BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002E09

Length=662
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KDP33374.1|  hypothetical protein JCGZ_12923                         229   3e-71   Jatropha curcas
ref|XP_002518170.1|  Inhibitor of growth protein, putative              226   5e-70   
ref|XP_009785672.1|  PREDICTED: PHD finger protein ING1 isoform X1      225   7e-70   Nicotiana sylvestris
ref|XP_006420512.1|  hypothetical protein CICLE_v10005726mg             224   2e-69   Citrus clementina [clementine]
ref|XP_006492151.1|  PREDICTED: PHD finger protein ING1-like            224   3e-69   Citrus sinensis [apfelsine]
ref|XP_004247811.1|  PREDICTED: PHD finger protein ING1                 223   7e-69   Solanum lycopersicum
ref|XP_007034499.1|  RING/FYVE/PHD zinc finger superfamily protei...    222   2e-68   Theobroma cacao [chocolate]
ref|XP_006340915.1|  PREDICTED: PHD finger protein ING1-like            221   3e-68   Solanum tuberosum [potatoes]
gb|ACJ84468.1|  unknown                                                 220   6e-68   Medicago truncatula
gb|AFK44120.1|  unknown                                                 220   6e-68   Medicago truncatula
emb|CDO99386.1|  unnamed protein product                                219   2e-67   Coffea canephora [robusta coffee]
ref|XP_003535966.1|  PREDICTED: PHD finger protein ING1-like isof...    218   3e-67   Glycine max [soybeans]
ref|XP_009785673.1|  PREDICTED: PHD finger protein ING1 isoform X2      214   3e-66   Nicotiana sylvestris
ref|XP_007145429.1|  hypothetical protein PHAVU_007G238400g             216   4e-66   Phaseolus vulgaris [French bean]
ref|XP_003555720.1|  PREDICTED: PHD finger protein ING1-like            214   2e-65   Glycine max [soybeans]
gb|ACU19192.1|  unknown                                                 213   4e-65   Glycine max [soybeans]
ref|XP_010264003.1|  PREDICTED: PHD finger protein ING1                 211   1e-64   Nelumbo nucifera [Indian lotus]
ref|XP_011091384.1|  PREDICTED: PHD finger protein ING1 isoform X1      211   2e-64   Sesamum indicum [beniseed]
ref|XP_004497737.1|  PREDICTED: PHD finger protein ING1-like            213   3e-64   Cicer arietinum [garbanzo]
gb|KJB28066.1|  hypothetical protein B456_005G039000                    209   6e-64   Gossypium raimondii
gb|KJB28062.1|  hypothetical protein B456_005G039000                    209   1e-63   Gossypium raimondii
ref|XP_011091386.1|  PREDICTED: PHD finger protein ING1 isoform X2      209   2e-63   Sesamum indicum [beniseed]
ref|XP_006589054.1|  PREDICTED: PHD finger protein ING1-like isof...    207   4e-63   Glycine max [soybeans]
gb|AFK33325.1|  unknown                                                 207   7e-63   Lotus japonicus
ref|XP_004134022.1|  PREDICTED: PHD finger protein ING1-like            206   1e-62   Cucumis sativus [cucumbers]
gb|KHN48841.1|  PHD finger protein ING1                                 206   2e-62   Glycine soja [wild soybean]
ref|XP_002285610.1|  PREDICTED: PHD finger protein ING1                 204   1e-61   Vitis vinifera
ref|XP_007227566.1|  hypothetical protein PRUPE_ppa010764mg             201   1e-60   Prunus persica
ref|XP_009609788.1|  PREDICTED: PHD finger protein ING1-like            197   2e-60   Nicotiana tomentosiformis
gb|EYU43804.1|  hypothetical protein MIMGU_mgv1a012611mg                200   5e-60   Erythranthe guttata [common monkey flower]
ref|XP_008438417.1|  PREDICTED: PHD finger protein ING1                 199   1e-59   Cucumis melo [Oriental melon]
ref|XP_009362046.1|  PREDICTED: PHD finger protein ING1-like            198   3e-59   Pyrus x bretschneideri [bai li]
ref|XP_009377447.1|  PREDICTED: PHD finger protein ING1-like            197   4e-59   Pyrus x bretschneideri [bai li]
ref|XP_011464224.1|  PREDICTED: PHD finger protein ING1 isoform X2      197   8e-59   Fragaria vesca subsp. vesca
ref|XP_008362239.1|  PREDICTED: PHD finger protein ING1-like            196   1e-58   Malus domestica [apple tree]
ref|XP_010069086.1|  PREDICTED: PHD finger protein ING1                 196   2e-58   Eucalyptus grandis [rose gum]
ref|XP_002304691.1|  PHD finger family protein                          196   2e-58   Populus trichocarpa [western balsam poplar]
ref|XP_004299213.1|  PREDICTED: PHD finger protein ING1 isoform X1      196   2e-58   Fragaria vesca subsp. vesca
gb|KJB28067.1|  hypothetical protein B456_005G039000                    194   2e-58   Gossypium raimondii
ref|XP_007034500.1|  RING/FYVE/PHD zinc finger superfamily protei...    194   7e-58   Theobroma cacao [chocolate]
ref|XP_011020717.1|  PREDICTED: PHD finger protein ING1                 194   2e-57   Populus euphratica
ref|XP_008224073.1|  PREDICTED: PHD finger protein ING1 isoform X1      192   3e-57   Prunus mume [ume]
gb|KJB33357.1|  hypothetical protein B456_006G054900                    192   4e-57   Gossypium raimondii
ref|XP_008812924.1|  PREDICTED: PHD finger protein ING1-like isof...    188   1e-55   Phoenix dactylifera
ref|XP_008777019.1|  PREDICTED: PHD finger protein ING1-like isof...    185   3e-54   Phoenix dactylifera
ref|XP_010550846.1|  PREDICTED: PHD finger protein ING1                 185   3e-54   Tarenaya hassleriana [spider flower]
gb|KJB28065.1|  hypothetical protein B456_005G039000                    182   3e-53   Gossypium raimondii
ref|XP_009390107.1|  PREDICTED: PHD finger protein ING1 isoform X1      182   4e-53   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN31619.1|  PHD finger protein ING1                                 182   8e-53   Glycine soja [wild soybean]
ref|XP_007034502.1|  RING/FYVE/PHD zinc finger superfamily protei...    181   1e-52   
ref|XP_010918839.1|  PREDICTED: PHD finger protein ING1                 179   4e-52   Elaeis guineensis
gb|KJB33358.1|  hypothetical protein B456_006G054900                    176   4e-52   Gossypium raimondii
ref|XP_009390117.1|  PREDICTED: PHD finger protein ING1 isoform X2      179   5e-52   
ref|XP_008812921.1|  PREDICTED: PHD finger protein ING1-like isof...    178   1e-51   Phoenix dactylifera
gb|KJB33359.1|  hypothetical protein B456_006G054900                    176   1e-51   Gossypium raimondii
ref|XP_008812920.1|  PREDICTED: PHD finger protein ING1-like isof...    178   1e-51   Phoenix dactylifera
ref|XP_006854339.1|  hypothetical protein AMTR_s00039p00134610          177   2e-51   Amborella trichopoda
ref|NP_566742.1|  PHD finger protein ING1                               177   4e-51   Arabidopsis thaliana [mouse-ear cress]
emb|CDX85182.1|  BnaC07g07240D                                          177   6e-51   
gb|KHG19241.1|  PHD finger ING1 -like protein                           174   9e-51   Gossypium arboreum [tree cotton]
ref|XP_009102538.1|  PREDICTED: PHD finger protein ING1                 176   2e-50   Brassica rapa
gb|KFK39701.1|  hypothetical protein AALP_AA3G277600                    174   3e-50   Arabis alpina [alpine rockcress]
gb|EPS59284.1|  hypothetical protein M569_15524                         170   3e-50   Genlisea aurea
gb|KJB28063.1|  hypothetical protein B456_005G039000                    173   5e-50   Gossypium raimondii
gb|KDO43053.1|  hypothetical protein CISIN_1g025753mg                   171   8e-49   Citrus sinensis [apfelsine]
ref|XP_010689994.1|  PREDICTED: PHD finger protein ING1 isoform X2      171   1e-48   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010689988.1|  PREDICTED: PHD finger protein ING1 isoform X1      170   2e-48   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010466802.1|  PREDICTED: PHD finger protein ING1-like            167   3e-47   Camelina sativa [gold-of-pleasure]
ref|XP_006298381.1|  hypothetical protein CARUB_v10014450mg             167   5e-47   
ref|XP_006418791.1|  hypothetical protein EUTSA_v10002653mg             166   9e-47   Eutrema salsugineum [saltwater cress]
ref|XP_007034501.1|  RING/FYVE/PHD zinc finger superfamily protei...    163   4e-46   
ref|XP_010488512.1|  PREDICTED: PHD finger protein ING1                 161   3e-45   Camelina sativa [gold-of-pleasure]
ref|XP_002883498.1|  hypothetical protein ARALYDRAFT_479934             161   6e-45   
ref|XP_006649386.1|  PREDICTED: PHD finger protein ING1-like            160   1e-44   Oryza brachyantha
ref|NP_001048939.1|  Os03g0143600                                       160   3e-44   
ref|XP_008777020.1|  PREDICTED: PHD finger protein ING1-like isof...    157   5e-44   
ref|XP_010513292.1|  PREDICTED: PHD finger protein ING1-like            158   9e-44   Camelina sativa [gold-of-pleasure]
gb|EAY88500.1|  hypothetical protein OsI_09971                          157   2e-43   Oryza sativa Indica Group [Indian rice]
ref|XP_004985739.1|  PREDICTED: PHD finger protein ING1-like            152   3e-41   Setaria italica
ref|XP_008224074.1|  PREDICTED: PHD finger protein ING1 isoform X2      150   5e-41   Prunus mume [ume]
ref|XP_010933237.1|  PREDICTED: PHD finger protein ING1-like            150   1e-40   Elaeis guineensis
ref|XP_003558832.1|  PREDICTED: PHD finger protein ING1                 149   2e-40   Brachypodium distachyon [annual false brome]
ref|XP_008658601.1|  PREDICTED: inhibitor of growth protein 5 iso...    148   3e-39   Zea mays [maize]
ref|NP_001148845.1|  inhibitor of growth protein 5                      146   3e-39   Zea mays [maize]
ref|XP_008658602.1|  PREDICTED: inhibitor of growth protein 5 iso...    147   4e-39   Zea mays [maize]
dbj|BAK07845.1|  predicted protein                                      145   7e-39   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ97745.1|  predicted protein                                      145   8e-39   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABR17867.1|  unknown                                                 142   1e-37   Picea sitchensis
gb|KJB28068.1|  hypothetical protein B456_005G039000                    135   1e-35   Gossypium raimondii
gb|EMS57339.1|  Inhibitor of growth protein 4                           130   2e-32   Triticum urartu
ref|XP_008342626.1|  PREDICTED: uncharacterized protein LOC103405401    102   4e-23   
ref|XP_001780390.1|  predicted protein                                  102   1e-22   
gb|AAO42002.1|  putative PHD-finger protein                           83.2    3e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002963669.1|  hypothetical protein SELMODRAFT_270360           83.2    7e-16   Selaginella moellendorffii
ref|XP_004346006.1|  PHDfinger domain containing protein              68.9    6e-11   Acanthamoeba castellanii str. Neff
ref|XP_006420511.1|  hypothetical protein CICLE_v10006965mg           70.5    1e-10   
gb|KJB28064.1|  hypothetical protein B456_005G039000                  63.9    2e-09   Gossypium raimondii
gb|KCW89858.1|  hypothetical protein EUGRSUZ_A02091                   64.7    3e-09   Eucalyptus grandis [rose gum]
ref|XP_002585609.1|  hypothetical protein BRAFLDRAFT_133135           63.9    4e-09   Branchiostoma floridae
ref|XP_010054517.1|  PREDICTED: PHD finger protein ING2 isoform X1    64.3    4e-09   Eucalyptus grandis [rose gum]
ref|XP_001650124.1|  AAEL004983-PA                                    63.9    6e-09   Aedes aegypti
ref|XP_001650123.1|  AAEL004983-PB                                    63.5    1e-08   Aedes aegypti
ref|XP_006826308.1|  hypothetical protein AMTR_s00004p00078450        62.8    1e-08   Amborella trichopoda
gb|ETN59393.1|  Inhibitor of growth proteining, ing4                  61.6    4e-08   Anopheles darlingi [American malaria mosquito]
gb|KFB41009.1|  AGAP009992-PA-like protein                            61.2    6e-08   Anopheles sinensis
ref|NP_001233000.1|  uncharacterized protein LOC100161116             61.2    6e-08   Acyrthosiphon pisum
gb|ELV12254.1|  D-2-hydroxyglutarate dehydrogenase, mitochondrial     61.2    1e-07   Tupaia chinensis
ref|XP_001848299.1|  inhibitor of growth protein, ing4                60.5    1e-07   Culex quinquefasciatus
ref|XP_002113450.1|  hypothetical protein TRIADDRAFT_50425            58.9    2e-07   Trichoplax adhaerens
ref|XP_010789447.1|  PREDICTED: inhibitor of growth protein 5         58.9    2e-07   Notothenia coriiceps [yellowbelly rockcod]
dbj|BAN20863.1|  inhibitor of growth proteining, ing4                 58.9    3e-07   Riptortus pedestris
ref|XP_001949522.2|  PREDICTED: inhibitor of growth protein 4-like    59.3    3e-07   Acyrthosiphon pisum
ref|XP_003632714.1|  PREDICTED: PHD finger protein ING2               58.9    4e-07   Vitis vinifera
emb|CAN71661.1|  hypothetical protein VITISV_016186                   58.5    4e-07   Vitis vinifera
ref|XP_008480050.1|  PREDICTED: inhibitor of growth protein 5-like    58.9    4e-07   Diaphorina citri
ref|XP_005707926.1|  hypothetical protein Gasu_13700                  58.2    4e-07   Galdieria sulphuraria
ref|XP_002588507.1|  hypothetical protein BRAFLDRAFT_114530           58.5    5e-07   Branchiostoma floridae
ref|XP_002732281.1|  PREDICTED: inhibitor of growth protein 4-like    58.5    5e-07   Saccoglossus kowalevskii
ref|NP_001241355.1|  uncharacterized protein LOC100787916             57.8    9e-07   Glycine max [soybeans]
ref|XP_001948924.2|  PREDICTED: inhibitor of growth protein 5-like    57.8    9e-07   Acyrthosiphon pisum
gb|KDP39713.1|  hypothetical protein JCGZ_02733                       57.8    9e-07   Jatropha curcas
ref|XP_001943164.2|  PREDICTED: inhibitor of growth protein 5-like    57.8    1e-06   Acyrthosiphon pisum
gb|ELU06105.1|  hypothetical protein CAPTEDRAFT_227494                57.4    1e-06   Capitella teleta
ref|XP_008547616.1|  PREDICTED: inhibitor of growth protein 5         57.4    1e-06   Microplitis demolitor
ref|XP_009053604.1|  hypothetical protein LOTGIDRAFT_214850           57.0    1e-06   Lottia gigantea
gb|AEE61445.1|  unknown                                               57.4    1e-06   Dendroctonus ponderosae
ref|XP_010269723.1|  PREDICTED: PHD finger protein ING2               57.0    2e-06   Nelumbo nucifera [Indian lotus]
ref|XP_009030358.1|  hypothetical protein HELRODRAFT_185182           57.0    2e-06   Helobdella robusta
ref|XP_006302707.1|  hypothetical protein CARUB_v10020819mg           56.6    2e-06   
gb|EFX72404.1|  hypothetical protein DAPPUDRAFT_308315                56.6    2e-06   Daphnia pulex
ref|XP_001692129.1|  hypothetical protein CHLREDRAFT_31927            56.6    2e-06   Chlamydomonas reinhardtii
ref|XP_002127711.1|  PREDICTED: inhibitor of growth protein 5 iso...  56.2    3e-06   Ciona intestinalis [sea vase]
ref|XP_319132.3|  AGAP009992-PA                                       56.2    3e-06   Anopheles gambiae str. PEST
ref|XP_010470337.1|  PREDICTED: PHD finger protein ING2 isoform X2    55.8    3e-06   Camelina sativa [gold-of-pleasure]
ref|XP_010511155.1|  PREDICTED: PHD finger protein ING2-like isof...  55.8    3e-06   Camelina sativa [gold-of-pleasure]
emb|CDJ90846.1|  Zinc finger domain containing protein                55.5    4e-06   Haemonchus contortus [red stomach worm]
ref|XP_010414880.1|  PREDICTED: PHD finger protein ING2-like          55.8    5e-06   Camelina sativa [gold-of-pleasure]
ref|XP_007234440.1|  PREDICTED: inhibitor of growth protein 5-lik...  55.5    5e-06   Astyanax mexicanus [blind cave fish]
ref|XP_010470336.1|  PREDICTED: PHD finger protein ING2 isoform X1    55.8    5e-06   Camelina sativa [gold-of-pleasure]
ref|XP_010511153.1|  PREDICTED: PHD finger protein ING2-like isof...  55.8    5e-06   Camelina sativa [gold-of-pleasure]
ref|XP_005798824.1|  PREDICTED: inhibitor of growth protein 4-lik...  55.5    6e-06   
ref|XP_003973903.1|  PREDICTED: inhibitor of growth protein 5-lik...  55.5    6e-06   
ref|XP_011034361.1|  PREDICTED: PHD finger protein ING2-like          55.5    6e-06   Populus euphratica
ref|XP_007503719.1|  PREDICTED: inhibitor of growth protein 4 iso...  55.8    6e-06   
ref|XP_007503718.1|  PREDICTED: inhibitor of growth protein 4 iso...  55.8    6e-06   
gb|KFH70497.1|  hypothetical protein MVEG_03347                       55.5    6e-06   Mortierella verticillata NRRL 6337
ref|XP_793913.3|  PREDICTED: inhibitor of growth protein 4-like       55.1    6e-06   
ref|XP_003737536.1|  PREDICTED: inhibitor of growth protein 4-like    55.1    7e-06   Galendromus occidentalis
ref|XP_011472032.1|  PREDICTED: inhibitor of growth protein 5         55.1    7e-06   Oryzias latipes [Japanese rice fish]
ref|XP_011346281.1|  PREDICTED: inhibitor of growth protein 5         55.1    7e-06   Ooceraea biroi
ref|XP_001629595.1|  predicted protein                                53.9    7e-06   Nematostella vectensis
ref|XP_011144411.1|  PREDICTED: inhibitor of growth protein 5 iso...  55.1    8e-06   
ref|XP_011494864.1|  PREDICTED: inhibitor of growth protein 5 iso...  55.1    8e-06   Ceratosolen solmsi marchali
ref|XP_005798821.1|  PREDICTED: inhibitor of growth protein 4-lik...  55.1    9e-06   Xiphophorus maculatus
gb|EPS66711.1|  hypothetical protein M569_08060                       55.8    9e-06   Genlisea aurea
ref|XP_009353151.1|  PREDICTED: PHD finger protein ING2               55.1    9e-06   Pyrus x bretschneideri [bai li]
ref|XP_008351429.1|  PREDICTED: PHD finger protein ING2-like          55.1    9e-06   Malus domestica [apple tree]
ref|XP_002319698.1|  PHD finger family protein                        54.7    1e-05   Populus trichocarpa [western balsam poplar]
gb|EKC39309.1|  Inhibitor of growth protein 5                         54.3    1e-05   Crassostrea gigas
ref|XP_008183349.1|  PREDICTED: inhibitor of growth protein 4-like    54.3    1e-05   Acyrthosiphon pisum
ref|XP_011432759.1|  PREDICTED: inhibitor of growth protein 5-like    54.3    1e-05   Crassostrea gigas
emb|CDY33693.1|  BnaC04g29580D                                        52.8    1e-05   Brassica napus [oilseed rape]
ref|XP_006362258.1|  PREDICTED: PHD finger protein ING2-like          54.3    1e-05   Solanum tuberosum [potatoes]
gb|ACU19850.1|  unknown                                               50.8    1e-05   Glycine max [soybeans]
ref|XP_010553805.1|  PREDICTED: PHD finger protein ING2               54.3    1e-05   
ref|XP_008429672.1|  PREDICTED: inhibitor of growth protein 4 iso...  54.3    1e-05   Poecilia reticulata
ref|XP_003385612.1|  PREDICTED: inhibitor of growth protein 5-like    54.3    1e-05   Amphimedon queenslandica
ref|XP_004249145.1|  PREDICTED: PHD finger protein ING2               54.3    2e-05   Solanum lycopersicum
ref|XP_004147532.1|  PREDICTED: PHD finger protein ING2-like          54.3    2e-05   Cucumis sativus [cucumbers]
gb|ETE65632.1|  Inhibitor of growth protein 4                         54.7    2e-05   Ophiophagus hannah
ref|XP_001364945.2|  PREDICTED: inhibitor of growth protein 4 iso...  53.9    2e-05   Monodelphis domestica
ref|XP_009124440.1|  PREDICTED: PHD finger protein ING2               54.3    2e-05   
gb|EHJ63393.1|  hypothetical protein KGM_06709                        54.7    2e-05   
ref|XP_006443408.1|  hypothetical protein CICLE_v10021354mg           54.3    2e-05   
ref|XP_007550173.1|  PREDICTED: inhibitor of growth protein 4 iso...  53.9    2e-05   Poecilia formosa
ref|XP_002525439.1|  Inhibitor of growth protein, putative            54.3    2e-05   Ricinus communis
ref|XP_008280187.1|  PREDICTED: inhibitor of growth protein 5         53.9    2e-05   Stegastes partitus
gb|KIH54551.1|  PHD-finger                                            53.9    2e-05   Ancylostoma duodenale
ref|XP_009015205.1|  hypothetical protein HELRODRAFT_184897           53.9    2e-05   Helobdella robusta
ref|XP_006479097.1|  PREDICTED: PHD finger protein ING2-like          53.9    2e-05   Citrus sinensis [apfelsine]
ref|XP_008305362.1|  PREDICTED: inhibitor of growth protein 5         53.9    2e-05   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_005610928.1|  PREDICTED: inhibitor of growth protein 4 iso...  53.9    2e-05   
ref|XP_008143061.1|  PREDICTED: inhibitor of growth protein 4 iso...  53.5    2e-05   
ref|XP_005610927.1|  PREDICTED: inhibitor of growth protein 4 iso...  53.5    2e-05   Equus caballus [domestic horse]
gb|ACQ58032.1|  Inhibitor of growth protein 4                         53.5    2e-05   Anoplopoma fimbria
ref|XP_005610926.1|  PREDICTED: inhibitor of growth protein 4 iso...  53.5    2e-05   
ref|XP_008143060.1|  PREDICTED: inhibitor of growth protein 4 iso...  53.5    2e-05   Eptesicus fuscus
ref|XP_009605784.1|  PREDICTED: PHD finger protein ING2               53.9    2e-05   Nicotiana tomentosiformis
ref|XP_008143059.1|  PREDICTED: inhibitor of growth protein 4 iso...  53.5    2e-05   Eptesicus fuscus
gb|EYB85652.1|  hypothetical protein Y032_0294g1639                   53.5    2e-05   Ancylostoma ceylanicum
ref|XP_002161789.2|  PREDICTED: uncharacterized protein LOC100215100  54.3    2e-05   
ref|XP_005610925.1|  PREDICTED: inhibitor of growth protein 4 iso...  53.5    3e-05   Equus caballus [domestic horse]
ref|XP_009793268.1|  PREDICTED: PHD finger protein ING2               53.5    3e-05   Nicotiana sylvestris
ref|XP_001496617.3|  PREDICTED: inhibitor of growth protein 4 iso...  53.5    3e-05   Equus caballus [domestic horse]
ref|XP_010672062.1|  PREDICTED: PHD finger protein ING2               53.5    3e-05   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008143058.1|  PREDICTED: inhibitor of growth protein 4 iso...  53.5    3e-05   Eptesicus fuscus
ref|XP_008143057.1|  PREDICTED: inhibitor of growth protein 4 iso...  53.5    3e-05   Eptesicus fuscus
ref|XP_006267091.1|  PREDICTED: d-2-hydroxyglutarate dehydrogenas...  54.3    3e-05   
ref|XP_008681775.1|  PREDICTED: inhibitor of growth protein 4 iso...  53.5    3e-05   Ursus maritimus [white bear]
ref|XP_006258138.1|  PREDICTED: inhibitor of growth protein 3 iso...  51.6    3e-05   
ref|XP_004596432.1|  PREDICTED: inhibitor of growth protein 4 iso...  53.1    3e-05   Ochotona princeps [southern American pika]
ref|XP_005338394.1|  PREDICTED: inhibitor of growth protein 4 iso...  53.1    3e-05   
ref|XP_011144407.1|  PREDICTED: inhibitor of growth protein 5 iso...  53.5    3e-05   Harpegnathos saltator
ref|XP_011144410.1|  PREDICTED: inhibitor of growth protein 5 iso...  53.5    3e-05   Harpegnathos saltator
ref|XP_004493148.1|  PREDICTED: PHD finger protein ING2-like          53.1    3e-05   Cicer arietinum [garbanzo]
ref|XP_004557236.1|  PREDICTED: inhibitor of growth protein 5-like    53.1    4e-05   Maylandia zebra
ref|XP_003439967.1|  PREDICTED: inhibitor of growth protein 5-lik...  53.1    4e-05   Oreochromis niloticus
ref|XP_005732313.1|  PREDICTED: inhibitor of growth protein 5-like    53.1    4e-05   Pundamilia nyererei
ref|XP_011144409.1|  PREDICTED: inhibitor of growth protein 5 iso...  53.1    4e-05   Harpegnathos saltator
ref|XP_007550686.1|  PREDICTED: inhibitor of growth protein 5         53.1    4e-05   Poecilia formosa
gb|KFK33297.1|  hypothetical protein AALP_AA6G356700                  51.6    4e-05   Arabis alpina [alpine rockcress]
ref|XP_007234439.1|  PREDICTED: inhibitor of growth protein 5-lik...  53.1    4e-05   
emb|CBY31229.1|  unnamed protein product                              52.8    4e-05   Oikopleura dioica
ref|NP_001007169.1|  inhibitor of growth                              52.8    4e-05   Danio rerio [leopard danio]
emb|CAD59105.1|  novel protein similar to human candidate tumor s...  52.8    4e-05   Danio rerio [leopard danio]
ref|XP_008681774.1|  PREDICTED: inhibitor of growth protein 4 iso...  53.1    4e-05   Ursus maritimus [white bear]
ref|XP_011494865.1|  PREDICTED: inhibitor of growth protein 4 iso...  53.1    4e-05   Ceratosolen solmsi marchali
ref|XP_010729341.1|  PREDICTED: inhibitor of growth protein 5 iso...  52.8    4e-05   
ref|XP_005815652.1|  PREDICTED: inhibitor of growth protein 5-like    52.8    4e-05   Xiphophorus maculatus
ref|XP_001745679.1|  hypothetical protein                             52.0    4e-05   Monosiga brevicollis MX1
ref|XP_008143063.1|  PREDICTED: inhibitor of growth protein 4 iso...  52.0    5e-05   Eptesicus fuscus
ref|XP_005610930.1|  PREDICTED: inhibitor of growth protein 4 iso...  52.0    5e-05   
ref|XP_004596433.1|  PREDICTED: inhibitor of growth protein 4 iso...  52.8    5e-05   Ochotona princeps [southern American pika]
ref|XP_009531554.1|  hypothetical protein PHYSODRAFT_511954           53.1    5e-05   Phytophthora sojae
gb|KIZ07723.1|  Inhibitor of growth protein 3                         52.8    5e-05   Monoraphidium neglectum
ref|XP_007903167.1|  PREDICTED: inhibitor of growth protein 3 iso...  53.1    5e-05   Callorhinchus milii [Australian ghost shark]
ref|XP_004915827.1|  PREDICTED: inhibitor of growth protein 4 iso...  52.8    5e-05   
