BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002E12

Length=373
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010255931.1|  PREDICTED: uncharacterized protein LOC104596...  52.4    1e-06   
ref|XP_009781633.1|  PREDICTED: uncharacterized protein LOC104230505  52.4    1e-06   Nicotiana sylvestris
gb|KHN15952.1|  hypothetical protein glysoja_013168                   45.4    3e-04   Glycine soja [wild soybean]
ref|XP_009798955.1|  PREDICTED: uncharacterized protein LOC104245088  45.8    4e-04   Nicotiana sylvestris
gb|KHG01392.1|  hypothetical protein F383_23255                       44.7    6e-04   Gossypium arboreum [tree cotton]
ref|XP_010327542.1|  PREDICTED: uncharacterized protein LOC101254839  44.7    6e-04   
gb|KJB09681.1|  hypothetical protein B456_001G156200                  44.3    7e-04   Gossypium raimondii
ref|XP_008461975.1|  PREDICTED: uncharacterized protein LOC103500456  44.3    8e-04   



>ref|XP_010255931.1| PREDICTED: uncharacterized protein LOC104596457 isoform X1 [Nelumbo 
nucifera]
Length=51

 Score = 52.4 bits (124),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = +2

Query  71   MIYRKWSLLTGPTSIvgavvgavvvgHLIFSQSDPAIKPKPRNSETLASSK  223
            MIYRKWSLLTGP SI+G++V  VVV + +F  +DP +KP+ R  ET +S+K
Sbjct  1    MIYRKWSLLTGPVSILGSIVATVVVANYLFVDNDPFVKPEQRKQETSSSTK  51



>ref|XP_009781633.1| PREDICTED: uncharacterized protein LOC104230505 [Nicotiana sylvestris]
Length=51

 Score = 52.4 bits (124),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = +2

Query  71   MIYRKWSLLTGPTSIvgavvgavvvgHLIFSQSDPAIKPKPRNSETLASSK  223
            MIYRKWSLLTGP +++GA+VG +VV +L+F Q+DP ++P P+  E  AS+K
Sbjct  1    MIYRKWSLLTGPPAMLGAIVGTIVVANLLFVQNDPFLEPNPKKQEKAASTK  51



>gb|KHN15952.1| hypothetical protein glysoja_013168 [Glycine soja]
Length=51

 Score = 45.4 bits (106),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = +2

Query  71   MIYRKWSLLTGPTSIvgavvgavvvgHLIFSQSDPAIKPKPRNSETLASSK  223
            MIYRKWSLLTGP +I+G VV A+   ++IF ++DP ++P+ RN E   ++K
Sbjct  1    MIYRKWSLLTGPVTILGGVVVAIAAANVIFVKNDPFLQPEERNYENQPATK  51



>ref|XP_009798955.1| PREDICTED: uncharacterized protein LOC104245088 [Nicotiana sylvestris]
Length=102

 Score = 45.8 bits (107),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  68   KMIYRKWSLLTGPTSIvgavvgavvvgHLIFSQSDPAIKP  187
            +MI+RKWSLLTGP +I+G +VGA+VV + IF Q+DP +KP
Sbjct  52   RMIHRKWSLLTGPAAILGGIVGAIVVANFIFVQNDPFLKP  91



>gb|KHG01392.1| hypothetical protein F383_23255 [Gossypium arboreum]
Length=49

 Score = 44.7 bits (104),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 36/50 (72%), Gaps = 1/50 (2%)
 Frame = +2

Query  71   MIYRKWSLLTGPTSIvgavvgavvvgHLIFSQSDPAIKPKPRNSETLASS  220
            MIYRKWSLLTGP SI+G +VGA VV HLIF   D  +KPK + ++ +  S
Sbjct  1    MIYRKWSLLTGPVSILGGIVGATVVAHLIF-LDDRYLKPKKKTTDRVDRS  49



>ref|XP_010327542.1| PREDICTED: uncharacterized protein LOC101254839 [Solanum lycopersicum]
Length=50

 Score = 44.7 bits (104),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 39/51 (76%), Gaps = 1/51 (2%)
 Frame = +2

Query  71   MIYRKWSLLTGPTSIvgavvgavvvgHLIFSQSDPAIKPKPRNSETLASSK  223
            MI+RKWSLLTGP +I+G +VG++VV + IF Q+DP +KP+ R  E   S+K
Sbjct  1    MIHRKWSLLTGPVAILGGIVGSIVVANFIFVQNDPFLKPE-RKLEKAPSTK  50



>gb|KJB09681.1| hypothetical protein B456_001G156200 [Gossypium raimondii]
Length=49

 Score = 44.3 bits (103),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 33/43 (77%), Gaps = 1/43 (2%)
 Frame = +2

Query  71   MIYRKWSLLTGPTSIvgavvgavvvgHLIFSQSDPAIKPKPRN  199
            MIYRKWSLLTGP SI+G +VGA VV HLIF   DP +KPK + 
Sbjct  1    MIYRKWSLLTGPVSILGGIVGATVVAHLIF-LDDPYLKPKKKT  42



>ref|XP_008461975.1| PREDICTED: uncharacterized protein LOC103500456 [Cucumis melo]
Length=49

 Score = 44.3 bits (103),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +2

Query  71   MIYRKWSLLTGPTSIvgavvgavvvgHLIFSQSDPAIKPKPRNSET  208
            MI+RKWSLLT P +I+G +V ++ V + IF + DP +KPK RN E 
Sbjct  1    MIHRKWSLLTVPPAILGGIVVSLAVANFIFVKEDPFLKPKERNVEA  46



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 555214126005