Gaps = 3/148 (2%)
 Frame = +2

Query  71   MAETIHQNVNVSNKRRPGSEEWERDDMMKAKKGGKPAVQMWEDPAAALASARHEFGEHGG  250
            MAE   +N N    +RP  +E + D    +KK       + EDPAAA+A+ RHEFGEHGG
Sbjct  1    MAEL--KNHNFRGTKRPSPDESD-DVKTDSKKPTAMISSLLEDPAAAIANTRHEFGEHGG  57

Query  251  VNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGTEAA  430
            VNMSIEASATFTVMEPE++RRMF+GELGPD D+FIYSRHFNPTVLN+SR MAA+EGT AA
Sbjct  58   VNMSIEASATFTVMEPETMRRMFAGELGPDRDFFIYSRHFNPTVLNLSRQMAALEGTAAA  117

Query  431  YCTASGMSAISSVMFQLLSSGDHVVAAR  514
            YCT+SGMSAI++V+ QLL+SGDHVVA+R
Sbjct  118  YCTSSGMSAIAAVLLQLLASGDHVVASR  145



>ref|XP_006352296.1| PREDICTED: methionine gamma-lyase-like [Solanum tuberosum]
Length=433

 Score =   200 bits (509),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 117/148 (79%), Gaps = 10/148 (7%)
 Frame = +2

Query  71   MAETIHQNVNVSNKRRPGSEEWERDDMMKAKKGGKPAVQMWEDPAAALASARHEFGEHGG  250
            MA    QN  V +K+RP +          A+K  K  + + EDPAAALA+ RHEFGEHGG
Sbjct  1    MAGKSEQNAVVLDKQRPAN---------VAQKSMKHHL-ILEDPAAALANVRHEFGEHGG  50

Query  251  VNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGTEAA  430
            VNMSIEAS TFTVMEPE+L RMF+GELGPD D+FIYSRH NPTVLN+SRLMAA+EGTEAA
Sbjct  51   VNMSIEASITFTVMEPENLSRMFAGELGPDRDFFIYSRHLNPTVLNLSRLMAALEGTEAA  110

Query  431  YCTASGMSAISSVMFQLLSSGDHVVAAR  514
            YCT+SGMSAISSV+ QL SSGDH+VA+R
Sbjct  111  YCTSSGMSAISSVLLQLCSSGDHIVASR  138



>ref|XP_004146134.1| PREDICTED: methionine gamma-lyase-like [Cucumis sativus]
 ref|XP_004170926.1| PREDICTED: methionine gamma-lyase-like [Cucumis sativus]
 gb|KGN55670.1| hypothetical protein Csa_3G002890 [Cucumis sativus]
Length=450

 Score =   201 bits (510),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 97/148 (66%), Positives = 118/148 (80%), Gaps = 2/148 (1%)
 Frame = +2

Query  71   MAETIHQNVNVSNKRRPGSEEWERDDMMKAKKGGKPAVQMWEDPAAALASARHEFGEHGG  250
            MAE   +N      +RP S+  +   +  +KK       + EDPAAA+A+ RHEFGEHGG
Sbjct  1    MAEL--KNHTFRGTKRPSSDGSDDVKLADSKKPTAMISSLLEDPAAAIANTRHEFGEHGG  58

Query  251  VNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGTEAA  430
            VNMSIEASATFTVMEPE++RRMF+GELGPD D+FIYSRHFNPTVLN+SR MAA+EGT AA
Sbjct  59   VNMSIEASATFTVMEPETMRRMFAGELGPDRDFFIYSRHFNPTVLNLSRQMAALEGTAAA  118

Query  431  YCTASGMSAISSVMFQLLSSGDHVVAAR  514
            YCT+SGMSAI++V+ QLL+SGDHVVA+R
Sbjct  119  YCTSSGMSAIAAVLLQLLASGDHVVASR  146



>ref|XP_007039394.1| Methionine gamma-lyase [Theobroma cacao]
 gb|EOY23895.1| Methionine gamma-lyase [Theobroma cacao]
Length=454

 Score =   199 bits (507),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 105/151 (70%), Positives = 119/151 (79%), Gaps = 3/151 (2%)
 Frame = +2

Query  71   MAETIHQNVNVSNKRRPGSEEWERDD-MMKAKKGGKPAVQ-MWE-DPAAALASARHEFGE  241
            MAET  +    S K+R    +    D +  +KK   P +   WE DPAAALASARHEFGE
Sbjct  1    MAETQSRGFVFSGKKRAAGADDFDGDDLFMSKKSMLPTLAPAWENDPAAALASARHEFGE  60

Query  242  HGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGT  421
            HGGVNMSIEASATFTVMEPE++RRMF+GELGPD D+FIYSRHFNPTVLN+ R MAA+EGT
Sbjct  61   HGGVNMSIEASATFTVMEPETMRRMFAGELGPDRDFFIYSRHFNPTVLNLGRQMAALEGT  120

Query  422  EAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            EAAYCTASGMSAISSV+ QL SSG HVVA+R
Sbjct  121  EAAYCTASGMSAISSVLLQLCSSGGHVVASR  151



>gb|KDO76719.1| hypothetical protein CISIN_1g013079mg [Citrus sinensis]
Length=450

 Score =   199 bits (506),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 117/140 (84%), Gaps = 3/140 (2%)
 Frame = +2

Query  104  SNKRRPGSEEWERDDMMKAKKGGKPAVQMWEDPAAALASARHEFGEHGGVNMSIEASATF  283
            S KR  G+EE + DD+ K KK        WEDPAAALASARHEFGEHGGVNMSIEASATF
Sbjct  9    SKKRSAGTEETDGDDLYKTKKSMLSTAAAWEDPAAALASARHEFGEHGGVNMSIEASATF  68

Query  284  TVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGTEAAYCTAS---GMS  454
            TVMEPE++RRMF+GELGPD D+FIYSRHFNPTVLN+SR MAA+EGTEAAYCTAS   GMS
Sbjct  69   TVMEPETMRRMFAGELGPDRDFFIYSRHFNPTVLNLSRQMAALEGTEAAYCTASDKAGMS  128

Query  455  AISSVMFQLLSSGDHVVAAR  514
            AISSV+ QL SSG HVVAAR
Sbjct  129  AISSVLMQLCSSGGHVVAAR  148



>ref|XP_008448562.1| PREDICTED: methionine gamma-lyase-like [Cucumis melo]
Length=449

 Score =   198 bits (503),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 96/148 (65%), Positives = 117/148 (79%), Gaps = 3/148 (2%)
 Frame = +2

Query  71   MAETIHQNVNVSNKRRPGSEEWERDDMMKAKKGGKPAVQMWEDPAAALASARHEFGEHGG  250
            MAE  + N   + +  P   +  + D   +KK       + EDPAAA+A+ RHEFGEHGG
Sbjct  1    MAELKNHNFRGTKRASPDESDDVKTD---SKKPTAMISSLLEDPAAAIANTRHEFGEHGG  57

Query  251  VNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGTEAA  430
            VNMSIEASATFTVMEPE++RRMF+GELGPD D+FIYSRHFNPTVLN+SR MAA+EGT AA
Sbjct  58   VNMSIEASATFTVMEPETMRRMFAGELGPDRDFFIYSRHFNPTVLNLSRQMAALEGTAAA  117

Query  431  YCTASGMSAISSVMFQLLSSGDHVVAAR  514
            YCT+SGMSAI++V+ QLL+SGDHVVA+R
Sbjct  118  YCTSSGMSAIAAVLLQLLASGDHVVASR  145



>gb|KFK32962.1| hypothetical protein AALP_AA6G312200 [Arabis alpina]
Length=424

 Score =   197 bits (501),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 91/106 (86%), Positives = 101/106 (95%), Gaps = 0/106 (0%)
 Frame = +2

Query  197  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNP  376
            DPAAALAS RHEFGEHGGVNMSIEASATFTVMEPE++RRMF+GELGPDND+F+YSRHFNP
Sbjct  25   DPAAALASIRHEFGEHGGVNMSIEASATFTVMEPETMRRMFTGELGPDNDFFVYSRHFNP  84

Query  377  TVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            TVLN+SR MAA+EGTEAAYCT+SGMSAISSVM QL SSG HVVA++
Sbjct  85   TVLNLSRQMAALEGTEAAYCTSSGMSAISSVMLQLCSSGGHVVASK  130



>ref|XP_007151964.1| hypothetical protein PHAVU_004G090200g [Phaseolus vulgaris]
 gb|ESW23958.1| hypothetical protein PHAVU_004G090200g [Phaseolus vulgaris]
Length=437

 Score =   197 bits (500),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 98/135 (73%), Positives = 109/135 (81%), Gaps = 5/135 (4%)
 Frame = +2

Query  107  NKRRPGSEEWERDDMMKAKKGGKPAVQMWEDPAAALASARHEFGEHGGVNMSIEASATFT  286
            N++R G+ +   D   K K   +       DPAAALA  RHEFGEHGGVNMSIEASATFT
Sbjct  8    NRKRSGALDVIADGDPKRKNAARDM-----DPAAALALTRHEFGEHGGVNMSIEASATFT  62

Query  287  VMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGTEAAYCTASGMSAISS  466
            VMEPE+LRRMF+GELGPD D+FIYSRHFNPTVL + RLMAAMEGTEAAYCTASGMSAISS
Sbjct  63   VMEPETLRRMFAGELGPDRDFFIYSRHFNPTVLKLGRLMAAMEGTEAAYCTASGMSAISS  122

Query  467  VMFQLLSSGDHVVAA  511
            V+FQL SSG HVVA+
Sbjct  123  VLFQLCSSGGHVVAS  137



>gb|KJB37456.1| hypothetical protein B456_006G205800 [Gossypium raimondii]
Length=459

 Score =   197 bits (501),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 102/154 (66%), Positives = 120/154 (78%), Gaps = 7/154 (5%)
 Frame = +2

Query  71   MAETIHQNVNVSN-KRRPGSEEWERDD-MMKAKKGGKPAVQM----WE-DPAAALASARH  229
            MAET      +S  KR   ++ +E DD +  AKK   P + +    WE DPAA+LA  RH
Sbjct  1    MAETRSCEFGISGMKRAAAADSFEVDDEIFVAKKSMLPTLAVAPAAWENDPAASLAGLRH  60

Query  230  EFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAA  409
            EFGEHGG+NMSIEASATFTVMEPE++RRMF+GELGPD D+FIYSRHFNPTVLN+ R +AA
Sbjct  61   EFGEHGGINMSIEASATFTVMEPETMRRMFTGELGPDRDFFIYSRHFNPTVLNLGRQVAA  120

Query  410  MEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAA  511
            +EGTEAAYCTASGM+AISSVM QL SSG HVVA+
Sbjct  121  LEGTEAAYCTASGMAAISSVMLQLCSSGGHVVAS  154



>gb|ADN33936.1| cystathionine gamma-synthase [Cucumis melo subsp. melo]
Length=417

 Score =   195 bits (496),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 88/109 (81%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  188  MWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRH  367
            + EDPAAA+A+ RHEFGEHGGVNMSIEASATFTVMEPE++RRMF+GELGPD D+FIYSRH
Sbjct  5    LLEDPAAAIANTRHEFGEHGGVNMSIEASATFTVMEPETMRRMFAGELGPDRDFFIYSRH  64

Query  368  FNPTVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            FNPTVLN+SR MAA+EGT AAYCT+SGMSAI++V+ QLL+SGDHVVA+R
Sbjct  65   FNPTVLNLSRQMAALEGTAAAYCTSSGMSAIAAVLLQLLASGDHVVASR  113



>ref|XP_010430614.1| PREDICTED: methionine gamma-lyase isoform X3 [Camelina sativa]
Length=445

 Score =   196 bits (497),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 98/141 (70%), Positives = 116/141 (82%), Gaps = 2/141 (1%)
 Frame = +2

Query  89   QNVNVSNKRRPGSEEWERDDMMKAKKGGKPAVQMWEDPAAALASARHEFGEHGGVNMSIE  268
            Q +  S K+R   ++ +  D M AKK      ++  DPAAALAS RHEFGEHGGVNMSIE
Sbjct  12   QPLVFSGKKRNDRDDDDDGDAMVAKKSALAVCEV--DPAAALASIRHEFGEHGGVNMSIE  69

Query  269  ASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGTEAAYCTASG  448
            ASATFTVMEP+++RRMF+GELGPDND+F+YSRHFNPTVLN+SR MAA+EGT+AAYCT+SG
Sbjct  70   ASATFTVMEPDTMRRMFAGELGPDNDFFVYSRHFNPTVLNLSRQMAALEGTQAAYCTSSG  129

Query  449  MSAISSVMFQLLSSGDHVVAA  511
            MSAISSVM QL SSG HVVA+
Sbjct  130  MSAISSVMLQLCSSGGHVVAS  150



>ref|XP_004244654.1| PREDICTED: methionine gamma-lyase-like [Solanum lycopersicum]
Length=409

 Score =   194 bits (493),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 90/108 (83%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = +2

Query  191  WEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHF  370
             EDPAAALA+ RHEF EHGGVNMSIEAS TFTVMEPE+L RMF+GELGPDND+FIYSRH 
Sbjct  7    LEDPAAALANVRHEFSEHGGVNMSIEASITFTVMEPENLSRMFAGELGPDNDFFIYSRHL  66

Query  371  NPTVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            NPTVLN+SRL+AA+EGTEAAYCT+SGMSAISSV+ QL SSGDHVVA+R
Sbjct  67   NPTVLNLSRLIAALEGTEAAYCTSSGMSAISSVLLQLCSSGDHVVASR  114



>ref|XP_010473731.1| PREDICTED: methionine gamma-lyase-like isoform X1 [Camelina sativa]
 ref|XP_010473732.1| PREDICTED: methionine gamma-lyase-like isoform X2 [Camelina sativa]
Length=446

 Score =   194 bits (493),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 116/141 (82%), Gaps = 2/141 (1%)
 Frame = +2

Query  89   QNVNVSNKRRPGSEEWERDDMMKAKKGGKPAVQMWEDPAAALASARHEFGEHGGVNMSIE  268
            Q +  S ++R   ++ +  D M AKK      ++  DPAAALAS RHEFGEHGGVNMSIE
Sbjct  13   QPLVFSGEKRNDRDDDDDGDAMVAKKSALAVCEV--DPAAALASIRHEFGEHGGVNMSIE  70

Query  269  ASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGTEAAYCTASG  448
            ASATFTVMEP+++RRMF+GELGPDND+F+YSRHFNPTVLN+SR MAA+EGT+AAYCT+SG
Sbjct  71   ASATFTVMEPDTMRRMFAGELGPDNDFFVYSRHFNPTVLNLSRQMAALEGTQAAYCTSSG  130

Query  449  MSAISSVMFQLLSSGDHVVAA  511
            MSAISSVM QL SSG HVVA+
Sbjct  131  MSAISSVMLQLCSSGGHVVAS  151



>ref|XP_002891507.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67766.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=441

 Score =   194 bits (493),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/105 (86%), Positives = 100/105 (95%), Gaps = 0/105 (0%)
 Frame = +2

Query  197  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNP  376
            DPAAAL+S RHEFGEHGGVNMSIEASATFTVMEP+++RRMFSGELGPDND+F+YSRHFNP
Sbjct  42   DPAAALSSIRHEFGEHGGVNMSIEASATFTVMEPDTMRRMFSGELGPDNDFFVYSRHFNP  101

Query  377  TVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAA  511
            TVLN+SR MAA+EGT+AAYCT+SGMSAISSVM QL SSG HVVAA
Sbjct  102  TVLNLSRQMAALEGTQAAYCTSSGMSAISSVMLQLCSSGGHVVAA  146



>ref|XP_010430612.1| PREDICTED: methionine gamma-lyase isoform X1 [Camelina sativa]
 ref|XP_010430613.1| PREDICTED: methionine gamma-lyase isoform X2 [Camelina sativa]
Length=446

 Score =   194 bits (493),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 116/141 (82%), Gaps = 2/141 (1%)
 Frame = +2

Query  89   QNVNVSNKRRPGSEEWERDDMMKAKKGGKPAVQMWEDPAAALASARHEFGEHGGVNMSIE  268
            Q +  S ++R   ++ +  D M AKK      ++  DPAAALAS RHEFGEHGGVNMSIE
Sbjct  13   QPLVFSGEKRNDRDDDDDGDAMVAKKSALAVCEV--DPAAALASIRHEFGEHGGVNMSIE  70

Query  269  ASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGTEAAYCTASG  448
            ASATFTVMEP+++RRMF+GELGPDND+F+YSRHFNPTVLN+SR MAA+EGT+AAYCT+SG
Sbjct  71   ASATFTVMEPDTMRRMFAGELGPDNDFFVYSRHFNPTVLNLSRQMAALEGTQAAYCTSSG  130

Query  449  MSAISSVMFQLLSSGDHVVAA  511
            MSAISSVM QL SSG HVVA+
Sbjct  131  MSAISSVMLQLCSSGGHVVAS  151



>ref|XP_004502061.1| PREDICTED: methionine gamma-lyase-like [Cicer arietinum]
Length=443

 Score =   193 bits (491),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 96/152 (63%), Positives = 119/152 (78%), Gaps = 13/152 (9%)
 Frame = +2

Query  71   MAETIHQNVNVSNKRRPGSEEWERDDMMKAKKGGK-----PAVQMWEDPAAALASARHEF  235
            MA+T+   VNV N +R        +D+++ +   K      AV    DPAA+ A+ARHEF
Sbjct  1    MADTL---VNVHNNKRS-----NENDVVEGRDAKKLMLWSGAVDAESDPAASFANARHEF  52

Query  236  GEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAME  415
            GEHGGVNMSIEASATFTVMEP++LRRMF+GELGP+NDYF+YSRHFNPTVLN+SR MAA+E
Sbjct  53   GEHGGVNMSIEASATFTVMEPDTLRRMFAGELGPENDYFVYSRHFNPTVLNLSRQMAALE  112

Query  416  GTEAAYCTASGMSAISSVMFQLLSSGDHVVAA  511
            GTEAAYCT+SGMSAI++ + QL SSG H+VA+
Sbjct  113  GTEAAYCTSSGMSAITAALLQLCSSGGHIVAS  144



>ref|NP_176647.1| methionine gamma-lyase [Arabidopsis thaliana]
 sp|Q9SGU9.1|MGL_ARATH RecName: Full=Methionine gamma-lyase; Short=AtMGL; AltName: Full=L-methioninase 
[Arabidopsis thaliana]
 gb|AAF19680.1|AC009519_14 F1N19.23 [Arabidopsis thaliana]
 gb|AAL16181.1|AF428413_1 At1g64660/F1N19_22 [Arabidopsis thaliana]
 gb|AAK96737.1| similar to O-succinylhomoserine sulfhydrylase [Arabidopsis thaliana]
 gb|AAP31932.1| At1g64660 [Arabidopsis thaliana]
 dbj|BAE98522.1| similar to O-succinylhomoserine sulfhydrylase [Arabidopsis thaliana]
 gb|AEE34271.1| methionine gamma-lyase [Arabidopsis thaliana]
Length=441

 Score =   193 bits (490),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 95/136 (70%), Positives = 112/136 (82%), Gaps = 3/136 (2%)
 Frame = +2

Query  104  SNKRRPGSEEWERDDMMKAKKGGKPAVQMWEDPAAALASARHEFGEHGGVNMSIEASATF  283
            S K+R   ++ E  D + AKK          DPAAA+A+ RHEFGEHGGVNMSIEASATF
Sbjct  14   SGKKRNDRDD-EDGDALVAKKSALAVCD--ADPAAAIANIRHEFGEHGGVNMSIEASATF  70

Query  284  TVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGTEAAYCTASGMSAIS  463
            TVMEP+++RRMF+GELGPDND+++YSRHFNPTVLN+SR MAA+EGT+AAYCT+SGMSAIS
Sbjct  71   TVMEPDTMRRMFTGELGPDNDFYVYSRHFNPTVLNLSRQMAALEGTQAAYCTSSGMSAIS  130

Query  464  SVMFQLLSSGDHVVAA  511
            SVM QL SSG HVVAA
Sbjct  131  SVMLQLCSSGGHVVAA  146



>ref|XP_006302266.1| hypothetical protein CARUB_v10020309mg [Capsella rubella]
 gb|EOA35164.1| hypothetical protein CARUB_v10020309mg [Capsella rubella]
Length=441

 Score =   192 bits (487),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/105 (84%), Positives = 100/105 (95%), Gaps = 0/105 (0%)
 Frame = +2

Query  197  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNP  376
            DPAAALAS RHEFGEHGGVNMSIEASATFTVMEP+++RRMF+GELGPDND+F+YSRHFNP
Sbjct  42   DPAAALASIRHEFGEHGGVNMSIEASATFTVMEPDTMRRMFAGELGPDNDFFVYSRHFNP  101

Query  377  TVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAA  511
            TVLN+SR MAA+EGT+AAYCT+SGMSAISSV+ QL SSG HVVA+
Sbjct  102  TVLNLSRQMAALEGTQAAYCTSSGMSAISSVILQLCSSGGHVVAS  146



>ref|XP_003542155.1| PREDICTED: methionine gamma-lyase-like [Glycine max]
Length=440

 Score =   192 bits (487),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 111/138 (80%), Gaps = 6/138 (4%)
 Frame = +2

Query  101  VSNKRRPGSEEWERDDMMKAKKGGKPAVQMWE-DPAAALASARHEFGEHGGVNMSIEASA  277
            V N++R G+     DD++    G +  V   + DPAAALA  RHEFGEHGGVNMSIEASA
Sbjct  6    VVNRKRSGT-----DDVVSENDGKRKNVVAPDMDPAAALALTRHEFGEHGGVNMSIEASA  60

Query  278  TFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGTEAAYCTASGMSA  457
            TFTVMEPE+L RMF+GELGPD D+FIYSRHFNPTVLN+ R MAA+EGTEAAYCTASGM+A
Sbjct  61   TFTVMEPETLCRMFTGELGPDRDFFIYSRHFNPTVLNLGRHMAALEGTEAAYCTASGMAA  120

Query  458  ISSVMFQLLSSGDHVVAA  511
            ISSV+ QL SSG HVVA+
Sbjct  121  ISSVLLQLCSSGGHVVAS  138



>ref|XP_009358710.1| PREDICTED: methionine gamma-lyase-like [Pyrus x bretschneideri]
Length=457

 Score =   192 bits (488),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 106/154 (69%), Positives = 125/154 (81%), Gaps = 6/154 (4%)
 Frame = +2

Query  71   MAETIHQNV---NVSNKRRPGSEEWERDDMMKAKKG---GKPAVQMWEDPAAALASARHE  232
            MA+T  Q +     ++K+R   ++ + DD + AKK       A   WEDPAAALASARHE
Sbjct  1    MADTKSQGLVFPTTNSKKRAEHDDMDNDDYVAAKKSMLLSSAAAAAWEDPAAALASARHE  60

Query  233  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  412
            FGEHGGVNMSIEASATFTVMEPE+LR+MFSGELG D D+FIYSRHFNPTVLN+SR MAA+
Sbjct  61   FGEHGGVNMSIEASATFTVMEPETLRKMFSGELGADRDFFIYSRHFNPTVLNLSRQMAAL  120