ref|XP_008441974.1|  PREDICTED: PHD finger protein ING2               52.8    5e-05   Cucumis melo [Oriental melon]
ref|XP_008209258.1|  PREDICTED: inhibitor of growth protein 4 iso...  52.8    5e-05   
ref|XP_002163181.2|  PREDICTED: inhibitor of growth protein 4-like    52.4    5e-05   
gb|KDP42993.1|  hypothetical protein JCGZ_25179                       52.8    5e-05   Jatropha curcas
ref|XP_005923335.1|  PREDICTED: inhibitor of growth protein 5-like    52.4    5e-05   
ref|XP_011364157.1|  PREDICTED: inhibitor of growth protein 4 iso...  52.4    5e-05   Pteropus vampyrus
ref|XP_001602605.2|  PREDICTED: inhibitor of growth protein 5 iso...  52.8    5e-05   Nasonia vitripennis
ref|XP_005338393.1|  PREDICTED: inhibitor of growth protein 4 iso...  52.8    5e-05   Ictidomys tridecemlineatus
ref|XP_005338395.1|  PREDICTED: inhibitor of growth protein 4 iso...  52.8    5e-05   
ref|XP_008071440.1|  PREDICTED: inhibitor of growth protein 4         51.6    5e-05   Carlito syrichta
ref|XP_011144412.1|  PREDICTED: inhibitor of growth protein 4 iso...  52.8    5e-05   
ref|XP_010293971.1|  PREDICTED: inhibitor of growth protein 4 iso...  52.8    5e-05   Phaethon lepturus
ref|XP_008939061.1|  PREDICTED: inhibitor of growth protein 4         52.8    5e-05   Merops nubicus
ref|XP_005338391.1|  PREDICTED: inhibitor of growth protein 4 iso...  52.8    6e-05   Ictidomys tridecemlineatus
ref|XP_005338390.1|  PREDICTED: inhibitor of growth protein 4 iso...  52.8    6e-05   Ictidomys tridecemlineatus
ref|XP_011309401.1|  PREDICTED: inhibitor of growth protein 5         52.8    6e-05   Fopius arisanus
ref|XP_010112433.1|  PHD finger protein ING2                          52.8    6e-05   
ref|XP_005798822.1|  PREDICTED: inhibitor of growth protein 4-lik...  52.8    6e-05   
ref|XP_004610513.1|  PREDICTED: inhibitor of growth protein 4 iso...  52.4    6e-05   Sorex araneus [Eurasian shrew]
ref|XP_005338392.1|  PREDICTED: inhibitor of growth protein 4 iso...  52.4    6e-05   Ictidomys tridecemlineatus
ref|XP_010134965.1|  PREDICTED: inhibitor of growth protein 4         52.4    6e-05   Buceros rhinoceros silvestris
emb|CDQ71398.1|  unnamed protein product                              52.4    6e-05   Oncorhynchus mykiss
emb|CCD78730.1|  putative inhibitor of growth family, member 5        52.0    6e-05   Schistosoma mansoni
ref|XP_009997293.1|  PREDICTED: inhibitor of growth protein 4         52.4    7e-05   Chaetura pelagica
ref|XP_004596430.1|  PREDICTED: inhibitor of growth protein 4 iso...  52.4    7e-05   Ochotona princeps [southern American pika]
ref|XP_004596431.1|  PREDICTED: inhibitor of growth protein 4 iso...  52.4    7e-05   Ochotona princeps [southern American pika]
ref|XP_002325414.2|  PHD finger family protein                        52.4    7e-05   Populus trichocarpa [western balsam poplar]
ref|XP_004915826.1|  PREDICTED: inhibitor of growth protein 4 iso...  52.4    7e-05   
emb|CDS11271.1|  hypothetical protein LRAMOSA03534                    52.4    7e-05   Lichtheimia ramosa
ref|XP_002941731.2|  PREDICTED: inhibitor of growth protein 4 iso...  52.4    7e-05   
gb|EPQ12350.1|  Inhibitor of growth protein 4                         52.0    7e-05   Myotis brandtii
ref|XP_004915828.1|  PREDICTED: inhibitor of growth protein 4 iso...  52.4    7e-05   
ref|XP_011010131.1|  PREDICTED: PHD finger protein ING2-like          52.4    7e-05   Populus euphratica
gb|EFN81277.1|  Inhibitor of growth protein 4                         52.4    8e-05   Harpegnathos saltator
ref|XP_008681772.1|  PREDICTED: inhibitor of growth protein 4 iso...  52.4    8e-05   Ursus maritimus [white bear]
gb|EDM15143.1|  inhibitor of growth family, member 3, isoform CRA_c   52.4    8e-05   Rattus norvegicus [brown rat]
ref|XP_004708176.1|  PREDICTED: inhibitor of growth protein 4 iso...  52.4    8e-05   Echinops telfairi [lesser hedgehog tenrec]
ref|XP_007935295.1|  PREDICTED: inhibitor of growth protein 4 iso...  52.0    8e-05   Orycteropus afer afer
ref|XP_004610512.1|  PREDICTED: inhibitor of growth protein 4 iso...  52.0    8e-05   Sorex araneus [Eurasian shrew]
ref|NP_001121056.1|  inhibitor of growth protein 4 isoform 4          52.0    8e-05   Homo sapiens [man]
ref|XP_004708175.1|  PREDICTED: inhibitor of growth protein 4 iso...  52.0    8e-05   Echinops telfairi [lesser hedgehog tenrec]
ref|XP_004915825.1|  PREDICTED: inhibitor of growth protein 4 iso...  52.4    8e-05   
ref|XP_008971956.1|  PREDICTED: inhibitor of growth protein 4 iso...  52.0    8e-05   Pan paniscus [bonobo]
ref|XP_006210923.1|  PREDICTED: inhibitor of growth protein 4 iso...  52.0    8e-05   Vicugna pacos
ref|XP_011158461.1|  PREDICTED: inhibitor of growth protein 5 iso...  52.4    8e-05   Solenopsis invicta [imported red fire ant]
ref|XP_006210924.1|  PREDICTED: inhibitor of growth protein 4 iso...  52.0    8e-05   
ref|XP_004931798.1|  PREDICTED: inhibitor of growth protein 3-like    52.8    8e-05   Bombyx mori [silk moth]
ref|XP_007161931.1|  hypothetical protein PHAVU_001G109900g           52.4    8e-05   Phaseolus vulgaris [French bean]
ref|XP_004708177.1|  PREDICTED: inhibitor of growth protein 4 iso...  52.0    8e-05   Echinops telfairi [lesser hedgehog tenrec]
ref|XP_009919780.1|  PREDICTED: inhibitor of growth protein 4 iso...  52.4    8e-05   Haliaeetus albicilla
ref|XP_004643602.1|  PREDICTED: inhibitor of growth protein 4 iso...  52.0    8e-05   
ref|XP_004708173.1|  PREDICTED: inhibitor of growth protein 4 iso...  52.0    8e-05   Echinops telfairi [lesser hedgehog tenrec]
ref|XP_004692943.1|  PREDICTED: inhibitor of growth protein 4 iso...  52.0    8e-05   
ref|XP_011466835.1|  PREDICTED: PHD finger protein ING2-like isof...  52.0    8e-05   
ref|XP_010895170.1|  PREDICTED: inhibitor of growth protein 4-like    52.0    8e-05   
ref|XP_004708174.1|  PREDICTED: inhibitor of growth protein 4 iso...  52.0    8e-05   
ref|XP_004915824.1|  PREDICTED: inhibitor of growth protein 4 iso...  52.4    8e-05   
ref|XP_008971955.1|  PREDICTED: inhibitor of growth protein 4 iso...  52.0    8e-05   
ref|XP_006210922.1|  PREDICTED: inhibitor of growth protein 4 iso...  52.0    8e-05   
ref|XP_004692942.1|  PREDICTED: inhibitor of growth protein 4 iso...  52.0    8e-05   
ref|XP_011158462.1|  PREDICTED: inhibitor of growth protein 5 iso...  52.0    8e-05   
ref|XP_007935294.1|  PREDICTED: inhibitor of growth protein 4 iso...  52.0    8e-05   
ref|XP_005637287.1|  PREDICTED: inhibitor of growth protein 4 iso...  52.0    8e-05   
ref|NP_001121055.1|  inhibitor of growth protein 4 isoform 3          52.0    8e-05   
ref|XP_002712933.1|  PREDICTED: inhibitor of growth protein 4 iso...  52.0    9e-05   
ref|NP_057246.2|  inhibitor of growth protein 4 isoform 1             52.0    9e-05   
ref|XP_853656.2|  PREDICTED: inhibitor of growth protein 4 isoformX2  52.0    9e-05   
ref|XP_007935291.1|  PREDICTED: inhibitor of growth protein 4 iso...  52.0    9e-05   
ref|XP_005637286.1|  PREDICTED: inhibitor of growth protein 4 iso...  52.0    9e-05   
ref|NP_001121054.1|  inhibitor of growth protein 4 isoform 9          52.0    9e-05   
ref|XP_007537092.1|  PREDICTED: inhibitor of growth protein 4 iso...  52.0    9e-05   
ref|XP_004766743.1|  PREDICTED: inhibitor of growth protein 4 iso...  52.0    9e-05   
ref|XP_008971954.1|  PREDICTED: inhibitor of growth protein 4 iso...  52.0    9e-05   
ref|XP_002922286.1|  PREDICTED: inhibitor of growth protein 4 iso...  52.0    9e-05   
ref|XP_003410690.1|  PREDICTED: inhibitor of growth protein 4 iso...  52.0    9e-05   
ref|XP_003820347.1|  PREDICTED: inhibitor of growth protein 4 iso...  52.0    9e-05   
ref|XP_007537091.1|  PREDICTED: inhibitor of growth protein 4 iso...  52.0    9e-05   
ref|XP_002428669.1|  Inhibitor of growth protein, putative            52.0    9e-05   
ref|XP_004692941.1|  PREDICTED: inhibitor of growth protein 4 iso...  52.0    9e-05   
gb|AFK43470.1|  unknown                                               52.0    9e-05   
gb|EDL13850.1|  inhibitor of growth family, member 3, isoform CRA_a   52.0    9e-05   
ref|XP_004692940.1|  PREDICTED: inhibitor of growth protein 4 iso...  52.0    9e-05   
ref|XP_010935809.1|  PREDICTED: PHD finger protein ING2               52.0    9e-05   
ref|XP_004692939.1|  PREDICTED: inhibitor of growth protein 4 iso...  52.0    9e-05   
ref|XP_011467588.1|  PREDICTED: PHD finger protein ING2 isoform X1    52.0    9e-05   
ref|XP_007537090.1|  PREDICTED: inhibitor of growth protein 4 iso...  52.0    9e-05   
ref|XP_004766742.1|  PREDICTED: inhibitor of growth protein 4 iso...  52.0    9e-05   
ref|XP_007537089.1|  PREDICTED: inhibitor of growth protein 4 iso...  52.0    9e-05   
ref|XP_008681771.1|  PREDICTED: inhibitor of growth protein 4 iso...  52.0    9e-05   
ref|XP_011466834.1|  PREDICTED: PHD finger protein ING2-like isof...  52.0    9e-05   
ref|NP_076115.3|  inhibitor of growth protein 3                       52.4    9e-05   
ref|XP_007258320.1|  PREDICTED: inhibitor of growth protein 4-like    52.0    9e-05   
gb|AAH13038.2|  ING4 protein                                          52.0    9e-05   
ref|NP_001187381.1|  inhibitor of growth protein 5                    52.0    1e-04   
ref|XP_003221270.1|  PREDICTED: inhibitor of growth protein 3 iso...  52.4    1e-04   
ref|XP_004766741.1|  PREDICTED: inhibitor of growth protein 4 iso...  52.0    1e-04   
ref|XP_008109387.1|  PREDICTED: inhibitor of growth protein 3 iso...  52.4    1e-04   
ref|XP_004766740.1|  PREDICTED: inhibitor of growth protein 4 iso...  52.0    1e-04   
ref|XP_006859382.1|  PREDICTED: inhibitor of growth protein 3         52.4    1e-04   
ref|XP_001082715.1|  PREDICTED: inhibitor of growth protein 3         52.4    1e-04   
ref|NP_001029279.1|  inhibitor of growth protein 3                    52.4    1e-04   
ref|XP_004897241.1|  PREDICTED: inhibitor of growth protein 3 iso...  52.4    1e-04   
ref|XP_003407285.1|  PREDICTED: inhibitor of growth protein 3         52.4    1e-04   
ref|XP_008296409.1|  PREDICTED: inhibitor of growth protein 4 iso...  52.0    1e-04   
ref|XP_002136791.1|  GA22529                                          52.0    1e-04   
ref|XP_004458524.1|  PREDICTED: inhibitor of growth protein 3 iso...  52.4    1e-04   
ref|XP_008429673.1|  PREDICTED: inhibitor of growth protein 4 iso...  52.0    1e-04   
ref|XP_005242541.1|  PREDICTED: inhibitor of growth protein 3         52.4    1e-04   
ref|XP_001365018.1|  PREDICTED: inhibitor of growth protein 3 iso...  52.4    1e-04   
ref|XP_008565563.1|  PREDICTED: inhibitor of growth protein 3         52.4    1e-04   
ref|XP_004677034.1|  PREDICTED: inhibitor of growth protein 3         52.4    1e-04   
ref|NP_001231197.1|  inhibitor of growth protein 3                    52.4    1e-04   
ref|XP_006236202.1|  PREDICTED: inhibitor of growth protein 3 iso...  52.4    1e-04   
ref|XP_005112780.1|  PREDICTED: inhibitor of growth protein 5-like    52.0    1e-04   
ref|XP_007550174.1|  PREDICTED: inhibitor of growth protein 4 iso...  52.0    1e-04   
ref|XP_006862717.1|  PREDICTED: inhibitor of growth protein 4 iso...  50.8    1e-04   
ref|XP_007951001.1|  PREDICTED: inhibitor of growth protein 3         52.4    1e-04   
ref|XP_004413958.1|  PREDICTED: inhibitor of growth protein 4 iso...  51.6    1e-04   
ref|XP_006258135.1|  PREDICTED: inhibitor of growth protein 3 iso...  52.4    1e-04   
ref|XP_003288959.1|  hypothetical protein DICPUDRAFT_48259            52.0    1e-04   
ref|XP_004856512.1|  PREDICTED: inhibitor of growth protein 3 iso...  52.4    1e-04   
ref|XP_003771603.1|  PREDICTED: inhibitor of growth protein 3         52.4    1e-04   
ref|XP_002712152.1|  PREDICTED: inhibitor of growth protein 3 iso...  52.4    1e-04   
ref|XP_010633640.1|  PREDICTED: inhibitor of growth protein 3 iso...  52.0    1e-04   
ref|XP_010633639.1|  PREDICTED: inhibitor of growth protein 3 iso...  52.4    1e-04   
ref|XP_003463303.1|  PREDICTED: inhibitor of growth protein 4 iso...  51.6    1e-04   
ref|XP_010870161.1|  PREDICTED: inhibitor of growth protein 5         51.6    1e-04   
ref|XP_007980901.1|  PREDICTED: inhibitor of growth protein 3 iso...  52.4    1e-04   
ref|XP_002752122.1|  PREDICTED: inhibitor of growth protein 3 iso...  52.4    1e-04   
ref|XP_003921096.1|  PREDICTED: inhibitor of growth protein 3 iso...  52.4    1e-04   
gb|ETI37436.1|  hypothetical protein F443_16573                       52.0    1e-04   
gb|EFZ18893.1|  hypothetical protein SINV_00251                       51.6    1e-04   
ref|XP_005519293.1|  PREDICTED: inhibitor of growth protein 3 iso...  52.0    1e-04   
ref|XP_008155807.1|  PREDICTED: inhibitor of growth protein 3 iso...  52.0    1e-04   
ref|XP_004386601.1|  PREDICTED: inhibitor of growth protein 3 iso...  52.0    1e-04   
ref|XP_003896556.1|  PREDICTED: inhibitor of growth protein 3 iso...  52.0    1e-04   
gb|AAG43153.1|AF063594_1  brain my036 protein                         52.0    1e-04   
ref|XP_007459395.1|  PREDICTED: inhibitor of growth protein 3 iso...  52.0    1e-04   
ref|XP_004658640.1|  PREDICTED: inhibitor of growth protein 3         52.0    1e-04   
ref|XP_005885547.1|  PREDICTED: inhibitor of growth protein 3 iso...  52.0    1e-04   
ref|XP_002922476.1|  PREDICTED: inhibitor of growth protein 3 iso...  52.0    1e-04   
ref|XP_006994551.1|  PREDICTED: inhibitor of growth protein 3 iso...  52.0    1e-04   
ref|XP_007177318.1|  PREDICTED: inhibitor of growth protein 3 iso...  52.0    1e-04   
gb|ETP35369.1|  hypothetical protein F442_16416                       52.0    1e-04   
ref|XP_005402365.1|  PREDICTED: inhibitor of growth protein 3 iso...  52.0    1e-04   
ref|XP_004741951.1|  PREDICTED: inhibitor of growth protein 3 iso...  52.0    1e-04   
ref|XP_004418820.1|  PREDICTED: inhibitor of growth protein 3         52.0    1e-04   
ref|XP_004265564.1|  PREDICTED: inhibitor of growth protein 3         52.0    1e-04   
ref|XP_001502102.1|  PREDICTED: inhibitor of growth protein 3 iso...  52.0    1e-04   
gb|ETO66214.1|  hypothetical protein F444_16550                       52.0    1e-04   
ref|XP_005363826.1|  PREDICTED: inhibitor of growth protein 3 iso...  52.0    1e-04   
ref|XP_004789473.1|  PREDICTED: inhibitor of growth protein 3 iso...  52.0    1e-04   
ref|NP_001025904.1|  inhibitor of growth protein 3                    52.0    1e-04   
ref|XP_008827106.1|  PREDICTED: inhibitor of growth protein 3         52.0    1e-04   
ref|XP_532530.2|  PREDICTED: inhibitor of growth protein 3 isoformX3  52.0    1e-04   
ref|XP_007525069.1|  PREDICTED: inhibitor of growth protein 3         52.0    1e-04   
ref|NP_061944.2|  inhibitor of growth protein 3 isoform 1             52.0    1e-04   
dbj|BAA90942.1|  unnamed protein product                              52.0    1e-04   
ref|XP_003475193.1|  PREDICTED: inhibitor of growth protein 3         52.0    1e-04   
ref|XP_006505228.1|  PREDICTED: inhibitor of growth protein 3 iso...  52.0    1e-04   
ref|XP_006994550.1|  PREDICTED: inhibitor of growth protein 3 iso...  52.0    1e-04   
ref|XP_010342053.1|  PREDICTED: inhibitor of growth protein 3 iso...  52.0    1e-04   
ref|XP_005305715.1|  PREDICTED: inhibitor of growth protein 3 iso...  52.0    1e-04   
ref|XP_006910636.1|  PREDICTED: inhibitor of growth protein 3         52.0    1e-04   
gb|KDD71874.1|  hypothetical protein H632_c4250p0                     50.1    1e-04   
gb|EAW88771.1|  inhibitor of growth family, member 4, isoform CRA_i   51.6    1e-04   
ref|XP_005338397.1|  PREDICTED: inhibitor of growth protein 4 iso...  50.8    1e-04   
ref|XP_007177315.1|  PREDICTED: inhibitor of growth protein 3 iso...  52.0    1e-04   
ref|XP_004404465.1|  PREDICTED: inhibitor of growth protein 3         52.0    1e-04   
emb|CAC48260.2|  hypothetical protein                                 52.0    1e-04   
ref|XP_005482011.1|  PREDICTED: inhibitor of growth protein 3 iso...  52.0    1e-04   
ref|XP_008704030.1|  PREDICTED: inhibitor of growth protein 3         52.0    1e-04   
ref|XP_005679445.1|  PREDICTED: inhibitor of growth protein 3 iso...  52.0    1e-04   
ref|XP_005894473.1|  PREDICTED: inhibitor of growth protein 3         52.0    1e-04   
ref|XP_007177317.1|  PREDICTED: inhibitor of growth protein 3 iso...  52.0    1e-04   
ref|XP_008062071.1|  PREDICTED: inhibitor of growth protein 3         52.0    1e-04   
ref|NP_001179873.1|  inhibitor of growth protein 3                    52.0    1e-04   
ref|XP_006202291.1|  PREDICTED: inhibitor of growth protein 3         52.0    1e-04   
ref|XP_005798823.1|  PREDICTED: inhibitor of growth protein 4-lik...  51.6    1e-04   
ref|XP_005078102.1|  PREDICTED: inhibitor of growth protein 3         52.0    1e-04   
ref|XP_004869479.1|  PREDICTED: inhibitor of growth protein 4 iso...  51.6    1e-04   
emb|CDH54340.1|  inhibitor of growth protein 4                        51.6    1e-04   
ref|XP_005482012.1|  PREDICTED: inhibitor of growth protein 3 iso...  52.0    1e-04   
ref|XP_005402367.1|  PREDICTED: inhibitor of growth protein 3 iso...  52.0    1e-04   
ref|XP_010866568.1|  PREDICTED: inhibitor of growth protein 3         52.0    1e-04   
ref|XP_008911782.1|  hypothetical protein PPTG_15786                  51.6    1e-04   
ref|XP_005519294.1|  PREDICTED: inhibitor of growth protein 3 iso...  52.0    1e-04   
ref|XP_007246225.1|  PREDICTED: inhibitor of growth protein 5-like    51.6    1e-04   
ref|XP_006929386.1|  PREDICTED: inhibitor of growth protein 3 iso...  52.0    1e-04   
ref|XP_005402366.1|  PREDICTED: inhibitor of growth protein 3 iso...  52.0    1e-04   
gb|EAW83546.1|  inhibitor of growth family, member 3, isoform CRA_a   52.0    1e-04   
ref|XP_006882733.1|  PREDICTED: inhibitor of growth protein 3         52.0    1e-04   
ref|XP_003983028.1|  PREDICTED: inhibitor of growth protein 3 iso...  52.0    1e-04   
gb|EAW83548.1|  inhibitor of growth family, member 3, isoform CRA_c   52.0    1e-04   
ref|XP_006122622.1|  PREDICTED: inhibitor of growth protein 3 iso...  52.0    1e-04   
ref|XP_004909501.1|  PREDICTED: inhibitor of growth protein 4 iso...  51.6    1e-04   
ref|NP_001018304.1|  inhibitor of growth protein 4                    51.6    1e-04   
dbj|BAE87748.1|  unnamed protein product                              50.1    1e-04   
ref|XP_006633380.1|  PREDICTED: inhibitor of growth protein 3-like    52.0    1e-04   
ref|XP_007030707.1|  PHD finger protein-related isoform 1             51.6    1e-04   
ref|XP_005998691.1|  PREDICTED: inhibitor of growth protein 3 iso...  52.0    1e-04   
ref|XP_005971395.1|  PREDICTED: inhibitor of growth protein 3         52.0    2e-04   
ref|XP_011227249.1|  PREDICTED: inhibitor of growth protein 3 iso...  50.1    2e-04   
ref|XP_010579613.1|  PREDICTED: inhibitor of growth protein 3         52.0    2e-04   
emb|CAG32209.1|  hypothetical protein RCJMB04_20c2                    51.2    2e-04   
ref|XP_007504265.1|  PREDICTED: inhibitor of growth protein 3 iso...  51.6    2e-04   
ref|XP_002055268.1|  GJ18885                                          52.0    2e-04   
ref|XP_008296410.1|  PREDICTED: inhibitor of growth protein 4 iso...  51.2    2e-04   
ref|XP_005998690.1|  PREDICTED: inhibitor of growth protein 3 iso...  52.0    2e-04   
emb|CAF90810.1|  unnamed protein product                              51.6    2e-04   
ref|XP_006170879.1|  PREDICTED: inhibitor of growth protein 4 iso...  50.1    2e-04   
ref|XP_002065118.1|  GK15283                                          51.6    2e-04   
ref|XP_006013539.1|  PREDICTED: inhibitor of growth protein 5 iso...  49.3    2e-04   
ref|XP_007177316.1|  PREDICTED: inhibitor of growth protein 3 iso...  51.6    2e-04   
ref|XP_004387272.1|  PREDICTED: inhibitor of growth protein 4 iso...  50.4    2e-04   
gb|EDM15144.1|  inhibitor of growth family, member 3, isoform CRA_d   49.3    2e-04   
ref|XP_008109390.1|  PREDICTED: inhibitor of growth protein 3 iso...  51.2    2e-04   
ref|XP_003463302.1|  PREDICTED: inhibitor of growth protein 4 iso...  51.2    2e-04   
ref|XP_011263899.1|  PREDICTED: inhibitor of growth protein 5         51.2    2e-04   
ref|XP_004909499.1|  PREDICTED: inhibitor of growth protein 4 iso...  51.2    2e-04   
ref|XP_004596435.1|  PREDICTED: inhibitor of growth protein 4 iso...  50.4    2e-04   
ref|XP_005365281.1|  PREDICTED: inhibitor of growth protein 4 iso...  51.2    2e-04   
dbj|BAC27489.1|  unnamed protein product                              51.2    2e-04   
ref|XP_005529563.1|  PREDICTED: inhibitor of growth protein 5         51.2    2e-04   
ref|XP_001357330.2|  GA21675                                          51.2    2e-04   
ref|XP_010782962.1|  PREDICTED: inhibitor of growth protein 4         51.2    2e-04   
ref|XP_004708179.1|  PREDICTED: inhibitor of growth protein 4 iso...  50.1    2e-04   
gb|AAI67048.1|  Ing5 protein                                          51.2    2e-04   
ref|XP_007469480.1|  PREDICTED: inhibitor of growth protein 4 iso...  51.2    2e-04   
ref|XP_003973902.1|  PREDICTED: inhibitor of growth protein 5-lik...  51.2    2e-04   
ref|XP_004909498.1|  PREDICTED: inhibitor of growth protein 4 iso...  51.2    2e-04   
ref|XP_003789835.1|  PREDICTED: inhibitor of growth protein 3         51.6    2e-04   
ref|XP_003403128.1|  PREDICTED: inhibitor of growth protein 5-lik...  51.2    2e-04   
ref|NP_001073356.1|  inhibitor of growth protein 4                    51.2    2e-04   
ref|XP_008787440.1|  PREDICTED: PHD finger protein ING2 isoform X1    51.2    2e-04   
ref|XP_006237411.1|  PREDICTED: inhibitor of growth protein 4 iso...  51.2    2e-04   
ref|XP_005000726.1|  PREDICTED: inhibitor of growth protein 4 iso...  51.2    2e-04   
ref|XP_004643361.1|  PREDICTED: inhibitor of growth protein 3         51.2    2e-04   
ref|XP_004909500.1|  PREDICTED: inhibitor of growth protein 4 iso...  51.2    2e-04   
gb|EAW88769.1|  inhibitor of growth family, member 4, isoform CRA_h   50.8    2e-04   
ref|XP_004909497.1|  PREDICTED: inhibitor of growth protein 4 iso...  51.2    2e-04   
ref|XP_004643601.1|  PREDICTED: inhibitor of growth protein 4 iso...  51.2    2e-04   
ref|XP_004909496.1|  PREDICTED: inhibitor of growth protein 4 iso...  51.2    2e-04   
ref|XP_005171330.1|  PREDICTED: inhibitor of growth isoform X1        51.2    2e-04   
ref|XP_004869477.1|  PREDICTED: inhibitor of growth protein 4 iso...  51.2    2e-04   
ref|NP_001026483.1|  inhibitor of growth protein 5                    50.8    2e-04   
ref|XP_005378861.1|  PREDICTED: inhibitor of growth protein 4 iso...  51.2    2e-04   
ref|XP_004869476.1|  PREDICTED: inhibitor of growth protein 4 iso...  51.2    2e-04   
ref|XP_004643600.1|  PREDICTED: inhibitor of growth protein 4 iso...  51.2    2e-04   
ref|XP_004643598.1|  PREDICTED: inhibitor of growth protein 4 iso...  51.2    2e-04   
ref|XP_011069174.1|  PREDICTED: inhibitor of growth protein 5         51.2    2e-04   
ref|XP_007030708.1|  PHD finger protein-related isoform 2             51.2    2e-04   
ref|XP_005361420.1|  PREDICTED: inhibitor of growth protein 5 iso...  50.8    2e-04   
ref|XP_007935297.1|  PREDICTED: inhibitor of growth protein 4 iso...  50.1    2e-04   
ref|XP_007537094.1|  PREDICTED: inhibitor of growth protein 4 iso...  50.1    2e-04   
ref|XP_002042170.1|  GM25576                                          51.2    2e-04   
gb|KJB45080.1|  hypothetical protein B456_007G288500                  51.2    2e-04   
ref|XP_004869475.1|  PREDICTED: inhibitor of growth protein 4 iso...  51.2    2e-04   
ref|XP_004869474.1|  PREDICTED: inhibitor of growth protein 4 iso...  51.2    2e-04   
gb|EFN63120.1|  Inhibitor of growth protein 4                         51.2    2e-04   
ref|XP_004869478.1|  PREDICTED: inhibitor of growth protein 4 iso...  50.8    2e-04   
ref|NP_579923.1|  inhibitor of growth protein 4                       51.2    2e-04   
ref|XP_003463301.1|  PREDICTED: inhibitor of growth protein 4 iso...  51.2    2e-04   
ref|XP_004411326.1|  PREDICTED: inhibitor of growth protein 4-lik...  50.8    2e-04   
ref|XP_007469477.1|  PREDICTED: inhibitor of growth protein 4 iso...  50.8    2e-04   
ref|XP_007469476.1|  PREDICTED: inhibitor of growth protein 4 iso...  50.8    2e-04   
ref|XP_005569990.1|  PREDICTED: inhibitor of growth protein 4 iso...  50.1    2e-04   
ref|XP_002079334.1|  GD22064                                          51.2    2e-04   
ref|XP_002018890.1|  GL25709                                          50.4    2e-04   
ref|XP_005361419.1|  PREDICTED: inhibitor of growth protein 5 iso...  50.8    2e-04   
ref|XP_005361418.1|  PREDICTED: inhibitor of growth protein 5 iso...  50.8    2e-04   
ref|XP_004413960.1|  PREDICTED: inhibitor of growth protein 4 iso...  50.1    2e-04   
ref|XP_006237412.1|  PREDICTED: inhibitor of growth protein 4 iso...  50.8    2e-04   



>gb|KDP33374.1| hypothetical protein JCGZ_12923 [Jatropha curcas]
Length=240

 Score =   229 bits (583),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 130/184 (71%), Positives = 153/184 (83%), Gaps = 9/184 (5%)
 Frame = +3

Query  36   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  215
            MSF+DEF+ NLE LPNILQKKY L+RDLD+SLQE+QRQN+QRC+ E+ED+K+ +K GNI 
Sbjct  1    MSFLDEFQANLESLPNILQKKYALLRDLDKSLQEIQRQNEQRCEQEIEDIKRGVKVGNIT  60

Query  216  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  395
             D+SLI+FSD+ LDEQKH+IRIADEKVALA+QAYDLVD HIQQLDQYLKKFDEELRR  E
Sbjct  61   PDTSLIRFSDETLDEQKHSIRIADEKVALAVQAYDLVDAHIQQLDQYLKKFDEELRR--E  118

Query  396  RENAVATGSTTSNVDNNVksgrsgdsskggrkkTRL-------ATATPAANPTGMDLDLP  554
            RENA AT S  S+VD + KSGR G+S +GGRKKTRL        TA  +ANPTGM+LD P
Sbjct  119  RENAAATASPGSSVDGSAKSGRGGESGRGGRKKTRLATAAAEATTAATSANPTGMELDCP  178

Query  555  VDPS  566
            VDP+
Sbjct  179  VDPN  182



>ref|XP_002518170.1| Inhibitor of growth protein, putative [Ricinus communis]
 gb|EEF44303.1| Inhibitor of growth protein, putative [Ricinus communis]
Length=242

 Score =   226 bits (575),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 128/186 (69%), Positives = 154/186 (83%), Gaps = 11/186 (6%)
 Frame = +3

Query  36   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  215
            MSF+DEF+ NLE LPNILQKKY L+RDLD+SLQE+QRQN+QRC+ E+ED+K+ +K+GNI 
Sbjct  1    MSFLDEFQANLESLPNILQKKYALLRDLDKSLQEIQRQNEQRCEREIEDIKRGVKAGNIT  60

Query  216  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  395
             D+SLI+FSDDALDEQKH+IRIADEKV LA+QAYDLVD HIQQLDQYLKKFDEELRR  E
Sbjct  61   PDTSLIRFSDDALDEQKHSIRIADEKVTLAVQAYDLVDAHIQQLDQYLKKFDEELRR--E  118

Query  396  RENAVATGSTTSNVDNNVksgrsgdsskggrkkTRL---------ATATPAANPTGMDLD  548
            RE+A AT   +S++D + K+GRS D  +GGRKKTRL         ATA  +ANPTGM+LD
Sbjct  119  RESATATALPSSSLDGSAKTGRSSDGGRGGRKKTRLATASAVTEAATAATSANPTGMELD  178

Query  549  LPVDPS  566
             PVDP+
Sbjct  179  CPVDPN  184



>ref|XP_009785672.1| PREDICTED: PHD finger protein ING1 isoform X1 [Nicotiana sylvestris]
Length=239

 Score =   225 bits (574),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 129/184 (70%), Positives = 146/184 (79%), Gaps = 10/184 (5%)
 Frame = +3

Query  36   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  215
            MSFIDEF+ N+E LPN L++KY L+RDLD+SLQ VQRQN+QRC+ E+EDM QRIK+GN+ 
Sbjct  1    MSFIDEFQANIEALPNHLRRKYALLRDLDKSLQGVQRQNEQRCEKEIEDMIQRIKAGNVT  60

Query  216  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  395
             DSSLIKFSDDALDEQKHAIRIADEKVALA QAYDLVD HIQQLDQYLKKFDEELRR  E
Sbjct  61   PDSSLIKFSDDALDEQKHAIRIADEKVALASQAYDLVDAHIQQLDQYLKKFDEELRR--E  118

Query  396  RENAVATGSTTSNVDNNVksgrsgdsskggrkkTRL-------ATATPAANPTGMDLDLP  554
            R+ AV TG+  + V+NN          KGGRKKTRL       ATA  AA P+GMDLDLP
Sbjct  119  RDVAVVTGTPATTVENN-GKSGRSGEGKGGRKKTRLATAAAATATAAAAATPSGMDLDLP  177

Query  555  VDPS  566
            VDP+
Sbjct  178  VDPN  181



>ref|XP_006420512.1| hypothetical protein CICLE_v10005726mg [Citrus clementina]
 gb|ESR33752.1| hypothetical protein CICLE_v10005726mg [Citrus clementina]
 gb|KDO43052.1| hypothetical protein CISIN_1g025753mg [Citrus sinensis]
Length=246

 Score =   224 bits (571),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 126/190 (66%), Positives = 152/190 (80%), Gaps = 15/190 (8%)
 Frame = +3

Query  36   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  215
            MSF+DEF+ NLE LPNILQKKY L+RDLD+SLQE+QRQN+QRC+ E+ED+ + I++GNI 
Sbjct  1    MSFLDEFQANLESLPNILQKKYALLRDLDKSLQEIQRQNEQRCEQEIEDLMREIRAGNIT  60

Query  216  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  395
             ++SLI+FSDDALDEQKH+IRIADEKVALA+QAYDLVDTHIQQLDQYLK FDEELRR  E
Sbjct  61   PNTSLIRFSDDALDEQKHSIRIADEKVALAVQAYDLVDTHIQQLDQYLKNFDEELRR--E  118

Query  396  RENAVATGSTTSNVDNNVksgrsgdsskggrkkTRL-------------ATATPAANPTG  536
            R++   T S   ++D + KSGRS +  +GGRKKTRL             A ATP ANPTG
Sbjct  119  RDSVATTASPAPSLDGSTKSGRSSEGGRGGRKKTRLATAAAAAAAAVTEAAATPVANPTG  178

Query  537  MDLDLPVDPS  566
            M+LDLPVDP+
Sbjct  179  MELDLPVDPN  188



>ref|XP_006492151.1| PREDICTED: PHD finger protein ING1-like [Citrus sinensis]
Length=246

 Score =   224 bits (570),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 126/190 (66%), Positives = 151/190 (79%), Gaps = 15/190 (8%)
 Frame = +3

Query  36   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  215
            MSF+DEF+ NLE LPNILQKKY L+RDLD+SLQE+QRQN+QRC+ E+ED+ + I++GNI 
Sbjct  1    MSFLDEFQANLESLPNILQKKYALLRDLDKSLQEIQRQNEQRCEQEIEDLMREIRAGNIT  60

Query  216  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  395
             ++SLI+FSDDALDEQKH+IRIADEKVALA+QAYDLVDTHIQQLDQYLK FDEELRR  E
Sbjct  61   PNTSLIRFSDDALDEQKHSIRIADEKVALAVQAYDLVDTHIQQLDQYLKNFDEELRR--E  118

Query  396  RENAVATGSTTSNVDNNVksgrsgdsskggrkkTRL-------------ATATPAANPTG  536
            R++   T S    +D + KSGRS +  +GGRKKTRL             A ATP ANPTG
Sbjct  119  RDSVATTASPAPTLDGSTKSGRSSEGGRGGRKKTRLATAAAAAAAAVTEAAATPVANPTG  178

Query  537  MDLDLPVDPS  566
            M+LDLPVDP+
Sbjct  179  MELDLPVDPN  188



>ref|XP_004247811.1| PREDICTED: PHD finger protein ING1 [Solanum lycopersicum]
Length=236

 Score =   223 bits (567),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 125/181 (69%), Positives = 143/181 (79%), Gaps = 7/181 (4%)
 Frame = +3

Query  36   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  215
            MSFI+EF+ N+E LPN L++KY L+RDLD+SLQ VQ QN+QRC  E+EDM QRIK+GN+ 
Sbjct  1    MSFIEEFQANIEALPNHLRRKYALLRDLDKSLQGVQTQNEQRCDKEIEDMIQRIKAGNVT  60

Query  216  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  395
             DSSLIKFSDDALDEQKHAIRIADEKVALA QAYDLVD HIQQLDQYLKKFDE+LRR  E
Sbjct  61   PDSSLIKFSDDALDEQKHAIRIADEKVALASQAYDLVDAHIQQLDQYLKKFDEDLRR--E  118

Query  396  RENAVATGSTTSNVDNNVksgrsgdsskggrkkTRL----ATATPAANPTGMDLDLPVDP  563
            R+ AV TG+  + V+NNV         KGGRKKTRL    A    AA P+GMDLDLPVDP
Sbjct  119  RDTAVVTGAPATTVENNV-KSGRSGEGKGGRKKTRLATAAAATATAATPSGMDLDLPVDP  177

Query  564  S  566
            +
Sbjct  178  N  178



>ref|XP_007034499.1| RING/FYVE/PHD zinc finger superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY05425.1| RING/FYVE/PHD zinc finger superfamily protein isoform 1 [Theobroma 
cacao]
Length=247

 Score =   222 bits (565),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 126/190 (66%), Positives = 152/190 (80%), Gaps = 15/190 (8%)
 Frame = +3

Query  36   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  215
            MSFIDEF+ +LE LPNILQKKY LMRDLD+SLQE+ RQN+QRC+ E+ED+++ +++GNI 
Sbjct  1    MSFIDEFQADLEALPNILQKKYALMRDLDKSLQEIVRQNEQRCEQEIEDIRRGVRAGNIT  60

Query  216  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  395
             D+SL++FSD+ALDEQKH+IRIADEKVALAIQAYDLVD+HIQQLDQYLKK DEELRR  E
Sbjct  61   PDTSLLRFSDEALDEQKHSIRIADEKVALAIQAYDLVDSHIQQLDQYLKKSDEELRR--E  118

Query  396  RENAVATGSTTSNVDNNVksgrsgdsskggrkkTRL-------------ATATPAANPTG  536
            RENA AT S+  + D+  KSGR  +S +GGRKKTRL               A  AANPTG
Sbjct  119  RENAAATASSGPSPDSTTKSGRPSESGRGGRKKTRLATAAAAAAAAAATEVAAAAANPTG  178

Query  537  MDLDLPVDPS  566
            M+LDLPVDP+
Sbjct  179  MELDLPVDPN  188



>ref|XP_006340915.1| PREDICTED: PHD finger protein ING1-like [Solanum tuberosum]
Length=236

 Score =   221 bits (563),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 124/181 (69%), Positives = 142/181 (78%), Gaps = 7/181 (4%)
 Frame = +3

Query  36   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  215
            MSFI+EF+ N+E LPN L++KY L+RDLD+SLQ VQ QN+QRC  E+EDM QRIK+GN+ 
Sbjct  1    MSFIEEFQANIEALPNHLRRKYALLRDLDKSLQGVQTQNEQRCDKEIEDMIQRIKAGNVT  60

Query  216  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  395
             DSSLIKFSDDALDEQKHAIRIADEKVALA QAYDLVD HIQQLDQYLKKFDE+LRR  E
Sbjct  61   PDSSLIKFSDDALDEQKHAIRIADEKVALASQAYDLVDAHIQQLDQYLKKFDEDLRR--E  118

Query  396  RENAVATGSTTSNVDNNVksgrsgdsskggrkkTRL----ATATPAANPTGMDLDLPVDP  563
            R+ AV TG+  +  +NNV         KGGRKKTRL    A    AA P+GMDLDLPVDP
Sbjct  119  RDTAVVTGAPATTAENNV-KSGRSGEGKGGRKKTRLATAAAATATAATPSGMDLDLPVDP  177

Query  564  S  566
            +
Sbjct  178  N  178



>gb|ACJ84468.1| unknown [Medicago truncatula]
 gb|KEH41192.1| PHD finger-like protein [Medicago truncatula]
Length=247

 Score =   220 bits (561),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 121/193 (63%), Positives = 149/193 (77%), Gaps = 20/193 (10%)
 Frame = +3

Query  36   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  215
            MSF++EF+ NL+ LPNIL KKY L+RDLD+SLQ+ QRQN+QRC+ E+ED+++ ++SGNIA
Sbjct  1    MSFLEEFQANLDSLPNILHKKYALLRDLDKSLQDNQRQNEQRCEQEIEDIRRGVRSGNIA  60

Query  216  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  395
             D+S+I+FSD+ALDEQKH+IRIADEKVALA+QAYDLVDTHIQQLDQYLKKFDEELRR  E
Sbjct  61   PDTSVIRFSDEALDEQKHSIRIADEKVALAVQAYDLVDTHIQQLDQYLKKFDEELRR--E  118

Query  396  RENAVATGSTTSNVDNNVksgrsgdsskggrkkTRLATAT----------------PAAN  527
            RENA  TG+ TS+ D N       +  +GGRKKTR A +                  +AN
Sbjct  119  RENAAITGAPTSSPDGNT--KSGKEGGRGGRKKTRQAASVQTATAAAMAAATEALATSAN  176

Query  528  PTGMDLDLPVDPS  566
            PTGMDLDLPVDP+
Sbjct  177  PTGMDLDLPVDPN  189



>gb|AFK44120.1| unknown [Medicago truncatula]
Length=247

 Score =   220 bits (561),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 121/193 (63%), Positives = 148/193 (77%), Gaps = 20/193 (10%)
 Frame = +3

Query  36   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  215
            MSF++EF+ NL+ LPNIL KKY L+RDLD+SLQ+ QRQN+QRC+ E+ED+++ ++SGNIA
Sbjct  1    MSFLEEFQANLDSLPNILHKKYALLRDLDKSLQDNQRQNEQRCEQEIEDIRRGVRSGNIA  60

Query  216  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  395
             D+S+I+FSD+ALDEQKH+IRIADEKVALA+QAYDLVDTHIQQLDQYLKKFDEELRR  E
Sbjct  61   PDTSVIRFSDEALDEQKHSIRIADEKVALAVQAYDLVDTHIQQLDQYLKKFDEELRR--E  118

Query  396  RENAVATGSTTSNVDNNVksgrsgdsskggrkkTRLATAT----------------PAAN  527
            RENA  TG+ TS+ D N       +  +GGRKKTR A +                   AN
Sbjct  119  RENAAITGAPTSSPDGNT--KSGKEGGRGGRKKTRQAASVQTATAAAMAAATEALATFAN  176

Query  528  PTGMDLDLPVDPS  566
            PTGMDLDLPVDP+
Sbjct  177  PTGMDLDLPVDPN  189



>emb|CDO99386.1| unnamed protein product [Coffea canephora]
Length=249

 Score =   219 bits (559),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 121/193 (63%), Positives = 140/193 (73%), Gaps = 19/193 (10%)
 Frame = +3

Query  36   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  215
            MSFID+F+ NLEVLPNILQKKY L+RDLD+SL E+QRQN+QRC  E+EDMK RIK G + 
Sbjct  1    MSFIDDFQANLEVLPNILQKKYALLRDLDKSLHEIQRQNEQRCGQEIEDMKNRIKDGGVT  60