Query  413  EGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            EGTEAAYCT+SGMSAISSV+ QL+SSG+H+VAAR
Sbjct  121  EGTEAAYCTSSGMSAISSVLLQLVSSGEHIVAAR  154



>gb|KEH42908.1| cystathionine beta-lyase/cystathionine gamma-synthase [Medicago 
truncatula]
Length=450

 Score =   191 bits (486),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 107/126 (85%), Gaps = 2/126 (2%)
 Frame = +2

Query  143  DDMMKAKKGGKPAVQMWE--DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRM  316
            DD  + KK    A Q     +PA +LA+ARHEFGEHGGVNMSIEAS TFTVMEPE+LRRM
Sbjct  22   DDETETKKKLATATQNGTVFNPATSLANARHEFGEHGGVNMSIEASVTFTVMEPETLRRM  81

Query  317  FSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGD  496
            F+GELGPD D+F+YSRHFNPTVLN+SRLMAA+EGTEAAYCT+SGMSAIS+ + QL S+G+
Sbjct  82   FAGELGPDRDFFVYSRHFNPTVLNLSRLMAALEGTEAAYCTSSGMSAISAAILQLTSTGE  141

Query  497  HVVAAR  514
            HVVA+R
Sbjct  142  HVVASR  147



>ref|XP_009112857.1| PREDICTED: methionine gamma-lyase [Brassica rapa]
Length=441

 Score =   191 bits (485),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 115/142 (81%), Gaps = 2/142 (1%)
 Frame = +2

Query  89   QNVNVSNKRRPGSEEWERDDMMKAKKGGKPAVQMWEDPAAALASARHEFGEHGGVNMSIE  268
            Q++  ++ ++    + E  D   AKK    A +   DPA ALAS RHEFGEHGGVNMSIE
Sbjct  8    QHLLTTSGKKRNDRDDEDGDSTVAKKSSLMACE--ADPAVALASIRHEFGEHGGVNMSIE  65

Query  269  ASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGTEAAYCTASG  448
            ASATFTVMEP+++RRMF+GELGP+ND+F+YSRHFNPTVLN+SR MAA+EGT+AAYCT+SG
Sbjct  66   ASATFTVMEPDTMRRMFAGELGPENDFFVYSRHFNPTVLNLSRQMAALEGTQAAYCTSSG  125

Query  449  MSAISSVMFQLLSSGDHVVAAR  514
            M+AISSV+ QL SSG HVVA++
Sbjct  126  MAAISSVLLQLCSSGGHVVASK  147



>ref|XP_008239227.1| PREDICTED: methionine gamma-lyase [Prunus mume]
Length=459

 Score =   191 bits (484),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 119/142 (84%), Gaps = 3/142 (2%)
 Frame = +2

Query  98   NVSNKRRPGSEEWERDDMMKAKKG---GKPAVQMWEDPAAALASARHEFGEHGGVNMSIE  268
            N ++K+R   ++ + DD + AKK       A   W+DPAAA ASARHEFGEHGGVNMSIE
Sbjct  15   NATSKKRAERDDMDNDDYVAAKKSMLLSSAAAAAWDDPAAAFASARHEFGEHGGVNMSIE  74

Query  269  ASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGTEAAYCTASG  448
            ASATFTVMEPE+LR+MFSGELG D D+FIYSRHFNPTVLN+SR MAA+EGTEAAYCT+SG
Sbjct  75   ASATFTVMEPETLRKMFSGELGADRDFFIYSRHFNPTVLNLSRQMAALEGTEAAYCTSSG  134

Query  449  MSAISSVMFQLLSSGDHVVAAR  514
            MSAISSV+ QL+SSGDH+VA+R
Sbjct  135  MSAISSVLLQLVSSGDHIVASR  156



>ref|XP_008390270.1| PREDICTED: methionine gamma-lyase-like [Malus domestica]
Length=457

 Score =   190 bits (483),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 104/154 (68%), Positives = 126/154 (82%), Gaps = 6/154 (4%)
 Frame = +2

Query  71   MAETIHQNV---NVSNKRRPGSEEWERDDMMKAKKG---GKPAVQMWEDPAAALASARHE  232
            MA+T  Q +    +++K+R   ++ + +D + AKK       A   WEDPAAALASARHE
Sbjct  1    MADTKSQGLVFPTINSKKRAEHDDIDNEDYVAAKKSMLLSSAAAAAWEDPAAALASARHE  60

Query  233  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  412
            FGEHGGVNMSIEASATFTVMEPE+LR+MFSGELG D D+FIYSRHFNPTVLN+SR MAA+
Sbjct  61   FGEHGGVNMSIEASATFTVMEPETLRKMFSGELGADRDFFIYSRHFNPTVLNLSRQMAAL  120

Query  413  EGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            EGTEAAYCT+SGMSAISSV+ QL+SSG+H+VA+R
Sbjct  121  EGTEAAYCTSSGMSAISSVLLQLVSSGEHIVASR  154



>ref|XP_008791621.1| PREDICTED: methionine gamma-lyase [Phoenix dactylifera]
Length=462

 Score =   190 bits (483),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 97/158 (61%), Positives = 116/158 (73%), Gaps = 16/158 (10%)
 Frame = +2

Query  71   MAETIHQNVNVSNKRRPGSEEWERDD----------MMKAKKGGKPAVQMWEDPAAALAS  220
            MAET    V  + K+R   +  + DD          ++  K+G +       DPA ALAS
Sbjct  1    MAETTQSMVFTNPKKRGHKDAADDDDGFVDGTGDWAVVSTKRGAR------NDPAGALAS  54

Query  221  ARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRL  400
            ARHEFGEHGGVNMSIEASATFTVMEP++LRRMF+GELGPD D+FIYSRH+NPTVLN+ R 
Sbjct  55   ARHEFGEHGGVNMSIEASATFTVMEPDTLRRMFAGELGPDRDFFIYSRHYNPTVLNLGRQ  114

Query  401  MAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            MAA+EGTEAAYCTASGM+AISSV+ QL  +G  VVA+R
Sbjct  115  MAALEGTEAAYCTASGMAAISSVIIQLCGAGGRVVASR  152



>ref|XP_009382322.1| PREDICTED: methionine gamma-lyase-like [Musa acuminata subsp. 
malaccensis]
Length=477

 Score =   190 bits (483),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 100/158 (63%), Positives = 119/158 (75%), Gaps = 20/158 (13%)
 Frame = +2

Query  71   MAETIHQNVNVSNKRRPGSEEWERDD----------MMKAKKGGKPAVQMWEDPAAALAS  220
            MAET+  +++ S KR P  EE  R D            ++++GG        DP AALAS
Sbjct  1    MAETM--DISYSKKRGPKEEEDGRVDEGWAGPLASKRDRSERGG--------DPTAALAS  50

Query  221  ARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRL  400
            ARHEFGEHGGVNMSIEASATFTVME ++++RMF GELGPD D++IYSRHFNPTVLN+SR 
Sbjct  51   ARHEFGEHGGVNMSIEASATFTVMEADTMQRMFKGELGPDRDHYIYSRHFNPTVLNLSRQ  110

Query  401  MAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            MAA+EGTEAAYCTASGMSAISSV+ QL  +G HVVA+R
Sbjct  111  MAALEGTEAAYCTASGMSAISSVLIQLCGAGGHVVASR  148



>ref|XP_007209123.1| hypothetical protein PRUPE_ppa005470mg [Prunus persica]
 gb|EMJ10322.1| hypothetical protein PRUPE_ppa005470mg [Prunus persica]
Length=459

 Score =   190 bits (482),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 102/140 (73%), Positives = 117/140 (84%), Gaps = 3/140 (2%)
 Frame = +2

Query  104  SNKRRPGSEEWERDDMMKAKKG---GKPAVQMWEDPAAALASARHEFGEHGGVNMSIEAS  274
            S+K+R   ++ + DD   AKK       A   WEDPAAA ASARHEFGEHGGVNMSIEAS
Sbjct  17   SSKKRAEHDDMDNDDYAVAKKSMLLSSAAAAAWEDPAAAFASARHEFGEHGGVNMSIEAS  76

Query  275  ATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGTEAAYCTASGMS  454
            ATFTVMEPE+LR+MFSGELG D D+FIYSRHFNPTVLN+SR MAA+EGTEAAYCT+SGMS
Sbjct  77   ATFTVMEPETLRKMFSGELGADRDFFIYSRHFNPTVLNLSRQMAALEGTEAAYCTSSGMS  136

Query  455  AISSVMFQLLSSGDHVVAAR  514
            AISSV+ QL+SSGDH+VA+R
Sbjct  137  AISSVLLQLVSSGDHIVASR  156



>emb|CDY53903.1| BnaA09g53100D [Brassica napus]
Length=441

 Score =   189 bits (481),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/133 (68%), Positives = 109/133 (82%), Gaps = 2/133 (2%)
 Frame = +2

Query  122  GSEEWERDDMMKAKKGGKPAVQMW--EDPAAALASARHEFGEHGGVNMSIEASATFTVME  295
            G +  +RDD        K +  M    DPA ALAS RHEFGEHGGVNMSIEASATFTVME
Sbjct  15   GKKRNDRDDEDGVSTVAKKSSLMACEADPAVALASIRHEFGEHGGVNMSIEASATFTVME  74

Query  296  PESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGTEAAYCTASGMSAISSVMF  475
            P+++RRMF+GELGP+ND+F+YSRHFNPTVLN+SR MAA+EGT+AAYCT+SGM+AISSV+ 
Sbjct  75   PDTMRRMFAGELGPENDFFVYSRHFNPTVLNLSRQMAALEGTQAAYCTSSGMAAISSVLL  134

Query  476  QLLSSGDHVVAAR  514
            QL SSG HVVA++
Sbjct  135  QLCSSGGHVVASK  147



>ref|XP_003601451.1| Cystathionine gamma-lyase [Medicago truncatula]
 gb|AES71702.1| cystathionine beta-lyase/cystathionine gamma-synthase [Medicago 
truncatula]
Length=443

 Score =   188 bits (478),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 100/150 (67%), Positives = 119/150 (79%), Gaps = 8/150 (5%)
 Frame = +2

Query  71   MAETIHQNVNV-SNKRRPGSEEWERDDMMKAKK--GGKPAVQMWEDPAAALASARHEFGE  241
            MA+T+  NVNV +NKR   +   E  D  K  K  GG+  V    DP AALA+ARHEFGE
Sbjct  1    MADTLF-NVNVLNNKRSLENPVVEVKDTKKLTKFNGGESDV----DPEAALANARHEFGE  55

Query  242  HGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGT  421
            HGGVNMSIEASATFTVMEP++LR++F+GELG + DY++YSRHFNPTVLN+SR MAA+EGT
Sbjct  56   HGGVNMSIEASATFTVMEPDTLRKIFAGELGHEGDYYVYSRHFNPTVLNLSRKMAALEGT  115

Query  422  EAAYCTASGMSAISSVMFQLLSSGDHVVAA  511
            EAAYCTASGMSAIS+V+ QL S G HVVA+
Sbjct  116  EAAYCTASGMSAISAVLLQLCSHGGHVVAS  145



>ref|XP_009359544.1| PREDICTED: methionine gamma-lyase-like [Pyrus x bretschneideri]
Length=457

 Score =   188 bits (477),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 120/141 (85%), Gaps = 3/141 (2%)
 Frame = +2

Query  101  VSNKRRPGSEEWERDDMMKAKKG---GKPAVQMWEDPAAALASARHEFGEHGGVNMSIEA  271
            +++K+R   ++ + +D + AKK       A   WEDPAAALASARHEFGEHGGVNM+IEA
Sbjct  14   INSKKRAEHDDIDNEDYVAAKKSMLLSSAAAAAWEDPAAALASARHEFGEHGGVNMAIEA  73

Query  272  SATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGTEAAYCTASGM  451
            SATFTVMEPE+LR+MFSGELG D D+FIYSRHFNPTVLN+SR MAA+EGTEAAYCT+SGM
Sbjct  74   SATFTVMEPETLRKMFSGELGADRDFFIYSRHFNPTVLNLSRQMAALEGTEAAYCTSSGM  133

Query  452  SAISSVMFQLLSSGDHVVAAR  514
            SAISSV+ QL+SSG+H+VA+R
Sbjct  134  SAISSVLLQLVSSGEHIVASR  154



>gb|ABK27101.1| unknown [Picea sitchensis]
Length=438

 Score =   187 bits (474),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/134 (66%), Positives = 108/134 (81%), Gaps = 6/134 (4%)
 Frame = +2

Query  113  RRPGSEEWERDDMMKAKKGGKPAVQMWEDPAAALASARHEFGEHGGVNMSIEASATFTVM  292
            +RP  E +   +  K  K     ++ W DP   LA+ARHEFGEHGGVNMSIEASATFTVM
Sbjct  9    KRPYEEAY--GEFCKKNK----VMKKWVDPVQGLANARHEFGEHGGVNMSIEASATFTVM  62

Query  293  EPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGTEAAYCTASGMSAISSVM  472
            EPE++++MFSGELGP+ D++IYSRHFNPTVLN+ R MAA+EGTEAAYCT+SGMSAISSV+
Sbjct  63   EPETMKKMFSGELGPERDFYIYSRHFNPTVLNLGRQMAALEGTEAAYCTSSGMSAISSVL  122

Query  473  FQLLSSGDHVVAAR  514
             QL + GDHVVA+R
Sbjct  123  SQLCNHGDHVVASR  136



>ref|XP_006849146.1| hypothetical protein AMTR_s00027p00096610 [Amborella trichopoda]
 gb|ERN10727.1| hypothetical protein AMTR_s00027p00096610 [Amborella trichopoda]
Length=457

 Score =   185 bits (470),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 95/149 (64%), Positives = 111/149 (74%), Gaps = 2/149 (1%)
 Frame = +2

Query  65   ATMAETIHQNVNVSNKRRPGSEEWERDDMMKAKKGGKPAVQMWEDPAAALASARHEFGEH  244
            ATM  T   ++++  KR+  SE  +  D    K       +   DPA ALASARHEFGEH
Sbjct  3    ATM--TPENSLSLPEKRQRYSEGDDNHDGGTKKMAQSVVKKPRRDPAEALASARHEFGEH  60

Query  245  GGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGTE  424
            GGVNMSIEASATFTVMEPE++ RMF GELGPD D+FIYSRHFNPTVLN+ R MAA+E TE
Sbjct  61   GGVNMSIEASATFTVMEPETMSRMFKGELGPDRDFFIYSRHFNPTVLNLGRAMAALEATE  120

Query  425  AAYCTASGMSAISSVMFQLLSSGDHVVAA  511
            AAYCTASG+SAISSV+ QL  SG H+VA+
Sbjct  121  AAYCTASGLSAISSVLLQLCPSGSHIVAS  149



>ref|XP_009411481.1| PREDICTED: methionine gamma-lyase-like [Musa acuminata subsp. 
malaccensis]
Length=460

 Score =   185 bits (469),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 98/153 (64%), Positives = 115/153 (75%), Gaps = 7/153 (5%)
 Frame = +2

Query  71   MAETIHQNVNVSNKRRPGSEEWERDDMMKAKKGGKPAVQMWE-----DPAAALASARHEF  235
            MAETI  +   SN +    +E ++D     K    PA +        DPA ALA+ARHEF
Sbjct  1    MAETI-PSPAFSNPKSTSRDE-DKDGGSDKKWAVAPAAKKARGSGGGDPAVALANARHEF  58

Query  236  GEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAME  415
            GEHGGVNMSIEASATFTVME E++RRMFSGELGPD D++IYSRHFNPTVLN+ R MAA+E
Sbjct  59   GEHGGVNMSIEASATFTVMEAETMRRMFSGELGPDRDFYIYSRHFNPTVLNLGRQMAAVE  118

Query  416  GTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            GTEAAYCTASGMSAISSV+ Q+  +G HVVA+R
Sbjct  119  GTEAAYCTASGMSAISSVLIQICGAGGHVVASR  151



>ref|XP_003520012.1| PREDICTED: methionine gamma-lyase-like [Glycine max]
Length=440

 Score =   184 bits (467),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 91/137 (66%), Positives = 108/137 (79%), Gaps = 4/137 (3%)
 Frame = +2

Query  101  VSNKRRPGSEEWERDDMMKAKKGGKPAVQMWEDPAAALASARHEFGEHGGVNMSIEASAT  280
            V+N++R   ++   ++  K K      V    DPA ALA  RHEFGEHGGVNMSIEASAT
Sbjct  6    VTNRKRSSGDDAVSENDRKRKN----MVARNMDPAEALALTRHEFGEHGGVNMSIEASAT  61

Query  281  FTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGTEAAYCTASGMSAI  460
            FTVMEPE+L RMF+GELGPD D+FIYSRHFNPTV+N+ R MAA+EGTEAAYCTASGM+AI
Sbjct  62   FTVMEPETLGRMFAGELGPDRDFFIYSRHFNPTVVNLGRHMAALEGTEAAYCTASGMAAI  121

Query  461  SSVMFQLLSSGDHVVAA  511
            SSV+ QL S+G HVVA+
Sbjct  122  SSVLLQLCSTGGHVVAS  138



>gb|KFK21963.1| hypothetical protein AALP_AAs48252U001300 [Arabis alpina]
Length=136

 Score =   174 bits (442),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 98/115 (85%), Gaps = 2/115 (2%)
 Frame = +2

Query  128  EEWERDDMMKAKKGGKPAVQMWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESL  307
            E+ +  D M AKK    A ++  DP AA+AS RHEFGEHGGVNMSI ASATFTVMEPE++
Sbjct  24   EDNKGGDAMAAKKSALAACEV--DPVAAMASIRHEFGEHGGVNMSIVASATFTVMEPETM  81

Query  308  RRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGTEAAYCTASGMSAISSVM  472
            RR+F GELGPDND+F+YSRHFNPTVLN+SR MAA+EGTEAAYCT+SGMSAISSV+
Sbjct  82   RRVFRGELGPDNDFFVYSRHFNPTVLNLSRKMAALEGTEAAYCTSSGMSAISSVI  136



>ref|XP_010919347.1| PREDICTED: methionine gamma-lyase [Elaeis guineensis]
Length=464

 Score =   183 bits (465),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 96/152 (63%), Positives = 109/152 (72%), Gaps = 4/152 (3%)
 Frame = +2

Query  71   MAETIHQNVNVSNKRRPGSEEWERDDMMKAKKGGKPAVQMWE----DPAAALASARHEFG  238
            MAET    V  + K+R   +    DD      G   AV        DPA ALAS RHEFG
Sbjct  1    MAETEQSMVFTNPKKRGPKDATADDDGFVTGTGDWAAVSTKRVARNDPAGALASVRHEFG  60

Query  239  EHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEG  418
            EHGGVNMSIEASATFTVME ++LRRMF+GELGPD D+FIYSRH NPTVLN+ R MAA+EG
Sbjct  61   EHGGVNMSIEASATFTVMEADTLRRMFAGELGPDRDFFIYSRHCNPTVLNLGRQMAALEG  120

Query  419  TEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            TEAAYCTASGM+AISSV+ QL  +G  VVA+R
Sbjct  121  TEAAYCTASGMAAISSVLIQLCGAGGRVVASR  152



>ref|XP_003536171.1| PREDICTED: methionine gamma-lyase [Glycine max]
Length=442

 Score =   180 bits (457),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 82/97 (85%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = +2

Query  224  RHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLM  403
            RHEFGEHGGVNMSIEASATFTVMEPE++RRMF+GELGPD D+FIYSRHFNPTVL++SRLM
Sbjct  43   RHEFGEHGGVNMSIEASATFTVMEPETMRRMFAGELGPDRDFFIYSRHFNPTVLSLSRLM  102

Query  404  AAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            AA+EGTEAAYCTASGMSAIS+V+ QL S G+HVVA+R
Sbjct  103  AALEGTEAAYCTASGMSAISAVLLQLCSHGEHVVASR  139



>ref|XP_010100197.1| Methionine gamma-lyase [Morus notabilis]
 gb|EXB81868.1| Methionine gamma-lyase [Morus notabilis]
Length=450

 Score =   179 bits (455),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 88/106 (83%), Positives = 101/106 (95%), Gaps = 0/106 (0%)
 Frame = +2

Query  197  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNP  376
            DPAAALA+ARHEFGEHGGVNMSIEASATFTVMEPE++RRMFSGELGPD D+FIYSRHFNP
Sbjct  42   DPAAALAAARHEFGEHGGVNMSIEASATFTVMEPETMRRMFSGELGPDRDFFIYSRHFNP  101

Query  377  TVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            TVL++ R MAA+EGTEAAYCTASGMSAIS+V+ QLLSSG ++VA++
Sbjct  102  TVLSLGRQMAALEGTEAAYCTASGMSAISAVLMQLLSSGQNIVASQ  147



>ref|XP_007161585.1| hypothetical protein PHAVU_001G082000g [Phaseolus vulgaris]
 gb|ESW33579.1| hypothetical protein PHAVU_001G082000g [Phaseolus vulgaris]
Length=439

 Score =   178 bits (451),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 93/130 (72%), Positives = 110/130 (85%), Gaps = 0/130 (0%)
 Frame = +2

Query  125  SEEWERDDMMKAKKGGKPAVQMWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPES  304
            +++  R D   A    K  +    DPAAALASARHEFGEHGGVNMSIEASATFTVMEPE+
Sbjct  9    TQKRNRSDDADAGDSKKLMLHAEADPAAALASARHEFGEHGGVNMSIEASATFTVMEPET  68

Query  305  LRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLL  484
            ++RMF+GELGPD D+FIYSRHFNPTVLN+SRLMAA+EGTEAAYCTASGMSAI++V+ QL 
Sbjct  69   MQRMFNGELGPDRDFFIYSRHFNPTVLNLSRLMAALEGTEAAYCTASGMSAITAVLLQLC  128

Query  485  SSGDHVVAAR  514
            S G+H+VA+R
Sbjct  129  SHGEHMVASR  138



>ref|XP_008437446.1| PREDICTED: methionine gamma-lyase-like [Cucumis melo]
Length=444

 Score =   175 bits (444),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = +2

Query  197  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNP  376
            DPAAALA AR EFGEHGGVNMSIE S TFTVME E++RRMF GELGP+ D+FIYSRHFNP
Sbjct  41   DPAAALAMARPEFGEHGGVNMSIENSITFTVMEAETMRRMFEGELGPERDFFIYSRHFNP  100

Query  377  TVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            TV+ +SR MAA+EGTEAAYCT+SGM+A+SSV+ QL+SSG H+VA+R
Sbjct  101  TVMALSRQMAALEGTEAAYCTSSGMAAVSSVLLQLVSSGGHIVASR  146



>ref|XP_001751901.1| predicted protein [Physcomitrella patens]
 gb|EDQ83336.1| predicted protein [Physcomitrella patens]
Length=411

 Score =   173 bits (439),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = +2

Query  197  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNP  376
            DP   LA+ R EFGEHGGVNMSIEAS TFTVMEPE++ ++F G+LGPD D++IYSRH+NP
Sbjct  2    DPVQGLANMRREFGEHGGVNMSIEASTTFTVMEPETMSKLFEGKLGPDRDFYIYSRHYNP  61