Query  216  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  395
             DSS +KFSD+ALDEQKHAIRIADEK+ALA+QAYDLVD HIQQLDQYLKK DEE+RR  E
Sbjct  61   PDSSFMKFSDEALDEQKHAIRIADEKIALALQAYDLVDAHIQQLDQYLKKLDEEIRR--E  118

Query  396  RENAVATGSTTSNVDNNVksgrsgdsskggrkkTRL----------------ATATPAAN  527
             +   +TGS    VDNNV        S  GRKKTRL                A  T + N
Sbjct  119  GDTVASTGSAAPAVDNNV-KSGKAGESSRGRKKTRLATATAAAAAAAAAAAAAATTTSTN  177

Query  528  PTGMDLDLPVDPS  566
            PTG++LDLPVDP+
Sbjct  178  PTGVELDLPVDPN  190



>ref|XP_003535966.1| PREDICTED: PHD finger protein ING1-like isoform X1 [Glycine max]
Length=242

 Score =   218 bits (556),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 117/186 (63%), Positives = 147/186 (79%), Gaps = 11/186 (6%)
 Frame = +3

Query  36   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  215
            MSF++EF+ NL+ LP ILQKKY L+RDLD+SL ++QRQN+QRC+ E+ED+++ ++SGNI 
Sbjct  1    MSFLEEFQANLDSLPVILQKKYALLRDLDKSLHDIQRQNEQRCEQEIEDIRRGVRSGNIT  60

Query  216  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  395
             D+S+I+FSD+ALDEQ H+IR+ADEKVALA+QAYDLVDTHIQ LDQYLK+F EE+RR  E
Sbjct  61   PDTSVIRFSDEALDEQNHSIRVADEKVALAVQAYDLVDTHIQHLDQYLKRFGEEIRR--E  118

Query  396  RENAVATGSTTSNVDNNVksgrs--gdsskggrkkTRLATATPA-------ANPTGMDLD  548
            RENA  TG   S  + N KSGR     + +GGRKKTR  T TPA       ANPTGMDL+
Sbjct  119  RENAAITGVPASGSEGNTKSGRGNESGTGRGGRKKTRQTTVTPAATEAQATANPTGMDLE  178

Query  549  LPVDPS  566
            LPVDP+
Sbjct  179  LPVDPN  184



>ref|XP_009785673.1| PREDICTED: PHD finger protein ING1 isoform X2 [Nicotiana sylvestris]
Length=199

 Score =   214 bits (546),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 104/137 (76%), Positives = 119/137 (87%), Gaps = 2/137 (1%)
 Frame = +3

Query  36   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  215
            MSFIDEF+ N+E LPN L++KY L+RDLD+SLQ VQRQN+QRC+ E+EDM QRIK+GN+ 
Sbjct  1    MSFIDEFQANIEALPNHLRRKYALLRDLDKSLQGVQRQNEQRCEKEIEDMIQRIKAGNVT  60

Query  216  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  395
             DSSLIKFSDDALDEQKHAIRIADEKVALA QAYDLVD HIQQLDQYLKKFDEELRR  E
Sbjct  61   PDSSLIKFSDDALDEQKHAIRIADEKVALASQAYDLVDAHIQQLDQYLKKFDEELRR--E  118

Query  396  RENAVATGSTTSNVDNN  446
            R+ AV TG+  + V+NN
Sbjct  119  RDVAVVTGTPATTVENN  135



>ref|XP_007145429.1| hypothetical protein PHAVU_007G238400g [Phaseolus vulgaris]
 gb|ESW17423.1| hypothetical protein PHAVU_007G238400g [Phaseolus vulgaris]
Length=242

 Score =   216 bits (549),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 117/186 (63%), Positives = 144/186 (77%), Gaps = 11/186 (6%)
 Frame = +3

Query  36   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  215
            MSF++EF+ NL+ LP ILQKKY L+RDLD+SLQ++QRQN+QRC+ E+ED+++ ++SGNI 
Sbjct  1    MSFLEEFQANLDSLPVILQKKYALLRDLDKSLQDIQRQNEQRCEHEIEDIRRGVRSGNIT  60

Query  216  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  395
             D+S+I+FSD+ALDEQKH+IR+ADEKVALA+QAYDLVDTHIQQLDQYLKKFDEELRR  E
Sbjct  61   PDTSVIRFSDEALDEQKHSIRVADEKVALAVQAYDLVDTHIQQLDQYLKKFDEELRR--E  118

Query  396  RENAVATGSTTSNVDNNVk-sgrsgdsskggrkkTRLAT--------ATPAANPTGMDLD  548
            RENA  TG   S  + N K    +   +  GRKKTR  T        A   A PTGMDLD
Sbjct  119  RENAAITGVPASGPEGNTKPGRGNESGTGRGRKKTRQTTLVTAAATEAQTTAKPTGMDLD  178

Query  549  LPVDPS  566
            LPVDP+
Sbjct  179  LPVDPN  184



>ref|XP_003555720.1| PREDICTED: PHD finger protein ING1-like [Glycine max]
Length=239

 Score =   214 bits (544),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 112/183 (61%), Positives = 143/183 (78%), Gaps = 8/183 (4%)
 Frame = +3

Query  36   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  215
            MSF++EF  NL+ LP IL+KKY L+RDLD+SLQ+++RQN+QRC+ E+ED+K+ ++SGNI 
Sbjct  1    MSFLEEFHANLDSLPVILRKKYTLLRDLDKSLQDIKRQNEQRCEQEIEDIKRGVRSGNIT  60

Query  216  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  395
             D+S I+FSD+ALDEQKH+IR+ADEKVALA+QAYDLVDT+IQQLDQYLKKFDEE+RR  E
Sbjct  61   PDTSAIRFSDEALDEQKHSIRVADEKVALAVQAYDLVDTNIQQLDQYLKKFDEEIRR--E  118

Query  396  RENAVATGSTTSNVDNNVksgrsgdssk------ggrkkTRLATATPAANPTGMDLDLPV  557
            RENA  TG   S  + N KSGR  +S          R+ T +  A   +NPTGMDL+LPV
Sbjct  119  RENAAITGVPASGPEGNTKSGRGNESGTGRGGRKKTRQTTMVTEAQATSNPTGMDLELPV  178

Query  558  DPS  566
            DP+
Sbjct  179  DPN  181



>gb|ACU19192.1| unknown [Glycine max]
Length=239

 Score =   213 bits (542),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 114/185 (62%), Positives = 144/185 (78%), Gaps = 12/185 (6%)
 Frame = +3

Query  36   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  215
            MSF++EF  NL+ LP IL+KKY L+RDLD+SLQ+++RQN+QRC+ E+ED+K+ ++SGNI 
Sbjct  1    MSFLEEFHANLDSLPVILRKKYTLLRDLDKSLQDIKRQNEQRCEQEIEDIKRGVRSGNIT  60

Query  216  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  395
             D+S I+FSD+ALDEQKH+IR+ADEKVALA+QAYDLVDT+IQQLDQYLKKFDEE+RR  E
Sbjct  61   PDTSAIRFSDEALDEQKHSIRVADEKVALAVQAYDLVDTNIQQLDQYLKKFDEEIRR--E  118

Query  396  RENAVATGSTTSNVDNNVksgrsgdsskggrkkTRL--------ATATPAANPTGMDLDL  551
            RENA  TG   S  + N KSGR  +S  G   + +         A ATP  NPTGMDL+L
Sbjct  119  RENAAITGVPASGPEGNTKSGRGNESGTGRGGRKKTRQTTMVTEAQATP--NPTGMDLEL  176

Query  552  PVDPS  566
            PVDP+
Sbjct  177  PVDPN  181



>ref|XP_010264003.1| PREDICTED: PHD finger protein ING1 [Nelumbo nucifera]
Length=232

 Score =   211 bits (538),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 122/177 (69%), Positives = 149/177 (84%), Gaps = 3/177 (2%)
 Frame = +3

Query  36   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  215
            MSF+++F+ +LE LP +LQ++Y LMR+LD+SLQE+QRQN+QRC+ E+ED+K+ +KSGNI 
Sbjct  1    MSFMEDFQASLESLPTMLQRQYSLMRNLDKSLQEIQRQNEQRCEQEIEDIKRGVKSGNIT  60

Query  216  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  395
             D+SLI+FSD AL+EQKH IRIADEKVALAIQAYDLVD HIQQLDQYLK+FDEELRR  E
Sbjct  61   PDASLIRFSDYALEEQKHCIRIADEKVALAIQAYDLVDAHIQQLDQYLKRFDEELRR--E  118

Query  396  RENAVATGSTTSNVDNNVksgrsgdsskggrkkTRLATATPAANPTGMDLDLPVDPS  566
            R+ A A G T  N+D +VKSGR  +SSK GRKKTRLA+A  AA P  MDLDLPVDP+
Sbjct  119  RDLASAGGVTAPNLDISVKSGRGSESSKRGRKKTRLASAA-AAEPPSMDLDLPVDPN  174



>ref|XP_011091384.1| PREDICTED: PHD finger protein ING1 isoform X1 [Sesamum indicum]
Length=247

 Score =   211 bits (538),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 128/191 (67%), Positives = 153/191 (80%), Gaps = 16/191 (8%)
 Frame = +3

Query  36   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  215
            MS  +EF+ N+E LPNILQ+KY L+RDLD+SLQE+QRQN+QRC+ E++DMK+ IKSGNI 
Sbjct  1    MSISEEFQANIEALPNILQRKYALLRDLDKSLQEIQRQNEQRCEQEIDDMKRGIKSGNIT  60

Query  216  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  395
             +SSL+KFSDDALDEQKHAIRIADEKVALA+QAYDLVD HIQQLDQYLKKFDE+LRR AE
Sbjct  61   PNSSLLKFSDDALDEQKHAIRIADEKVALAVQAYDLVDAHIQQLDQYLKKFDEDLRR-AE  119

Query  396  RENAVATGSTTSNVDNNVksgrsgdsskggrkkTRL--------------ATATPAANPT  533
            R+   A+G T+  +DNNVK+GRSG++S  GRKKTRL              A A  AAN T
Sbjct  120  RDTMAASG-TSPTLDNNVKAGRSGETSNRGRKKTRLATATAAASASATAAAAAATAANST  178

Query  534  GMDLDLPVDPS  566
             M+LDLPVDP+
Sbjct  179  SMELDLPVDPN  189



>ref|XP_004497737.1| PREDICTED: PHD finger protein ING1-like [Cicer arietinum]
Length=293

 Score =   213 bits (541),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 119/191 (62%), Positives = 145/191 (76%), Gaps = 16/191 (8%)
 Frame = +3

Query  36   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  215
            MSF++EF+ NL+ LPNIL KKY L+RDLD+SL + QRQN+QRC+ E+ED+++ ++SGNI 
Sbjct  47   MSFLEEFQANLDSLPNILHKKYALLRDLDKSLHDNQRQNEQRCEQEIEDIRRGVRSGNIT  106

Query  216  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  395
             D+ +I+FSD+ALDEQKH+IRIADEKVALA+QAYDLVDTHIQQLDQYLKKFDEELRR  E
Sbjct  107  PDTLVIRFSDEALDEQKHSIRIADEKVALAVQAYDLVDTHIQQLDQYLKKFDEELRR--E  164

Query  396  RENAVATGSTTSNVDNNVksgrsgdsskggrkkTR--------------LATATPAANPT  533
            RENA  TG   S  D N KSG+  +  +GGRKKTR                    +ANPT
Sbjct  165  RENAAITGVPASIPDGNTKSGKGNEGGRGGRKKTRQTQTASVATAAAAAAEALATSANPT  224

Query  534  GMDLDLPVDPS  566
            GMDLDLPVDP+
Sbjct  225  GMDLDLPVDPN  235



>gb|KJB28066.1| hypothetical protein B456_005G039000 [Gossypium raimondii]
Length=207

 Score =   209 bits (531),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 124/182 (68%), Positives = 148/182 (81%), Gaps = 10/182 (5%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  221
            FIDEF+ +LE LPNILQKKY LMRDLD+SLQE+ RQN+QRC+ E+EDMK+ +++GNI  D
Sbjct  4    FIDEFQADLEALPNILQKKYALMRDLDKSLQEIVRQNEQRCEQEIEDMKRGLRAGNITPD  63

Query  222  SSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAERE  401
            +SL++FS++ALDEQKH++RIADEKVALAIQAYDLVD+HIQQLDQYLKK  EELRR  ERE
Sbjct  64   TSLLRFSEEALDEQKHSVRIADEKVALAIQAYDLVDSHIQQLDQYLKKSGEELRR--ERE  121

Query  402  NAVATGSTTSNVDNNVksgrsgdsskggrkkTRL-------ATATPAANPTGMDLDLPVD  560
            N  AT S T   D   KSGRSG+S +GGRKKTRL         A  AANPTG++LDLPVD
Sbjct  122  N-TATASPTQTPDGTTKSGRSGESGRGGRKKTRLATAAAATEVAASAANPTGVELDLPVD  180

Query  561  PS  566
            P+
Sbjct  181  PN  182



>gb|KJB28062.1| hypothetical protein B456_005G039000 [Gossypium raimondii]
Length=240

 Score =   209 bits (532),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 124/182 (68%), Positives = 148/182 (81%), Gaps = 10/182 (5%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  221
            FIDEF+ +LE LPNILQKKY LMRDLD+SLQE+ RQN+QRC+ E+EDMK+ +++GNI  D
Sbjct  4    FIDEFQADLEALPNILQKKYALMRDLDKSLQEIVRQNEQRCEQEIEDMKRGLRAGNITPD  63

Query  222  SSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAERE  401
            +SL++FS++ALDEQKH++RIADEKVALAIQAYDLVD+HIQQLDQYLKK  EELRR  ERE
Sbjct  64   TSLLRFSEEALDEQKHSVRIADEKVALAIQAYDLVDSHIQQLDQYLKKSGEELRR--ERE  121

Query  402  NAVATGSTTSNVDNNVksgrsgdsskggrkkTRL-------ATATPAANPTGMDLDLPVD  560
            N  AT S T   D   KSGRSG+S +GGRKKTRL         A  AANPTG++LDLPVD
Sbjct  122  N-TATASPTQTPDGTTKSGRSGESGRGGRKKTRLATAAAATEVAASAANPTGVELDLPVD  180

Query  561  PS  566
            P+
Sbjct  181  PN  182



>ref|XP_011091386.1| PREDICTED: PHD finger protein ING1 isoform X2 [Sesamum indicum]
Length=246

 Score =   209 bits (532),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 127/191 (66%), Positives = 152/191 (80%), Gaps = 17/191 (9%)
 Frame = +3

Query  36   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  215
            MS  +EF+ N+E LPNILQ+KY L+RDLD+SLQE+QRQN+QRC+ E++DMK+ IKSGNI 
Sbjct  1    MSISEEFQANIEALPNILQRKYALLRDLDKSLQEIQRQNEQRCEQEIDDMKRGIKSGNIT  60

Query  216  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  395
             +SSL+KFSDDALDEQKHAIRIADEKVALA+QAYDLVD HIQQLDQYLKKFDE+LRR  E
Sbjct  61   PNSSLLKFSDDALDEQKHAIRIADEKVALAVQAYDLVDAHIQQLDQYLKKFDEDLRR--E  118

Query  396  RENAVATGSTTSNVDNNVksgrsgdsskggrkkTRL--------------ATATPAANPT  533
            R+   A+G T+  +DNNVK+GRSG++S  GRKKTRL              A A  AAN T
Sbjct  119  RDTMAASG-TSPTLDNNVKAGRSGETSNRGRKKTRLATATAAASASATAAAAAATAANST  177

Query  534  GMDLDLPVDPS  566
             M+LDLPVDP+
Sbjct  178  SMELDLPVDPN  188



>ref|XP_006589054.1| PREDICTED: PHD finger protein ING1-like isoform X2 [Glycine max]
Length=236

 Score =   207 bits (528),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 113/186 (61%), Positives = 142/186 (76%), Gaps = 17/186 (9%)
 Frame = +3

Query  36   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  215
            MSF++EF+ NL+ LP ILQKKY L+RDLD+SL ++QRQN+QRC+ E+ED+++ ++SGNI 
Sbjct  1    MSFLEEFQANLDSLPVILQKKYALLRDLDKSLHDIQRQNEQRCEQEIEDIRRGVRSGNIT  60

Query  216  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  395
             D+S+I+FSD+ALDEQ H+IR+ADEKVALA+QAYDLVDTHIQ LDQYLK+F        E
Sbjct  61   PDTSVIRFSDEALDEQNHSIRVADEKVALAVQAYDLVDTHIQHLDQYLKRF--------E  112

Query  396  RENAVATGSTTSNVDNNVksgrs--gdsskggrkkTRLATATPA-------ANPTGMDLD  548
            RENA  TG   S  + N KSGR     + +GGRKKTR  T TPA       ANPTGMDL+
Sbjct  113  RENAAITGVPASGSEGNTKSGRGNESGTGRGGRKKTRQTTVTPAATEAQATANPTGMDLE  172

Query  549  LPVDPS  566
            LPVDP+
Sbjct  173  LPVDPN  178



>gb|AFK33325.1| unknown [Lotus japonicus]
Length=245

 Score =   207 bits (528),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 115/189 (61%), Positives = 138/189 (73%), Gaps = 14/189 (7%)
 Frame = +3

Query  36   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  215
            MSF++EF+ NL+ LP ILQKKY L+RDLD+SL ++QRQN+QRCQ EVED+++ ++ GNI 
Sbjct  1    MSFLEEFQANLDSLPVILQKKYSLLRDLDKSLHDIQRQNEQRCQQEVEDIRRGVRLGNIT  60

Query  216  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  395
             D S I+FSD+ALDEQKH+IRIADEKVALA+QAYDLVDTHIQQLDQYLKKFDEELRR  E
Sbjct  61   PDVSAIRFSDEALDEQKHSIRIADEKVALAVQAYDLVDTHIQQLDQYLKKFDEELRR--E  118

Query  396  RENAVATGSTTSNVDNNVksgrsgdsskggrkkTRLATA------------TPAANPTGM  539
            RENA   G  +S  D   KSGR      G +K  +   A              + NPTGM
Sbjct  119  RENAAIAGVPSSGPDATTKSGRGESGRGGRKKSRQTTLAAAAAAATATDAQPTSVNPTGM  178

Query  540  DLDLPVDPS  566
            DLDLPVDP+
Sbjct  179  DLDLPVDPN  187



>ref|XP_004134022.1| PREDICTED: PHD finger protein ING1-like [Cucumis sativus]
 ref|XP_004157658.1| PREDICTED: PHD finger protein ING1-like [Cucumis sativus]
 gb|KGN56782.1| hypothetical protein Csa_3G133330 [Cucumis sativus]
Length=239

 Score =   206 bits (525),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 114/183 (62%), Positives = 139/183 (76%), Gaps = 8/183 (4%)
 Frame = +3

Query  36   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  215
            MSF++EF+ NLE LPNILQKKY L+ DLD+SLQ + +QN+QRC+ E+ED+K+ +K GNI 
Sbjct  1    MSFLEEFQANLESLPNILQKKYALLHDLDQSLQGLVKQNEQRCEQEIEDIKRGVKCGNIT  60

Query  216  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  395
             D+SLI+FSD+ALDEQKH+IRIADEKVALA+QAYDLVDTHIQQLDQYLK FDE+LR   E
Sbjct  61   PDTSLIRFSDEALDEQKHSIRIADEKVALAVQAYDLVDTHIQQLDQYLKNFDEKLRH--E  118

Query  396  RENAVATGSTTSNVDNNVks------grsgdsskggrkkTRLATATPAANPTGMDLDLPV  557
            R  A ATG   S+VD N KS      GR G   + G+       A   ANPTGM+L+LPV
Sbjct  119  RGTAAATGLPASSVDVNTKSGRGTEGGRGGRKKRNGQAAAATTEAPTTANPTGMELELPV  178

Query  558  DPS  566
            DP+
Sbjct  179  DPN  181



>gb|KHN48841.1| PHD finger protein ING1, partial [Glycine soja]
Length=236

 Score =   206 bits (524),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 112/180 (62%), Positives = 140/180 (78%), Gaps = 11/180 (6%)
 Frame = +3

Query  54   FETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASDSSLI  233
            F  +L+ LP ILQKKY L+RDLD+SL ++QRQN+QRC+ E+ED+++ ++SGNI  D+S+I
Sbjct  1    FSADLDSLPVILQKKYALLRDLDKSLHDIQRQNEQRCEQEIEDIRRGVRSGNITPDTSVI  60

Query  234  KFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAERENAVA  413
            +FSD+ALDEQ H+IR+ADEKVALA+QAYDLVDTHIQ LDQYLK+F EE+RR  ERENA  
Sbjct  61   RFSDEALDEQNHSIRVADEKVALAVQAYDLVDTHIQHLDQYLKRFGEEIRR--ERENAAI  118

Query  414  TGSTTSNVDNNVksgrs--gdsskggrkkTRLATATPA-------ANPTGMDLDLPVDPS  566
            TG   S  + N KSGR     + +GGRKKTR  T TPA       ANPTGMDL+LPVDP+
Sbjct  119  TGVPASGSEGNTKSGRGNESGTGRGGRKKTRQTTVTPAATEAQATANPTGMDLELPVDPN  178



>ref|XP_002285610.1| PREDICTED: PHD finger protein ING1 [Vitis vinifera]
 emb|CBI33330.3| unnamed protein product [Vitis vinifera]
Length=235

 Score =   204 bits (519),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 118/175 (67%), Positives = 142/175 (81%), Gaps = 8/175 (5%)
 Frame = +3

Query  60   TNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASDSSLIKF  239
            ++LE LPN+LQ+KY L+RDLD+SLQE+QRQN+QRC+ E+ED+KQ +KSGNI  D SLI+F
Sbjct  5    SDLESLPNVLQRKYALLRDLDKSLQEIQRQNEQRCEQEIEDIKQGVKSGNITPDPSLIRF  64

Query  240  SDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAERENAVATG  419
            SD+ALDEQKH+IRIADEKVALA+QAYDLVDTHIQQLDQYL+KFDE++RR  ER+    TG
Sbjct  65   SDEALDEQKHSIRIADEKVALAVQAYDLVDTHIQQLDQYLRKFDEDIRR--ERDGIAGTG  122

Query  420  STTSNVDNNVksgrsgdsskggrkkTRL------ATATPAANPTGMDLDLPVDPS  566
                  D+  KSGR  +SS+GGRKKTRL      A  T AANPT MDLDLPVDP+
Sbjct  123  LPAPIPDSGTKSGRGSESSRGGRKKTRLAAAAAAAPVTAAANPTSMDLDLPVDPN  177



>ref|XP_007227566.1| hypothetical protein PRUPE_ppa010764mg [Prunus persica]
 gb|EMJ28765.1| hypothetical protein PRUPE_ppa010764mg [Prunus persica]
Length=237

 Score =   201 bits (512),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 116/182 (64%), Positives = 144/182 (79%), Gaps = 8/182 (4%)
 Frame = +3

Query  36   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  215
            MSF++EF  NLE LPNIL + Y ++R+LD+SLQ++QRQN+QRC+ E+ED+K+ IKSGNI 
Sbjct  1    MSFLEEFNANLESLPNILARHYAVLRNLDKSLQDIQRQNEQRCEQEIEDIKREIKSGNIT  60

Query  216  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  395
             D+SLI+FSD+ALDEQKH+I IADEKV LA++AYDLVDTHIQQLDQYLK F+EELR   E
Sbjct  61   PDTSLIRFSDEALDEQKHSIGIADEKVMLAVRAYDLVDTHIQQLDQYLKTFEEELR---E  117

Query  396  RENAVATGSTTSNVDNNVksgrsgdsskggrkkTRL-----ATATPAANPTGMDLDLPVD  560
            R+  VA+     +VD   K GRS +  +GGRKKTRL     ATAT A NPT MDLD+PVD
Sbjct  118  RDTVVASALPAPSVDTGAKPGRSSEGGRGGRKKTRLATATAATATAAVNPTAMDLDIPVD  177

Query  561  PS  566
            P+
Sbjct  178  PN  179



>ref|XP_009609788.1| PREDICTED: PHD finger protein ING1-like, partial [Nicotiana tomentosiformis]
Length=118

 Score =   197 bits (500),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 95/117 (81%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = +3

Query  36   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  215
            MSFIDEF+ N+E LPN L++KY L+RDLD+SLQ VQRQN+QRC+ E+EDM QRIK+GN+ 
Sbjct  1    MSFIDEFQANIEALPNHLRRKYALLRDLDKSLQGVQRQNEQRCEKEIEDMIQRIKAGNVT  60

Query  216  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRR  386
             DSSLIKFSDDALDEQKHAIRIADEKVALA QAYDLVD HIQQLDQYLKKFDEELRR
Sbjct  61   PDSSLIKFSDDALDEQKHAIRIADEKVALASQAYDLVDAHIQQLDQYLKKFDEELRR  117



>gb|EYU43804.1| hypothetical protein MIMGU_mgv1a012611mg [Erythranthe guttata]
Length=245

 Score =   200 bits (508),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 120/189 (63%), Positives = 148/189 (78%), Gaps = 14/189 (7%)
 Frame = +3

Query  36   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  215
            MS  DEF+ ++E LPNILQ+KY L+RDLD+SLQE+QRQN+QRC+ E++DMK+ IKSG+I 
Sbjct  1    MSISDEFQADIEALPNILQRKYALLRDLDKSLQEIQRQNEQRCEQEIDDMKRGIKSGSIT  60

Query  216  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  395
             +SSL+KFSDDALDEQKHAIRIADEKVALA+Q YDLVDTHIQQLDQ LKKFDE+LRR  E
Sbjct  61   PNSSLLKFSDDALDEQKHAIRIADEKVALAVQVYDLVDTHIQQLDQCLKKFDEDLRR--E  118

Query  396  RENAVATGSTTSNVDNNVksgrsgdsskggrkkTRL------------ATATPAANPTGM  539
            RE     GS  +  ++NVKSG+SG++S  GRKKTRL            A+A   AN + M
Sbjct  119  REAIATAGSPPAPENSNVKSGKSGETSNRGRKKTRLATATAAASASASASAAATANSSSM  178

Query  540  DLDLPVDPS  566
            +LD+PVDP+
Sbjct  179  ELDIPVDPN  187



>ref|XP_008438417.1| PREDICTED: PHD finger protein ING1 [Cucumis melo]
 ref|XP_008438418.1| PREDICTED: PHD finger protein ING1 [Cucumis melo]
 ref|XP_008438419.1| PREDICTED: PHD finger protein ING1 [Cucumis melo]
 ref|XP_008438420.1| PREDICTED: PHD finger protein ING1 [Cucumis melo]
Length=239

 Score =   199 bits (506),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 112/183 (61%), Positives = 137/183 (75%), Gaps = 8/183 (4%)
 Frame = +3

Query  36   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  215
            MSF++EF+ NLE LPNILQKKY L+ DLD+SLQ + +QN+QRC+ E+ED+K+ +K GNI 
Sbjct  1    MSFLEEFQANLESLPNILQKKYALLHDLDQSLQGLVKQNEQRCEQEIEDIKRGVKCGNIT  60

Query  216  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  395
             D+SLI+FSD+ALDEQKH+IRIADEKVALA+QAYDLVDTHIQQLDQYLK FDE+LR   E
Sbjct  61   PDTSLIRFSDEALDEQKHSIRIADEKVALAVQAYDLVDTHIQQLDQYLKNFDEKLRH--E  118

Query  396  RENAVATGSTTSNVDNNVks------grsgdsskggrkkTRLATATPAANPTGMDLDLPV  557
            R  A ATG   S+VD N KS      GR G   +  +       A   A PTGM+L+LPV
Sbjct  119  RGTAAATGLPASSVDGNTKSGRGTEGGRGGRKKRNAQAAASTTEAPTTATPTGMELELPV  178

Query  558  DPS  566
            DP+
Sbjct  179  DPN  181



>ref|XP_009362046.1| PREDICTED: PHD finger protein ING1-like [Pyrus x bretschneideri]
Length=237

 Score =   198 bits (503),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 116/182 (64%), Positives = 143/182 (79%), Gaps = 8/182 (4%)
 Frame = +3

Query  36   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  215
            MSF++EF  NLE LPNIL K Y +MR LDRSLQ+ QRQN+QRC+ E+ED+K+ IKSGNI 
Sbjct  1    MSFLEEFNANLESLPNILAKNYSVMRTLDRSLQDNQRQNEQRCEQEIEDIKREIKSGNIT  60

Query  216  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  395
             D+SLI+FSD+ALDEQKH++ IADEKV LA++AYDLVDTHIQQLDQYLK F+EELR   E
Sbjct  61   PDTSLIRFSDEALDEQKHSVGIADEKVLLAVRAYDLVDTHIQQLDQYLKNFEEELR---E  117

Query  396  RENAVATGSTTSNVDNNVksgrsgdsskggrkkTRL-----ATATPAANPTGMDLDLPVD  560
            R++A A+     N D+  KSG+S +  +GGRKKTRL     A AT + NPT MDLD+PVD
Sbjct  118  RDSAAASALPAPNPDSGAKSGKSSEGGRGGRKKTRLATAAAAAATASVNPTAMDLDIPVD  177

Query  561  PS  566
            P+
Sbjct  178  PN  179



>ref|XP_009377447.1| PREDICTED: PHD finger protein ING1-like [Pyrus x bretschneideri]
Length=237

 Score =   197 bits (502),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 114/182 (63%), Positives = 144/182 (79%), Gaps = 8/182 (4%)
 Frame = +3

Query  36   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  215
            MSF++EF  NLE LPNIL K Y +MR LD+SLQ++QRQN+QRC+ E+ED+K+ IKSGNI 
Sbjct  1    MSFLEEFNANLESLPNILAKNYSVMRTLDQSLQDIQRQNEQRCEQEIEDIKREIKSGNIT  60

Query  216  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  395
             D+SLI+FSD+ALDEQKH++ IADEKV LA++AYD+VDTHIQQLDQYLK F+EELR   E
Sbjct  61   PDTSLIRFSDEALDEQKHSVGIADEKVLLAVRAYDMVDTHIQQLDQYLKTFEEELR---E  117

Query  396  RENAVATGSTTSNVDNNVksgrsgdsskggrkkTRL-----ATATPAANPTGMDLDLPVD  560
            R++A A+     N D+  KSG+S +  +GGRKKTRL     A AT + NPT MDLD+PVD
Sbjct  118  RDSAAASALPAPNPDSGAKSGKSSEGGRGGRKKTRLATAAAAAATASVNPTAMDLDIPVD  177

Query  561  PS  566
            P+
Sbjct  178  PN  179



>ref|XP_011464224.1| PREDICTED: PHD finger protein ING1 isoform X2 [Fragaria vesca 
subsp. vesca]
Length=243

 Score =   197 bits (500),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 102/186 (55%), Positives = 127/186 (68%), Gaps = 9/186 (5%)
 Frame = +3

Query  36   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  215
            MSF++EF  NLE LPNILQ+ Y ++R+LD+SLQ++QRQN+QRC+ E+ED+K+ IKSGNI 
Sbjct  1    MSFLEEFHANLESLPNILQRHYAVLRNLDKSLQDIQRQNEQRCEQEIEDIKREIKSGNIT  60

Query  216  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  395
             DSSLI+FSD+ALDEQKH+I IADEKV LA++AYDLVDTHIQQLDQYLKK   ELR  A 
Sbjct  61   PDSSLIRFSDEALDEQKHSIGIADEKVMLAVRAYDLVDTHIQQLDQYLKKIGAELRPDAV  120

Query  396  RENAVATGSTTSNVDNNVksgrsgdsskggrkkTRLATATP---------AANPTGMDLD  548
              +A+   S      +           K  +       A P          ANPTGMDLD
Sbjct  121  AASAMPAPSLDGTAKSGRSGEGGRGGRKKKQATVTAPEAAPVPATATVPAPANPTGMDLD  180

Query  549  LPVDPS  566
            +PVDP+
Sbjct  181  IPVDPN  186



>ref|XP_008362239.1| PREDICTED: PHD finger protein ING1-like [Malus domestica]
 ref|XP_008362240.1| PREDICTED: PHD finger protein ING1-like [Malus domestica]
Length=237

 Score =   196 bits (499),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 114/182 (63%), Positives = 143/182 (79%), Gaps = 8/182 (4%)
 Frame = +3

Query  36   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  215
            MSF++EF  NLE LPNIL K Y +MR LD+SLQ++QRQN+QRC+ E+ED+K+ IKSGNI 
Sbjct  1    MSFLEEFNANLESLPNILAKNYSVMRTLDQSLQDIQRQNEQRCEQEIEDIKREIKSGNIT  60

Query  216  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  395
             D+SLI+FSD+ALDEQKH+I IADEKV LA++AYDLVDTHIQQLDQYLK F+EELR   E
Sbjct  61   PDTSLIRFSDEALDEQKHSIGIADEKVLLAVRAYDLVDTHIQQLDQYLKTFEEELR---E  117

Query  396  RENAVATGSTTSNVDNNVksgrsgdsskggrkkTRL-----ATATPAANPTGMDLDLPVD  560
            R++A A+     + D+  KSG+S +  +GGRKKTRL     A A  + NPT MDLD+PVD
Sbjct  118  RDSAAASALPAPSPDSGAKSGKSSEGGRGGRKKTRLATAAAAAAIASVNPTAMDLDIPVD  177

Query  561  PS  566
            P+
Sbjct  178  PN  179



>ref|XP_010069086.1| PREDICTED: PHD finger protein ING1 [Eucalyptus grandis]
 gb|KCW57312.1| hypothetical protein EUGRSUZ_H001091 [Eucalyptus grandis]
Length=232

 Score =   196 bits (497),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 111/184 (60%), Positives = 144/184 (78%), Gaps = 17/184 (9%)
 Frame = +3

Query  36   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  215
            MSF+DEF+ +LE LPNILQKKY L+RDLD+SL++++RQN+QRC+ E+E++KQ +KSGN  
Sbjct  1    MSFLDEFQADLEALPNILQKKYALLRDLDKSLEDLRRQNEQRCEQEIEEIKQGVKSGNT-  59

Query  216  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  395
                   FSD+ LDEQ+H+IRIADEKVALA+ AYDLVDTHIQQLDQYLKK +EELRR  +
Sbjct  60   -------FSDEVLDEQRHSIRIADEKVALAVHAYDLVDTHIQQLDQYLKKCNEELRR--D  110

Query  396  RENAVATGSTTSNVDNNVksgrsgdsskggrkkTRLAT-----ATPAA--NPTGMDLDLP  554
            +E+    G ++S+VD + K GR  +S +GGRK TRLAT     AT AA  NP GM+LD+P
Sbjct  111  KESVPPEGISSSSVDASTKPGRGSESGRGGRKNTRLATQAATEATNAASTNPPGMELDIP  170

Query  555  VDPS  566
            +DP+
Sbjct  171  IDPN  174



>ref|XP_002304691.1| PHD finger family protein [Populus trichocarpa]
 gb|EEE79670.1| PHD finger family protein [Populus trichocarpa]
Length=246

 Score =   196 bits (498),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 105/188 (56%), Positives = 134/188 (71%), Gaps = 14/188 (7%)
 Frame = +3

Query  39   SFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIAS  218
            SF+DEF+ NLE LPNILQKKY L+RDLD+SLQE+QRQN+QRC+ E+ED+K+ +K+GNI  
Sbjct  3    SFVDEFQANLEALPNILQKKYSLLRDLDKSLQEIQRQNEQRCEQEIEDIKRGVKAGNITP  62

Query  219  DSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAER  398
            ++SLI+FSD+ALDEQKH+IRIADEK+ALA+QAYDLVD HIQQLDQ+LK  DE+ RR  ER
Sbjct  63   NTSLIRFSDEALDEQKHSIRIADEKMALAVQAYDLVDAHIQQLDQFLKLCDEDNRR--ER  120

Query  399  ENAV------------ATGSTTSNVDNNVksgrsgdsskggrkkTRLATATPAANPTGMD  542
            + A              T S   +        ++   +     +T +A AT  AN TGM 
Sbjct  121  DTAAAAPALLASSLDGGTKSGRGSESGRGGRKKTRLVAAEEATETEVAVATTFANTTGMQ  180

Query  543  LDLPVDPS  566
            LDLPVDP+
Sbjct  181  LDLPVDPN  188



>ref|XP_004299213.1| PREDICTED: PHD finger protein ING1 isoform X1 [Fragaria vesca 
subsp. vesca]
Length=245

 Score =   196 bits (498),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 106/188 (56%), Positives = 133/188 (71%), Gaps = 11/188 (6%)
 Frame = +3

Query  36   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  215
            MSF++EF  NLE LPNILQ+ Y ++R+LD+SLQ++QRQN+QRC+ E+ED+K+ IKSGNI 
Sbjct  1    MSFLEEFHANLESLPNILQRHYAVLRNLDKSLQDIQRQNEQRCEQEIEDIKREIKSGNIT  60

Query  216  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  395
             DSSLI+FSD+ALDEQKH+I IADEKV LA++AYDLVDTHIQQLDQYLKK   ELR  ++
Sbjct  61   PDSSLIRFSDEALDEQKHSIGIADEKVMLAVRAYDLVDTHIQQLDQYLKKIGAELRPASD  120

Query  396  RENAVATGST----TSNVDNNVksgrsgdsskggrkkTRLATATPA-------ANPTGMD  542
               A A  +     T+    + + GR G   K        A   PA       ANPTGMD
Sbjct  121  AVAASAMPAPSLDGTAKSGRSGEGGRGGRKKKQATVTAPEAAPVPATATVPAPANPTGMD  180

Query  543  LDLPVDPS  566
            LD+PVDP+
Sbjct  181  LDIPVDPN  188



>gb|KJB28067.1| hypothetical protein B456_005G039000 [Gossypium raimondii]
Length=201

 Score =   194 bits (494),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/136 (70%), Positives = 114/136 (84%), Gaps = 3/136 (2%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  221
            FIDEF+ +LE LPNILQKKY LMRDLD+SLQE+ RQN+QRC+ E+EDMK+ +++GNI  D
Sbjct  4    FIDEFQADLEALPNILQKKYALMRDLDKSLQEIVRQNEQRCEQEIEDMKRGLRAGNITPD  63

Query  222  SSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAERE  401
            +SL++FS++ALDEQKH++RIADEKVALAIQAYDLVD+HIQQLDQYLKK  EELRR  ERE
Sbjct  64   TSLLRFSEEALDEQKHSVRIADEKVALAIQAYDLVDSHIQQLDQYLKKSGEELRR--ERE  121

Query  402  NAVATGSTTSNVDNNV  449
            N  AT S T   D   
Sbjct  122  N-TATASPTQTPDGTT  136



>ref|XP_007034500.1| RING/FYVE/PHD zinc finger superfamily protein isoform 2 [Theobroma 
cacao]
 gb|EOY05426.1| RING/FYVE/PHD zinc finger superfamily protein isoform 2 [Theobroma 
cacao]
Length=237

 Score =   194 bits (494),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 116/190 (61%), Positives = 142/190 (75%), Gaps = 25/190 (13%)
 Frame = +3

Query  36   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  215
            MSFIDEF+ +LE LPNILQKKY LMRDLD+SLQE+ RQN+QRC+ E+ED+++ +++GNI 
Sbjct  1    MSFIDEFQADLEALPNILQKKYALMRDLDKSLQEIVRQNEQRCEQEIEDIRRGVRAGNIT  60

Query  216  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  395
             D+SL++FSD+ALDEQKH+IRIADEK          VD+HIQQLDQYLKK DEELRR  E
Sbjct  61   PDTSLLRFSDEALDEQKHSIRIADEK----------VDSHIQQLDQYLKKSDEELRR--E  108

Query  396  RENAVATGSTTSNVDNNVksgrsgdsskggrkkTRL-------------ATATPAANPTG  536
            RENA AT S+  + D+  KSGR  +S +GGRKKTRL               A  AANPTG
Sbjct  109  RENAAATASSGPSPDSTTKSGRPSESGRGGRKKTRLATAAAAAAAAAATEVAAAAANPTG  168

Query  537  MDLDLPVDPS  566
            M+LDLPVDP+
Sbjct  169  MELDLPVDPN  178



>ref|XP_011020717.1| PREDICTED: PHD finger protein ING1 [Populus euphratica]
Length=246

 Score =   194 bits (492),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 108/188 (57%), Positives = 136/188 (72%), Gaps = 14/188 (7%)
 Frame = +3

Query  39   SFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIAS  218
            SF+DEF+ NLE LPNILQKKY L+RDLD+SLQE+QRQN+QRC+ E+ED+K+ +K+GNI  
Sbjct  3    SFVDEFQANLEALPNILQKKYSLLRDLDKSLQEIQRQNEQRCEQEIEDIKRGVKAGNITP  62

Query  219  DSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAER  398
            ++SLI+FSD+ALDEQKH+IRIADEK+ALA+QAYDLVD HIQQLDQ+LK  D + RR  ER
Sbjct  63   NTSLIRFSDEALDEQKHSIRIADEKMALAVQAYDLVDAHIQQLDQFLKLCDVDNRR--ER  120

Query  399  ENAVAT---------GSTTSNVDNNVksgrsgds---skggrkkTRLATATPAANPTGMD  542
            + A A          GST S   +    G    +   +     +T +A AT  AN TGM 
Sbjct  121  DTAAAAPALLASSLDGSTKSGRGSESGRGGRKKTRLVAAEEATETEVAVATTFANTTGMQ  180

Query  543  LDLPVDPS  566
            LDLPVDP+
Sbjct  181  LDLPVDPN  188



>ref|XP_008224073.1| PREDICTED: PHD finger protein ING1 isoform X1 [Prunus mume]
Length=237

 Score =   192 bits (489),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 114/182 (63%), Positives = 141/182 (77%), Gaps = 8/182 (4%)
 Frame = +3

Query  36   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  215
            MSF++EF  NLE LPNIL + Y ++R LD+SLQ++QRQN+QRC+ E+ED+K+ IKSGNI 
Sbjct  1    MSFLEEFNANLESLPNILARHYAVLRSLDKSLQDIQRQNEQRCEQEIEDIKREIKSGNIT  60

Query  216  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  395
             D+SLI+FSD+ALDEQKH+I IADEKV LA++AYDLVDTHIQQLDQYLK F+EELR   E
Sbjct  61   PDTSLIRFSDEALDEQKHSIGIADEKVMLAVRAYDLVDTHIQQLDQYLKTFEEELR---E  117

Query  396  RENAVATGSTTSNVDNNVksgrsgdsskggrkkTRL-----ATATPAANPTGMDLDLPVD  560
            R+   A+     + D   K GRS +  +GGRKKTRL     ATAT A NPT MDLD+PVD
Sbjct  118  RDTVAASALPAPSADTGAKPGRSSEGGRGGRKKTRLATATAATATAAVNPTAMDLDIPVD  177

Query  561  PS  566
            P+
Sbjct  178  PN  179



>gb|KJB33357.1| hypothetical protein B456_006G054900 [Gossypium raimondii]
Length=239

 Score =   192 bits (489),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 119/189 (63%), Positives = 142/189 (75%), Gaps = 22/189 (12%)
 Frame = +3

Query  36   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  215
            MSFID+F+ +LE LPNILQKKY LMRDLD+SLQE+ RQN+QRC+ E+ED+K+ +++ NI 
Sbjct  1    MSFIDQFQADLEALPNILQKKYALMRDLDKSLQEIVRQNEQRCEQEIEDIKRGLRAENI-  59

Query  216  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  395
                  +FSD+ALDEQKH IRIADEKVALAIQ YDLVD+HIQQLDQYLK  DEELRR  E
Sbjct  60   ------RFSDEALDEQKHGIRIADEKVALAIQTYDLVDSHIQQLDQYLKMSDEELRR--E  111

Query  396  RENAVATGSTTSNVDNNVksgrsgdsskggrkkTRL------------ATATPAANPTGM  539
            RENA AT S   + ++  KSGRS +S +GGRKKTRL              A  A NPTGM
Sbjct  112  RENA-ATASPVPSPNSTTKSGRSNESGRGGRKKTRLATAAAAAAAATEVAAAAAENPTGM  170

Query  540  DLDLPVDPS  566
            +LDLPVDP+
Sbjct  171  ELDLPVDPN  179



>ref|XP_008812924.1| PREDICTED: PHD finger protein ING1-like isoform X3 [Phoenix dactylifera]
Length=227

 Score =   188 bits (478),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 103/177 (58%), Positives = 136/177 (77%), Gaps = 8/177 (5%)
 Frame = +3

Query  36   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  215
            M F+++F+ + E LP +LQ+ YGLMRDLD+SLQ VQRQN+QRC+ E+ED++  ++SGNI 
Sbjct  1    MGFLEDFQASFESLPALLQRNYGLMRDLDKSLQGVQRQNEQRCEQEIEDIRLGVESGNIT  60

Query  216  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  395
             D+SLI+FSD+ALDEQKH IRIADEKVALA Q YD+VD H+QQLDQY++K  EE+R+  E
Sbjct  61   PDTSLIRFSDEALDEQKHCIRIADEKVALATQVYDMVDAHVQQLDQYMRKL-EEVRQ--E  117

Query  396  RENAVATGSTTSNVDNNVksgrsgdsskggrkkTRLATATPAANPTGMDLDLPVDPS  566
            RE A   G   SN D + +S R  +SS+GGRKK+RLA   P+     +DL+LPVDP+
Sbjct  118  RELATGAGVGASNADASTRSRRVAESSRGGRKKSRLAVEPPS-----VDLELPVDPN  169



>ref|XP_008777019.1| PREDICTED: PHD finger protein ING1-like isoform X1 [Phoenix dactylifera]
Length=228

 Score =   185 bits (469),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 104/178 (58%), Positives = 137/178 (77%), Gaps = 9/178 (5%)
 Frame = +3

Query  36   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  215
            M F+++F+ + E LP +L++ YGLMR+LD+SLQ VQ+QN+QRC+ E+ED+KQ I+SGNI 
Sbjct  1    MGFLEDFQASFESLPTLLERNYGLMRELDKSLQGVQQQNEQRCEQEIEDIKQGIESGNIT  60

Query  216  -SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVA  392
             S SSLI+FSD+ALDEQKH IRIADEKVALA QAYD+VD HIQQLDQY++K  EELR+  
Sbjct  61   RSRSSLIRFSDEALDEQKHCIRIADEKVALATQAYDMVDAHIQQLDQYMRKL-EELRQ--  117

Query  393  ERENAVATGSTTSNVDNNVksgrsgdsskggrkkTRLATATPAANPTGMDLDLPVDPS  566
            ERE A   G+  SN D + +S R  +S++GGRKK++LA       P  + L+LPVDP+
Sbjct  118  ERELATGAGAGASNADASTRSRRIAESNRGGRKKSQLAV-----EPASIGLELPVDPN  170



>ref|XP_010550846.1| PREDICTED: PHD finger protein ING1 [Tarenaya hassleriana]
Length=244

 Score =   185 bits (470),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 111/193 (58%), Positives = 146/193 (76%), Gaps = 24/193 (12%)
 Frame = +3

Query  36   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  215
            MS ++EFE NL  L ++LQKKY L+RDLD+SLQE+QRQN+QRC+ E+E++++ I++G   
Sbjct  1    MSSVEEFEANLVSLSHVLQKKYALLRDLDKSLQEIQRQNEQRCEREIEEIRKGIRAG--P  58

Query  216  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  395
             D++L +FSD+ALDEQKH+IRIADEKVALA+QAYDLVD H+QQLDQYLKK DEE+RR  E
Sbjct  59   PDTALTRFSDEALDEQKHSIRIADEKVALAMQAYDLVDMHVQQLDQYLKKSDEEMRR--E  116

Query  396  RENAVATGSTTSNVDNNVksgrsgdsskggrkkTRL----------------ATATPAAN  527
            +E A    + +SNV ++ K+GRS +S +GGRKKTRL                A +  A N
Sbjct  117  KEAA----APSSNVGSSGKAGRSNESGRGGRKKTRLATANAVAAAASTAATAAASASAGN  172

Query  528  PTGMDLDLPVDPS  566
            P+GMDLDLPVDP+
Sbjct  173  PSGMDLDLPVDPN  185



>gb|KJB28065.1| hypothetical protein B456_005G039000 [Gossypium raimondii]
Length=230

 Score =   182 bits (462),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 115/182 (63%), Positives = 138/182 (76%), Gaps = 20/182 (11%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  221
            FIDEF+ +LE LPNILQKKY LMRDLD+SLQE+ RQN+QRC+ E+EDMK+ +++GNI  D
Sbjct  4    FIDEFQADLEALPNILQKKYALMRDLDKSLQEIVRQNEQRCEQEIEDMKRGLRAGNITPD  63