Query  377  TVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAA  511
            TVLN+SR MAAMEGT+AAYCTASGMSAISSV+ QL +SGDH+VA+
Sbjct  62   TVLNLSRQMAAMEGTQAAYCTASGMSAISSVLTQLCNSGDHIVAS  106



>ref|XP_008366029.1| PREDICTED: LOW QUALITY PROTEIN: methionine gamma-lyase-like [Malus 
domestica]
Length=379

 Score =   171 bits (434),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 80/108 (74%), Positives = 92/108 (85%), Gaps = 0/108 (0%)
 Frame = +2

Query  191  WEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHF  370
            WEDPA ALA+ARHEFGEHGGVNMSIEASATFTVMEPE+LR+MF  ELG D D+FIY  HF
Sbjct  26   WEDPATALANARHEFGEHGGVNMSIEASATFTVMEPETLRKMFFDELGADRDFFIYRCHF  85

Query  371  NPTVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            N TVLN+S  MA +EG EAAYCT+SGMS IS V+ QL SSG+H+VA++
Sbjct  86   NLTVLNLSPQMAVLEGIEAAYCTSSGMSTISFVLLQLDSSGEHIVASK  133



>ref|XP_004143943.1| PREDICTED: methionine gamma-lyase-like [Cucumis sativus]
 ref|XP_004163580.1| PREDICTED: methionine gamma-lyase-like [Cucumis sativus]
 gb|KGN49981.1| hypothetical protein Csa_5G148520 [Cucumis sativus]
Length=442

 Score =   172 bits (437),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 80/106 (75%), Positives = 94/106 (89%), Gaps = 0/106 (0%)
 Frame = +2

Query  197  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNP  376
            DPAAALA A  EFGEHGGVNMSIE S TFTVME E++RRMF GELGP+ D+FIYSRHFNP
Sbjct  41   DPAAALAMASPEFGEHGGVNMSIENSITFTVMEAETMRRMFEGELGPERDFFIYSRHFNP  100

Query  377  TVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            TV+ +SR MAA+EGTEAAYCT+SGM+A+SSV+ QL+SSG H+VA+R
Sbjct  101  TVMALSRQMAALEGTEAAYCTSSGMAAVSSVLLQLVSSGGHIVASR  146



>ref|XP_002964805.1| hypothetical protein SELMODRAFT_82714 [Selaginella moellendorffii]
 gb|EFJ33643.1| hypothetical protein SELMODRAFT_82714 [Selaginella moellendorffii]
Length=441

 Score =   171 bits (433),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/140 (61%), Positives = 103/140 (74%), Gaps = 1/140 (1%)
 Frame = +2

Query  95   VNVSNKRR-PGSEEWERDDMMKAKKGGKPAVQMWEDPAAALASARHEFGEHGGVNMSIEA  271
            ++ S KR   GS      D   AK+    +     DP   L S RHEFGEHGGVNMSIEA
Sbjct  1    MDASTKRGGSGSASGFFQDRYSAKRPRASSPPPPLDPEEGLVSIRHEFGEHGGVNMSIEA  60

Query  272  SATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGTEAAYCTASGM  451
            S+TFTVME E++ +MF GELGPD D++IYSRHFNPTVLN+ R +AAMEGT+AAYCTASGM
Sbjct  61   SSTFTVMEAETMGKMFKGELGPDRDFYIYSRHFNPTVLNLGRQIAAMEGTQAAYCTASGM  120

Query  452  SAISSVMFQLLSSGDHVVAA  511
            SA++SV+ QL  +GDHVVA+
Sbjct  121  SAVASVILQLCDAGDHVVAS  140



>ref|XP_002961730.1| hypothetical protein SELMODRAFT_76894 [Selaginella moellendorffii]
 gb|EFJ36990.1| hypothetical protein SELMODRAFT_76894 [Selaginella moellendorffii]
Length=441

 Score =   171 bits (433),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 77/105 (73%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = +2

Query  197  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNP  376
            DP   L S RHEFGEHGGVNMSIEAS+TFTVME E++ +MF GELGPD D++IYSRHFNP
Sbjct  36   DPEEGLVSIRHEFGEHGGVNMSIEASSTFTVMEAETMAKMFKGELGPDRDFYIYSRHFNP  95

Query  377  TVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAA  511
            TVLN+ R +AAMEGT+AAYCTASGMSA++SV+ QL  +GDHVVA+
Sbjct  96   TVLNLGRQIAAMEGTQAAYCTASGMSAVASVILQLCDAGDHVVAS  140



>dbj|BAK03127.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=461

 Score =   168 bits (425),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 84/107 (79%), Positives = 98/107 (92%), Gaps = 1/107 (1%)
 Frame = +2

Query  197  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPD-NDYFIYSRHFN  373
            DPAAALA+ARHEFGEHGGVNMSIEASATFTVMEP+++RR+F+GELGP+  D +IYSRHFN
Sbjct  44   DPAAALAAARHEFGEHGGVNMSIEASATFTVMEPDTMRRLFTGELGPERGDLYIYSRHFN  103

Query  374  PTVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            PTVL + R MAA+EGTEAAYCTASGMSAISSV+ QL+ +G HVVA+R
Sbjct  104  PTVLALGRQMAALEGTEAAYCTASGMSAISSVLMQLVGAGGHVVASR  150



>ref|XP_003574196.1| PREDICTED: methionine gamma-lyase [Brachypodium distachyon]
Length=458

 Score =   167 bits (424),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 84/107 (79%), Positives = 98/107 (92%), Gaps = 1/107 (1%)
 Frame = +2

Query  197  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPD-NDYFIYSRHFN  373
            DPAAALA+ARHEFGEHGGVNMSIEASATFTVMEP+++R++F+GELGPD  D +IYSRHFN
Sbjct  42   DPAAALAAARHEFGEHGGVNMSIEASATFTVMEPDTMRKLFAGELGPDRGDLYIYSRHFN  101

Query  374  PTVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            PTVL + R MAA+EGTEAAYCTASGMSAISSV+ QL+ +G HVVA+R
Sbjct  102  PTVLALGRQMAALEGTEAAYCTASGMSAISSVLMQLVGAGGHVVASR  148



>ref|XP_008646566.1| PREDICTED: methionine gamma-lyase-like [Zea mays]
Length=471

 Score =   167 bits (424),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 86/108 (80%), Positives = 97/108 (90%), Gaps = 1/108 (1%)
 Frame = +2

Query  194  EDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPD-NDYFIYSRHF  370
            EDPAAALA+ARHEFGEHGGVNMSIEASATFTVMEPE++RR+F+GELGPD    +IYSRHF
Sbjct  41   EDPAAALAAARHEFGEHGGVNMSIEASATFTVMEPETMRRLFAGELGPDRGGMYIYSRHF  100

Query  371  NPTVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            NPTV  + R MAA+EGTEAAYCTASGMSAISSVM QL+ +G HVVA+R
Sbjct  101  NPTVQALGRQMAALEGTEAAYCTASGMSAISSVMVQLVGAGGHVVASR  148



>gb|AFW68376.1| hypothetical protein ZEAMMB73_868492 [Zea mays]
Length=476

 Score =   167 bits (424),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 86/108 (80%), Positives = 97/108 (90%), Gaps = 1/108 (1%)
 Frame = +2

Query  194  EDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPD-NDYFIYSRHF  370
            EDPAAALA+ARHEFGEHGGVNMSIEASATFTVMEPE++RR+F+GELGPD    +IYSRHF
Sbjct  46   EDPAAALAAARHEFGEHGGVNMSIEASATFTVMEPETMRRLFAGELGPDRGGMYIYSRHF  105

Query  371  NPTVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            NPTV  + R MAA+EGTEAAYCTASGMSAISSVM QL+ +G HVVA+R
Sbjct  106  NPTVQALGRQMAALEGTEAAYCTASGMSAISSVMVQLVGAGGHVVASR  153



>ref|NP_001152224.1| O-succinylhomoserine sulfhydrylase [Zea mays]
 gb|ACG46481.1| O-succinylhomoserine sulfhydrylase [Zea mays]
Length=473

 Score =   166 bits (421),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 89/151 (59%), Positives = 112/151 (74%), Gaps = 3/151 (2%)
 Frame = +2

Query  71   MAETIHQNVNVSNKRRP-GSEEWERDDMMKAKKGGKPAVQMWEDPAAALASA-RHEFGEH  244
            MA+T+     ++  +RP G++ +       +  G KP  +  E   AA  +A RHEFGEH
Sbjct  1    MAQTLSAASELATLKRPFGNDGFGDGSNNGSATGEKPKARRREADPAAAMAAARHEFGEH  60

Query  245  GGVNMSIEASATFTVMEPESLRRMFSGELGPD-NDYFIYSRHFNPTVLNVSRLMAAMEGT  421
            GGVNMSIEASATFTVMEP+++RR+F+GELGPD  D +IYSRHFNPTVL + R MAA+EGT
Sbjct  61   GGVNMSIEASATFTVMEPDTMRRLFAGELGPDRGDMYIYSRHFNPTVLALGRQMAALEGT  120

Query  422  EAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            EA YCTASGMSAISSV+ QL+ +G HVVA+R
Sbjct  121  EAGYCTASGMSAISSVLMQLVGAGGHVVASR  151



>tpg|DAA49293.1| TPA: O-succinylhomoserine sulfhydrylase [Zea mays]
Length=473

 Score =   166 bits (421),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 89/151 (59%), Positives = 112/151 (74%), Gaps = 3/151 (2%)
 Frame = +2

Query  71   MAETIHQNVNVSNKRRP-GSEEWERDDMMKAKKGGKPAVQMWEDPAAALASA-RHEFGEH  244
            MA+T+     ++  +RP G++ +       +  G KP  +  E   AA  +A RHEFGEH
Sbjct  1    MAQTLSAASELATLKRPFGNDGFGDGSNNGSATGEKPKARRREADPAAALAAARHEFGEH  60

Query  245  GGVNMSIEASATFTVMEPESLRRMFSGELGPD-NDYFIYSRHFNPTVLNVSRLMAAMEGT  421
            GGVNMSIEASATFTVMEP+++RR+F+GELGPD  D +IYSRHFNPTVL + R MAA+EGT
Sbjct  61   GGVNMSIEASATFTVMEPDTMRRLFAGELGPDRGDMYIYSRHFNPTVLALGRQMAALEGT  120

Query  422  EAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            EA YCTASGMSAISSV+ QL+ +G HVVA+R
Sbjct  121  EAGYCTASGMSAISSVLMQLVGAGGHVVASR  151



>ref|NP_001065069.1| Os10g0517500 [Oryza sativa Japonica Group]
 gb|AAK39571.1|AC025296_6 putative gamma-lyase [Oryza sativa Japonica Group]
 gb|AAP54634.1| Cys/Met metabolism PLP-dependent enzyme family protein, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF26983.1| Os10g0517500 [Oryza sativa Japonica Group]
 dbj|BAG94621.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE51269.1| hypothetical protein OsJ_32167 [Oryza sativa Japonica Group]
Length=464

 Score =   165 bits (417),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 86/136 (63%), Positives = 103/136 (76%), Gaps = 2/136 (1%)
 Frame = +2

Query  113  RRPGSEEWERDDMMKAKKGGKPAVQMWEDPAAALASA-RHEFGEHGGVNMSIEASATFTV  289
            +RP   + +          GKP  +  E   AA  +A RHEFGEHGGVNMSIEASATFTV
Sbjct  16   KRPFQNDDDNSSNGNGNADGKPKARRREADPAAALAAARHEFGEHGGVNMSIEASATFTV  75

Query  290  MEPESLRRMFSGELGPD-NDYFIYSRHFNPTVLNVSRLMAAMEGTEAAYCTASGMSAISS  466
            MEP+++RR+FSGELGP+  D +IYSRHFNPTVL + R MAA+EGTEAAYCTASGMSAISS
Sbjct  76   MEPDTMRRLFSGELGPERGDLYIYSRHFNPTVLALGRQMAALEGTEAAYCTASGMSAISS  135

Query  467  VMFQLLSSGDHVVAAR  514
            V+ QL+ +G HVVA+R
Sbjct  136  VLMQLVGAGGHVVASR  151



>ref|XP_002464368.1| hypothetical protein SORBIDRAFT_01g017060 [Sorghum bicolor]
 gb|EER91366.1| hypothetical protein SORBIDRAFT_01g017060 [Sorghum bicolor]
Length=477

 Score =   164 bits (416),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 89/98 (91%), Gaps = 1/98 (1%)
 Frame = +2

Query  224  RHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPD-NDYFIYSRHFNPTVLNVSRL  400
            RHEFGEHGGVNMSIEASATFTVMEP+++RR+F+GELGPD  D +IYSRHFNPTVL + R 
Sbjct  56   RHEFGEHGGVNMSIEASATFTVMEPDTMRRLFAGELGPDRGDMYIYSRHFNPTVLALGRQ  115

Query  401  MAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            MAA+EGTEAAYCTASGMSAIS+V+ QL+ +G HVVA+R
Sbjct  116  MAALEGTEAAYCTASGMSAISAVLMQLVGAGGHVVASR  153



>gb|EAY79213.1| hypothetical protein OsI_34329 [Oryza sativa Indica Group]
Length=469

 Score =   163 bits (413),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 85/136 (63%), Positives = 103/136 (76%), Gaps = 2/136 (1%)
 Frame = +2

Query  113  RRPGSEEWERDDMMKAKKGGKPAVQMWEDPAAALASA-RHEFGEHGGVNMSIEASATFTV  289
            +RP   + +          GKP  +  E   AA  +A RHEFGEHGGVNMSIEASATFTV
Sbjct  16   KRPFQNDDDNSSNGNGNADGKPKARRREADPAAALAAARHEFGEHGGVNMSIEASATFTV  75

Query  290  MEPESLRRMFSGELGPD-NDYFIYSRHFNPTVLNVSRLMAAMEGTEAAYCTASGMSAISS  466
            MEP+++RR+F+GELGP+  D +IYSRHFNPTVL + R MAA+EGTEAAYCTASGMSAISS
Sbjct  76   MEPDTMRRLFAGELGPERGDLYIYSRHFNPTVLALGRQMAALEGTEAAYCTASGMSAISS  135

Query  467  VMFQLLSSGDHVVAAR  514
            V+ QL+ +G HVVA+R
Sbjct  136  VLMQLVGAGGHVVASR  151



>ref|XP_004982603.1| PREDICTED: methionine gamma-lyase-like [Setaria italica]
Length=480

 Score =   162 bits (409),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 87/98 (89%), Gaps = 1/98 (1%)
 Frame = +2

Query  224  RHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPD-NDYFIYSRHFNPTVLNVSRL  400
            RHEFGEHGGVNMSIEASATFTVMEP+++RR+F+GELGPD  D +IYSRHFNPTVL + R 
Sbjct  59   RHEFGEHGGVNMSIEASATFTVMEPDTMRRLFAGELGPDRGDMYIYSRHFNPTVLALGRQ  118

Query  401  MAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            MAA+E TEAAYCTASGMSAISSV+ QL+  G HVVA+R
Sbjct  119  MAALEATEAAYCTASGMSAISSVLMQLVGVGGHVVASR  156



>ref|XP_001759514.1| predicted protein [Physcomitrella patens]
 gb|EDQ75816.1| predicted protein [Physcomitrella patens]
Length=424

 Score =   154 bits (390),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 92/112 (82%), Gaps = 0/112 (0%)
 Frame = +2

Query  176  PAVQMWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFI  355
            PA++ + DP   LA+     G+HGGVN++IEAS+TF ++EP++L ++FSGELG D+  ++
Sbjct  6    PAIKKFPDPVQTLANVHQGLGQHGGVNVAIEASSTFAIVEPQTLNKLFSGELGTDHGLYL  65

Query  356  YSRHFNPTVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAA  511
            YSRHFNPTVL++ R MAA+E TEAAYCTASGMSAI++VM QL SSGDH+VA+
Sbjct  66   YSRHFNPTVLSLGRKMAALEDTEAAYCTASGMSAIAAVMLQLCSSGDHIVAS  117



>ref|XP_011020545.1| PREDICTED: methionine gamma-lyase-like [Populus euphratica]
Length=417

 Score =   149 bits (377),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 85/107 (79%), Gaps = 0/107 (0%)
 Frame = +2

Query  194  EDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFN  373
            E PA ALA+ARH+ GEH G+NMSIEAS TFT  + +++ R F GE+GP    +IYSRH N
Sbjct  15   EVPAEALAAARHQLGEHNGINMSIEASNTFTFKDSDAMNRAFLGEVGPKTGIYIYSRHLN  74

Query  374  PTVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            PT+LN+ R +AAMEGTE AYCTASGMSAISSV+ QL ++G HVVAA+
Sbjct  75   PTILNLGRQIAAMEGTETAYCTASGMSAISSVLLQLCNAGGHVVAAK  121



>ref|XP_002304835.2| hypothetical protein POPTR_0003s18600g [Populus trichocarpa]
 gb|EEE79814.2| hypothetical protein POPTR_0003s18600g [Populus trichocarpa]
Length=417

 Score =   148 bits (374),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 84/107 (79%), Gaps = 0/107 (0%)
 Frame = +2

Query  194  EDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFN  373
            E PA ALA+ARH+ GEH G+NMSIEAS TFT  + +++ R F GE+GP    +IYSRH N
Sbjct  15   EVPAEALAAARHKLGEHNGINMSIEASNTFTFKDSDAMNRAFLGEVGPKTGIYIYSRHLN  74

Query  374  PTVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            PT+LN+ R +AAMEGTE AYCTASGMSAISSV  QL ++G HVVAA+
Sbjct  75   PTILNLGRQIAAMEGTETAYCTASGMSAISSVFLQLCNTGGHVVAAK  121



>gb|AFT91998.1| cystathionine gamma-synthase [Populus alba x Populus glandulosa]
 gb|AFT92010.1| cystathionine gamma-synthase [Populus alba x Populus glandulosa]
Length=420

 Score =   141 bits (356),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 90/132 (68%), Gaps = 14/132 (11%)
 Frame = +2

Query  119  PGSEEWERDDMMKAKKGGKPAVQMWED-PAAALASARHEFGEHGGVNMSIEASATFTVME  295
            PG+EE E             +++  ED P   LA+ARHE GEH GVNMSIE S TF    
Sbjct  3    PGNEELE-------------SIEPREDLPTERLANARHELGEHNGVNMSIEVSDTFVFKN  49

Query  296  PESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGTEAAYCTASGMSAISSVMF  475
            PE++ + F GE+GP+   +IYSRH+NPTVLN S  +AA+EGTE AYCT+SGM+AISSV+ 
Sbjct  50   PENMGKAFLGEVGPETGTYIYSRHYNPTVLNFSHQLAAIEGTETAYCTSSGMAAISSVLL  109

Query  476  QLLSSGDHVVAA  511
            +L  +G HVVAA
Sbjct  110  ELCKNGGHVVAA  121



>gb|AFT91997.1| cystathionine gamma-synthase [Populus tomentosa]
 gb|AFT92009.1| cystathionine gamma-synthase [Populus tomentosa]
Length=420

 Score =   141 bits (355),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 89/132 (67%), Gaps = 14/132 (11%)
 Frame = +2

Query  119  PGSEEWERDDMMKAKKGGKPAVQMWED-PAAALASARHEFGEHGGVNMSIEASATFTVME  295
            PG+EE E              ++  ED P   LA+ARHE GEH GVNMSIE S TF    
Sbjct  3    PGNEELEN-------------IEPREDLPTERLANARHELGEHNGVNMSIEVSDTFVFKN  49

Query  296  PESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGTEAAYCTASGMSAISSVMF  475
            PE++ + F GE+GP+   +IYSRH+NPTVLN S  +AA+EGTE AYCT+SGM+AISSV+ 
Sbjct  50   PENMGKAFLGEVGPETGTYIYSRHYNPTVLNFSHQLAAIEGTETAYCTSSGMAAISSVLL  109

Query  476  QLLSSGDHVVAA  511
            +L  +G HVVAA
Sbjct  110  ELCKNGGHVVAA  121



>ref|XP_006388026.1| hypothetical protein POPTR_0393s00210g [Populus trichocarpa]
 gb|ERP46940.1| hypothetical protein POPTR_0393s00210g [Populus trichocarpa]
Length=420

 Score =   139 bits (350),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 64/104 (62%), Positives = 79/104 (76%), Gaps = 0/104 (0%)
 Frame = +2

Query  200  PAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPT  379
            P   LA+ARHE GEH GVNMSIE S TF    PE++ + F GE+GP+   +IYSRH+NPT
Sbjct  18   PTERLANARHELGEHNGVNMSIEVSDTFVFKNPENMGKAFLGEIGPETGTYIYSRHYNPT  77

Query  380  VLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAA  511
            VLN S  +AA+EGTE AYCT+SGM+AISSV+ +L  +G HVVAA
Sbjct  78   VLNFSHQLAAIEGTETAYCTSSGMAAISSVLLELCKNGGHVVAA  121



>ref|XP_002304836.2| hypothetical protein POPTR_0003s18590g [Populus trichocarpa]
 gb|EEE79815.2| hypothetical protein POPTR_0003s18590g [Populus trichocarpa]
Length=433

 Score =   137 bits (346),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 68/122 (56%), Positives = 84/122 (69%), Gaps = 17/122 (14%)
 Frame = +2

Query  200  PAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPT  379
            PA ALA+ARHE GEH G+NMSIEAS+TFT  + +++ R F GE+GP    +IYSRH NPT
Sbjct  16   PAEALAAARHELGEHNGINMSIEASSTFTFKDSDAMNRAFLGEVGPKTGIYIYSRHLNPT  75

Query  380  VLNVSRLMAAMEGTEAAYCTASG-----------------MSAISSVMFQLLSSGDHVVA  508
             LN+ R +AA+EGTE AYCTASG                 MSAISSV+ QL ++G HVVA
Sbjct  76   TLNLGRQIAAIEGTETAYCTASGGLKLQLTSIVIDSLFARMSAISSVLLQLCNTGGHVVA  135

Query  509  AR  514
            A+
Sbjct  136  AK  137



>ref|XP_001756897.1| predicted protein [Physcomitrella patens]
 gb|EDQ78128.1| predicted protein [Physcomitrella patens]
Length=395

 Score =   134 bits (336),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 82/112 (73%), Gaps = 0/112 (0%)
 Frame = +2

Query  176  PAVQMWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFI  355
            PA++ + +P   LA ARH  G++GGVN +IEAS+TF ++ P+ L ++FSGELG D   ++
Sbjct  8    PAIKKFPNPVQNLAGARHGLGQYGGVNGAIEASSTFAIILPQRLNKLFSGELGTDQGLYL  67

Query  356  YSRHFNPTVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAA  511
            YSRHFNPT+ ++ R MA  E  EAAYCT SGMSAI+S M QL SSGD VV +
Sbjct  68   YSRHFNPTMRSLGRKMAVDEDMEAAYCTMSGMSAIASFMLQLCSSGDQVVVS  119



>ref|WP_022667695.1| cystathionine beta-lyase [Desulfospira joergensenii]
Length=406