Query  222  SSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAERE  401
            +SL++FS++ALDEQKH++RIADEKVALAIQAYDL          YLKK  EELRR  ERE
Sbjct  64   TSLLRFSEEALDEQKHSVRIADEKVALAIQAYDL----------YLKKSGEELRR--ERE  111

Query  402  NAVATGSTTSNVDNNVksgrsgdsskggrkkTRL-------ATATPAANPTGMDLDLPVD  560
            N  AT S T   D   KSGRSG+S +GGRKKTRL         A  AANPTG++LDLPVD
Sbjct  112  N-TATASPTQTPDGTTKSGRSGESGRGGRKKTRLATAAAATEVAASAANPTGVELDLPVD  170

Query  561  PS  566
            P+
Sbjct  171  PN  172



>ref|XP_009390107.1| PREDICTED: PHD finger protein ING1 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=229

 Score =   182 bits (461),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 100/177 (56%), Positives = 136/177 (77%), Gaps = 6/177 (3%)
 Frame = +3

Query  36   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  215
            M F+++F+ ++E +P +LQ+ Y LMRDLD+SL  V++QN+QRC+ E+ED+K+ I+SG+I 
Sbjct  1    MGFVEDFQASIESVPAMLQRNYSLMRDLDKSLLGVRQQNEQRCEQEIEDIKRGIESGSIT  60

Query  216  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  395
             D+SLI+FSD+ALDEQKH IRIADEKV LAIQAYD+VD HIQQLDQY++K  EELR+  E
Sbjct  61   PDASLIRFSDEALDEQKHCIRIADEKVTLAIQAYDMVDAHIQQLDQYMRKL-EELRQERE  119

Query  396  RENAVATGSTTSNVDNNVksgrsgdsskggrkkTRLATATPAANPTGMDLDLPVDPS  566
                    +  SN D N +SGR+ +S +GGRKK+RL     AA P G++L+LPVDP+
Sbjct  120  LAAGADNAAGVSNTDPNTRSGRATESGRGGRKKSRL-----AAEPPGVELELPVDPN  171



>gb|KHN31619.1| PHD finger protein ING1, partial [Glycine soja]
Length=273

 Score =   182 bits (463),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 87/132 (66%), Positives = 111/132 (84%), Gaps = 2/132 (2%)
 Frame = +3

Query  54   FETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASDSSLI  233
            F  +L+ LP IL+KKY L+RDLD+SLQ+++RQN+QRC+ E+ED+K+ ++SGNI  D+S I
Sbjct  1    FSADLDSLPVILRKKYTLLRDLDKSLQDIKRQNEQRCEQEIEDIKRGVRSGNITPDTSAI  60

Query  234  KFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAERENAVA  413
            +FSD+ALDEQKH+IR+ADEKVALA+QAYDLVDT+IQQLDQYLKKFDEE+RR  ERENA  
Sbjct  61   RFSDEALDEQKHSIRVADEKVALAVQAYDLVDTNIQQLDQYLKKFDEEIRR--ERENAAI  118

Query  414  TGSTTSNVDNNV  449
            TG   S  + N 
Sbjct  119  TGVPASGPEGNT  130



>ref|XP_007034502.1| RING/FYVE/PHD zinc finger superfamily protein isoform 4 [Theobroma 
cacao]
 gb|EOY05428.1| RING/FYVE/PHD zinc finger superfamily protein isoform 4 [Theobroma 
cacao]
Length=231

 Score =   181 bits (458),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 111/190 (58%), Positives = 136/190 (72%), Gaps = 31/190 (16%)
 Frame = +3

Query  36   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  215
            MSFIDEF+ +LE LPNILQKKY LMRDLD+SLQE+ RQN+QRC+ E+ED+++ +++GNI 
Sbjct  1    MSFIDEFQADLEALPNILQKKYALMRDLDKSLQEIVRQNEQRCEQEIEDIRRGVRAGNIT  60

Query  216  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  395
             D+SL++FSD+ALDEQKH+IRIADEK                QLDQYLKK DEELRR  E
Sbjct  61   PDTSLLRFSDEALDEQKHSIRIADEK----------------QLDQYLKKSDEELRR--E  102

Query  396  RENAVATGSTTSNVDNNVksgrsgdsskggrkkTRL-------------ATATPAANPTG  536
            RENA AT S+  + D+  KSGR  +S +GGRKKTRL               A  AANPTG
Sbjct  103  RENAAATASSGPSPDSTTKSGRPSESGRGGRKKTRLATAAAAAAAAAATEVAAAAANPTG  162

Query  537  MDLDLPVDPS  566
            M+LDLPVDP+
Sbjct  163  MELDLPVDPN  172



>ref|XP_010918839.1| PREDICTED: PHD finger protein ING1 [Elaeis guineensis]
Length=228

 Score =   179 bits (454),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 100/178 (56%), Positives = 137/178 (77%), Gaps = 9/178 (5%)
 Frame = +3

Query  36   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  215
            M F+++F+ + E LP +LQ+ YGLMR+LD+SLQ VQ+QN+QRC+ E+E ++ RI+SGNI 
Sbjct  1    MGFLEDFQASFESLPALLQRNYGLMRELDKSLQGVQQQNEQRCEQEIEGIRLRIESGNIT  60

Query  216  SDS-SLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVA  392
             ++ SLI+FSD+ALDEQKH IRIADEKVALA QAYD+VD HIQQLDQY++K  E+LR+  
Sbjct  61   PNTTSLIRFSDEALDEQKHCIRIADEKVALATQAYDMVDAHIQQLDQYMRKL-EQLRQ--  117

Query  393  ERENAVATGSTTSNVDNNVksgrsgdsskggrkkTRLATATPAANPTGMDLDLPVDPS  566
            ERE A   G+  SN D + +SGR  +S++G RKK++LA   P+     + L+LPVDP+
Sbjct  118  ERELATGAGAGASNADASTRSGRIAESNRGMRKKSQLAVEPPS-----ISLELPVDPN  170



>gb|KJB33358.1| hypothetical protein B456_006G054900 [Gossypium raimondii]
Length=150

 Score =   176 bits (447),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 89/132 (67%), Positives = 105/132 (80%), Gaps = 9/132 (7%)
 Frame = +3

Query  36   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  215
            MSFID+F+ +LE LPNILQKKY LMRDLD+SLQE+ RQN+QRC+ E+ED+K+ +++ NI 
Sbjct  1    MSFIDQFQADLEALPNILQKKYALMRDLDKSLQEIVRQNEQRCEQEIEDIKRGLRAENI-  59

Query  216  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  395
                  +FSD+ALDEQKH IRIADEKVALAIQ YDLVD+HIQQLDQYLK  DEELRR  E
Sbjct  60   ------RFSDEALDEQKHGIRIADEKVALAIQTYDLVDSHIQQLDQYLKMSDEELRR--E  111

Query  396  RENAVATGSTTS  431
            RENA       S
Sbjct  112  RENAATASPVPS  123



>ref|XP_009390117.1| PREDICTED: PHD finger protein ING1 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=224

 Score =   179 bits (453),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 102/177 (58%), Positives = 138/177 (78%), Gaps = 11/177 (6%)
 Frame = +3

Query  36   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  215
            M F+++F+ ++E +P +LQ+ Y LMRDLD+SL  V++QN+QRC+ E+ED+K+ I+SG+I 
Sbjct  1    MGFVEDFQASIESVPAMLQRNYSLMRDLDKSLLGVRQQNEQRCEQEIEDIKRGIESGSIT  60

Query  216  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  395
             D+SLI+FSD+ALDEQKH IRIADEKV LAIQAYD+VD HIQQLDQY++K  EELR+ A 
Sbjct  61   PDASLIRFSDEALDEQKHCIRIADEKVTLAIQAYDMVDAHIQQLDQYMRKL-EELRQ-AG  118

Query  396  RENAVATGSTTSNVDNNVksgrsgdsskggrkkTRLATATPAANPTGMDLDLPVDPS  566
             +NA       SN D N +SGR+ +S +GGRKK+RL     AA P G++L+LPVDP+
Sbjct  119  ADNAAG----VSNTDPNTRSGRATESGRGGRKKSRL-----AAEPPGVELELPVDPN  166



>ref|XP_008812921.1| PREDICTED: PHD finger protein ING1-like isoform X2 [Phoenix dactylifera]
 ref|XP_008812922.1| PREDICTED: PHD finger protein ING1-like isoform X2 [Phoenix dactylifera]
 ref|XP_008812923.1| PREDICTED: PHD finger protein ING1-like isoform X2 [Phoenix dactylifera]
Length=241

 Score =   178 bits (452),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 100/168 (60%), Positives = 128/168 (76%), Gaps = 8/168 (5%)
 Frame = +3

Query  63   NLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASDSSLIKFS  242
              E LP +LQ+ YGLMRDLD+SLQ VQRQN+QRC+ E+ED++  ++SGNI  D+SLI+FS
Sbjct  24   GFESLPALLQRNYGLMRDLDKSLQGVQRQNEQRCEQEIEDIRLGVESGNITPDTSLIRFS  83

Query  243  DDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAERENAVATGS  422
            D+ALDEQKH IRIADEKVALA Q YD+VD H+QQLDQY++K  EE+R+  ERE A   G 
Sbjct  84   DEALDEQKHCIRIADEKVALATQVYDMVDAHVQQLDQYMRKL-EEVRQ--ERELATGAGV  140

Query  423  TTSNVDNNVksgrsgdsskggrkkTRLATATPAANPTGMDLDLPVDPS  566
              SN D + +S R  +SS+GGRKK+RLA   P+     +DL+LPVDP+
Sbjct  141  GASNADASTRSRRVAESSRGGRKKSRLAVEPPS-----VDLELPVDPN  183



>gb|KJB33359.1| hypothetical protein B456_006G054900 [Gossypium raimondii]
Length=181

 Score =   176 bits (447),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 89/132 (67%), Positives = 105/132 (80%), Gaps = 9/132 (7%)
 Frame = +3

Query  36   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  215
            MSFID+F+ +LE LPNILQKKY LMRDLD+SLQE+ RQN+QRC+ E+ED+K+ +++ NI 
Sbjct  1    MSFIDQFQADLEALPNILQKKYALMRDLDKSLQEIVRQNEQRCEQEIEDIKRGLRAENI-  59

Query  216  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  395
                  +FSD+ALDEQKH IRIADEKVALAIQ YDLVD+HIQQLDQYLK  DEELRR  E
Sbjct  60   ------RFSDEALDEQKHGIRIADEKVALAIQTYDLVDSHIQQLDQYLKMSDEELRR--E  111

Query  396  RENAVATGSTTS  431
            RENA       S
Sbjct  112  RENAATASPVPS  123



>ref|XP_008812920.1| PREDICTED: PHD finger protein ING1-like isoform X1 [Phoenix dactylifera]
Length=244

 Score =   178 bits (452),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 100/168 (60%), Positives = 128/168 (76%), Gaps = 8/168 (5%)
 Frame = +3

Query  63   NLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASDSSLIKFS  242
              E LP +LQ+ YGLMRDLD+SLQ VQRQN+QRC+ E+ED++  ++SGNI  D+SLI+FS
Sbjct  27   GFESLPALLQRNYGLMRDLDKSLQGVQRQNEQRCEQEIEDIRLGVESGNITPDTSLIRFS  86

Query  243  DDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAERENAVATGS  422
            D+ALDEQKH IRIADEKVALA Q YD+VD H+QQLDQY++K  EE+R+  ERE A   G 
Sbjct  87   DEALDEQKHCIRIADEKVALATQVYDMVDAHVQQLDQYMRKL-EEVRQ--ERELATGAGV  143

Query  423  TTSNVDNNVksgrsgdsskggrkkTRLATATPAANPTGMDLDLPVDPS  566
              SN D + +S R  +SS+GGRKK+RLA   P+     +DL+LPVDP+
Sbjct  144  GASNADASTRSRRVAESSRGGRKKSRLAVEPPS-----VDLELPVDPN  186



>ref|XP_006854339.1| hypothetical protein AMTR_s00039p00134610 [Amborella trichopoda]
 gb|ERN15806.1| hypothetical protein AMTR_s00039p00134610 [Amborella trichopoda]
Length=229

 Score =   177 bits (450),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 98/176 (56%), Positives = 133/176 (76%), Gaps = 6/176 (3%)
 Frame = +3

Query  36   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  215
            M+F+DEF  ++  LP+ L  KY  MRDLD+ LQ +QRQN+QRC+ E+E++++  +SGNI 
Sbjct  1    MAFLDEFLNHIASLPSELHYKYAHMRDLDKKLQVLQRQNEQRCEHEMEEIRRGAESGNIR  60

Query  216  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  395
             D+SLI+FS++ LDEQKH   +ADEKV+LA+QAYD+VDT+IQQLD+Y+KKFDE+LRR AE
Sbjct  61   PDTSLIRFSNETLDEQKHCTSLADEKVSLAVQAYDMVDTYIQQLDKYMKKFDEDLRR-AE  119

Query  396  RENAVATGSTTSNVDNNVksgrsgdsskggrkkTRLATATPAANPTGMDLDLPVDP  563
            RE A A+G++ +   +      S  SS+GGRKK+R+     AA P  MDLDLPVDP
Sbjct  120  RELAGASGASENAGSSAKSGRTSESSSRGGRKKSRV-----AAEPQNMDLDLPVDP  170



>ref|NP_566742.1| PHD finger protein ING1 [Arabidopsis thaliana]
 sp|Q9LIQ6.1|ING1_ARATH RecName: Full=PHD finger protein ING1; AltName: Full=Protein 
INHIBITOR OF GROWTH 1; Short=Protein AtING1 [Arabidopsis thaliana]
 dbj|BAB03019.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAM67115.1| PHD-finger protein, putative [Arabidopsis thaliana]
 gb|ABD94083.1| At3g24010 [Arabidopsis thaliana]
 dbj|BAH30468.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE76844.1| PHD finger protein ING1 [Arabidopsis thaliana]
Length=234

 Score =   177 bits (448),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 106/183 (58%), Positives = 139/183 (76%), Gaps = 13/183 (7%)
 Frame = +3

Query  36   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  215
            MSF +EFE NL  L ++LQKKY L+RDLD+SLQE QRQN+QRC+ E+ED++ R ++GNI 
Sbjct  1    MSFAEEFEANLVSLAHVLQKKYALLRDLDKSLQENQRQNEQRCEKEIEDIR-RGRAGNIT  59

Query  216  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  395
             ++SL KFS++ALDEQKH++RIADEKV LA+QAYDLVD H+QQLDQY+KK DE +R+  E
Sbjct  60   PNTSLTKFSEEALDEQKHSVRIADEKVTLAMQAYDLVDMHVQQLDQYMKKSDEVIRK--E  117

Query  396  RENAVATGSTTSNVDNNVksgrsgdsskggrkkTRL------ATATPAANPTGMDLDLPV  557
            +E A A    T  ++NN K+G +G+  +GGRKKTRL      A A+     + MDLDLPV
Sbjct  118  KEAAAA----TLELENNGKAGNAGEGGRGGRKKTRLATAASTAAASTGMTSSNMDLDLPV  173

Query  558  DPS  566
            DP+
Sbjct  174  DPN  176



>emb|CDX85182.1| BnaC07g07240D [Brassica napus]
Length=243

 Score =   177 bits (448),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 104/187 (56%), Positives = 145/187 (78%), Gaps = 20/187 (11%)
 Frame = +3

Query  33   RMSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNI  212
            +MSF DEFE+NL  L ++LQKKY L+RDLD+SLQE QRQN+QRC+ E+ED++ R ++GN+
Sbjct  10   QMSFADEFESNLVSLAHVLQKKYALLRDLDKSLQENQRQNEQRCEKEIEDIR-RGRTGNV  68

Query  213  ASDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVA  392
              ++    FS++A+DEQKH++RIADEK+ALA+QAYDLVD H+QQLDQY+KK +E++RR  
Sbjct  69   TPNAH---FSEEAIDEQKHSVRIADEKLALAMQAYDLVDMHVQQLDQYMKKSNEQMRR--  123

Query  393  ERENAVATGSTTSNVDNNVksgrsgdsskggrkkTRL---------ATATPAANPTGMDL  545
            E+ENA A     SN++N+ ++G++G+  +GGRKKTRL         A+A+     TGMDL
Sbjct  124  EKENASA-----SNLENSGEAGKAGEGRRGGRKKTRLATAASTAAVASASTGMTSTGMDL  178

Query  546  DLPVDPS  566
            DLPVDP+
Sbjct  179  DLPVDPN  185



>gb|KHG19241.1| PHD finger ING1 -like protein [Gossypium arboreum]
Length=191

 Score =   174 bits (442),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 88/132 (67%), Positives = 105/132 (80%), Gaps = 9/132 (7%)
 Frame = +3

Query  36   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  215
            MSFIDEF+ +LE LPNILQK+Y LMRDLD+SLQE+ RQN+QRC+ E+ED+K+ +++ NI 
Sbjct  1    MSFIDEFQADLEALPNILQKRYALMRDLDKSLQEIVRQNEQRCEQEIEDIKRGVRAENI-  59

Query  216  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  395
                  +FSD+ALDEQKH IRIADEKVALAIQ YDLVD+HIQQLDQYLK  D+ELRR  E
Sbjct  60   ------RFSDEALDEQKHGIRIADEKVALAIQTYDLVDSHIQQLDQYLKMSDDELRR--E  111

Query  396  RENAVATGSTTS  431
            RENA       S
Sbjct  112  RENAATASPVPS  123



>ref|XP_009102538.1| PREDICTED: PHD finger protein ING1 [Brassica rapa]
 emb|CDX77452.1| BnaA07g05900D [Brassica napus]
Length=243

 Score =   176 bits (445),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 105/187 (56%), Positives = 141/187 (75%), Gaps = 20/187 (11%)
 Frame = +3

Query  33   RMSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNI  212
            +MSF DEFE+NL  L ++LQKKY L+RDLD+SLQE QRQN+QRC+ E+ED    I+ G  
Sbjct  10   QMSFADEFESNLVSLAHVLQKKYALLRDLDKSLQENQRQNEQRCEKEIED----IRRGRT  65

Query  213  ASDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVA  392
            A+ +    FS++A+DEQKH++RIADEKVALA+QAYDLVD H+QQLDQY+KK +E++RR  
Sbjct  66   ANVTPNAHFSEEAIDEQKHSVRIADEKVALAMQAYDLVDMHVQQLDQYMKKSNEQMRR--  123

Query  393  ERENAVATGSTTSNVDNNVksgrsgdsskggrkkTRL---------ATATPAANPTGMDL  545
            E+ENA A     SN++N+ ++G++G+  +GGRKKTRL         A+A+     TGMDL
Sbjct  124  EKENASA-----SNLENSGEAGKAGEGRRGGRKKTRLATAASTAAVASASTGMTSTGMDL  178

Query  546  DLPVDPS  566
            DLPVDP+
Sbjct  179  DLPVDPN  185



>gb|KFK39701.1| hypothetical protein AALP_AA3G277600 [Arabis alpina]
Length=232

 Score =   174 bits (442),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 106/183 (58%), Positives = 144/183 (79%), Gaps = 15/183 (8%)
 Frame = +3

Query  36   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  215
            MSF +EFE+NL  L ++LQKKY L+RDLD+SLQE QR N+QRC+ E++D++ R ++GNI 
Sbjct  1    MSFAEEFESNLVSLAHVLQKKYALLRDLDKSLQENQRLNEQRCEKEIDDIR-RGRTGNIT  59

Query  216  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  395
             +++L +FS++ALDEQKH++RIADEKVALA+QAYDLVD H+QQLDQY+KK  EE+RR  E
Sbjct  60   PNTTLTQFSEEALDEQKHSVRIADEKVALAMQAYDLVDMHVQQLDQYMKK-SEEMRR--E  116

Query  396  RENAVATGSTTSNVDNNVksgrsgdsskggrkkTRL------ATATPAANPTGMDLDLPV  557
            +E+A A      NVD++ K+G++G+  +GGRKKTRL      A A+   + TGMDLDLPV
Sbjct  117  KESAAAL-----NVDSSGKAGKAGEGGRGGRKKTRLATAASTAAASTGISSTGMDLDLPV  171

Query  558  DPS  566
            DP+
Sbjct  172  DPN  174



>gb|EPS59284.1| hypothetical protein M569_15524, partial [Genlisea aurea]
Length=108

 Score =   170 bits (431),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 80/108 (74%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = +3

Query  63   NLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASDSSLIKFS  242
            ++E LPNILQ+KY L+RD+D+SLQE+QRQN+ RC+LE++DMK+ IK GN   DSSL KFS
Sbjct  1    DIEALPNILQRKYALLRDMDKSLQEIQRQNELRCELEIDDMKRDIKLGNATPDSSLFKFS  60

Query  243  DDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRR  386
            ++ALDEQKHAIRIADEKV+LA+QAYDLVDTHIQQLDQ+LKKFD++LRR
Sbjct  61   NEALDEQKHAIRIADEKVSLAMQAYDLVDTHIQQLDQFLKKFDDDLRR  108



>gb|KJB28063.1| hypothetical protein B456_005G039000 [Gossypium raimondii]
Length=215

 Score =   173 bits (439),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 107/160 (67%), Positives = 129/160 (81%), Gaps = 10/160 (6%)
 Frame = +3

Query  108  MRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASDSSLIKFSDDALDEQKHAIRIAD  287
            MRDLD+SLQE+ RQN+QRC+ E+EDMK+ +++GNI  D+SL++FS++ALDEQKH++RIAD
Sbjct  1    MRDLDKSLQEIVRQNEQRCEQEIEDMKRGLRAGNITPDTSLLRFSEEALDEQKHSVRIAD  60

Query  288  EKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAERENAVATGSTTSNVDNNVksgrsg  467
            EKVALAIQAYDLVD+HIQQLDQYLKK  EELRR  EREN  AT S T   D   KSGRSG
Sbjct  61   EKVALAIQAYDLVDSHIQQLDQYLKKSGEELRR--EREN-TATASPTQTPDGTTKSGRSG  117

Query  468  dsskggrkkTRL-------ATATPAANPTGMDLDLPVDPS  566
            +S +GGRKKTRL         A  AANPTG++LDLPVDP+
Sbjct  118  ESGRGGRKKTRLATAAAATEVAASAANPTGVELDLPVDPN  157



>gb|KDO43053.1| hypothetical protein CISIN_1g025753mg [Citrus sinensis]
 gb|KDO43054.1| hypothetical protein CISIN_1g025753mg [Citrus sinensis]
Length=248

 Score =   171 bits (434),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 101/161 (63%), Positives = 124/161 (77%), Gaps = 15/161 (9%)
 Frame = +3

Query  123  RSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASDSSLIKFSDDALDEQKHAIRIADEKVAL  302
             +L E+QRQN+QRC+ E+ED+ + I++GNI  ++SLI+FSDDALDEQKH+IRIADEKVAL
Sbjct  32   HTLAEIQRQNEQRCEQEIEDLMREIRAGNITPNTSLIRFSDDALDEQKHSIRIADEKVAL  91

Query  303  AIQAYDLVDTHIQQLDQYLKKFDEELRRVAERENAVATGSTTSNVDNNVksgrsgdsskg  482
            A+QAYDLVDTHIQQLDQYLK FDEELRR  ER++   T S   ++D + KSGRS +  +G
Sbjct  92   AVQAYDLVDTHIQQLDQYLKNFDEELRR--ERDSVATTASPAPSLDGSTKSGRSSEGGRG  149

Query  483  grkkTRL-------------ATATPAANPTGMDLDLPVDPS  566
            GRKKTRL             A ATP ANPTGM+LDLPVDP+
Sbjct  150  GRKKTRLATAAAAAAAAVTEAAATPVANPTGMELDLPVDPN  190



>ref|XP_010689994.1| PREDICTED: PHD finger protein ING1 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=237

 Score =   171 bits (432),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 112/179 (63%), Positives = 142/179 (79%), Gaps = 5/179 (3%)
 Frame = +3

Query  39   SFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIAS  218
            SF+DEF+ NLE+LPNILQKKY L+RDLD+SLQ++ RQN QR + E++++KQ + SG++  
Sbjct  3    SFLDEFQANLELLPNILQKKYALLRDLDKSLQDILRQNGQRFEQELDNIKQGLLSGSVTP  62