 Score =   129 bits (323),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 78/107 (73%), Gaps = 1/107 (1%)
 Frame = +2

Query  197  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDND-YFIYSRHFN  373
            +P  AL  AR EFGEHGGV  SI  SATFTVM P ++  +FSG  GP+    F+YSRHFN
Sbjct  5    NPEQALLKARREFGEHGGVAPSISRSATFTVMHPRTMPEIFSGLKGPEQGGCFLYSRHFN  64

Query  374  PTVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            PTV  +SR +AAMEGTEAA CTASGMSAIS  + Q+  S DH+VA++
Sbjct  65   PTVDVLSRYLAAMEGTEAAICTASGMSAISCAILQICKSKDHIVASQ  111



>ref|WP_024333343.1| cystathionine beta-lyase [Desulfotignum balticum]
Length=406

 Score =   126 bits (317),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 78/106 (74%), Gaps = 1/106 (1%)
 Frame = +2

Query  197  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDND-YFIYSRHFN  373
            +P  AL +AR EFGEHGGV  SI  SATFTVM P ++  +F+G  GP+    F+YSRHFN
Sbjct  5    NPEKALLNARREFGEHGGVVPSISRSATFTVMHPGTMPEIFNGLKGPEQGGCFLYSRHFN  64

Query  374  PTVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAA  511
            PTV  ++R +AAMEGTEAA CTASGMSAIS  + Q   SGDH+VA+
Sbjct  65   PTVDVLARYLAAMEGTEAAVCTASGMSAISCTILQTCYSGDHIVAS  110



>ref|WP_006964281.1| cystathionine gamma-lyase CysA [Desulfotignum phosphitoxidans]
 gb|EMS81534.1| cystathionine gamma-lyase CysA [Desulfotignum phosphitoxidans 
DSM 13687]
Length=406

 Score =   126 bits (316),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 78/106 (74%), Gaps = 1/106 (1%)
 Frame = +2

Query  197  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDND-YFIYSRHFN  373
            +P  AL +AR EFGEHGGV  SI  SATFTVM P ++  +F+G  GP+    F+YSRHFN
Sbjct  5    NPEKALLNARREFGEHGGVVPSISRSATFTVMHPGTMPEIFNGLKGPEQGGCFLYSRHFN  64

Query  374  PTVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAA  511
            PTV  ++R +AAMEGTEAA CTASGMSAIS  + Q   SGDH+VA+
Sbjct  65   PTVDVLARYLAAMEGTEAAVCTASGMSAISCTILQTCYSGDHIVAS  110



>ref|WP_027709412.1| cystathionine beta-lyase [Zooshikella ganghwensis]
Length=409

 Score =   124 bits (311),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/102 (61%), Positives = 81/102 (79%), Gaps = 1/102 (1%)
 Frame = +2

Query  212  LASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDY-FIYSRHFNPTVLN  388
            LA A+HEFGEHGGVNMSIEAS+TFTVME  +L  +F G+ GP     ++Y RHFNPTV N
Sbjct  11   LADAKHEFGEHGGVNMSIEASSTFTVMEANTLPEIFQGQKGPQQGGCYLYGRHFNPTVYN  70

Query  389  VSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            +++ +A +EG+E+AYCTASGM+AISS + QLL+ GD V+A+ 
Sbjct  71   LAQQLACIEGSESAYCTASGMAAISSTLLQLLNPGDEVIASH  112



>ref|XP_005848305.1| hypothetical protein CHLNCDRAFT_35132 [Chlorella variabilis]
 gb|EFN56203.1| hypothetical protein CHLNCDRAFT_35132 [Chlorella variabilis]
Length=569

 Score =   125 bits (314),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 76/104 (73%), Gaps = 0/104 (0%)
 Frame = +2

Query  194  EDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFN  373
            EDPAA LA +R EFGE GGVN  IE S TFTV+E ++L ++F+GE GP    ++Y R FN
Sbjct  17   EDPAARLADSRREFGEWGGVNAGIEVSTTFTVLEADTLPQIFAGEKGPSGGCYLYGRSFN  76

Query  374  PTVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVV  505
            PTV  + R +AA+EG  A+YC ASGM+AIS+ +  L +SGDH+V
Sbjct  77   PTVRYLGRQLAALEGAAASYCCASGMAAISATLLALCNSGDHIV  120



>ref|XP_010497416.1| PREDICTED: methionine gamma-lyase-like [Camelina sativa]
Length=197

 Score =   119 bits (299),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = +2

Query  314  MFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSG  493
            MF+GELGPDND+F+YSRHFNPTVLN+SR MAA+EGT+AAYCT+SGMSAISSVM QL SSG
Sbjct  1    MFAGELGPDNDFFVYSRHFNPTVLNLSRQMAALEGTQAAYCTSSGMSAISSVMLQLCSSG  60

Query  494  DHVVAAR  514
             HVVA+ 
Sbjct  61   GHVVASN  67



>ref|XP_002955875.1| hypothetical protein VOLCADRAFT_66358 [Volvox carteri f. nagariensis]
 gb|EFJ43076.1| hypothetical protein VOLCADRAFT_66358 [Volvox carteri f. nagariensis]
Length=412

 Score =   117 bits (294),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 78/109 (72%), Gaps = 1/109 (1%)
 Frame = +2

Query  188  MWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDND-YFIYSR  364
            +  DP   L S + EFGE GGVN S+E S TFTV+E ++L  +FSGE+GP+    ++Y R
Sbjct  4    LQADPLDRLVSGKREFGEFGGVNASVEISTTFTVLEADTLPAIFSGEVGPEKGGCYVYGR  63

Query  365  HFNPTVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAA  511
             FNPTV ++ RL+AA+EG EAAY  +SGM+AISS +  L + GDH+VA+
Sbjct  64   AFNPTVRHLGRLLAALEGCEAAYPCSSGMAAISSTLMALCNQGDHIVAS  112



>gb|KHN47224.1| Cystathionine gamma-lyase [Glycine soja]
Length=278

 Score =   106 bits (265),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/88 (61%), Positives = 64/88 (73%), Gaps = 4/88 (5%)
 Frame = +2

Query  101  VSNKRRPGSEEWERDDMMKAKKGGKPAVQMWEDPAAALASARHEFGEHGGVNMSIEASAT  280
            V+N++R   +    D + +  +  K  V    DPA ALA  RHEFGEHGGVNMSIEASAT
Sbjct  6    VTNRKRSSGD----DAVSENDRKRKNMVARNMDPAEALALTRHEFGEHGGVNMSIEASAT  61

Query  281  FTVMEPESLRRMFSGELGPDNDYFIYSR  364
            FTVMEPE+L RMF+GELGPD D+FIYSR
Sbjct  62   FTVMEPETLCRMFAGELGPDRDFFIYSR  89



>ref|XP_005651025.1| cystathionine gamma-synthase [Coccomyxa subellipsoidea C-169]
 gb|EIE26481.1| cystathionine gamma-synthase [Coccomyxa subellipsoidea C-169]
Length=430

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/106 (48%), Positives = 73/106 (69%), Gaps = 1/106 (1%)
 Frame = +2

Query  197  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDY-FIYSRHFN  373
            +P  +L+  + EFGE GGVN SIE+S TFTV+    + ++F G L P+    ++Y R FN
Sbjct  10   EPTVSLSRHKKEFGEFGGVNASIESSTTFTVLHAGDMPQIFEGTLNPEKGACYLYGRSFN  69

Query  374  PTVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAA  511
            PTV  + R +AA+EGTEA Y  +SG++AIS+   QL +SGDH+VA+
Sbjct  70   PTVRYLGRQLAALEGTEAGYAVSSGLAAISATFLQLCNSGDHIVAS  115



>ref|XP_006385806.1| hypothetical protein POPTR_0003s14660g [Populus trichocarpa]
 gb|ERP63603.1| hypothetical protein POPTR_0003s14660g [Populus trichocarpa]
Length=200

 Score =   102 bits (253),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 62/140 (44%), Positives = 75/140 (54%), Gaps = 41/140 (29%)
 Frame = +2

Query  104  SNKRRPGSEEWERDDMMKAKKGGKPAVQM---WEDPAAALASARHEFGEHGGVNMSIEAS  274
            + K+R  + +   DD + A K    +  M   WEDPAAALA++RHEFGEHGGVNMS EAS
Sbjct  8    AGKKRSSTGQDGDDDCIVANKKAMLSTGMPSTWEDPAAALATSRHEFGEHGGVNMSTEAS  67

Query  275  ATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGTEAAYCTASGMS  454
            ATFTVMEPE++RRMFS EL                                      G S
Sbjct  68   ATFTVMEPETMRRMFSSEL--------------------------------------GTS  89

Query  455  AISSVMFQLLSSGDHVVAAR  514
            AISSV+ QL  SG  +VA+R
Sbjct  90   AISSVLLQLCCSGGRMVASR  109



>ref|WP_025865695.1| cystathionine beta-lyase [Prolixibacter bellariivorans]
Length=402

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 70/105 (67%), Gaps = 4/105 (4%)
 Frame = +2

Query  197  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNP  376
            DPA  +    + FGE GGVN SI  S+TFT M+ +++   F GE       F+YSRH+NP
Sbjct  7    DPATRIQRLEN-FGEFGGVNPSITDSSTFTFMDAKTMLDTFHGE---TEGCFLYSRHWNP  62

Query  377  TVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAA  511
            +   +S  +AAMEGTE A+ T SGMSAI++V+ QL ++GDH++ +
Sbjct  63   SNKALSDAIAAMEGTEGAWVTGSGMSAITTVLLQLCNAGDHIITS  107



>ref|WP_038562571.1| cystathionine beta-lyase [Draconibacterium orientale]
Length=393

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 71/108 (66%), Gaps = 4/108 (4%)
 Frame = +2

Query  188  MWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRH  367
            M  DPA  +   + +FGE GGVN SI  S+T+T +E E++   F G +      F+YSRH
Sbjct  1    MNSDPAKRIFDIQ-QFGEFGGVNPSITDSSTYTFLEGETMEETFLGHM---EGCFLYSRH  56

Query  368  FNPTVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAA  511
            +NP+   ++  +AAMEGTE+A+ T+SGM+AI+  + QL  SGDH++ +
Sbjct  57   WNPSNKYLADALAAMEGTESAWITSSGMAAITCAILQLCHSGDHIITS  104



>gb|KJF42319.1| cystathionine beta-lyase [Draconibacterium sp. JN14CK-3]
Length=393

 Score = 90.5 bits (223),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 71/108 (66%), Gaps = 4/108 (4%)
 Frame = +2

Query  188  MWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRH  367
            M  DPA  +   + +FGE GGVN SI  S+T+T +E E++   F G +      F+YSRH
Sbjct  1    MNSDPAKRIFDIQ-QFGEFGGVNPSITDSSTYTFLEGETMEETFLGHM---EGCFLYSRH  56

Query  368  FNPTVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAA  511
            +NP+   ++  +AAMEGTE+A+ T+SGM+AI+  + QL  SGDH++ +
Sbjct  57   WNPSNKFLADALAAMEGTESAWITSSGMAAITCSILQLCKSGDHIITS  104



>ref|WP_027075614.1| cystathionine beta-lyase [Maribacter antarcticus]
Length=407

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/109 (45%), Positives = 70/109 (64%), Gaps = 4/109 (4%)
 Frame = +2

Query  188  MWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRH  367
            M +  A  L   +H FGE+GGVN SI  S+T+T +   S + MF    G     ++YSRH
Sbjct  1    MSKKAANDLQDLQH-FGEYGGVNPSISDSSTYTFL---SAKTMFDTFEGNTEGCYLYSRH  56

Query  368  FNPTVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
              P+ L +   +AA+EGTEAA  TASGM AI++V+ QL ++GDH+V++R
Sbjct  57   STPSNLYLGEALAALEGTEAANVTASGMGAITAVILQLCNAGDHIVSSR  105



>ref|WP_014561543.1| cystathionine beta-lyase [Ignavibacterium album]
 gb|AFH50402.1| Methionine-gamma-lyase [Ignavibacterium album JCM 16511]
Length=401

 Score = 86.3 bits (212),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 42/94 (45%), Positives = 64/94 (68%), Gaps = 3/94 (3%)
 Frame = +2

Query  233  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  412
            FGE+G VN SI  S+T+T + P++++ +F  E+      F+YSRH+NPT   ++  +A +
Sbjct  16   FGEYGDVNPSITDSSTYTFLNPKTMKELFEHEI---EGCFLYSRHWNPTNKYLAEALAKL  72

Query  413  EGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            E TEAA  T+SGM AIS  M QL ++GD +V++R
Sbjct  73   EDTEAAIVTSSGMGAISCTMLQLCNAGDEIVSSR  106



>ref|WP_044633542.1| cystathionine beta-lyase [Tamlana sedimentorum]
 gb|KJD34247.1| cystathionine beta-lyase [Tamlana sedimentorum]
Length=402

 Score = 86.3 bits (212),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 47/105 (45%), Positives = 69/105 (66%), Gaps = 4/105 (4%)
 Frame = +2

Query  200  PAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPT  379
            PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G  +  ++YSRH +P+
Sbjct  5    PANNIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNADGCYLYSRHSSPS  60

Query  380  VLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
             L +   +AAMEGTE A  TASGM AI++V+ QL S+GDH++++R
Sbjct  61   NLYLGEALAAMEGTETANVTASGMGAITAVLMQLCSAGDHIISSR  105



>ref|WP_027311134.1| cystathionine beta-lyase [Bacteroidetes bacterium SCGC AAA027-N21]
Length=400

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 67/105 (64%), Gaps = 4/105 (4%)
 Frame = +2

Query  200  PAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPT  379
            PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH +P+
Sbjct  6    PANNIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNAEGCYLYSRHSSPS  61

Query  380  VLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
             L + + MAAMEGTEAA  +ASGM AI+  + QL S GDH+V++R
Sbjct  62   NLYLDKAMAAMEGTEAANVSASGMGAITPTLLQLCSQGDHIVSSR  106



>ref|WP_031444038.1| cystathionine beta-lyase [Arenibacter algicola]
Length=406

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/94 (48%), Positives = 64/94 (68%), Gaps = 3/94 (3%)
 Frame = +2

Query  233  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  412
            FGE+GGVN SI  S+T+T +   S + MF    G     ++YSRH +P+ L +   +AA+
Sbjct  15   FGEYGGVNPSISDSSTYTFL---SAKTMFDTFEGNTEGCYLYSRHSSPSNLYLGEALAAL  71

Query  413  EGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            EGTE A  TASGM AIS+V+ QL ++GDH+V++R
Sbjct  72   EGTETANVTASGMGAISAVILQLCNAGDHIVSSR  105



>ref|WP_026775536.1| cystathionine beta-lyase [Polaribacter sp. Hel_I_88]
Length=399

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 69/109 (63%), Gaps = 4/109 (4%)
 Frame = +2

Query  188  MWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRH  367
            M  +PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G  +  ++YSRH
Sbjct  1    MKFNPADNIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNADGCYLYSRH  56

Query  368  FNPTVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
              P+ L +   +AAMEGTE A  TASGM AI+ V+ QL ++GDH+V++R
Sbjct  57   STPSNLYLGEALAAMEGTETANVTASGMGAITPVLLQLCNAGDHIVSSR  105



>ref|WP_027066687.1| cystathionine beta-lyase [Maribacter sp. Hel_I_7]
Length=406

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/94 (47%), Positives = 65/94 (69%), Gaps = 3/94 (3%)
 Frame = +2

Query  233  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  412
            FGE+GGVN SI  S+T+T +   S + MF    G     ++YSRH +P+ L +   +AA+
Sbjct  15   FGEYGGVNPSISDSSTYTFI---SAKTMFDTFEGNTEGCYLYSRHSSPSNLYLGEALAAL  71

Query  413  EGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            EGTE+A  TASGM AI++V+ QL +SGDH++++R
Sbjct  72   EGTESANVTASGMGAITAVILQLCNSGDHIISSR  105



>ref|WP_027126595.1| cystathionine beta-lyase [Gelidibacter mesophilus]
Length=399

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/105 (45%), Positives = 67/105 (64%), Gaps = 4/105 (4%)
 Frame = +2

Query  200  PAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPT  379
            PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G  +  ++YSRH  P+
Sbjct  5    PANNIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNADGCYLYSRHSTPS  60

Query  380  VLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
             L + + +AAMEGTE A  TASGM AI+ V+ QL  +GDH+V++R
Sbjct  61   NLYLGKALAAMEGTETATVTASGMGAITPVLMQLCGAGDHIVSSR  105



>ref|WP_041327761.1| cystathionine beta-lyase [Robiginitalea biformata]
Length=407

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 64/94 (68%), Gaps = 3/94 (3%)
 Frame = +2

Query  233  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  412
            FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH +P+ L +   +AA+
Sbjct  16   FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNTEGCYLYSRHSSPSNLYLGEALAAL  72

Query  413  EGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            EGTE+A  TASGM AI++V+ QL SSGDH+V++R
Sbjct  73   EGTESANVTASGMGAITAVILQLCSSGDHLVSSR  106



>gb|EAR15507.1| cystathionine beta-lyase [Robiginitalea biformata HTCC2501]
Length=417

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 64/94 (68%), Gaps = 3/94 (3%)
 Frame = +2

Query  233  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  412
            FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH +P+ L +   +AA+
Sbjct  26   FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNTEGCYLYSRHSSPSNLYLGEALAAL  82

Query  413  EGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            EGTE+A  TASGM AI++V+ QL SSGDH+V++R
Sbjct  83   EGTESANVTASGMGAITAVILQLCSSGDHLVSSR  116



>ref|WP_020897041.1| O-acetylhomoserine sulfhydrylase [Winogradskyella psychrotolerans]
 gb|EPR74512.1| O-acetylhomoserine sulfhydrylase [Winogradskyella psychrotolerans 
RS-3]
Length=399

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/109 (45%), Positives = 68/109 (62%), Gaps = 4/109 (4%)
 Frame = +2

Query  188  MWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRH  367
            M   PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G  +  ++YSRH
Sbjct  1    MTFKPANNIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNADGCYLYSRH  56

Query  368  FNPTVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
             +P+ L +   +AAMEGTE A  TASGM AI+ V+ QL  +GDHVV++R
Sbjct  57   SSPSNLYLGEALAAMEGTETATVTASGMGAITPVLLQLCDAGDHVVSSR  105



>ref|WP_028584498.1| cystathionine beta-lyase [Desulfobulbus mediterraneus]
Length=404

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 70/107 (65%), Gaps = 3/107 (3%)
 Frame = +2

Query  191  WEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHF  370
            + +P  AL       GEHGGV  SI  S+TF V +PES+  +FSGE     D F+YSR F
Sbjct  3    FHNPEQALEQCSRTLGEHGGVAPSISRSSTFVVDDPESMAALFSGE---REDGFLYSRSF  59

Query  371  NPTVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAA  511
            NPTV  + R +AA+E TEAA  TASGM+AI++ + QL   GDH+VA+
Sbjct  60   NPTVNVLCRSLAALEATEAAMGTASGMAAIATTLLQLCRHGDHIVAS  106



>ref|WP_020214240.1| cystathionine beta-lyase [Flavobacterium rivuli]
 gb|KGO86542.1| cystathionine beta-lyase [Flavobacterium rivuli WB 3.3-2 = DSM 
21788]
Length=408

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 69/106 (65%), Gaps = 4/106 (4%)
 Frame = +2

Query  197  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNP  376
            +PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G  +  ++YSRH +P
Sbjct  5    NPADNIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNADGCYLYSRHSSP  60

Query  377  TVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            + L + + +AAMEGTE A  TASGM AI++ + QL  SGDH+V++R
Sbjct  61   SNLYLGQALAAMEGTETANVTASGMGAITTALLQLCHSGDHIVSSR  106



>ref|WP_007093497.1| cystathionine beta-lyase [Kordia algicida]
 gb|EDP94427.1| methionine gamma-lyase [Kordia algicida OT-1]
Length=404

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 69/109 (63%), Gaps = 4/109 (4%)
 Frame = +2

Query  188  MWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRH  367
            M  +PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G  +  ++YSRH
Sbjct  1    MKFNPANNIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNADGCYLYSRH  56

Query  368  FNPTVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
             +P+ L +   +AAMEGTE A  +ASGM AI+ V+ QL  SGDH+V++R
Sbjct  57   SSPSNLYLGEALAAMEGTETANVSASGMGAITPVLLQLCKSGDHIVSSR  105



>ref|WP_038264494.1| cystathionine beta-lyase [Zhouia amylolytica]
 gb|ETN95824.1| cystathionine beta-lyase [Zhouia amylolytica AD3]
Length=399

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/105 (45%), Positives = 66/105 (63%), Gaps = 4/105 (4%)
 Frame = +2

Query  200  PAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPT  379
            PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH +P+
Sbjct  5    PADKIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNTEGCYLYSRHSSPS  60

Query  380  VLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
             L +   +AAMEGTE A  TASGM AI++V+ QL  +GDH+V +R
Sbjct  61   NLYLGEALAAMEGTETANVTASGMGAITAVIMQLCGTGDHIVTSR  105



>ref|WP_035664548.1| cystathionine beta-lyase, partial [Flavobacterium sp. ACAM 123]
Length=390

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/94 (46%), Positives = 62/94 (66%), Gaps = 3/94 (3%)
 Frame = +2

Query  233  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  412
            FGE GGVN SI  S+T+T +  +++   F G +      ++YSRH +P+ L + R MAAM
Sbjct  15   FGEFGGVNPSISDSSTYTFLSAKTMFDTFEGNM---EGCYLYSRHSSPSNLYLDRAMAAM  71

Query  413  EGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            EGTE A  +ASGM AI+  + QL  +GDH+V++R
Sbjct  72   EGTETANVSASGMGAITPTLMQLCGAGDHIVSSR  105



>ref|WP_007138646.1| cystathionine beta-lyase [Flavobacterium frigoris]
 gb|EIA08747.1| O-acetylhomoserine sulfhydrylase / O-succinylhomoserine sulfhydrylase 
[Flavobacterium frigoris PS1]
Length=399

 Score = 85.1 bits (209),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 69/109 (63%), Gaps = 4/109 (4%)
 Frame = +2

Query  188  MWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRH  367
            M  +PA  +   ++ FGE GGVN SI  S+T+T +  +++   F G +      ++YSRH
Sbjct  1    MKFNPADNIQDLQY-FGEFGGVNPSISDSSTYTFLSAKTMFDTFEGNM---EGCYLYSRH  56

Query  368  FNPTVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
             +P+ L + + MAAMEGTE A  +ASGM AI+  + QL  +GDH+V++R
Sbjct  57   SSPSNLYLDKAMAAMEGTETANVSASGMGAITPTLLQLCGAGDHIVSSR  105



>ref|WP_039118922.1| cystathionine beta-lyase [Flavobacterium sp. JRM]
 gb|KIC01293.1| cystathionine beta-lyase [Flavobacterium sp. JRM]
Length=407

 Score = 85.1 bits (209),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 44/105 (42%), Positives = 68/105 (65%), Gaps = 4/105 (4%)
 Frame = +2

Query  200  PAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPT  379
            PA  +   ++ FGE GGVN SI  S+T+T +  +++   F G +      ++YSRH +P+
Sbjct  6    PANCIQDLQY-FGEFGGVNPSISDSSTYTFLSAKTMSDTFEGNI---EGCYLYSRHSSPS  61

Query  380  VLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
             L + + +AAMEGTE A  +ASGM AI+  + QL S+GDH+V++R
Sbjct  62   NLYLDQALAAMEGTETANVSASGMGAITPTLMQLCSAGDHIVSSR  106



>ref|WP_026992162.1| cystathionine beta-lyase [Flavobacterium subsaxonicum]
 gb|KGO94782.1| cystathionine beta-lyase [Flavobacterium subsaxonicum WB 4.1-42 
= DSM 21790]
Length=407

 Score = 85.1 bits (209),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 69/106 (65%), Gaps = 4/106 (4%)
 Frame = +2

Query  197  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNP  376
            +PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH +P
Sbjct  5    NPADNIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNAEGCYLYSRHSSP  60

Query  377  TVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            + L +S+ +AAMEGTEAA   ASGM AI++ + QL  +GDH+V++R
Sbjct  61   SNLYLSQALAAMEGTEAANVAASGMGAITTTLLQLCKAGDHIVSSR  106



>ref|WP_019669934.1| cystathionine beta-lyase [Eudoraea adriatica]
Length=408

 Score = 85.1 bits (209),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 63/96 (66%), Gaps = 3/96 (3%)
 Frame = +2

Query  227  HEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMA  406
            H FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH +P+ L +   +A
Sbjct  13   HNFGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNTEGCYLYSRHSSPSNLYLGEALA  69

Query  407  AMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            A+EGTE A  TASGM AI++V+ QL +S DH+V++R
Sbjct  70   ALEGTETANVTASGMGAITAVILQLCNSEDHIVSSR  105



>ref|WP_026815273.1| cystathionine beta-lyase [Arenibacter certesii]
Length=399

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 44/94 (47%), Positives = 62/94 (66%), Gaps = 3/94 (3%)
 Frame = +2

Query  233  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  412
            FGE+GGVN SI  S+T+T +   S + MF    G     ++YSRH +P+ L +   +AA+
Sbjct  15   FGEYGGVNPSISDSSTYTFL---SAKTMFDTFEGNTEGCYLYSRHSSPSNLYLGEALAAL  71

Query  413  EGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            EGTE A  T SGM AI+SV+ QL  +GDH+V++R
Sbjct  72   EGTETANVTGSGMGAITSVILQLCDAGDHIVSSR  105



>ref|WP_039107807.1| cystathionine beta-lyase [Flavobacterium sp. AED]
 gb|KIA86450.1| cystathionine beta-lyase [Flavobacterium sp. AED]
Length=408

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 68/106 (64%), Gaps = 4/106 (4%)
 Frame = +2

Query  197  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNP  376
            +PA  +   ++ FGE GGVN SI  S+T+T +  +++   F G +      ++YSRH +P
Sbjct  5    NPADNIQDLQY-FGEFGGVNPSISDSSTYTFLSAKTMFDTFEGNM---EGCYLYSRHSSP  60

Query  377  TVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            + L + + +AAMEGTE A  +ASGM AI+  + QL  SGDH+V++R
Sbjct  61   SNLYLDKALAAMEGTETANVSASGMGAITPTLLQLCGSGDHIVSSR  106



>ref|WP_039113897.1| cystathionine beta-lyase [Flavobacterium sp. KMS]
 gb|KIA97550.1| cystathionine beta-lyase [Flavobacterium sp. KMS]
Length=407

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 44/105 (42%), Positives = 68/105 (65%), Gaps = 4/105 (4%)
 Frame = +2

Query  200  PAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPT  379
            PA  +   ++ FGE GGVN SI  S+T+T +  +++   F G +      ++YSRH +P+
Sbjct  6    PANCIQDLQY-FGEFGGVNPSISDSSTYTFLSAKTMSDTFEGNI---EGCYLYSRHSSPS  61

Query  380  VLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
             L + + +AAMEGTE A  +ASGM AI+  + QL S+GDH+V++R
Sbjct  62   NLYLDQALAAMEGTETANVSASGMGAITPTLMQLCSAGDHIVSSR  106



>ref|WP_035626372.1| cystathionine beta-lyase [Flavobacterium hydatis]
 gb|KFF11245.1| cystathionine beta-lyase [Flavobacterium hydatis]
Length=407

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 44/105 (42%), Positives = 68/105 (65%), Gaps = 4/105 (4%)
 Frame = +2

Query  200  PAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPT  379
            PA  +   ++ FGE GGVN SI  S+T+T +  +++   F G +      ++YSRH +P+
Sbjct  6    PANCIQDLQY-FGEFGGVNPSISDSSTYTFLSAKTMSDTFEGNM---EGCYLYSRHSSPS  61

Query  380  VLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
             L + + +AAMEGTE A  +ASGM AI+  + QL S+GDH+V++R
Sbjct  62   NLYLDQALAAMEGTETANVSASGMGAITPTLMQLCSAGDHIVSSR  106



>ref|WP_036123108.1| cystathionine beta-lyase [Mangrovimonas yunxiaonensis]
 gb|KFB00994.1| cystathionine beta-lyase [Mangrovimonas yunxiaonensis]
Length=401

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/109 (45%), Positives = 68/109 (62%), Gaps = 4/109 (4%)
 Frame = +2

Query  188  MWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRH  367
            M   PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G  +  ++YSRH
Sbjct  1    MAFKPANNIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNADGCYLYSRH  56

Query  368  FNPTVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
             +P+ L +   +AAMEGTE A  TASGM AI+ V+ QL  +GDHVV++R
Sbjct  57   SSPSNLYLGEALAAMEGTETATVTASGMGAITPVIMQLCGAGDHVVSSR  105



>ref|WP_031453699.1| cystathionine beta-lyase [Flavobacterium chungangense]
Length=400

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 68/106 (64%), Gaps = 4/106 (4%)
 Frame = +2

Query  197  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNP  376
            +PA  +   ++ FGE GGVN SI  S+T+T +  +++   F G +      ++YSRH +P
Sbjct  5    NPADKIQDLQY-FGEFGGVNPSISDSSTYTFLSAKTMFDTFEGNM---EGCYLYSRHSSP  60

Query  377  TVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            + L + + +AAMEGTE A  +ASGM AI+  + QL  SGDH+V++R
Sbjct  61   SNLYLDQALAAMEGTETANVSASGMGAITPTLLQLCGSGDHIVSSR  106



>ref|WP_011710043.1| cystathionine beta-lyase [Gramella forsetii]
 emb|CAL67140.1| methionine gamma-lyase [Gramella forsetii KT0803]
Length=404

 Score = 84.7 bits (208),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 68/109 (62%), Gaps = 4/109 (4%)
 Frame = +2

Query  188  MWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRH  367
            M   PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH
Sbjct  1    MKYKPADRIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNAEGCYLYSRH  56

Query  368  FNPTVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
             +P+ L +   +AAMEGTE A  +ASGM AI+SV+ QL ++GDH+V +R
Sbjct  57   SSPSNLYLGEALAAMEGTETANVSASGMGAITSVLMQLCNAGDHIVCSR  105



>ref|WP_036153848.1| cystathionine beta-lyase [Maribacter forsetii]
Length=406

 Score = 84.7 bits (208),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 43/94 (46%), Positives = 65/94 (69%), Gaps = 3/94 (3%)
 Frame = +2

Query  233  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  412
            FGE+GGVN SI  S+T+T +   S + MF    G     ++YSRH +P+ L +   +AA+
Sbjct  15   FGEYGGVNPSISDSSTYTFI---SAKTMFDTFEGNTEGCYLYSRHSSPSNLYLGEALAAL  71

Query  413  EGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            EGTE+A  TASGM AI++V+ QL ++GDH++++R
Sbjct  72   EGTESANVTASGMGAITAVILQLCNAGDHIISSR  105



>ref|WP_024980967.1| cystathionine beta-lyase [Flavobacterium succinicans]
Length=400

 Score = 84.7 bits (208),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 68/106 (64%), Gaps = 4/106 (4%)
 Frame = +2

Query  197  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNP  376
            +PA  +   ++ FGE GGVN SI  S+T+T +  +++   F G +      ++YSRH +P
Sbjct  5    NPADNIQDLQY-FGEFGGVNPSISDSSTYTFLSAKTMFDTFEGNM---EGCYLYSRHSSP  60

Query  377  TVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            + L + + +AAMEGTEAA   ASGM AI+  + QL  SGDH+V++R
Sbjct  61   SNLYLDQAIAAMEGTEAANVAASGMGAITPTLLQLCGSGDHIVSSR  106



>ref|WP_027878816.1| cystathionine beta-lyase [Mesoflavibacter zeaxanthinifaciens]
Length=399

 Score = 84.7 bits (208),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 67/105 (64%), Gaps = 4/105 (4%)
 Frame = +2

Query  200  PAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPT  379
            PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G  +  ++YSRH +P+
Sbjct  5    PANNIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNADGCYLYSRHSSPS  60

Query  380  VLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
             L +   +AAMEGTE A  TASGM AI+ V+ QL  +GDHVV++R
Sbjct  61   NLYLGEALAAMEGTETANVTASGMGAITPVIMQLCGAGDHVVSSR  105



>ref|WP_008634437.1| cystathionine beta-lyase [Bizionia argentinensis]
 gb|EGV44880.1| cys/Met metabolism PLP-dependent enzyme family protein [Bizionia 
argentinensis JUB59]
Length=399

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 61/94 (65%), Gaps = 3/94 (3%)
 Frame = +2

Query  233  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  412
            FGE GGVN SI  S+T+T +   S + MF    G  +  ++YSRH  P+ L +   +AAM
Sbjct  15   FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNADGCYLYSRHSTPSNLYLGEALAAM  71

Query  413  EGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            EGTE A  TASGM AI+ V+ QL  +GDHVV++R
Sbjct  72   EGTETATVTASGMGAITPVIMQLCGAGDHVVSSR  105



>dbj|GAL77579.1| O-acetylhomoserine sulfhydrylase [Algibacter lectus]
Length=370

 Score = 84.0 bits (206),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 45/94 (48%), Positives = 62/94 (66%), Gaps = 3/94 (3%)
 Frame = +2

Query  233  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  412
            FGE GGVN SI  S+T+T +   S + MF    G  +  ++YSRH +P+ L +   +AAM
Sbjct  15   FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNADGCYLYSRHSSPSNLYLGEALAAM  71

Query  413  EGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            EGTE A  +ASGM AI+ V+ QL  SGDH+V++R
Sbjct  72   EGTETANVSASGMGAITPVLLQLCDSGDHIVSSR  105



>ref|WP_036827174.1| cystathionine beta-lyase [Polaribacter sp. Hel1_85]
 gb|KGL58828.1| O-acetylhomoserine sulfhydrylase / O-succinylhomoserine sulfhydrylase 
[Polaribacter sp. Hel1_85]
Length=399

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 69/109 (63%), Gaps = 4/109 (4%)
 Frame = +2

Query  188  MWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRH  367
            M  +PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G  +  ++YSRH
Sbjct  1    MKFNPADKIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNADGCYLYSRH  56

Query  368  FNPTVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
              P+ L++   +AAMEGTE A  +ASGM AI+ V+ QL  +GDH+V++R
Sbjct  57   STPSNLHLGEALAAMEGTETANVSASGMGAITPVLMQLCGAGDHIVSSR  105



>ref|WP_008615133.1| cystathionine beta-lyase [Joostella marina]
 gb|EIJ40669.1| cystathionine beta-lyase/cystathionine gamma-synthase [Joostella 
marina DSM 19592]
Length=400

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 70/109 (64%), Gaps = 4/109 (4%)
 Frame = +2

Query  188  MWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRH  367
            M  +PA A+   ++ FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH
Sbjct  1    MKFNPADAIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNTEGCYLYSRH  56

Query  368  FNPTVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
             +P+ L +   +AA+EGTE A  TASGM AI++V+ QL ++ DH+V++R
Sbjct  57   SSPSNLYLGEALAALEGTETANVTASGMGAITAVIMQLCNTNDHIVSSR  105



>ref|WP_042244621.1| cystathionine beta-lyase [Jejuia pallidilutea]
 dbj|GAL67901.1| O-acetylhomoserine sulfhydrylase [Jejuia pallidilutea]
 dbj|GAL73160.1| O-acetylhomoserine sulfhydrylase [Jejuia pallidilutea]
 dbj|GAL89345.1| O-acetylhomoserine sulfhydrylase [Jejuia pallidilutea]
Length=401

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 70/109 (64%), Gaps = 4/109 (4%)
 Frame = +2

Query  188  MWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRH  367
            M   PA ++   ++ FGE GGVN SI  S+T+T +   S + MF    G  +  ++YSRH
Sbjct  1    MSFKPANSIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNADGCYLYSRH  56

Query  368  FNPTVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
             +P+ L +   +AAME TE A  TASGM AI+SVM QL ++GDH++++R
Sbjct  57   SSPSNLYLGAALAAMEHTETANVTASGMGAITSVMLQLCNAGDHIISSR  105



>ref|WP_042506508.1| cystathionine beta-lyase [Algibacter lectus]
 dbj|GAL64703.1| O-acetylhomoserine sulfhydrylase [Algibacter lectus]
Length=400

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 68/109 (62%), Gaps = 4/109 (4%)
 Frame = +2

Query  188  MWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRH  367
            M   PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G  +  ++YSRH
Sbjct  1    MAFKPANNIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNADGCYLYSRH  56

Query  368  FNPTVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
             +P+ L +   +AAMEGTE A  +ASGM AI+ V+ QL  SGDH+V++R
Sbjct  57   SSPSNLYLGEALAAMEGTETANVSASGMGAITPVLLQLCGSGDHIVSSR  105



>ref|WP_042719927.1| cystathionine beta-lyase [Flavobacterium sp. B17]
Length=408

 Score = 84.3 bits (207),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 45/94 (48%), Positives = 62/94 (66%), Gaps = 3/94 (3%)
 Frame = +2

Query  233  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  412
            FGE GGVN SI  S+T+T +   S + MF    G  +  ++YSRH +P  L +S+ +A M
Sbjct  16   FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNADGCYLYSRHSSPMNLYLSQALAKM  72

Query  413  EGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            E TE A  TASGM AI+SV+ QL  SGDH++++R
Sbjct  73   ENTETANVTASGMGAITSVLLQLCKSGDHIISSR  106



>ref|WP_014387952.1| cystathionine beta-lyase [Flavobacterium indicum]
 emb|CCG52810.1| Cys/Met metabolism PLP-dependent enzyme [Flavobacterium indicum 
GPTSA100-9 = DSM 17447]
Length=400

 Score = 84.3 bits (207),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 67/106 (63%), Gaps = 4/106 (4%)
 Frame = +2

Query  197  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNP  376
            +PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH +P
Sbjct  5    NPADKIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNAEGCYLYSRHSSP  60

Query  377  TVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
              L + + +AAMEGTEAA   ASGM AI+ V+ QL  +GDH+V++R
Sbjct  61   MNLYLGQALAAMEGTEAANVAASGMGAITPVLLQLCGAGDHIVSSR  106



>ref|WP_007646642.1| O-acetylhomoserine sulfhydrylase [Formosa sp. AK20]
 gb|EMQ96487.1| O-acetylhomoserine sulfhydrylase [Formosa sp. AK20]
Length=399

 Score = 84.3 bits (207),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 49/109 (45%), Positives = 68/109 (62%), Gaps = 4/109 (4%)
 Frame = +2

Query  188  MWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRH  367
            M   PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G  +  ++YSRH
Sbjct  1    MAFKPANNIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNADGCYLYSRH  56

Query  368  FNPTVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
             +P+ L +   +AAMEGTE A  TASGM AI+ V+ QL  +GDHVV++R
Sbjct  57   SSPSNLYLGEALAAMEGTETANVTASGMGAITPVIMQLCGAGDHVVSSR  105



>ref|WP_037324572.1| cystathionine beta-lyase [Salinimicrobium terrae]
Length=407

 Score = 84.3 bits (207),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 45/105 (43%), Positives = 66/105 (63%), Gaps = 4/105 (4%)
 Frame = +2

Query  200  PAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPT  379
            PA  +   ++ FGE GGVN SI  S+T+T +  +++   F G+       ++YSRH +P+
Sbjct  5    PANKIQDLQY-FGEFGGVNPSISDSSTYTFLSAKTMFDTFEGDA---EGCYLYSRHSSPS  60

Query  380  VLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
             L +   +AAMEGTEAA   ASGM AI+ V+ QL   GDHV+++R
Sbjct  61   NLYLGEALAAMEGTEAANVAASGMGAITPVLLQLCQGGDHVISSR  105



>ref|WP_035130855.1| cystathionine beta-lyase [Flavobacterium beibuense]
 gb|KGO83455.1| cystathionine beta-lyase [Flavobacterium beibuense F44-8]
Length=399

 Score = 84.0 bits (206),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 69/109 (63%), Gaps = 4/109 (4%)
 Frame = +2

Query  188  MWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRH  367
            M  +PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G  +  ++YSRH
Sbjct  1    MKFNPADNIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNADGCYLYSRH  56

Query  368  FNPTVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
             +P+ L + + +AAMEGTE A   ASGM AI+ V+ QL  +GDH+V++R
Sbjct  57   SSPSNLYLGQALAAMEGTETANVAASGMGAITPVLLQLCGAGDHIVSSR  105



>ref|WP_027377153.1| cystathionine beta-lyase [Chryseobacterium palustre]
Length=400

 Score = 84.0 bits (206),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 44/94 (47%), Positives = 61/94 (65%), Gaps = 3/94 (3%)
 Frame = +2

Query  233  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  412
            FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH +P+ L +   +A M
Sbjct  16   FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNTEGCYLYSRHSSPSNLYLGEALAQM  72

Query  413  EGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            EGTE+A  TASGM AI+S + QL  SGDH++++R
Sbjct  73   EGTESANVTASGMGAITSTLLQLCKSGDHIISSR  106



>ref|WP_019387558.1| cystathionine beta-lyase [Arenitalea lutea]
Length=400

 Score = 84.0 bits (206),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 69/109 (63%), Gaps = 4/109 (4%)
 Frame = +2

Query  188  MWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRH  367
            M   PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G  +  ++YSRH
Sbjct  1    MAFKPANNIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNADGCYLYSRH  56

Query  368  FNPTVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
             +P+ L +   +AAMEGTE A  +ASGM AI+ V+ QL S+GDH+V++R
Sbjct  57   SSPSNLYLGEALAAMEGTETANVSASGMGAITPVIMQLCSAGDHIVSSR  105



>ref|WP_026915592.1| cystathionine beta-lyase [Gramella portivictoriae]
Length=404

 Score = 84.0 bits (206),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 68/109 (62%), Gaps = 4/109 (4%)
 Frame = +2

Query  188  MWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRH  367
            M   PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH
Sbjct  1    MKYKPADRIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNAEGCYLYSRH  56

Query  368  FNPTVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
             +P+ L +   +AAMEGTE+A   ASGM AI+SV+ QL ++GDH+V +R
Sbjct  57   SSPSNLYLGEALAAMEGTESANVAASGMGAITSVLMQLCNAGDHIVCSR  105



>ref|WP_013870851.1| cystathionine beta-lyase [Lacinutrix sp. 5H-3-7-4]
 gb|AEH02072.1| Cys/Met metabolism pyridoxal-phosphate-dependent protein [Lacinutrix 
sp. 5H-3-7-4]
Length=404

 Score = 84.0 bits (206),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 49/109 (45%), Positives = 67/109 (61%), Gaps = 4/109 (4%)
 Frame = +2

Query  188  MWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRH  367
            M   PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G  +  ++YSRH
Sbjct  1    MAFKPANNIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNADGCYLYSRH  56

Query  368  FNPTVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
              P+ L +   +AAMEGTE A  TASGM AI+ V+ QL  +GDHVV++R
Sbjct  57   STPSNLYLGEALAAMEGTETANVTASGMGAITPVIMQLCGAGDHVVSSR  105



>ref|WP_008991878.1| cystathionine beta-lyase [Galbibacter marinus]
 gb|EKF54929.1| cystathionine beta-lyase [Galbibacter marinus]
Length=399

 Score = 84.0 bits (206),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 68/109 (62%), Gaps = 4/109 (4%)
 Frame = +2

Query  188  MWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRH  367
            M   PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH
Sbjct  1    MKFKPANNIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNTEGCYLYSRH  56

Query  368  FNPTVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
             +P+ L +   +AAME TE A  TASGM AI++ +FQL ++GDH+V++R
Sbjct  57   SSPSNLYLGEALAAMENTETANVTASGMGAITATIFQLCNAGDHIVSSR  105



>ref|WP_026704856.1| cystathionine beta-lyase [Flavobacterium soli]
Length=405

 Score = 84.0 bits (206),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 68/106 (64%), Gaps = 4/106 (4%)
 Frame = +2

Query  197  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNP  376
            +PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH +P
Sbjct  5    NPADNIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNAEGCYLYSRHSSP  60

Query  377  TVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            + L + + +AAMEGTE+A  +ASGM AI+  + QL  SGDH+V++R
Sbjct  61   SNLYLDKALAAMEGTESANVSASGMGAITPTLLQLCGSGDHIVSSR  106



>ref|WP_028290818.1| cystathionine beta-lyase [Olleya sp. VCSA23]
Length=399

 Score = 84.0 bits (206),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 66/109 (61%), Gaps = 4/109 (4%)
 Frame = +2

Query  188  MWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRH  367
            M   PA  +   ++ FGE GGVN SI  S+T+T +  +++   F G     +  ++YSRH
Sbjct  1    MTFKPANNIQDLQY-FGEFGGVNPSISDSSTYTFLSAKTMFDTFEGNA---DGCYLYSRH  56

Query  368  FNPTVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
              P+ L +   +AAMEGTE A  TASGM AI+ V+ QL   GDH+V++R
Sbjct  57   STPSNLYLGEALAAMEGTETANVTASGMGAITPVIMQLCGQGDHIVSSR  105



>ref|WP_035671447.1| cystathionine beta-lyase [Flavobacterium sp. 83]
Length=401

 Score = 84.0 bits (206),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 43/106 (41%), Positives = 68/106 (64%), Gaps = 4/106 (4%)
 Frame = +2

Query  197  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNP  376
            +PA  +   ++ FGE GGVN SI  S+T+T +  +++   F G +      ++YSRH +P
Sbjct  5    NPADNIQDLQY-FGEFGGVNPSISDSSTYTFLSAKTMFDTFEGNM---EGCYLYSRHSSP  60

Query  377  TVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            + L + + +AAMEGTE A  +ASGM AI+  + QL  +GDH+V++R
Sbjct  61   SNLYLDKALAAMEGTETANVSASGMGAITPTLLQLCGTGDHIVSSR  106



>ref|WP_028606171.1| cystathionine beta-lyase [Olleya sp. VCSM12]
Length=399

 Score = 83.6 bits (205),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 66/109 (61%), Gaps = 4/109 (4%)
 Frame = +2