Query  219  DSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAER  398
            + S I+FSD+ALDEQKH+IRIADEKVALAIQAYDLVDTHIQQLDQYLK  +EE RR  E 
Sbjct  63   EPSRIRFSDEALDEQKHSIRIADEKVALAIQAYDLVDTHIQQLDQYLKTSEEESRREKEL  122

Query  399  ENAVATGSTTSNVDNNVksgrsgdsskggrkkTRL---ATATPAANPTGMDLDLPVDPS  566
             +A A+  + +NVD + KSGR  +  +GGRKKTRL   A +T  ANP  MDLD+PVDP+
Sbjct  123  ASAAAS--SDANVDGSSKSGRGSEGGRGGRKKTRLAASAASTAPANPPSMDLDVPVDPN  179



>ref|XP_010689988.1| PREDICTED: PHD finger protein ING1 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=239

 Score =   170 bits (431),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 112/179 (63%), Positives = 142/179 (79%), Gaps = 5/179 (3%)
 Frame = +3

Query  39   SFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIAS  218
            SF+DEF+ NLE+LPNILQKKY L+RDLD+SLQ++ RQN QR + E++++KQ + SG++  
Sbjct  5    SFLDEFQANLELLPNILQKKYALLRDLDKSLQDILRQNGQRFEQELDNIKQGLLSGSVTP  64

Query  219  DSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAER  398
            + S I+FSD+ALDEQKH+IRIADEKVALAIQAYDLVDTHIQQLDQYLK  +EE RR  E 
Sbjct  65   EPSRIRFSDEALDEQKHSIRIADEKVALAIQAYDLVDTHIQQLDQYLKTSEEESRREKEL  124

Query  399  ENAVATGSTTSNVDNNVksgrsgdsskggrkkTRL---ATATPAANPTGMDLDLPVDPS  566
             +A A+  + +NVD + KSGR  +  +GGRKKTRL   A +T  ANP  MDLD+PVDP+
Sbjct  125  ASAAAS--SDANVDGSSKSGRGSEGGRGGRKKTRLAASAASTAPANPPSMDLDVPVDPN  181



>ref|XP_010466802.1| PREDICTED: PHD finger protein ING1-like [Camelina sativa]
Length=233

 Score =   167 bits (422),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 105/184 (57%), Positives = 140/184 (76%), Gaps = 16/184 (9%)
 Frame = +3

Query  36   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  215
            MSF +EFE NL  L ++LQKKY L+RDLD+SLQE QRQN+QRC+ E+ED++ R ++GNI 
Sbjct  1    MSFAEEFEANLVSLAHVLQKKYSLLRDLDKSLQENQRQNEQRCEKEIEDIR-RGRTGNIT  59

Query  216  -SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVA  392
             S +SL +FS++ALDEQKH++RIADEKVALA+QAYDLVD H+QQLDQY+KK  EE+R+  
Sbjct  60   PSSTSLTQFSEEALDEQKHSVRIADEKVALAMQAYDLVDMHVQQLDQYMKK-SEEIRK--  116

Query  393  ERENAVATGSTTSNVDNNVksgrsgdsskggrkkTRL------ATATPAANPTGMDLDLP  554
            E+E A A       ++N+ K+G++G+  +GGRKKTRL      A A+     + MDLDLP
Sbjct  117  EKEAAAAL-----ELENSEKAGKAGEGGRGGRKKTRLATAASTAAASTGVTSSNMDLDLP  171

Query  555  VDPS  566
            VDP+
Sbjct  172  VDPN  175



>ref|XP_006298381.1| hypothetical protein CARUB_v10014450mg, partial [Capsella rubella]
 gb|EOA31279.1| hypothetical protein CARUB_v10014450mg, partial [Capsella rubella]
Length=256

 Score =   167 bits (422),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 103/184 (56%), Positives = 140/184 (76%), Gaps = 13/184 (7%)
 Frame = +3

Query  33   RMSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNI  212
            +MSF +EFE NL  L ++LQKKY L+RDLD+SLQE QRQN+QRC+ E+ED++ R ++GNI
Sbjct  22   QMSFAEEFEANLVSLAHVLQKKYALLRDLDKSLQENQRQNEQRCEKEIEDIR-RGRTGNI  80

Query  213  ASDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVA  392
              ++SL +FS++ALDEQKH++RIADEKVALA+QAYDLVD H+QQLDQY+KK DEE+R+  
Sbjct  81   TPNTSLTQFSEEALDEQKHSVRIADEKVALAMQAYDLVDMHVQQLDQYMKKSDEEIRK--  138

Query  393  ERENAVATGSTTSNVDNNVksgrsgdsskggrkkTRL------ATATPAANPTGMDLDLP  554
                     +   +++N+ K+G++G+  +GGRKKTRL      A A+ A   T MDLDLP
Sbjct  139  ----EKEAAAAALDLENSGKAGKAGEGGRGGRKKTRLATAASTAAASTAVTSTNMDLDLP  194

Query  555  VDPS  566
            VDP+
Sbjct  195  VDPN  198



>ref|XP_006418791.1| hypothetical protein EUTSA_v10002653mg [Eutrema salsugineum]
 gb|ESQ37227.1| hypothetical protein EUTSA_v10002653mg [Eutrema salsugineum]
Length=235

 Score =   166 bits (419),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 106/184 (58%), Positives = 137/184 (74%), Gaps = 14/184 (8%)
 Frame = +3

Query  36   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  215
            MSF DEFE NL  L ++LQKKY L+RDLD+SLQE QRQN+QRC+ E++D++ R ++GN+ 
Sbjct  1    MSFADEFEANLVSLAHVLQKKYALLRDLDKSLQENQRQNEQRCEKEIDDIR-RGRTGNVT  59

Query  216  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  395
              +SL +FS++ALDEQKH++RIADEKVALA+QAYDLVD H+QQLDQY+KK DEE+RR  E
Sbjct  60   PSTSLTQFSEEALDEQKHSVRIADEKVALAMQAYDLVDMHVQQLDQYMKKSDEEMRREKE  119

Query  396  RENAVATGSTTSNVDNNVksgrsgdsskggrkkTRL-------ATATPAANPTGMDLDLP  554
            +ENA A+   +S          +G+  +GGRKKTRL       A AT   + T MDLDLP
Sbjct  120  KENAAASNLESSEAGK------AGEGRRGGRKKTRLATAASTAAAATTGTSSTNMDLDLP  173

Query  555  VDPS  566
            VDP+
Sbjct  174  VDPN  177



>ref|XP_007034501.1| RING/FYVE/PHD zinc finger superfamily protein isoform 3, partial 
[Theobroma cacao]
 gb|EOY05427.1| RING/FYVE/PHD zinc finger superfamily protein isoform 3, partial 
[Theobroma cacao]
Length=214

 Score =   163 bits (413),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 98/113 (87%), Gaps = 2/113 (2%)
 Frame = +3

Query  111  RDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASDSSLIKFSDDALDEQKHAIRIADE  290
            RDLD+SLQE+ RQN+QRC+ E+ED+++ +++GNI  D+SL++FSD+ALDEQKH+IRIADE
Sbjct  1    RDLDKSLQEIVRQNEQRCEQEIEDIRRGVRAGNITPDTSLLRFSDEALDEQKHSIRIADE  60

Query  291  KVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAERENAVATGSTTSNVDNNV  449
            KVALAIQAYDLVD+HIQQLDQYLKK DEELRR  ERENA AT S+  + D+  
Sbjct  61   KVALAIQAYDLVDSHIQQLDQYLKKSDEELRR--ERENAAATASSGPSPDSTT  111



>ref|XP_010488512.1| PREDICTED: PHD finger protein ING1 [Camelina sativa]
Length=234

 Score =   161 bits (408),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 94/178 (53%), Positives = 122/178 (69%), Gaps = 3/178 (2%)
 Frame = +3

Query  36   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  215
            MSF +EFE NL  L ++LQKKY L+RDLD+SLQE QRQN+QRC+ E+ED++ R ++GNI 
Sbjct  1    MSFAEEFEANLVSLAHVLQKKYSLLRDLDKSLQENQRQNEQRCEKEIEDIR-RGRTGNIT  59

Query  216  -SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVA  392
             S +SL +FS++ALDEQKH++RIADEKVALA+QAYDLVD H+QQLDQY+KK  EE+R+  
Sbjct  60   PSSTSLTQFSEEALDEQKHSVRIADEKVALAMQAYDLVDMHVQQLDQYMKK-SEEIRKEK  118

Query  393  ERENAVATGSTTSNVDNNVksgrsgdsskggrkkTRLATATPAANPTGMDLDLPVDPS  566
            E   A      +       + GR G            A A+     + MDLDLPVDP+
Sbjct  119  EAAAAALELENSEKAGKAGEGGRGGRKKTRLATAASTAAASTGVTSSNMDLDLPVDPN  176



>ref|XP_002883498.1| hypothetical protein ARALYDRAFT_479934 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59757.1| hypothetical protein ARALYDRAFT_479934 [Arabidopsis lyrata subsp. 
lyrata]
Length=234

 Score =   161 bits (407),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 102/183 (56%), Positives = 136/183 (74%), Gaps = 13/183 (7%)
 Frame = +3

Query  36   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  215
            MSF +EFE NL  L ++LQKKY L+RDLD+SLQE QRQN+QRC+ E++D++ + ++GNI 
Sbjct  1    MSFAEEFEANLVSLAHVLQKKYALLRDLDKSLQENQRQNEQRCEKEIDDIR-KGRAGNIT  59

Query  216  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  395
             + SL +FS++ALDEQKH++RIADEKVALA+QAYDLVD H+QQLDQY+KK +E  R ++E
Sbjct  60   PNISLTQFSEEALDEQKHSVRIADEKVALAMQAYDLVDMHVQQLDQYMKKSEE--RFLSE  117

Query  396  RENAVATGSTTSNVDNNVksgrsgdsskggrkkTRL------ATATPAANPTGMDLDLPV  557
            +E A A         NN K+G +G+  +GGRKKTRL      A A+     + MDLDLPV
Sbjct  118  KEAAAAALELE----NNGKAGNAGEGGRGGRKKTRLATAASTAAASTGMTSSNMDLDLPV  173

Query  558  DPS  566
            DP+
Sbjct  174  DPN  176



>ref|XP_006649386.1| PREDICTED: PHD finger protein ING1-like [Oryza brachyantha]
Length=246

 Score =   160 bits (405),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 100/192 (52%), Positives = 133/192 (69%), Gaps = 19/192 (10%)
 Frame = +3

Query  36   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  215
            M F+++F+ ++E LP +L + Y LMR+LDRSLQ VQ +N+QRCQ E+ED+K  ++SG+IA
Sbjct  1    MGFLEDFQASVEALPAMLHRNYSLMRELDRSLQGVQTENEQRCQQEIEDIKHGLESGSIA  60

Query  216  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  395
             D + +KFSD+A+DEQKH +RIADEKVALA Q YDLVD HIQQLDQ+++K  EELR+  E
Sbjct  61   FDPAKLKFSDEAIDEQKHCVRIADEKVALATQTYDLVDAHIQQLDQFMRKL-EELRQEKE  119

Query  396  RENAVA--------------TGSTTSNVDNNVksgrsgdsskggrkkT-RLATATPAANP  530
               A A                + TS VDN  K GRSG+  +GGRKKT ++ T  PA   
Sbjct  120  AATAAATAAAAGTTVAATVMASAGTSAVDNTPKGGRSGERGRGGRKKTAKVPTEQPA---  176

Query  531  TGMDLDLPVDPS  566
              +DL+LPVDP+
Sbjct  177  PAIDLELPVDPN  188



>ref|NP_001048939.1| Os03g0143600 [Oryza sativa Japonica Group]
 gb|AAO72583.1| putative PHD-finger protein [Oryza sativa Japonica Group]
 gb|AAO72665.1| putative PHD-finger protein [Oryza sativa Japonica Group]
 dbj|BAC78580.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|ABF93930.1| PHD-finger family protein, expressed [Oryza sativa Japonica Group]
 dbj|BAF10853.1| Os03g0143600 [Oryza sativa Japonica Group]
 gb|EAZ25544.1| hypothetical protein OsJ_09369 [Oryza sativa Japonica Group]
 dbj|BAG90907.1| unnamed protein product [Oryza sativa Japonica Group]
Length=253

 Score =   160 bits (404),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 98/199 (49%), Positives = 133/199 (67%), Gaps = 26/199 (13%)
 Frame = +3

Query  36   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  215
            M F+++F+ ++E LP +LQ+ Y LMR+LD+SLQ VQ  N+QRCQ E+ED+K  ++SG+I 
Sbjct  1    MGFLEDFQASVEALPAMLQRNYSLMRELDKSLQGVQTGNEQRCQQEIEDIKHGLESGSIT  60

Query  216  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  395
             D + +KFSD+A++EQKH +RIADEKVALA Q YDLVD HIQQLDQ+++K  EELR+  E
Sbjct  61   YDPAKLKFSDEAIEEQKHCVRIADEKVALASQTYDLVDAHIQQLDQFMRKL-EELRQEKE  119

Query  396  -----------RENAVATGS----------TTSNVDNNVksgrsgdsskggrkkT-RLAT  509
                          +VATG+           TS  DN  K GRS +  +GGRKKT ++ T
Sbjct  120  AATTAAAAAAAAAASVATGTPVAATVTASAGTSTADNTPKGGRSSERGRGGRKKTAKVPT  179

Query  510  ATPAANPTGMDLDLPVDPS  566
              PA     +DL+LPVDP+
Sbjct  180  EQPAP---AIDLELPVDPN  195



>ref|XP_008777020.1| PREDICTED: PHD finger protein ING1-like isoform X2 [Phoenix dactylifera]
Length=204

 Score =   157 bits (398),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 119/154 (77%), Gaps = 9/154 (6%)
 Frame = +3

Query  108  MRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA-SDSSLIKFSDDALDEQKHAIRIA  284
            MR+LD+SLQ VQ+QN+QRC+ E+ED+KQ I+SGNI  S SSLI+FSD+ALDEQKH IRIA
Sbjct  1    MRELDKSLQGVQQQNEQRCEQEIEDIKQGIESGNITRSRSSLIRFSDEALDEQKHCIRIA  60

Query  285  DEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAERENAVATGSTTSNVDNNVksgrs  464
            DEKVALA QAYD+VD HIQQLDQY++K  EELR+  ERE A   G+  SN D + +S R 
Sbjct  61   DEKVALATQAYDMVDAHIQQLDQYMRKL-EELRQ--ERELATGAGAGASNADASTRSRRI  117

Query  465  gdsskggrkkTRLATATPAANPTGMDLDLPVDPS  566
             +S++GGRKK++LA       P  + L+LPVDP+
Sbjct  118  AESNRGGRKKSQLAV-----EPASIGLELPVDPN  146



>ref|XP_010513292.1| PREDICTED: PHD finger protein ING1-like [Camelina sativa]
Length=234

 Score =   158 bits (399),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 92/178 (52%), Positives = 120/178 (67%), Gaps = 3/178 (2%)
 Frame = +3

Query  36   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  215
            MSF +EFE NL  L ++LQKKY L+RDLD+SLQE QRQN+QRC+ E+ED++ R ++GNI 
Sbjct  1    MSFAEEFEANLVSLAHVLQKKYSLLRDLDKSLQENQRQNEQRCEKEIEDIR-RGRTGNIT  59

Query  216  -SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVA  392
             S +SL +FS++ALDEQKH++RIADEKVALA+QAYDLVD H+QQLDQ +KK  EE+R+  
Sbjct  60   PSSTSLTQFSEEALDEQKHSVRIADEKVALAMQAYDLVDMHVQQLDQCMKK-SEEIRKEK  118

Query  393  ERENAVATGSTTSNVDNNVksgrsgdsskggrkkTRLATATPAANPTGMDLDLPVDPS  566
            E   A      +       + GR G            A  +     + MDLDLPVDP+
Sbjct  119  EAAAAALELENSEKAGKAGEGGRGGRKKTRLATAASTAATSTGVTSSNMDLDLPVDPN  176



>gb|EAY88500.1| hypothetical protein OsI_09971 [Oryza sativa Indica Group]
Length=255

 Score =   157 bits (398),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 99/201 (49%), Positives = 134/201 (67%), Gaps = 28/201 (14%)
 Frame = +3

Query  36   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  215
            M F+++F+ ++E LP +LQ+ Y LMR+LD+SLQ VQ  N+QRCQ E+ED+K  ++SG+I 
Sbjct  1    MGFLEDFQASVEALPAMLQRNYSLMRELDKSLQGVQTGNEQRCQQEIEDIKHGLESGSIT  60

Query  216  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  395
             D + +KFSD+A++EQKH +RIADEKVALA Q YDLVD HIQQLDQ+++K  EELR+  E
Sbjct  61   YDPAKLKFSDEAIEEQKHCVRIADEKVALASQTYDLVDAHIQQLDQFMRKL-EELRQEKE  119

Query  396  -------------RENAVATGST----------TSNVDNNVksgrsgdsskggrkkT-RL  503
                            +VATG+           TS  DN  K GRSG+  +GGRKKT ++
Sbjct  120  AATTAAAAAAAAAAAASVATGTPVAATVTASAGTSTADNTPKGGRSGERGRGGRKKTAKV  179

Query  504  ATATPAANPTGMDLDLPVDPS  566
             T  PA     +DL+LPVDP+
Sbjct  180  PTEQPAP---AIDLELPVDPN  197



>ref|XP_004985739.1| PREDICTED: PHD finger protein ING1-like [Setaria italica]
Length=243

 Score =   152 bits (383),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 94/189 (50%), Positives = 132/189 (70%), Gaps = 16/189 (8%)
 Frame = +3

Query  36   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  215
            M F+++F+ ++E LP++L + Y LMR+LD+SLQ VQ +N+QRCQ E+ED+K  ++SG+I 
Sbjct  1    MGFLEDFQASVESLPSMLHRNYSLMRELDKSLQGVQLENEQRCQQEIEDIKHGLESGSIT  60

Query  216  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  395
             D + +KFS++A++EQKH +RIADEKVALA Q YDLVD HIQQLDQ+L+K  EE+R+  E
Sbjct  61   YDPAKLKFSEEAIEEQKHCVRIADEKVALATQTYDLVDAHIQQLDQFLRKL-EEIRQEKE  119

Query  396  RENAVATGST------------TSNVDNNVksgrsgdsskggrkkTRLATATPAANPTGM  539
               AVA G+              S  D   K+GRSG+  +GGRKK ++ T  PA     +
Sbjct  120  AAAAVAAGTVAPAAATPAASAGVSTADATPKTGRSGERGRGGRKKAKVPTEPPAPP---I  176

Query  540  DLDLPVDPS  566
            DL+LPVDP+
Sbjct  177  DLELPVDPN  185



>ref|XP_008224074.1| PREDICTED: PHD finger protein ING1 isoform X2 [Prunus mume]
Length=213

 Score =   150 bits (378),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 100/182 (55%), Positives = 122/182 (67%), Gaps = 32/182 (18%)
 Frame = +3

Query  36   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  215
            MSF++EF  N                        +QRQN+QRC+ E+ED+K+ IKSGNI 
Sbjct  1    MSFLEEFNAN------------------------IQRQNEQRCEQEIEDIKREIKSGNIT  36

Query  216  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  395
             D+SLI+FSD+ALDEQKH+I IADEKV LA++AYDLVDTHIQQLDQYLK F+EELR   E
Sbjct  37   PDTSLIRFSDEALDEQKHSIGIADEKVMLAVRAYDLVDTHIQQLDQYLKTFEEELR---E  93

Query  396  RENAVATGSTTSNVDNNVksgrsgdsskggrkkTRL-----ATATPAANPTGMDLDLPVD  560
            R+   A+     + D   K GRS +  +GGRKKTRL     ATAT A NPT MDLD+PVD
Sbjct  94   RDTVAASALPAPSADTGAKPGRSSEGGRGGRKKTRLATATAATATAAVNPTAMDLDIPVD  153

Query  561  PS  566
            P+
Sbjct  154  PN  155



>ref|XP_010933237.1| PREDICTED: PHD finger protein ING1-like [Elaeis guineensis]
Length=272

 Score =   150 bits (380),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 89/143 (62%), Positives = 112/143 (78%), Gaps = 8/143 (6%)
 Frame = +3

Query  138  VQRQNDQRCQLEVEDMKQRIKSGNIASDSSLIKFSDDALDEQKHAIRIADEKVALAIQAY  317
            VQRQN+QRC+ E+ D+++ I+SGNI  D+SLI+FSD+ALDEQKH IRIADEKVALA QAY
Sbjct  80   VQRQNEQRCEQEIGDIRRGIESGNITPDTSLIRFSDEALDEQKHCIRIADEKVALATQAY  139

Query  318  DLVDTHIQQLDQYLKKFDEELRRVAERENAVATGSTTSNVDNNVksgrsgdsskggrkkT  497
            D+VD HIQQLDQY++K  EELR+  ERE A   G  TSN D + +SGR  +SS+GGRKK+
Sbjct  140  DMVDAHIQQLDQYMRKL-EELRQ--ERELATGAGVGTSNADASTRSGRVAESSRGGRKKS  196

Query  498  RLATATPAANPTGMDLDLPVDPS  566
            RLA   P+     +DL+LPVDP+
Sbjct  197  RLAVEPPS-----VDLELPVDPN  214



>ref|XP_003558832.1| PREDICTED: PHD finger protein ING1 [Brachypodium distachyon]
Length=245

 Score =   149 bits (377),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 94/193 (49%), Positives = 129/193 (67%), Gaps = 22/193 (11%)
 Frame = +3

Query  36   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  215
            M F+++F+ ++E LP +L K Y LMR+LD+SLQ VQ +N+QRCQ E+ED+K  ++SG+I 
Sbjct  1    MGFLEDFQASVEALPAMLHKNYSLMRELDKSLQGVQLENEQRCQQEIEDIKHGLESGSIT  60

Query  216  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  395
             + + +KFSD+A++EQKH +RIADEKVALA Q YDLVD HIQQLDQ+++K  EELR+  E
Sbjct  61   YEPAKLKFSDEAMEEQKHCVRIADEKVALATQTYDLVDAHIQQLDQFMRKL-EELRQEKE  119

Query  396  RENAVATG----------------STTSNVDNNVksgrsgdsskggrkkTRLATATPAAN  527
               A A                  S +S  D   KSGRSG+  +GGRKK ++    PA  
Sbjct  120  AAAATAAAGSVVAATVAAPASAGTSRSSAADAAPKSGRSGERGRGGRKKAKIPMEQPA--  177

Query  528  PTGMDLDLPVDPS  566
               +DL+LPVDP+
Sbjct  178  ---IDLELPVDPN  187



>ref|XP_008658601.1| PREDICTED: inhibitor of growth protein 5 isoform X1 [Zea mays]
Length=303

 Score =   148 bits (373),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 96/120 (80%), Gaps = 1/120 (1%)
 Frame = +3

Query  36   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  215
            M F+++F+ ++E LP++L + Y LMR+LD+SL  VQ +N+QRCQ E+ED+K  ++SG+I 
Sbjct  1    MGFLEDFQASVEALPSMLHRNYSLMRELDKSLHGVQLENEQRCQQEIEDIKHGLESGSIT  60

Query  216  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  395
             D + +KFS++A++EQKH +RIADEKVALA Q YDLVD HIQQLDQ+++K  EE+R+  E
Sbjct  61   YDPAKLKFSEEAMEEQKHCVRIADEKVALATQTYDLVDAHIQQLDQFMRKL-EEIRQGKE  119



>ref|NP_001148845.1| inhibitor of growth protein 5 [Zea mays]
 gb|ACG33115.1| inhibitor of growth protein 5 [Zea mays]
 gb|ACN27090.1| unknown [Zea mays]
 gb|ADX60122.1| PHD transcription factor [Zea mays]
 gb|AFW89644.1| inhibitor of growth protein 5 [Zea mays]
Length=249

 Score =   146 bits (369),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 96/120 (80%), Gaps = 1/120 (1%)
 Frame = +3

Query  36   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  215
            M F+++F+ ++E LP++L + Y LMR+LD+SL  VQ +N+QRCQ E+ED+K  ++SG+I 
Sbjct  1    MGFLEDFQASVEALPSMLHRNYSLMRELDKSLHGVQLENEQRCQQEIEDIKHGLESGSIT  60