Query  188  MWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRH  367
            M   PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G  +  ++YSRH
Sbjct  1    MTFKPANNIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNADGCYLYSRH  56

Query  368  FNPTVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
              P+ L +   +AAMEGTE A  TASGM AI+ V+ QL   GDH+V++R
Sbjct  57   STPSNLYLGEALAAMEGTETANVTASGMGAITPVIMQLCGQGDHIVSSR  105



>ref|WP_044639103.1| cystathionine beta-lyase [Siansivirga zeaxanthinifaciens]
 gb|AJR04387.1| cystathionine beta-lyase [Siansivirga zeaxanthinifaciens CC-SAMT-1]
Length=400

 Score = 83.6 bits (205),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 45/105 (43%), Positives = 68/105 (65%), Gaps = 4/105 (4%)
 Frame = +2

Query  200  PAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPT  379
            PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G  +  ++YSRH +P+
Sbjct  6    PANKIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNADGCYLYSRHSSPS  61

Query  380  VLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
             L +   +AAMEGTE A  +ASGM AI++V+ Q+  SGDH++++R
Sbjct  62   NLYLGEALAAMEGTETANVSASGMGAITAVLMQICGSGDHIISSR  106



>ref|WP_044048288.1| cystathionine beta-lyase, partial [Flavobacterium johnsoniae]
Length=400

 Score = 83.6 bits (205),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 43/106 (41%), Positives = 68/106 (64%), Gaps = 4/106 (4%)
 Frame = +2

Query  197  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNP  376
            +PA  +   ++ FGE GGVN SI  S+T+T +  +++   F G +      ++YSRH +P
Sbjct  5    NPADKIQDLQY-FGEFGGVNPSISDSSTYTFLSAKTMFDTFEGNM---EGCYLYSRHSSP  60

Query  377  TVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            + L + + +AAMEGTE A  +ASGM AI+  + QL  +GDH+V++R
Sbjct  61   SNLYLDQALAAMEGTETANVSASGMGAITPTLLQLCGAGDHIVSSR  106



>ref|WP_037320529.1| cystathionine beta-lyase [Salegentibacter sp. Hel_I_6]
Length=404

 Score = 83.6 bits (205),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 66/109 (61%), Gaps = 4/109 (4%)
 Frame = +2

Query  188  MWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRH  367
            M   PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH
Sbjct  1    MKYKPADNIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNSEGCYLYSRH  56

Query  368  FNPTVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
             +P+ L +   +AAMEGTE A   ASGM AI+S + QL  +GDH+V++R
Sbjct  57   SSPSNLYLGEALAAMEGTETANVAASGMGAITSTLLQLCQAGDHIVSSR  105



>ref|WP_004569139.1| cystathionine beta-lyase [Polaribacter irgensii]
 gb|EAR13342.1| methionine gamma-lyase [Polaribacter irgensii 23-P]
Length=399

 Score = 83.6 bits (205),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 67/109 (61%), Gaps = 4/109 (4%)
 Frame = +2

Query  188  MWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRH  367
            M  +PA  +   ++ FGE GGVN SI  S+T+T M   ++R  F G     +   +Y+RH
Sbjct  1    MKFNPADNIQDVQY-FGEFGGVNPSISDSSTYTFMSANTMRDTFEGN---TDGCHLYARH  56

Query  368  FNPTVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
              P+ L +   +AAMEGTE A   ASGM AI+ V+ QL+ +G+H+V++R
Sbjct  57   TTPSNLYLGAALAAMEGTETANVAASGMGAITPVLLQLVGAGEHIVSSR  105



>ref|WP_015480967.1| cystathionine beta-lyase [Polaribacter sp. MED152]
 gb|EAQ42254.1| Cys/Met metabolism PLP-dependent enzyme [Polaribacter sp. MED152]
Length=399

 Score = 83.6 bits (205),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 67/109 (61%), Gaps = 4/109 (4%)
 Frame = +2

Query  188  MWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRH  367
            M  +PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G  +  ++YSRH
Sbjct  1    MSYNPADKIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNADGCYLYSRH  56

Query  368  FNPTVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
              P+ L +   +AAMEGTE A  TASGM AI+ V+ QL  + DH++++R
Sbjct  57   STPSNLYLGEALAAMEGTETANVTASGMGAITPVLLQLCGANDHIISSR  105



>ref|WP_041519168.1| cystathionine beta-lyase [Flavobacterium hibernum]
 gb|KIO51666.1| cystathionine beta-lyase [Flavobacterium hibernum]
Length=400

 Score = 83.6 bits (205),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 43/106 (41%), Positives = 68/106 (64%), Gaps = 4/106 (4%)
 Frame = +2

Query  197  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNP  376
            +PA  +   ++ FGE GGVN SI  S+T+T +  +++   F G +      ++YSRH +P
Sbjct  5    NPADKIQDLQY-FGEFGGVNPSISDSSTYTFLSAKTMFDTFEGNM---EGCYLYSRHSSP  60

Query  377  TVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            + L + + +AAMEGTE A  +ASGM AI+  + QL  +GDH+V++R
Sbjct  61   SNLYLDQALAAMEGTETANVSASGMGAITPTLLQLCGAGDHIVSSR  106



>ref|WP_035666777.1| cystathionine beta-lyase, partial [Flavobacterium sp. KJJ]
Length=400

 Score = 83.6 bits (205),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 43/106 (41%), Positives = 68/106 (64%), Gaps = 4/106 (4%)
 Frame = +2

Query  197  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNP  376
            +PA  +   ++ FGE GGVN SI  S+T+T +  +++   F G +      ++YSRH +P
Sbjct  5    NPADKIQDLQY-FGEFGGVNPSISDSSTYTFLSAKTMFDTFEGNM---EGCYLYSRHSSP  60

Query  377  TVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            + L + + +AAMEGTE A  +ASGM AI+  + QL  +GDH+V++R
Sbjct  61   SNLYLDQALAAMEGTETANVSASGMGAITPTLLQLCGAGDHIVSSR  106



>ref|WP_026708059.1| cystathionine beta-lyase [Flavobacterium frigidarium]
Length=400

 Score = 83.6 bits (205),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 43/106 (41%), Positives = 68/106 (64%), Gaps = 4/106 (4%)
 Frame = +2

Query  197  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNP  376
            +PA  +   ++ FGE GGVN SI  S+T+T +  +++   F G +      ++YSRH +P
Sbjct  5    NPADNIQDLQY-FGEFGGVNPSISDSSTYTFLSAKTMFDTFEGNM---EGCYLYSRHSSP  60

Query  377  TVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            + L + + +AAMEGTE A  +ASGM AI+  + QL  +GDH+V++R
Sbjct  61   SNLYLDKALAAMEGTETANVSASGMGAITPTLLQLCGAGDHIVSSR  106



>gb|ABQ05159.1| Cystathionine gamma-synthase [Flavobacterium johnsoniae UW101]
Length=414

 Score = 83.6 bits (205),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 43/106 (41%), Positives = 68/106 (64%), Gaps = 4/106 (4%)
 Frame = +2

Query  197  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNP  376
            +PA  +   ++ FGE GGVN SI  S+T+T +  +++   F G +      ++YSRH +P
Sbjct  5    NPADKIQDLQY-FGEFGGVNPSISDSSTYTFLSAKTMFDTFEGNM---EGCYLYSRHSSP  60

Query  377  TVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            + L + + +AAMEGTE A  +ASGM AI+  + QL  +GDH+V++R
Sbjct  61   SNLYLDQALAAMEGTETANVSASGMGAITPTLLQLCGAGDHIVSSR  106



>ref|WP_017495491.1| cystathionine beta-lyase [Flavobacterium sp. WG21]
Length=408

 Score = 83.6 bits (205),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 43/106 (41%), Positives = 68/106 (64%), Gaps = 4/106 (4%)
 Frame = +2

Query  197  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNP  376
            +PA  +   ++ FGE GGVN SI  S+T+T +  +++   F G +      ++YSRH +P
Sbjct  5    NPADKIQDLQY-FGEFGGVNPSISDSSTYTFLSAKTMFDTFEGNM---EGCYLYSRHSSP  60

Query  377  TVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            + L + + +AAMEGTE A  +ASGM AI+  + QL  +GDH+V++R
Sbjct  61   SNLYLDQALAAMEGTETANVSASGMGAITPTLLQLCGAGDHIVSSR  106



>ref|WP_026811643.1| cystathionine beta-lyase [Arenibacter latericius]
Length=399

 Score = 83.6 bits (205),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 44/94 (47%), Positives = 61/94 (65%), Gaps = 3/94 (3%)
 Frame = +2

Query  233  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  412
            FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH +P+ L +   +AA+
Sbjct  15   FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNTEGCYLYSRHSSPSNLYLGEALAAL  71

Query  413  EGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            EGTE A  T SGM AI+SV+ QL  +GDH+V++R
Sbjct  72   EGTETANVTGSGMGAITSVILQLCDAGDHIVSSR  105



>ref|WP_035128700.1| cystathionine beta-lyase [Flavobacterium aquatile]
 gb|KGD66842.1| cystathionine beta-lyase [Flavobacterium aquatile LMG 4008]
Length=405

 Score = 83.6 bits (205),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 68/106 (64%), Gaps = 4/106 (4%)
 Frame = +2

Query  197  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNP  376
            +PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH +P
Sbjct  5    NPADKIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNAEGCYLYSRHSSP  60

Query  377  TVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            + L + + +AAMEGTE A  +ASGM AI+  + QL S+GDH+V++R
Sbjct  61   SNLYLDQALAAMEGTETANVSASGMGAITPTLLQLCSNGDHIVSSR  106



>ref|WP_026728807.1| cystathionine beta-lyase [Flavobacterium denitrificans]
Length=414

 Score = 83.6 bits (205),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 43/106 (41%), Positives = 68/106 (64%), Gaps = 4/106 (4%)
 Frame = +2

Query  197  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNP  376
            +PA  +   ++ FGE GGVN SI  S+T+T +  +++   F G +      ++YSRH +P
Sbjct  5    NPADKIQDLQY-FGEFGGVNPSISDSSTYTFLSAKTMFDTFEGNM---EGCYLYSRHSSP  60

Query  377  TVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            + L + + +AAMEGTE A  +ASGM AI+  + QL  +GDH+V++R
Sbjct  61   SNLYLDQALAAMEGTETANVSASGMGAITPTLLQLCGAGDHIVSSR  106



>ref|WP_029294450.1| cystathionine beta-lyase [Chryseobacterium hispalense]
Length=408

 Score = 83.6 bits (205),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 44/94 (47%), Positives = 63/94 (67%), Gaps = 3/94 (3%)
 Frame = +2

Query  233  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  412
            FGE GGVN SI  S+T+T +   S + MF    G  +  ++YSRH +P  L +S+ +A +
Sbjct  16   FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNADGCYLYSRHSSPMNLYLSQALAKL  72

Query  413  EGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            E TEAA  TASGM AI+SV+ Q+  SGDH++++R
Sbjct  73   ENTEAANVTASGMGAITSVLLQICKSGDHIISSR  106



>ref|WP_026985975.1| cystathionine beta-lyase [Flavobacterium sp. URHB0058]
Length=400

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/106 (41%), Positives = 68/106 (64%), Gaps = 4/106 (4%)
 Frame = +2

Query  197  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNP  376
            +PA  +   ++ FGE GGVN SI  S+T+T +  +++   F G +      ++YSRH +P
Sbjct  5    NPADKIQDLQY-FGEFGGVNPSISDSSTYTFLSAKTMFDTFEGNM---EGCYLYSRHSSP  60

Query  377  TVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            + L + + +AAMEGTE A  +ASGM AI+  + QL  +GDH+V++R
Sbjct  61   SNLYLDQALAAMEGTETANVSASGMGAITPTLLQLCGAGDHIVSSR  106



>ref|WP_035684485.1| cystathionine beta-lyase [Flavobacterium reichenbachii]
 gb|KFF06281.1| cystathionine beta-lyase [Flavobacterium reichenbachii]
Length=407

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/106 (41%), Positives = 68/106 (64%), Gaps = 4/106 (4%)
 Frame = +2

Query  197  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNP  376
            +PA  +   ++ FGE GGVN SI  S+T+T +  +++   F G +      ++YSRH +P
Sbjct  5    NPADKIQDLQY-FGEFGGVNPSISDSSTYTFLSAKTMFDTFEGNM---EGCYLYSRHSSP  60

Query  377  TVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            + L + + +AAMEGTE A  +ASGM AI+  + QL  +GDH+V++R
Sbjct  61   SNLYLDQALAAMEGTETANVSASGMGAITPTLLQLCGAGDHIVSSR  106



>gb|KIX21419.1| cystathionine beta-lyase [Flavobacterium sp. 316]
Length=400

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 68/106 (64%), Gaps = 4/106 (4%)
 Frame = +2

Query  197  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNP  376
            +PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH +P
Sbjct  5    NPADKIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNAEGCYLYSRHSSP  60

Query  377  TVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            + L + + +AAMEGTE+A  +ASGM AI+  + QL  +GDH+V++R
Sbjct  61   SNLYLDKALAAMEGTESANVSASGMGAITPTLLQLCENGDHIVSSR  106



>ref|WP_026716030.1| cystathionine beta-lyase [Flavobacterium gelidilacus]
Length=400

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 66/106 (62%), Gaps = 4/106 (4%)
 Frame = +2

Query  197  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNP  376
            +PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH +P
Sbjct  5    NPADNIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNAEGCYLYSRHSSP  60

Query  377  TVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            + L + R +AAMEGTE A   ASGM AI+  + QL  +GDH+V++R
Sbjct  61   SNLYLDRALAAMEGTETANVAASGMGAITPTLLQLCGNGDHIVSSR  106



>ref|WP_011963843.1| cystathionine beta-lyase [Flavobacterium psychrophilum]
 ref|YP_001296607.1| Cys/Met metabolism PLP-dependent enzyme [Flavobacterium psychrophilum 
JIP02/86]
 emb|CAL43800.1| Cys/Met metabolism PLP-dependent enzyme [Flavobacterium psychrophilum 
JIP02/86]
 gb|AIG30489.1| cystathionine beta-lyase [Flavobacterium psychrophilum]
 gb|AIG32764.1| cystathionine beta-lyase [Flavobacterium psychrophilum]
 gb|AIG34919.1| cystathionine beta-lyase [Flavobacterium psychrophilum]
 gb|AIG37284.1| cystathionine beta-lyase [Flavobacterium psychrophilum]
 gb|AIG39548.1| cystathionine beta-lyase [Flavobacterium psychrophilum]
 gb|AIG41813.1| cystathionine beta-lyase [Flavobacterium psychrophilum]
 gb|AIJ37567.1| Cystathionine gamma-synthase [Flavobacterium psychrophilum]
 gb|AIN71380.1| cystathionine beta-lyase [Flavobacterium psychrophilum FPG101]
 gb|AIN74490.1| cystathionine beta-lyase [Flavobacterium psychrophilum FPG3]
 gb|AIT65918.1| cystathionine beta-lyase [Flavobacterium psychrophilum]
Length=400

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 67/106 (63%), Gaps = 4/106 (4%)
 Frame = +2

Query  197  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNP  376
            +PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH +P
Sbjct  5    NPADKIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNAEGCYLYSRHSSP  60

Query  377  TVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            + L + R +AAMEGTE+A   ASGM AI+  + QL  +GDH+V++R
Sbjct  61   SNLYLDRALAAMEGTESANVAASGMGAITPTLLQLCGNGDHIVSSR  106



>ref|WP_042566587.1| cystathionine beta-lyase [Flavobacterium sp. MEB061]
 gb|KIQ16425.1| cystathionine beta-lyase [Flavobacterium sp. MEB061]
Length=405

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/106 (41%), Positives = 68/106 (64%), Gaps = 4/106 (4%)
 Frame = +2

Query  197  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNP  376
            +PA  +   ++ FGE GGVN SI  S+T+T +  +++   F G +      ++YSRH +P
Sbjct  5    NPADKIQDLQY-FGEFGGVNPSISDSSTYTFLSAKTMFDTFEGNM---EGCYLYSRHSSP  60

Query  377  TVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            + L + + +AAMEGTE A  +ASGM AI+  + QL  +GDH+V++R
Sbjct  61   SNLYLDQALAAMEGTETANVSASGMGAITPTLLQLCGAGDHIVSSR  106



>ref|WP_035649238.1| cystathionine beta-lyase [Flavobacterium sp. Fl]
Length=414

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/106 (41%), Positives = 68/106 (64%), Gaps = 4/106 (4%)
 Frame = +2

Query  197  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNP  376
            +PA  +   ++ FGE GGVN SI  S+T+T +  +++   F G +      ++YSRH +P
Sbjct  5    NPADKIQDLQY-FGEFGGVNPSISDSSTYTFLSAKTMFDTFEGNM---EGCYLYSRHSSP  60

Query  377  TVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            + L + + +AAMEGTE A  +ASGM AI+  + QL  +GDH+V++R
Sbjct  61   SNLYLDQALAAMEGTETANVSASGMGAITPTLLQLCGAGDHIVSSR  106



>ref|WP_007804337.1| cystathionine beta-lyase [Flavobacterium sp. CF136]
 gb|EJL66563.1| cystathionine beta-lyase/cystathionine gamma-synthase [Flavobacterium 
sp. CF136]
Length=400

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/106 (41%), Positives = 68/106 (64%), Gaps = 4/106 (4%)
 Frame = +2

Query  197  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNP  376
            +PA  +   ++ FGE GGVN SI  S+T+T +  +++   F G +      ++YSRH +P
Sbjct  5    NPADNIQDLQY-FGEFGGVNPSISDSSTYTFLSAKTMFDTFEGNI---EGCYLYSRHSSP  60

Query  377  TVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            + L + + +AAMEGTE A  +ASGM AI+  + QL  +GDH+V++R
Sbjct  61   SNLYLDQALAAMEGTETANVSASGMGAITPTLLQLCGAGDHIVSSR  106



>ref|WP_026976217.1| cystathionine beta-lyase [Flavobacterium tegetincola]
Length=400

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 66/106 (62%), Gaps = 4/106 (4%)
 Frame = +2

Query  197  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNP  376
            +PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH +P
Sbjct  5    NPADNIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNAEGCYLYSRHSSP  60

Query  377  TVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            + L + R +AAMEGTE A   ASGM AI+  + QL  +GDH+V++R
Sbjct  61   SNLYLDRALAAMEGTETANVAASGMGAITPTLLQLCGNGDHIVSSR  106



>ref|WP_034045025.1| cystathionine beta-lyase [Flaviramulus ichthyoenteri]
Length=400

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 68/109 (62%), Gaps = 4/109 (4%)
 Frame = +2

Query  188  MWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRH  367
            M   PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G  +  ++YSRH
Sbjct  1    MAFKPANNIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNADGCYLYSRH  56

Query  368  FNPTVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
             +P+ L +   +AAMEGTE A  +ASGM AI+ V+ QL  +GDH+V++R
Sbjct  57   SSPSNLYLGEALAAMEGTETANVSASGMGAITPVLLQLCGAGDHIVSSR  105



>ref|WP_039353474.1| cystathionine beta-lyase [Chryseobacterium jeonii]
 gb|KIA88204.1| cystathionine beta-lyase [Chryseobacterium jeonii]
Length=400

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/94 (46%), Positives = 60/94 (64%), Gaps = 3/94 (3%)
 Frame = +2

Query  233  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  412
            FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH  P+ L +S  +A M
Sbjct  16   FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNTEGCYLYSRHSTPSNLYLSEALAQM  72

Query  413  EGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            EGTE+A  TASGM AI+S + Q+   GDH++++R
Sbjct  73   EGTESANVTASGMGAITSTLLQICKGGDHIISSR  106



>ref|WP_036385279.1| cystathionine beta-lyase [Muricauda sp. MAR_2010_75]
Length=406

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/94 (47%), Positives = 61/94 (65%), Gaps = 3/94 (3%)
 Frame = +2

Query  233  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  412
            FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH +P+ L +   MA +
Sbjct  15   FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNTEGCYLYSRHSSPSNLYLGEAMAQL  71

Query  413  EGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            EGTE+A   ASGM AI+S++FQL  +GDH+V +R
Sbjct  72   EGTESANVFASGMGAITSIIFQLCDAGDHIVCSR  105



>ref|WP_013307125.1| cystathionine beta-lyase [Maribacter sp. HTCC2170]
 gb|EAR00240.1| cystathionine beta-lyase [Maribacter sp. HTCC2170]
Length=406

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/94 (47%), Positives = 62/94 (66%), Gaps = 3/94 (3%)
 Frame = +2

Query  233  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  412
            FGE+GGVN SI  S+T+T +   S + MF    G     ++Y+RH +P+ L +   +AA+
Sbjct  15   FGEYGGVNPSISDSSTYTFL---SAKTMFDTFEGNTEGCYLYTRHSSPSNLYLGEALAAL  71

Query  413  EGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            EGTE A  TASGM AIS+V+ QL  S DH+V++R
Sbjct  72   EGTETANVTASGMGAISAVIMQLCDSDDHIVSSR  105



>ref|WP_027137507.1| cystathionine beta-lyase [Gaetbulibacter saemankumensis]
Length=406

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 68/109 (62%), Gaps = 4/109 (4%)
 Frame = +2

Query  188  MWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRH  367
            M   PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G  +  ++YSRH
Sbjct  1    MAFKPANNIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNADGCYLYSRH  56

Query  368  FNPTVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
             +P+ L +   +AAMEGTE A  +ASGM AI+ V+ +L  SGDH+V++R
Sbjct  57   SSPSNLYLGEALAAMEGTETANVSASGMGAITPVLLELCESGDHIVSSR  105



>ref|WP_029035905.1| cystathionine beta-lyase [Salinimicrobium xinjiangense]
Length=407

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 67/109 (61%), Gaps = 4/109 (4%)
 Frame = +2

Query  188  MWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRH  367
            M   PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH
Sbjct  1    MKFKPADNIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNAEGCYLYSRH  56

Query  368  FNPTVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
             +P+ L +   +AAMEGTEAA   ASGM AI+ V+ QL  +GDH++++R
Sbjct  57   SSPSNLYLGEALAAMEGTEAANVAASGMGAITPVLLQLCQAGDHIISSR  105



>ref|WP_008272189.1| cystathionine beta-lyase [Flavobacteriales bacterium ALC-1]
 gb|EDP69802.1| methionine gamma-lyase [Flavobacteriales bacterium ALC-1]
Length=404

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 68/109 (62%), Gaps = 4/109 (4%)
 Frame = +2

Query  188  MWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRH  367
            M   PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G  +  ++YSRH
Sbjct  1    MKFKPANNIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNADGCYLYSRH  56

Query  368  FNPTVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
             +P+ L +   +AAMEGTE A  TASGM AI+ V+ QL  +G+H+V++R
Sbjct  57   SSPSNLYLGEALAAMEGTETATVTASGMGAITPVLLQLCDAGEHIVSSR  105



>ref|WP_036783245.1| cystathionine beta-lyase [Polaribacter sp. Hel1_33_49]
 gb|KGL59526.1| Cys/Met metabolism PLP-dependent enzyme [Polaribacter sp. Hel1_33_49]
Length=399

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 69/109 (63%), Gaps = 4/109 (4%)
 Frame = +2

Query  188  MWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRH  367
            M  +PA  +   ++ FGE GGVN SI  S+T+T +  +++   F G     +  ++YSRH
Sbjct  1    MKFNPADNIQDLQY-FGEFGGVNPSISDSSTYTFLSAKTMVDTFEGN---TDGCYLYSRH  56

Query  368  FNPTVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
              P+ L +   +AAMEGTE A   ASGM AI+ V+ QL+++G+H+V++R
Sbjct  57   STPSNLYLGEALAAMEGTETANVAASGMGAITPVLLQLVAAGEHIVSSR  105



>ref|WP_008257661.1| cystathionine beta-lyase [Flavobacteria bacterium BAL38]
 gb|EAZ94840.1| cystathionine beta-lyase [Flavobacteria bacterium BAL38]
Length=400

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/105 (43%), Positives = 67/105 (64%), Gaps = 4/105 (4%)
 Frame = +2

Query  200  PAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPT  379
            PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH +P+
Sbjct  6    PADKIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNTEGCYLYSRHSSPS  61

Query  380  VLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
             L + + +AAMEGTE+A  +ASGM AI+  + QL  +GDH+V++R
Sbjct  62   NLYLDKALAAMEGTESANVSASGMGAITPTLLQLCGNGDHIVSSR  106



>ref|WP_034719601.1| cystathionine beta-lyase [Chryseobacterium antarcticum]
 gb|KEY18928.1| cystathionine beta-lyase [Chryseobacterium antarcticum]
Length=400

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/94 (48%), Positives = 60/94 (64%), Gaps = 3/94 (3%)
 Frame = +2

Query  233  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  412
            FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH  P+ L +S  +A M
Sbjct  16   FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNTEGCYLYSRHSTPSNLYLSEALAQM  72

Query  413  EGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            EGTE+A  TASGM AI+S + QL  SGD +V++R
Sbjct  73   EGTESANVTASGMGAITSTLLQLCKSGDEIVSSR  106



>ref|WP_022827196.1| cystathionine beta-lyase [Flavobacterium antarcticum]
Length=400

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 66/106 (62%), Gaps = 4/106 (4%)
 Frame = +2

Query  197  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNP  376
            +PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH +P
Sbjct  5    NPADNIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNAEGCYLYSRHSSP  60

Query  377  TVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            + L + R +AAMEGTE A   ASGM AI+  + QL  +GDH+V++R
Sbjct  61   SNLYLDRALAAMEGTETANVAASGMGAITPTLLQLCGNGDHIVSSR  106



>ref|WP_026451516.1| cystathionine beta-lyase [Aequorivita capsosiphonis]
Length=399

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/105 (44%), Positives = 66/105 (63%), Gaps = 4/105 (4%)
 Frame = +2

Query  200  PAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPT  379
            PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G  +  ++YSRH  P+
Sbjct  5    PADKIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNADGCYLYSRHSTPS  60

Query  380  VLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
             L++ + +AAMEGTE A   ASGM AI+  + QL  +GDHVV++R
Sbjct  61   NLHLGQALAAMEGTETANVAASGMGAITPAILQLCQAGDHVVSSR  105



>ref|WP_040280051.1| cystathionine beta-lyase [Psychroserpens damuponensis]
Length=408

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 67/109 (61%), Gaps = 4/109 (4%)
 Frame = +2

Query  188  MWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRH  367
            M   PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G  +  ++YSRH
Sbjct  1    MAFKPANNIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNADGCYLYSRH  56

Query  368  FNPTVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
              P+ L +   +AAMEGTE A  +ASGM AI+ V+ QL  +GDHVV++R
Sbjct  57   STPSNLYLGEALAAMEGTETANVSASGMGAITPVIMQLCGAGDHVVSSR  105



>ref|WP_023572328.1| cystathionine beta-lyase [Flavobacterium enshiense]
 gb|ESU24722.1| cystathionine beta-lyase [Flavobacterium enshiense DK69]
 gb|KGO96820.1| cystathionine beta-lyase [Flavobacterium enshiense DK69]
Length=409

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 67/106 (63%), Gaps = 4/106 (4%)
 Frame = +2

Query  197  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNP  376
            +PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH +P
Sbjct  5    NPADKIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNAEGCYLYSRHSSP  60

Query  377  TVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            + L + + +AAMEGTE+A   ASGM AI+  + QL  +GDH+V++R
Sbjct  61   SNLYLDKALAAMEGTESANVAASGMGAITPTLLQLCGNGDHIVSSR  106



>ref|WP_034891363.1| cystathionine beta-lyase [Gillisia sp. Hel_I_29]
Length=404

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 67/109 (61%), Gaps = 4/109 (4%)
 Frame = +2

Query  188  MWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRH  367
            M   PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G  +  ++YSRH
Sbjct  1    MKYKPADHIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNADGCYLYSRH  56

Query  368  FNPTVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
             +P+ L +   +AAMEGTE A   ASGM AI+S + QL  +GDH+V++R
Sbjct  57   SSPSNLYLGEALAAMEGTETANVAASGMGAITSAILQLCKAGDHIVSSR  105



>ref|WP_026981459.1| cystathionine beta-lyase [Flavobacterium suncheonense]
 gb|KGO87149.1| cystathionine beta-lyase [Flavobacterium suncheonense GH29-5 
= DSM 17707]
Length=401

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 67/106 (63%), Gaps = 4/106 (4%)
 Frame = +2

Query  197  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNP  376
            +PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH +P
Sbjct  5    NPADKIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNAEGCYLYSRHSSP  60

Query  377  TVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            + L + + +AAMEGTE+A   ASGM AI+  + QL  +GDH+V++R
Sbjct  61   SNLYLDKALAAMEGTESANVAASGMGAITPTLLQLCGNGDHIVSSR  106



>ref|WP_039366244.1| cystathionine beta-lyase [Chryseobacterium taiwanense]
 gb|KIC64313.1| cystathionine beta-lyase [Chryseobacterium taiwanense]
Length=408

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/94 (47%), Positives = 62/94 (66%), Gaps = 3/94 (3%)
 Frame = +2

Query  233  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  412
            FGE GGVN SI  S+T+T +   S + MF    G  +  ++YSRH +P  L +S+ +A M
Sbjct  16   FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNADGCYLYSRHSSPMNLYLSQALAKM  72

Query  413  EGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            E TE A  TASGM AI+SV+ Q+  SGDH++++R
Sbjct  73   ENTETANVTASGMGAITSVLMQICKSGDHIISSR  106



>ref|WP_027386160.1| cystathionine beta-lyase [Chryseobacterium gregarium]
Length=408

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/94 (48%), Positives = 61/94 (65%), Gaps = 3/94 (3%)
 Frame = +2

Query  233  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  412
            FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH +P  L +S  +A M
Sbjct  16   FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNAEGCYLYSRHSSPMNLYLSEALAKM  72

Query  413  EGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            E TEAA  TASGM AI+SV+ Q+  SGDH++++R
Sbjct  73   ENTEAANVTASGMGAITSVLMQVCKSGDHIISSR  106



>ref|WP_038530974.1| cystathionine beta-lyase [Formosa agariphila]
 emb|CDF80147.1| Cys/Met metabolism PLP-dependent enzyme [Formosa agariphila KMM 
3901]
Length=400

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 68/109 (62%), Gaps = 4/109 (4%)
 Frame = +2

Query  188  MWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRH  367
            M   PA ++   ++ FGE GGVN SI  S+T+T +   S + MF    G  +  ++YSRH
Sbjct  1    MAFKPANSIQDLQY-FGEFGGVNPSISDSSTYTFI---SAKTMFDTFEGNTDGCYLYSRH  56

Query  368  FNPTVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
             +P+ L +   +AAMEGTE A   ASGM AI+SV+ Q   +GDHVV++R
Sbjct  57   SSPSNLYLGEALAAMEGTETANVYASGMGAITSVLLQNCGAGDHVVSSR  105



>gb|KFF74221.1| cystathionine beta-lyase [Chryseobacterium sp. P1-3]
Length=408

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/94 (47%), Positives = 62/94 (66%), Gaps = 3/94 (3%)
 Frame = +2

Query  233  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  412
            FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH +P  L +++ +A M
Sbjct  16   FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNAEGCYLYSRHSSPMNLYLAQALAKM  72

Query  413  EGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            E TE+A  TASGM AI+SV+ QL  SGDH++++R
Sbjct  73   ENTESANVTASGMGAITSVLMQLCKSGDHIISSR  106



>ref|WP_002980746.1| cystathionine beta-lyase [Chryseobacterium gleum]
 gb|EFK35586.1| Cys/Met metabolism PLP-dependent enzyme [Chryseobacterium gleum 
ATCC 35910]
Length=409

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/94 (47%), Positives = 62/94 (66%), Gaps = 3/94 (3%)
 Frame = +2

Query  233  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  412
            FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH +P  L +++ +A M
Sbjct  16   FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNAEGCYLYSRHSSPMNLYLAQALAKM  72

Query  413  EGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            E TE+A  TASGM AI+SV+ QL  SGDH++++R
Sbjct  73   ENTESANVTASGMGAITSVLMQLCKSGDHIISSR  106



>ref|WP_034678770.1| cystathionine beta-lyase [Chryseobacterium formosense]
 gb|KFE98207.1| cystathionine beta-lyase [Chryseobacterium formosense]
Length=409

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/94 (47%), Positives = 62/94 (66%), Gaps = 3/94 (3%)
 Frame = +2

Query  233  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  412
            FGE GGVN SI  S+T+T +   S + MF    G  +  ++YSRH +P  L +S+ +A M
Sbjct  16   FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNADGCYLYSRHSSPMNLYLSQALAKM  72

Query  413  EGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            E TE A  TASGM AI+SV+ Q+  SGDH++++R
Sbjct  73   ENTETANVTASGMGAITSVLMQVCKSGDHIISSR  106



>ref|WP_008239835.1| cystathionine beta-lyase [Imtechella halotolerans]
 gb|EID74031.1| cystathionine beta-lyase [Imtechella halotolerans K1]
Length=399

 Score = 82.4 bits (202),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 68/109 (62%), Gaps = 4/109 (4%)
 Frame = +2

Query  188  MWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRH  367
            M  +PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH
Sbjct  1    MKFNPANHIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNTEGCYLYSRH  56

Query  368  FNPTVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
             +P+ L +   +AAMEGTE A  TASGM AI++V+ QL  +G H+V++R
Sbjct  57   SSPSNLYLGEALAAMEGTETANVTASGMGAITAVIMQLCDAGSHIVSSR  105



>ref|WP_034711020.1| cystathionine beta-lyase [Chryseobacterium soli]
 gb|KFF13169.1| cystathionine beta-lyase [Chryseobacterium soli]
Length=409

 Score = 82.4 bits (202),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/94 (46%), Positives = 62/94 (66%), Gaps = 3/94 (3%)
 Frame = +2

Query  233  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  412
            FGE GGVN SI  S+T+T +   S + MF    G  +  ++YSRH +P  L +S+ +A +
Sbjct  16   FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNADGCYLYSRHSSPMNLYLSQALAKL  72

Query  413  EGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            E TE A  TASGM AI+SV+ Q+  SGDH++++R
Sbjct  73   ENTETANVTASGMGAITSVLLQICKSGDHIISSR  106



>ref|WP_040995836.1| cystathionine beta-lyase [Chryseobacterium oranimense]
 emb|CEJ69807.1| Cystathionine gamma-lyase [Chryseobacterium oranimense G311]
Length=408

 Score = 82.4 bits (202),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 44/94 (47%), Positives = 62/94 (66%), Gaps = 3/94 (3%)
 Frame = +2

Query  233  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  412
            FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH +P  L +++ +A M
Sbjct  16   FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNAEGCYLYSRHSSPMNLYLAQALAKM  72

Query  413  EGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            E TEAA  TASGM AI+SV+ Q+  SGDH++++R
Sbjct  73   ENTEAANVTASGMGAITSVLMQICKSGDHIISSR  106



>ref|WP_044624939.1| cystathionine beta-lyase [Tamlana nanhaiensis]
 gb|KJD34554.1| cystathionine beta-lyase [Tamlana nanhaiensis]
Length=399

 Score = 82.0 bits (201),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 69/109 (63%), Gaps = 4/109 (4%)
 Frame = +2

Query  188  MWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRH  367
            M   PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G  +  ++YSRH
Sbjct  1    MAFKPANNIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNADGCYLYSRH  56

Query  368  FNPTVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
             +P+ L +   +AAME TE A  TASGM AI++V+ QL ++GDH++++R
Sbjct  57   SSPSNLYLGEALAAMEDTETANVTASGMGAITAVLMQLCNAGDHIISSR  105



>ref|WP_023576634.1| cystathionine beta-lyase [Flavobacterium saliperosum]
 gb|ESU25382.1| cystathionine beta-lyase [Flavobacterium saliperosum S13]
Length=401

 Score = 82.0 bits (201),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 67/106 (63%), Gaps = 4/106 (4%)
 Frame = +2

Query  197  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNP  376
            +PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH +P
Sbjct  5    NPADRIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNAEGCYLYSRHSSP  60

Query  377  TVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            + L + + +AAMEGTE+A   ASGM AI+  + QL  +GDH+V++R
Sbjct  61   SNLYLDKALAAMEGTESANVAASGMGAITPTLLQLCGNGDHIVSSR  106



>ref|WP_023579261.1| cystathionine beta-lyase [Flavobacterium limnosediminis]
 gb|ESU28278.1| cystathionine beta-lyase [Flavobacterium limnosediminis JC2902]
Length=407

 Score = 82.0 bits (201),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 67/106 (63%), Gaps = 4/106 (4%)
 Frame = +2

Query  197  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNP  376
            +PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH +P
Sbjct  5    NPADRIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNAEGCYLYSRHSSP  60

Query  377  TVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            + L + + +AAMEGTE+A   ASGM AI+  + QL  +GDH+V++R
Sbjct  61   SNLYLDKALAAMEGTESANVAASGMGAITPTLLQLCGNGDHIVSSR  106



>ref|WP_034704868.1| cystathionine beta-lyase [Chryseobacterium luteum]
 gb|KFF03604.1| cystathionine beta-lyase [Chryseobacterium luteum]
Length=408

 Score = 82.0 bits (201),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 45/94 (48%), Positives = 62/94 (66%), Gaps = 3/94 (3%)
 Frame = +2

Query  233  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  412
            FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH +P  L +++ +A M
Sbjct  16   FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNAEGCYLYSRHSSPMNLYLAQALAKM  72

Query  413  EGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            E TEAA  TASGM AI+SV+ Q+  SGDH+V++R
Sbjct  73   ENTEAANVTASGMGAITSVLMQVCKSGDHIVSSR  106



>ref|WP_013749695.1| cystathionine beta-lyase [Dokdonia sp. 4H-3-7-5]
 gb|AEE18187.1| Cys/Met metabolism pyridoxal-phosphate-dependent protein [Dokdonia 
sp. 4H-3-7-5]
Length=404

 Score = 82.0 bits (201),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 66/109 (61%), Gaps = 4/109 (4%)
 Frame = +2

Query  188  MWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRH  367
            M   PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G  +  ++YSRH
Sbjct  1    MKFKPANEIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNADGCYLYSRH  56

Query  368  FNPTVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
              P+ L +   +AAMEGTE A   ASGM AI+ V+ QL  +GDHVV++R
Sbjct  57   STPSNLYLGAALAAMEGTETANVAASGMGAITPVLLQLCQAGDHVVSSR  105



>ref|WP_014783742.1| cystathionine beta-lyase [Aequorivita sublithincola]
 gb|AFL82493.1| cystathionine beta-lyase/cystathionine gamma-synthase [Aequorivita 
sublithincola DSM 14238]
Length=399

 Score = 82.0 bits (201),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 66/109 (61%), Gaps = 4/109 (4%)
 Frame = +2

Query  188  MWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRH  367
            M   PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G  +  ++YSRH
Sbjct  1    MAFKPADNIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNADGCYLYSRH  56

Query  368  FNPTVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
              P+ L + + +AAMEGTE A   ASGM AI+  + QL  +GDHVV++R
Sbjct  57   STPSNLYLGKALAAMEGTETANVAASGMGAITPAILQLCKAGDHVVSSR  105



>ref|WP_041802134.1| cystathionine beta-lyase [Muricauda ruestringensis]
Length=406

 Score = 82.0 bits (201),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 44/94 (47%), Positives = 60/94 (64%), Gaps = 3/94 (3%)
 Frame = +2

Query  233  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  412
            FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH +P+ L +   MA +
Sbjct  15   FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNTEGCYLYSRHSSPSNLYLGEAMAQL  71

Query  413  EGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            EGTE+A   ASGM AI++V+ QL  SGDH+V +R
Sbjct  72   EGTESANVYASGMGAITAVILQLCDSGDHIVCSR  105



>ref|WP_034059175.1| cystathionine beta-lyase [Lacinutrix sp. PAMC 27137]
Length=404

 Score = 81.6 bits (200),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 67/109 (61%), Gaps = 4/109 (4%)
 Frame = +2

Query  188  MWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRH  367
            M   PA  +   ++ FGE+GGVN SI  S+T+T ++ +++   F G     +  ++YSRH
Sbjct  1    MAFKPANNIQDLQY-FGENGGVNPSISDSSTYTFLKAKTMLDTFEGN---TDGCYLYSRH  56

Query  368  FNPTVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
             +P+ L +   +AAMEGTE A    SGM AI+  + QL  +GDH+V++R
Sbjct  57   TSPSNLYLGEALAAMEGTETANVAGSGMGAITPTLLQLCGAGDHIVSSR  105



>ref|WP_023571459.1| cystathionine beta-lyase [Flavobacterium cauense]
 gb|ESU18943.1| cystathionine beta-lyase [Flavobacterium cauense R2A-7]
 gb|KGO82423.1| cystathionine beta-lyase [Flavobacterium cauense R2A-7]
Length=401

 Score = 81.6 bits (200),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 66/106 (62%), Gaps = 4/106 (4%)
 Frame = +2

Query  197  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNP  376
            +PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH +P
Sbjct  5    NPADRIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNAEGCYLYSRHSSP  60

Query  377  TVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            + L + + +AAMEGTE A   ASGM AI+  + QL  +GDH+V++R
Sbjct  61   SNLYLDKALAAMEGTETANVAASGMGAITPTLLQLCGNGDHIVSSR  106



>ref|WP_026726694.1| cystathionine beta-lyase [Flavobacterium sasangense]
Length=400

 Score = 81.6 bits (200),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 67/106 (63%), Gaps = 4/106 (4%)
 Frame = +2

Query  197  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNP  376
            +PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH +P
Sbjct  5    NPADRIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNAEGCYLYSRHSSP  60

Query  377  TVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            + L + + +AAMEGTE+A   ASGM AI+  + QL  +GDH+V++R
Sbjct  61   SNLYLDKALAAMEGTESANVAASGMGAITPTLLQLCGNGDHIVSSR  106



>ref|WP_034726484.1| cystathionine beta-lyase [Chryseobacterium sp. JM1]
 gb|KFF20948.1| cystathionine beta-lyase [Chryseobacterium sp. JM1]
Length=408

 Score = 81.6 bits (200),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 44/94 (47%), Positives = 62/94 (66%), Gaps = 3/94 (3%)
 Frame = +2

Query  233  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  412
            FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH +P  L +++ +A M
Sbjct  16   FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNAEGCYLYSRHSSPMNLYLAQALAKM  72

Query  413  EGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            E TEAA  TASGM AI+SV+ Q+  SGDH++++R
Sbjct  73   ENTEAANVTASGMGAITSVLMQVCKSGDHIISSR  106



>ref|WP_034743007.1| cystathionine beta-lyase [Chryseobacterium vrystaatense]
 gb|KFF26183.1| cystathionine beta-lyase [Chryseobacterium vrystaatense]
Length=408

 Score = 81.6 bits (200),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 44/94 (47%), Positives = 62/94 (66%), Gaps = 3/94 (3%)
 Frame = +2

Query  233  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  412
            FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH +P  L +++ +A M
Sbjct  16   FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNAEGCYLYSRHSSPMNLYLAQALAKM  72

Query  413  EGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            E TEAA  TASGM AI+SV+ Q+  SGDH++++R
Sbjct  73   ENTEAANVTASGMGAITSVLMQVCKSGDHIISSR  106



>ref|WP_013188250.1| cystathionine beta-lyase [Croceibacter atlanticus]
 gb|EAP86869.1| Cys/Met metabolism lyase (PLP-dependent) [Croceibacter atlanticus 
HTCC2559]
Length=399

 Score = 81.6 bits (200),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 64/106 (60%), Gaps = 4/106 (4%)
 Frame = +2

Query  197  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNP  376
            +PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH  P
Sbjct  4    NPADRIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNAEGCYLYSRHSTP  59

Query  377  TVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            + L +   +AAMEGTE A   A+GM AI+ V+ QL   GDHVV++R
Sbjct  60   SNLYLGEALAAMEGTETANVAATGMGAITPVLLQLCKQGDHVVSSR  105



>dbj|BAO77673.1| O-acetylhomoserine sulfhydrylase [Winogradskyella sp. PG-2]
Length=405

 Score = 81.6 bits (200),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 46/105 (44%), Positives = 66/105 (63%), Gaps = 4/105 (4%)
 Frame = +2

Query  200  PAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPT  379
            PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G  +  ++YSRH +P+
Sbjct  5    PANNIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNADGCYLYSRHSSPS  60

Query  380  VLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
             L +   +AAMEGTE A  TASGM AI+ V+ QL  + DH+V++R
Sbjct  61   NLYLGEALAAMEGTETATVTASGMGAITPVLLQLCDAEDHIVSSR  105



>ref|WP_040506325.1| cystathionine beta-lyase [Gillisia limnaea]
Length=404

 Score = 81.3 bits (199),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 66/109 (61%), Gaps = 4/109 (4%)
 Frame = +2

Query  188  MWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRH  367
            M   PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G  +  ++YSRH
Sbjct  1    MKYKPADHIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNADGCYLYSRH  56

Query  368  FNPTVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
             +P+ L +   +AAMEGTE A   ASGM AI+  + QL  +GDHVV++R
Sbjct  57   SSPSNLYLGEALAAMEGTETANVAASGMGAITGALLQLCMAGDHVVSSR  105



>dbj|BAP30620.1| putative methionine gamma-lyase [Chryseobacterium sp. StRB126]
Length=410

 Score = 81.3 bits (199),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 43/94 (46%), Positives = 62/94 (66%), Gaps = 3/94 (3%)
 Frame = +2

Query  233  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  412
            FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH +P  L +++ +A M
Sbjct  18   FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNAEGCYLYSRHSSPMNLYLAQALAKM  74

Query  413  EGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            E TE+A  TASGM AI+SV+ Q+  SGDH++++R
Sbjct  75   ENTESANVTASGMGAITSVLMQICKSGDHIISSR  108



>gb|AEM72292.1| Cystathionine gamma-lyase [Muricauda ruestringensis DSM 13258]
Length=432

 Score = 81.6 bits (200),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 44/94 (47%), Positives = 60/94 (64%), Gaps = 3/94 (3%)
 Frame = +2

Query  233  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  412
            FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH +P+ L +   MA +
Sbjct  41   FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNTEGCYLYSRHSSPSNLYLGEAMAQL  97

Query  413  EGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            EGTE+A   ASGM AI++V+ QL  SGDH+V +R
Sbjct  98   EGTESANVYASGMGAITAVILQLCDSGDHIVCSR  131



>ref|WP_013552336.1| cystathionine beta-lyase [Cellulophaga algicola]
 gb|ADV50885.1| Cystathionine gamma-lyase [Cellulophaga algicola DSM 14237]
Length=406

 Score = 81.3 bits (199),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 42/94 (45%), Positives = 59/94 (63%), Gaps = 3/94 (3%)
 Frame = +2

Query  233  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  412
            FGE GGVN SI  S+T+T M  +++   F G        ++YSRH  P+ L +   +AA+
Sbjct  15   FGEFGGVNPSISDSSTYTFMSAKTMSDTFEGN---TEGCYLYSRHSTPSNLYLGEALAAL  71

Query  413  EGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            E TE A   ASGM AI+SV+ QL  +GDH+V++R
Sbjct  72   ESTETANVYASGMGAITSVILQLCDAGDHIVSSR  105



>ref|WP_034685460.1| cystathionine beta-lyase [Chryseobacterium piperi]
 gb|KFF25604.1| cystathionine beta-lyase [Chryseobacterium piperi]
Length=408

 Score = 81.3 bits (199),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 43/94 (46%), Positives = 62/94 (66%), Gaps = 3/94 (3%)
 Frame = +2

Query  233  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  412
            FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH +P  L +++ +A +
Sbjct  16   FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNAEGCYLYSRHSSPMNLYLAQALAKL  72

Query  413  EGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            E TEAA  TASGM AI+SV+ Q+  SGDH++++R
Sbjct  73   ENTEAANVTASGMGAITSVLLQVCKSGDHIISSR  106



>ref|WP_007842611.1| MULTISPECIES: cystathionine beta-lyase [Chryseobacterium]
 gb|EJL72973.1| cystathionine beta-lyase/cystathionine gamma-synthase [Chryseobacterium 
sp. CF314]
Length=408

 Score = 81.3 bits (199),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 43/94 (46%), Positives = 62/94 (66%), Gaps = 3/94 (3%)
 Frame = +2

Query  233  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  412
            FGE GGVN SI  S+T+T +   S + MF    G  +  ++YSRH +P  L +S+ +A +
Sbjct  16   FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNADGCYLYSRHSSPMNLYLSQALAKL  72

Query  413  EGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            E TE A  TASGM AI+SV+ Q+  SGDH++++R
Sbjct  73   ENTETANVTASGMGAITSVLMQVCKSGDHIISSR  106



>gb|EHQ04475.1| Cys/Met metabolism pyridoxal-phosphate-dependent protein [Gillisia 
limnaea DSM 15749]
Length=422

 Score = 81.3 bits (199),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 67/111 (60%), Gaps = 4/111 (4%)
 Frame = +2

Query  182  VQMWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYS  361
            + M   PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G  +  ++YS
Sbjct  17   IIMKYKPADHIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNADGCYLYS  72

Query  362  RHFNPTVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            RH +P+ L +   +AAMEGTE A   ASGM AI+  + QL  +GDHVV++R
Sbjct  73   RHSSPSNLYLGEALAAMEGTETANVAASGMGAITGALLQLCMAGDHVVSSR  123



>ref|WP_039346486.1| cystathionine beta-lyase [Chryseobacterium solincola]
 gb|KIA82384.1| cystathionine beta-lyase [Chryseobacterium solincola]
Length=409

 Score = 81.3 bits (199),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 43/94 (46%), Positives = 60/94 (64%), Gaps = 3/94 (3%)
 Frame = +2

Query  233  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  412
            FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH +P+ L +   +A M
Sbjct  16   FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNTEGCYLYSRHSSPSNLYLGEALAQM  72

Query  413  EGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            EGTE+A  TASGM AI+S + QL  S DH++++R
Sbjct  73   EGTESANVTASGMGAITSTLLQLCKSDDHIISSR  106



>ref|WP_040253833.1| cystathionine beta-lyase [Psychroserpens mesophilus]
Length=404

 Score = 81.3 bits (199),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 45/105 (43%), Positives = 66/105 (63%), Gaps = 4/105 (4%)
 Frame = +2

Query  200  PAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPT  379
            PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G  +  ++YSRH +P+
Sbjct  5    PANNIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNADGCYLYSRHSSPS  60

Query  380  VLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
             L +   +AAMEGTE A  +ASGM AI+  + QL  +GDH+V++R
Sbjct  61   NLYLGEALAAMEGTETANVSASGMGAITPTLMQLCDAGDHIVSSR  105



>ref|WP_034695275.1| cystathionine beta-lyase [Chryseobacterium sp. CF365]
Length=409

 Score = 80.9 bits (198),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 43/94 (46%), Positives = 62/94 (66%), Gaps = 3/94 (3%)
 Frame = +2

Query  233  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  412
            FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH +P  L +++ +A M
Sbjct  16   FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNAEGCYLYSRHSSPMNLYLAQALAKM  72

Query  413  EGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            E TE+A  TASGM AI+SV+ Q+  SGDH++++R
Sbjct  73   ENTESANVTASGMGAITSVLMQVCKSGDHIISSR  106



>ref|WP_034733845.1| cystathionine beta-lyase [Chryseobacterium indologenes]
 dbj|GAE63122.1| putative amino acid lyase [Chryseobacterium indologenes NBRC 
14944]
Length=408

 Score = 80.9 bits (198),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 43/94 (46%), Positives = 62/94 (66%), Gaps = 3/94 (3%)
 Frame = +2

Query  233  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  412
            FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH +P  L +++ +A M
Sbjct  16   FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNAEGCYLYSRHSSPMNLYLAQALAKM  72

Query  413  EGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            E TE+A  TASGM AI+SV+ Q+  SGDH++++R
Sbjct  73   ENTESANVTASGMGAITSVLMQVCKSGDHIISSR  106



>ref|WP_027373193.1| cystathionine beta-lyase [Chryseobacterium sp. UNC8MFCol]
Length=408

 Score = 80.9 bits (198),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 43/94 (46%), Positives = 62/94 (66%), Gaps = 3/94 (3%)
 Frame = +2

Query  233  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  412
            FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH +P  L +++ +A M
Sbjct  16   FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNAEGCYLYSRHSSPMNLYLAQALAKM  72

Query  413  EGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            E TE+A  TASGM AI+SV+ Q+  SGDH++++R
Sbjct  73   ENTESANVTASGMGAITSVLMQVCKSGDHIISSR  106



>ref|XP_006662513.1| PREDICTED: LOW QUALITY PROTEIN: methionine gamma-lyase-like [Oryza 
brachyantha]
Length=312

 Score = 79.7 bits (195),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 43/47 (91%), Gaps = 1/47 (2%)
 Frame = +2

Query  224  RHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPD-NDYFIYS  361
            RHEFGEHGGVNMSIEASATFTVMEP+++RR+F+GELGP+  D  ++S
Sbjct  45   RHEFGEHGGVNMSIEASATFTVMEPDTMRRLFAGELGPERGDLVVHS  91



>ref|WP_027378279.1| cystathionine beta-lyase [Chryseobacterium daeguense]
Length=408

 Score = 80.9 bits (198),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 43/94 (46%), Positives = 62/94 (66%), Gaps = 3/94 (3%)
 Frame = +2

Query  233  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  412
            FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH +P  L +++ +A +
Sbjct  16   FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNAEGCYLYSRHSSPMNLYLAQALAKL  72

Query  413  EGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            E TEAA  TASGM AI+SV+ Q+  SGDH++++R
Sbjct  73   ENTEAANVTASGMGAITSVLMQVCKSGDHIISSR  106



>ref|WP_025615136.1| cystathionine beta-lyase [Cellulophaga baltica]
 gb|AIY14355.1| cystathionine beta-lyase [Cellulophaga baltica NN016038]
Length=406

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/94 (44%), Positives = 59/94 (63%), Gaps = 3/94 (3%)
 Frame = +2

Query  233  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  412
            FGE GGVN SI  S+T+T M  +++   F G        ++YSRH  P+ L +   +A +
Sbjct  15   FGEFGGVNPSISDSSTYTFMAAKTMFDTFEGN---TEGCYLYSRHSTPSNLYLGEALATL  71

Query  413  EGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            EGTE A   ASGM AI+SV+ Q+  +GDH+V++R
Sbjct  72   EGTETANVYASGMGAITSVILQMCDAGDHIVSSR  105



>ref|WP_024480783.1| cystathionine beta-lyase [Cellulophaga baltica]
Length=406

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/94 (44%), Positives = 59/94 (63%), Gaps = 3/94 (3%)
 Frame = +2

Query  233  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  412
            FGE GGVN SI  S+T+T M  +++   F G        ++YSRH  P+ L +   +A +
Sbjct  15   FGEFGGVNPSISDSSTYTFMAAKTMFDTFEGN---TEGCYLYSRHSTPSNLYLGEALATL  71

Query  413  EGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            EGTE A   ASGM AI+SV+ Q+  +GDH+V++R
Sbjct  72   EGTETANVYASGMGAITSVILQMCDAGDHIVSSR  105



>ref|WP_028281947.1| cystathionine beta-lyase [Olleya marilimosa]
Length=404

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 60/94 (64%), Gaps = 3/94 (3%)
 Frame = +2

Query  233  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  412
            FGE GGVN SI  S+T+T ++ +++   F G     +  ++YSRH  P+ L +   +AAM
Sbjct  15   FGEFGGVNPSISDSSTYTFLKAKTMFDTFEGN---TDGCYLYSRHSTPSNLYLGEALAAM  71

Query  413  EGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            EGTE+A    SGM AI+  + QL  +GDH+V++R
Sbjct  72   EGTESANVAGSGMGAITPTLLQLCGAGDHIVSSR  105



>emb|CCF99963.1| methionine gamma-lyase [uncultured Flavobacteriia bacterium]
Length=399

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 66/109 (61%), Gaps = 4/109 (4%)
 Frame = +2

Query  188  MWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRH  367
            M  +PA  +   ++ FGE GGVN SI  S+T+T +  +++   F G     +  ++YSRH
Sbjct  1    MKFNPANNIQDLQY-FGEFGGVNPSISDSSTYTFISAKTMLDTFEGN---TDGCYLYSRH  56

Query  368  FNPTVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
              P+ L +   +AAMEGTEAA   +SGM AI+  + Q+   GDHVV++R
Sbjct  57   STPSNLYLGEALAAMEGTEAANVASSGMGAITPTILQICGHGDHVVSSR  105



>ref|WP_029446484.1| cystathionine beta-lyase [Cellulophaga baltica]
 gb|AIZ42723.1| cystathionine beta-lyase [Cellulophaga baltica 18]
Length=406

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/94 (44%), Positives = 59/94 (63%), Gaps = 3/94 (3%)
 Frame = +2

Query  233  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  412
            FGE GGVN SI  S+T+T M  +++   F G        ++YSRH  P+ L +   +A +
Sbjct  15   FGEFGGVNPSISDSSTYTFMAAKTMFDTFEGN---TEGCYLYSRHSTPSNLYLGEALATL  71

Query  413  EGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            EGTE A   ASGM AI+SV+ Q+  +GDH+V++R
Sbjct  72   EGTETANVYASGMGAITSVILQMCDAGDHIVSSR  105



>ref|WP_029449234.1| cystathionine beta-lyase [Cellulophaga baltica]
Length=406

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/94 (44%), Positives = 59/94 (63%), Gaps = 3/94 (3%)
 Frame = +2

Query  233  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  412
            FGE GGVN SI  S+T+T M  +++   F G        ++YSRH  P+ L +   +A +
Sbjct  15   FGEFGGVNPSISDSSTYTFMAAKTMFDTFEGN---TEGCYLYSRHSTPSNLYLGEALATL  71

Query  413  EGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            EGTE A   ASGM AI+SV+ Q+  +GDH+V++R
Sbjct  72   EGTETANVYASGMGAITSVILQMCDAGDHIVSSR  105



>ref|WP_034666996.1| cystathionine beta-lyase [Cellulophaga sp. E6(2014)]
 gb|KGK30545.1| cystathionine beta-lyase [Cellulophaga sp. E6(2014)]
Length=406

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/94 (44%), Positives = 59/94 (63%), Gaps = 3/94 (3%)
 Frame = +2

Query  233  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  412
            FGE GGVN SI  S+T+T M  +++   F G        ++YSRH  P+ L +   +A +
Sbjct  15   FGEFGGVNPSISDSSTYTFMAAKTMFDTFEGN---TEGCYLYSRHSTPSNLYLGEALATL  71

Query  413  EGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            EGTE A   ASGM AI+SV+ Q+  +GDH+V++R
Sbjct  72   EGTETANVYASGMGAITSVILQMCDAGDHIVSSR  105



>ref|WP_021778620.1| Cys/Met metabolism PLP-dependent enzyme [Dokdonia sp. MED134]
 gb|EAQ38280.1| Cys/Met metabolism PLP-dependent enzyme [Dokdonia sp. MED134]
Length=404

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/94 (47%), Positives = 59/94 (63%), Gaps = 3/94 (3%)
 Frame = +2

Query  233  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  412
            FGE GGVN SI  S+T+T +   S + MF    G  +  ++YSRH  P+ L +   +AAM
Sbjct  15   FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNADGCYLYSRHSTPSNLYLGAALAAM  71

Query  413  EGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            EGTE A   ASGM AI+  + QL  +GDHVV++R
Sbjct  72   EGTETANVAASGMGAITPTLLQLCQAGDHVVSSR  105



>ref|WP_020081610.1| cystathionine beta-lyase [Flavobacterium sp. SCGC AAA160-P02]
Length=404

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 60/96 (63%), Gaps = 3/96 (3%)
 Frame = +2

Query  227  HEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMA  406
              FGE GGVN SI  S+T+T +  +++   F G     +   +YSRH  P+ + +   +A
Sbjct  13   QNFGEFGGVNPSISDSSTYTFLSAKTMADTFEGN---TDGCHLYSRHTTPSNMFLGEALA  69

Query  407  AMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            AMEGTE A  +ASGM AI+ V+ QL  +GDH+V++R
Sbjct  70   AMEGTETANVSASGMGAITPVLLQLCGAGDHIVSSR  105



>ref|WP_035334044.1| cystathionine beta-lyase [Dokdonia sp. PRO95]
Length=404

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 65/109 (60%), Gaps = 4/109 (4%)
 Frame = +2

Query  188  MWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRH  367
            M   PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G  +  ++YSRH
Sbjct  1    MKFKPANEIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNADGCYLYSRH  56

Query  368  FNPTVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
              P+ L +   +AAMEGTE A   ASGM AI+  + QL  +GDHVV++R
Sbjct  57   STPSNLYLGAALAAMEGTETANVAASGMGAITPTLLQLCQAGDHVVSSR  105



>ref|WP_035325087.1| cystathionine beta-lyase [Dokdonia donghaensis]
 gb|KGO06072.1| cystathionine beta-lyase [Dokdonia donghaensis DSW-1]
Length=404

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 65/109 (60%), Gaps = 4/109 (4%)
 Frame = +2

Query  188  MWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRH  367
            M   PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G  +  ++YSRH
Sbjct  1    MKFKPANEIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNADGCYLYSRH  56

Query  368  FNPTVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
              P+ L +   +AAMEGTE A   ASGM AI+  + QL  +GDHVV++R
Sbjct  57   STPSNLYLGAALAAMEGTETANVAASGMGAITPTLLQLCQAGDHVVSSR  105



>ref|WP_028891291.1| cystathionine beta-lyase [Tenacibaculum sp. 47A_GOM-205m]
Length=399

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 67/109 (61%), Gaps = 4/109 (4%)
 Frame = +2

Query  188  MWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRH  367
            M   PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G  +  ++YSRH
Sbjct  1    MKFKPANNIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNTDGCYLYSRH  56

Query  368  FNPTVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
             +P+ L ++  +AAMEGTE A   A+GM AI+  + Q+  +GDH+V++R
Sbjct  57   SSPSNLYLAEALAAMEGTETANVAATGMGAITPTILQICGAGDHIVSSR  105



>ref|WP_028887221.1| cystathionine beta-lyase [Tenacibaculum ovolyticum]
Length=404

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 68/105 (65%), Gaps = 4/105 (4%)
 Frame = +2

Query  200  PAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPT  379
            PA  +   ++ FGE GGVN SI  S+T+T ++ +++   F G     +  ++YSRH +P+
Sbjct  5    PANDIQDLQY-FGEFGGVNPSISDSSTYTFIKAKTMFDTFEGN---TDGCYLYSRHTSPS  60

Query  380  VLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
             L +S  +AAMEGTE A  + +GM +I++ + Q+  +GDH+V++R
Sbjct  61   NLYLSEALAAMEGTETANVSGTGMGSITATILQICGAGDHIVSSR  105



>ref|WP_010231094.1| cystathionine beta-lyase [Gillisia marina]
Length=405

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 65/109 (60%), Gaps = 4/109 (4%)
 Frame = +2

Query  188  MWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRH  367
            M   PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G  +  ++YSRH
Sbjct  1    MKYKPANHIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNQDGCYLYSRH  56

Query  368  FNPTVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
              P+ L +   +AAMEGTE A   ASGM AI++ + QL  + DH+V++R
Sbjct  57   STPSNLYLGEALAAMEGTETANVAASGMGAITAALLQLCKADDHIVSSR  105



>ref|WP_026711287.1| cystathionine beta-lyase [Flavobacterium filum]
Length=402

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 66/106 (62%), Gaps = 4/106 (4%)
 Frame = +2

Query  197  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNP  376
            +PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH +P
Sbjct  7    NPADKIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNAEGCYLYSRHSSP  62

Query  377  TVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
              L +   +AAMEGTE+A   ASGM AI+ V+ QL ++GD +V++R
Sbjct  63   MNLYLGEALAAMEGTESANVAASGMGAITPVLLQLCAAGDEIVSSR  108



>ref|WP_026839051.1| cystathionine beta-lyase [Gillisia sp. JM1]
Length=405

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 64/109 (59%), Gaps = 4/109 (4%)
 Frame = +2

Query  188  MWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRH  367
            M   PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G  +  ++YSRH
Sbjct  1    MKYKPANHIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNQDGCYLYSRH  56

Query  368  FNPTVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
              P+ L +   +AAMEGTE A   ASGM AI+  + QL  + DH+V++R
Sbjct  57   STPSNLYLGEALAAMEGTETANVAASGMGAITGALLQLCKADDHIVSSR  105



>ref|WP_010516575.1| cystathionine beta-lyase [Mesoflavibacter zeaxanthinifaciens]
Length=406

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 61/96 (64%), Gaps = 3/96 (3%)
 Frame = +2

Query  227  HEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMA  406
            H FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH +P+ L +   +A
Sbjct  13   HYFGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNTEGCYLYSRHSSPSNLYLGEALA  69

Query  407  AMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            A+E TE+A   ASGM AI++V+ QL S+ DH+V +R
Sbjct  70   ALEQTESANVYASGMGAITAVIMQLCSANDHIVTSR  105



>ref|WP_026934033.1| cystathionine beta-lyase [Gramella echinicola]
Length=404

 Score = 79.0 bits (193),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 66/109 (61%), Gaps = 4/109 (4%)
 Frame = +2

Query  188  MWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRH  367
            M   PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH
Sbjct  1    MKYKPADHIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNAEGCYLYSRH  56

Query  368  FNPTVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
             +P+ L +   +AAME TE A  +ASGM AI+S + QL ++GDH+V +R
Sbjct  57   SSPSNLYLGEALAAMEETETANVSASGMGAITSTLMQLCNAGDHIVCSR  105



>ref|WP_034920606.1| cystathionine beta-lyase [Gillisia sp. CAL575]
Length=405

 Score = 78.6 bits (192),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 64/109 (59%), Gaps = 4/109 (4%)
 Frame = +2

Query  188  MWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRH  367
            M   PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G  +  ++YSRH
Sbjct  1    MKYKPANHIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNQDGCYLYSRH  56

Query  368  FNPTVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
              P+ L +   +AAMEGTE A   ASGM AI+  + QL  + DH+V++R
Sbjct  57   STPSNLYLGEALAAMEGTETANVAASGMGAITGALLQLCKAEDHIVSSR  105



>gb|EDM43122.1| probable Methionine gamma-lyase [unidentified eubacterium SCB49]
Length=412

 Score = 78.6 bits (192),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 47/125 (38%), Positives = 68/125 (54%), Gaps = 12/125 (10%)
 Frame = +2

Query  140  RDDMMKAKKGGKPAVQMWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMF  319
            +++ M   K  KPA  + +            FGE GGVN SI  S+T+T +   S + MF
Sbjct  6    KNEPMSDNKNFKPANNIQD---------LQYFGEFGGVNPSISDSSTYTFL---SAKTMF  53

Query  320  SGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGTEAAYCTASGMSAISSVMFQLLSSGDH  499
                G  +  ++YSRH  P+ L +   +AAMEGTE A   ASGM AI+  + Q   +GDH
Sbjct  54   DTFEGNADGCYLYSRHSTPSNLYLGEALAAMEGTETANVAASGMGAITPTILQFCQAGDH  113

Query  500  VVAAR  514
            +V++R
Sbjct  114  LVSSR  118



>ref|WP_042336387.1| cystathionine beta-lyase [Candidatus Accumulibacter sp. BA-92]
 gb|EXI76995.1| Methionine gamma-lyase [Candidatus Accumulibacter sp. BA-92]
Length=411

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/94 (45%), Positives = 56/94 (60%), Gaps = 3/94 (3%)
 Frame = +2

Query  233  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  412
            FGE G VN SI  S+T+T + PE +  +F  E+      F+YSRHFNPT   ++  +  M
Sbjct  15   FGEFGDVNPSITDSSTYTFLSPERMEELFEHEI---EGCFLYSRHFNPTNKYLASALQRM  71

Query  413  EGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            E  E+A   ASGM AIS+ +  L S+GD VV  R
Sbjct  72   EDGESAQVMASGMGAISTTLMTLCSAGDEVVCGR  105



>ref|WP_034939616.1| cystathionine beta-lyase [Candidatus Accumulibacter sp. SK-12]
 gb|EXI66373.1| Methionine gamma-lyase [Candidatus Accumulibacter sp. SK-12]
Length=406

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/94 (44%), Positives = 56/94 (60%), Gaps = 3/94 (3%)
 Frame = +2

Query  233  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  412
            FGE G VN SI  S+T+T + PE +  +F  E+      F+YSRHFNPT   ++  +  M
Sbjct  15   FGEFGDVNPSITDSSTYTFLSPERMEELFEHEI---EGCFLYSRHFNPTNKYLASALVRM  71

Query  413  EGTEAAYCTASGMSAISSVMFQLLSSGDHVVAAR  514
            E  EAA   ASGM AIS+ +  L ++GD +V  R
Sbjct  72   EDGEAAQVMASGMGAISTTLMTLCAAGDEIVCGR  105



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 552470516325