Query  216  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  395
             D + +KFS++A++EQKH +RIADEKVALA Q YDLVD HIQQLDQ+++K  EE+R+  E
Sbjct  61   YDPAKLKFSEEAMEEQKHCVRIADEKVALATQTYDLVDAHIQQLDQFMRKL-EEIRQGKE  119



>ref|XP_008658602.1| PREDICTED: inhibitor of growth protein 5 isoform X2 [Zea mays]
Length=271

 Score =   147 bits (370),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 92/113 (81%), Gaps = 0/113 (0%)
 Frame = +3

Query  36   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  215
            M F+++F+ ++E LP++L + Y LMR+LD+SL  VQ +N+QRCQ E+ED+K  ++SG+I 
Sbjct  1    MGFLEDFQASVEALPSMLHRNYSLMRELDKSLHGVQLENEQRCQQEIEDIKHGLESGSIT  60

Query  216  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDE  374
             D + +KFS++A++EQKH +RIADEKVALA Q YDLVD HIQQLDQ+++K +E
Sbjct  61   YDPAKLKFSEEAMEEQKHCVRIADEKVALATQTYDLVDAHIQQLDQFMRKLEE  113



>dbj|BAK07845.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=253

 Score =   145 bits (367),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 95/117 (81%), Gaps = 2/117 (2%)
 Frame = +3

Query  36   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  215
            M F+++F+ ++E LP +L K Y LMR+LD+SLQ VQ +N+QRCQ E+ED+K  ++SG+I 
Sbjct  1    MGFLEDFQASVETLPAMLHKNYSLMRELDKSLQGVQLENEQRCQQEIEDIKHGLESGSIT  60

Query  216  S-DSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELR  383
            + + + +KFSD+A++EQKH +RIADEKVALA Q YDLVD HIQQLDQ+++K  EELR
Sbjct  61   TYEPAKLKFSDEAIEEQKHCVRIADEKVALATQTYDLVDAHIQQLDQFMRKL-EELR  116



>dbj|BAJ97745.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=253

 Score =   145 bits (367),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 95/117 (81%), Gaps = 2/117 (2%)
 Frame = +3

Query  36   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  215
            M F+++F+ ++E LP +L K Y LMR+LD+SLQ VQ +N+QRCQ E+ED+K  ++SG+I 
Sbjct  1    MGFLEDFQASVETLPAMLHKNYSLMRELDKSLQGVQLENEQRCQQEIEDIKHGLESGSIT  60

Query  216  S-DSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELR  383
            + + + +KFSD+A++EQKH +RIADEKVALA Q YDLVD HIQQLDQ+++K  EELR
Sbjct  61   TYEPAKLKFSDEAIEEQKHCVRIADEKVALATQTYDLVDAHIQQLDQFMRKL-EELR  116



>gb|ABR17867.1| unknown [Picea sitchensis]
Length=228

 Score =   142 bits (357),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 94/177 (53%), Positives = 128/177 (72%), Gaps = 7/177 (4%)
 Frame = +3

Query  36   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  215
            M+ +D+F  N+  LP+ L + Y LMR+LD  LQ +QR N++RC+ E+E++K+  +SGNI 
Sbjct  1    MTILDDFINNITSLPSDLTRCYELMRELDVQLQVLQRHNEERCEHELEEIKRGAESGNIT  60

Query  216  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  395
             D+S+ +FSDDAL EQK    IADEKV+LA+QAYDLVD HIQ+LD+Y+KKFDE+LRR  E
Sbjct  61   PDASVFRFSDDALAEQKDCSNIADEKVSLAVQAYDLVDGHIQRLDKYMKKFDEDLRR--E  118

Query  396  RENAVATGSTTSNVDNNVksgrsgdsskggrkkTRLATATPAANPTGMDLDLPVDPS  566
            RE A A  +   N D + +SGR  +SSK GRK++++      A P  MDLDLPVDP+
Sbjct  119  RELAGAVVAMDHNTDTSGRSGRGHESSKAGRKRSQI-----VAEPLSMDLDLPVDPN  170



>gb|KJB28068.1| hypothetical protein B456_005G039000 [Gossypium raimondii]
Length=190

 Score =   135 bits (340),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 89/135 (66%), Positives = 106/135 (79%), Gaps = 10/135 (7%)
 Frame = +3

Query  183  MKQRIKSGNIASDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLK  362
            MK+ +++GNI  D+SL++FS++ALDEQKH++RIADEKVALAIQAYDLVD+HIQQLDQYLK
Sbjct  1    MKRGLRAGNITPDTSLLRFSEEALDEQKHSVRIADEKVALAIQAYDLVDSHIQQLDQYLK  60

Query  363  KFDEELRRVAERENAVATGSTTSNVDNNVksgrsgdsskggrkkTRL-------ATATPA  521
            K  EELRR  EREN  AT S T   D   KSGRSG+S +GGRKKTRL         A  A
Sbjct  61   KSGEELRR--EREN-TATASPTQTPDGTTKSGRSGESGRGGRKKTRLATAAAATEVAASA  117

Query  522  ANPTGMDLDLPVDPS  566
            ANPTG++LDLPVDP+
Sbjct  118  ANPTGVELDLPVDPN  132



>gb|EMS57339.1| Inhibitor of growth protein 4 [Triticum urartu]
Length=315

 Score =   130 bits (327),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 68/141 (48%), Positives = 93/141 (66%), Gaps = 28/141 (20%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQ--------------------------EVQ  143
            F+++F+  +E LP +L K Y LMR+LD+SLQ                           VQ
Sbjct  36   FLEKFQACVETLPAMLHKNYSLMRELDKSLQACDCNSVLCDYCCALLLFKPIGPCNKSVQ  95

Query  144  RQNDQRCQLEVEDMKQRIKSGNIAS-DSSLIKFSDDALDEQKHAIRIADEKVALAIQAYD  320
             +N+QRCQ E+ED+K  ++SG+I + + + +KFSD+A++EQKH +RIADEKVALA Q YD
Sbjct  96   LENEQRCQQEIEDIKHGLESGSITTYEPAKLKFSDEAIEEQKHCVRIADEKVALATQTYD  155

Query  321  LVDTHIQQLDQYLKKFDEELR  383
            LVD HIQQLDQY++K  EELR
Sbjct  156  LVDAHIQQLDQYMRKL-EELR  175



>ref|XP_008342626.1| PREDICTED: uncharacterized protein LOC103405401 [Malus domestica]
Length=164

 Score =   102 bits (253),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 60/74 (81%), Gaps = 1/74 (1%)
 Frame = +3

Query  162  CQLEVEDMKQRIKSGNIASDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQ  341
            C+ E+ED+K+ I+ GNI  + SL +FSDD LD+QKH I I DEKV L ++AYDLVDTHIQ
Sbjct  55   CEQEIEDIKREIRPGNIKPNXSLNRFSDD-LDQQKHNIGIVDEKVLLXVRAYDLVDTHIQ  113

Query  342  QLDQYLKKFDEELR  383
            QLDQYLK F+EELR
Sbjct  114  QLDQYLKTFEEELR  127



>ref|XP_001780390.1| predicted protein [Physcomitrella patens]
 gb|EDQ54844.1| predicted protein, partial [Physcomitrella patens]
Length=236

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 88/124 (71%), Gaps = 2/124 (2%)
 Frame = +3

Query  36   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  215
            M++++++ ++++ LP  LQK Y L+R+LD+  Q +Q+    +C   +E++++  +SG+ +
Sbjct  1    MTYLEDYISSVQTLPTELQKNYQLLRELDQKFQALQKHMQVQCAKGLEEVRKAKESGSAS  60

Query  216  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  395
             D+  ++ S++ L+  K  + +A+EKV LA+Q YDLVD HIQ+LD+ LKKF+EELRR  +
Sbjct  61   PDTVALQHSNEVLNVHKACLTVAEEKVFLAVQTYDLVDGHIQRLDKDLKKFEEELRR--D  118

Query  396  RENA  407
            RE A
Sbjct  119  REAA  122



>gb|AAO42002.1| putative PHD-finger protein [Arabidopsis thaliana]
Length=160

 Score = 83.2 bits (204),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 76/108 (70%), Gaps = 12/108 (11%)
 Frame = +3

Query  261  QKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAERENAVATGSTTSNVD  440
            QKH++RIADEKV LA+QAYDLVD H+QQLDQY+KK  E +R+  E+E A A    T  ++
Sbjct  1    QKHSVRIADEKVTLAMQAYDLVDMHVQQLDQYMKKSGEVIRK--EKEAAAA----TLELE  54

Query  441  NNVksgrsgdsskggrkkTRL------ATATPAANPTGMDLDLPVDPS  566
            NN K+G +G+  +GGRKKTRL      A A+     + MDLDLPVDP+
Sbjct  55   NNGKAGNAGEGGRGGRKKTRLATAASTAAASTGMTSSNMDLDLPVDPN  102



>ref|XP_002963669.1| hypothetical protein SELMODRAFT_270360 [Selaginella moellendorffii]
 ref|XP_002974758.1| hypothetical protein SELMODRAFT_228279 [Selaginella moellendorffii]
 gb|EFJ24278.1| hypothetical protein SELMODRAFT_228279 [Selaginella moellendorffii]
 gb|EFJ35540.1| hypothetical protein SELMODRAFT_270360 [Selaginella moellendorffii]
Length=213

 Score = 83.2 bits (204),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 57/177 (32%), Positives = 89/177 (50%), Gaps = 24/177 (14%)
 Frame = +3

Query  36   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  215
            +SF+++F  +   LP  LQ+ Y L+R LD    E+QRQ    C   +ED+KQ +K+G  A
Sbjct  4    ISFLEDFIGSTASLPAELQQNYSLIRQLDEQQNELQRQMHGCCAHGLEDVKQVLKAGGAA  63

Query  216  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  395
            +++   K++       K  + +A+EKVALA+  YD+VD +IQ+LD+YLKK+ E+  +  +
Sbjct  64   AEAVANKYASSIASVHKTCVDVANEKVALALSTYDMVDNYIQRLDKYLKKYKEDCEQAKD  123

Query  396  RENAVATGSTTSNVDNNVksgrsgdsskggrkkTRLATATPAANPTGMDLDLPVDPS  566
             +     G      D                     AT          DLD+PVDP+
Sbjct  124  LQ-----GGDEQQADVG-------------------ATGEDDRQNPSTDLDIPVDPN  156



>ref|XP_004346006.1| PHDfinger domain containing protein [Acanthamoeba castellanii 
str. Neff]
 gb|ELR21462.1| PHDfinger domain containing protein [Acanthamoeba castellanii 
str. Neff]
Length=229

 Score = 68.9 bits (167),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 56/185 (30%), Positives = 94/185 (51%), Gaps = 27/185 (15%)
 Frame = +3

Query  39   SFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIAS  218
            ++++++  ++  LP+ +++ + LM+DLD   Q+ Q   D+  Q     +K++ K  ++A 
Sbjct  3    TYLEKYLESIANLPHEVKRNFALMQDLD---QQTQGTMDKLEQSSRAYLKRKAKDASVAD  59

Query  219  DSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDL-------VDTHIQQLDQYLKKFDEE  377
            D +L K  DD     K A+   DEK+ LA Q Y+L       VD HI++LD  LKKF+ E
Sbjct  60   DRALQKIRDDF----KRAMETGDEKIELAAQTYELVRSAFDYVDKHIRRLDADLKKFEAE  115

Query  378  LRRVAERENAVATGSTTSNVDNNVksgrsgdsskggrkkTRLATATPAANPT--GMDLDL  551
            L +  +       G+  S    N          KG +K  R +   P A P    +D+D+
Sbjct  116  LEQ--QETKGKGKGTKASKHKEN---------GKGQKKSVRASELPPDAAPRLFNVDIDM  164

Query  552  PVDPS  566
            P+DP+
Sbjct  165  PIDPN  169



>ref|XP_006420511.1| hypothetical protein CICLE_v10006965mg, partial [Citrus clementina]
 gb|ESR33751.1| hypothetical protein CICLE_v10006965mg, partial [Citrus clementina]
Length=620

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +3

Query  72   VLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASDSSLIKF  239
            +  NILQKKY L+RD+D+SLQE+QR+N+QRC+ E+ED+   I++ NI  ++SL+ +
Sbjct  563  IAANILQKKYALLRDIDKSLQEIQRENEQRCEQEIEDLMWEIRARNITPNTSLMAY  618



>gb|KJB28064.1| hypothetical protein B456_005G039000 [Gossypium raimondii]
Length=198

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 62/88 (70%), Gaps = 10/88 (11%)
 Frame = +3

Query  324  VDTHIQQLDQYLKKFDEELRRVAERENAVATGSTTSNVDNNVksgrsgdsskggrkkTRL  503
            VD+HIQQLDQYLKK  EELRR  EREN  AT S T   D   KSGRSG+S +GGRKKTRL
Sbjct  56   VDSHIQQLDQYLKKSGEELRR--ERENT-ATASPTQTPDGTTKSGRSGESGRGGRKKTRL  112

Query  504  -------ATATPAANPTGMDLDLPVDPS  566
                     A  AANPTG++LDLPVDP+
Sbjct  113  ATAAAATEVAASAANPTGVELDLPVDPN  140



>gb|KCW89858.1| hypothetical protein EUGRSUZ_A02091 [Eucalyptus grandis]
Length=266

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 47/135 (35%), Positives = 71/135 (53%), Gaps = 12/135 (9%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  221
            +ID++      LP  LQ+    +R+LD   Q +  Q  Q+ +  V   KQ  + GN  + 
Sbjct  9    YIDDYFEYASTLPAELQRLLNTIRELDDRSQSMMNQTGQQTKYCVGLSKQSSRRGNYNAY  68

Query  222  SSLIKFSDDALD----------EQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFD  371
            SS     DD  +           Q  A+ ++ EKV LA QAYDL+D+HI++LD+ LK F 
Sbjct  69   SSNYNNDDDDTEIEKMRKEIEGNQDSALSLSTEKVLLARQAYDLIDSHIKRLDEDLKNFA  128

Query  372  EELR--RVAERENAV  410
            E+L+  ++A  E AV
Sbjct  129  EDLKQGKIAPDEPAV  143



>ref|XP_002585609.1| hypothetical protein BRAFLDRAFT_133135 [Branchiostoma floridae]
 gb|EEN41620.1| hypothetical protein BRAFLDRAFT_133135 [Branchiostoma floridae]
Length=230

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 58/180 (32%), Positives = 92/180 (51%), Gaps = 15/180 (8%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLE--VEDMKQRIKSGNIA  215
            +++ +  ++E LP  LQ+ + LMRDLD      QR  D R ++E   ED    +K  +  
Sbjct  6    YLEHYLDSIENLPFELQRNFSLMRDLD------QRSQDLRGEIEKMAEDYVSDVKGLSPE  59

Query  216  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  395
                 +K    A ++ K      D+KV LA+Q Y++VD HI++LD  L +F+ EL+    
Sbjct  60   KRVERLKNIQSAFNKSKE---FGDDKVQLAMQTYEMVDKHIRKLDADLARFEAELKNKTV  116

Query  396  RENAVATG-STTSNVDNNVksgrsgdsskggrkkTRLATATPAA--NPTGMDLDLPVDPS  566
                V  G S  SN    VKS     + +  R+K  +  + P A  +P+ + LD+PVDP+
Sbjct  117  DSPTVDPGPSGKSNKLQEVKSKTRPPARRVHRRKPVILPSLPVAFTHPSDV-LDMPVDPN  175



>ref|XP_010054517.1| PREDICTED: PHD finger protein ING2 isoform X1 [Eucalyptus grandis]
Length=267

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 47/136 (35%), Positives = 71/136 (52%), Gaps = 13/136 (10%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  221
            +ID++      LP  LQ+    +R+LD   Q +  Q  Q+ +  V   KQ  + GN  + 
Sbjct  9    YIDDYFEYASTLPAELQRLLNTIRELDDRSQSMMNQTGQQTKYCVGLSKQSSRRGNYNAY  68

Query  222  SSLIKFSDDALD----------EQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFD  371
            SS     DD  +           Q  A+ ++ EKV LA QAYDL+D+HI++LD+ LK F 
Sbjct  69   SSNYNNDDDDTEIEKMRKEIEGNQDSALSLSTEKVLLARQAYDLIDSHIKRLDEDLKNFA  128

Query  372  EELR---RVAERENAV  410
            E+L+   ++A  E AV
Sbjct  129  EDLKQEGKIAPDEPAV  144



>ref|XP_001650124.1| AAEL004983-PA [Aedes aegypti]
 gb|EAT43584.1| AAEL004983-PA [Aedes aegypti]
Length=274

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 65/122 (53%), Gaps = 19/122 (16%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  221
            +++ +   LE LPN L++ + LMRDLD   Q + +  D++     E MKQ + S      
Sbjct  6    YLEHYLDGLEHLPNELKRNFTLMRDLDSRAQVLMKSIDEKAN---EFMKQLVNSKE----  58

Query  222  SSLIKFSDDALDEQKHAIR--------IADEKVALAIQAYDLVDTHIQQLDQYLKKFDEE  377
                 F DD   E+  AI+          D+KV LAIQ Y+LVD HI++LD  L +F+ E
Sbjct  59   ----NFPDDVKKEKLRAIQELFNKAKEFGDDKVQLAIQTYELVDKHIRRLDSDLARFEGE  114

Query  378  LR  383
            ++
Sbjct  115  IQ  116



>ref|XP_001650123.1| AAEL004983-PB [Aedes aegypti]
 gb|EAT43583.1| AAEL004983-PB [Aedes aegypti]
Length=286

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 65/122 (53%), Gaps = 19/122 (16%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  221
            +++ +   LE LPN L++ + LMRDLD   Q + +  D++     E MKQ + S      
Sbjct  6    YLEHYLDGLEHLPNELKRNFTLMRDLDSRAQVLMKSIDEKAN---EFMKQLVNSKE----  58

Query  222  SSLIKFSDDALDEQKHAIR--------IADEKVALAIQAYDLVDTHIQQLDQYLKKFDEE  377
                 F DD   E+  AI+          D+KV LAIQ Y+LVD HI++LD  L +F+ E
Sbjct  59   ----NFPDDVKKEKLRAIQELFNKAKEFGDDKVQLAIQTYELVDKHIRRLDSDLARFEGE  114

Query  378  LR  383
            ++
Sbjct  115  IQ  116



>ref|XP_006826308.1| hypothetical protein AMTR_s00004p00078450 [Amborella trichopoda]
 gb|ERM93545.1| hypothetical protein AMTR_s00004p00078450 [Amborella trichopoda]
Length=251

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 60/115 (52%), Gaps = 0/115 (0%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  221
            F+D++      LP  LQ+    MR+LD   Q +  Q   + +  +       K GN   D
Sbjct  9    FVDDYLEYSSTLPAELQRLLSTMRELDERSQAIINQTRDQTKYFLSMSGNGSKKGNSEED  68

Query  222  SSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRR  386
              + K   D    Q +A+ +  EKV LA QAYDL+D+H+++LD+ L  F E+L++
Sbjct  69   EGMEKLRKDIEMSQDNALSLCTEKVLLAQQAYDLIDSHVKRLDEDLTNFAEDLKQ  123



>gb|ETN59393.1| Inhibitor of growth proteining, ing4 [Anopheles darlingi]
Length=286

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 67/122 (55%), Gaps = 19/122 (16%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  221
            +++ +   LE LPN L++ + LMRDLD   Q + +  D++     E MK  +     A +
Sbjct  6    YLEHYLDGLEHLPNELKRNFTLMRDLDSRAQVLMKSIDEKAN---EFMKTLMN----AQE  58

Query  222  SSLIKFSDDALDEQKHAIR--------IADEKVALAIQAYDLVDTHIQQLDQYLKKFDEE  377
            S    FSDD   E+  AI+          D+KV LAIQ Y+LVD HI++LD  L +F+ E
Sbjct  59   S----FSDDVKKEKLQAIQELFNKAKEYGDDKVQLAIQTYELVDKHIRRLDSDLARFEGE  114

Query  378  LR  383
            ++
Sbjct  115  IQ  116



>gb|KFB41009.1| AGAP009992-PA-like protein [Anopheles sinensis]
Length=286

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 66/122 (54%), Gaps = 19/122 (16%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  221
            +++ +   LE LPN L++ + LMRDLD   Q + +  D++     E MK  +        
Sbjct  6    YLEHYLDGLEHLPNELKRNFTLMRDLDSRAQVLMKSIDEKAN---EFMKSLV--------  54

Query  222  SSLIKFSDDALDEQKHAIR--------IADEKVALAIQAYDLVDTHIQQLDQYLKKFDEE  377
            +S   FSD+   E+  AI+          D+KV LAIQ Y+LVD HI++LD  L +F+ E
Sbjct  55   NSKENFSDEVKKEKLQAIQDLFNKAKEYGDDKVQLAIQTYELVDKHIRRLDSDLARFEGE  114

Query  378  LR  383
            ++
Sbjct  115  IQ  116



>ref|NP_001233000.1| uncharacterized protein LOC100161116 [Acyrthosiphon pisum]
 dbj|BAH71552.1| ACYPI002366 [Acyrthosiphon pisum]
Length=279

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 61/114 (54%), Gaps = 7/114 (6%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  221
            +++ +  +LE LP  LQ+ + LMRDLD   QE+ R  D+      +D    +K   +   
Sbjct  6    YLEHYLDSLENLPVELQRNFTLMRDLDSRAQELMRNIDKL----ADDYMSNVKGYTVEKK  61

Query  222  SSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELR  383
            +  +       D+ K      D+KV LAIQ Y+LVD HI++LD  L +F+ E++
Sbjct  62   NETMTSIQRQFDKAKE---YGDDKVQLAIQTYELVDKHIRKLDSDLARFEAEIQ  112



>gb|ELV12254.1| D-2-hydroxyglutarate dehydrogenase, mitochondrial [Tupaia chinensis]
Length=662

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 46/167 (28%), Positives = 82/167 (49%), Gaps = 26/167 (16%)
 Frame = +3

Query  66   LEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASDSSLIKFSD  245
            +E LP  LQ+ + LMR+LD      QR  D++ +++V    + I +    S    ++   
Sbjct  8    IENLPCELQRNFQLMRELD------QRTEDKKAEIDVL-AAEYISTVKALSAEQRVEHLQ  60

Query  246  DALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAERENAVATGST  425
                        +D+KV LA+Q Y++VD HI++LD  L +F+ +L+  AE  +  ++G+ 
Sbjct  61   KIQSAYSKCREYSDDKVQLAMQTYEMVDKHIRRLDADLARFEADLKDKAEGSDFESSGAR  120

Query  426  TSNVDNNVksgrsgdsskggrkkTRLATATPAANPTGMDLDLPVDPS  566
                                + K+ LA A  + +P+ + LD+PVDP+
Sbjct  121  A------------------LKSKSELADAILSVHPSDV-LDMPVDPN  148



>ref|XP_001848299.1| inhibitor of growth protein, ing4 [Culex quinquefasciatus]
 gb|EDS28024.1| inhibitor of growth protein, ing4 [Culex quinquefasciatus]
Length=283

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/122 (33%), Positives = 65/122 (53%), Gaps = 19/122 (16%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  221
            +++ +   LE LPN L++ + LMR+LD   Q + +  D++     E MKQ + +      
Sbjct  6    YLEHYLDGLEHLPNELKRNFTLMRELDSRAQGMMKSIDEKAN---EFMKQLVNTKET---  59

Query  222  SSLIKFSDDALDEQKHAIR--------IADEKVALAIQAYDLVDTHIQQLDQYLKKFDEE  377
                 F DD   E+   I+        + D+KV LAIQ Y+LVD HI++LD  L +F+ E
Sbjct  60   -----FPDDVKKEKLRTIQELFNKAKELGDDKVQLAIQTYELVDKHIRRLDSDLARFEGE  114

Query  378  LR  383
            ++
Sbjct  115  IQ  116



>ref|XP_002113450.1| hypothetical protein TRIADDRAFT_50425 [Trichoplax adhaerens]
 gb|EDV23924.1| hypothetical protein TRIADDRAFT_50425 [Trichoplax adhaerens]
Length=238

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 50/185 (27%), Positives = 90/185 (49%), Gaps = 17/185 (9%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  221
            +++ +  ++E LP+ LQ+ + LM++LD+  Q+++ + D+  Q  V+++       N+ SD
Sbjct  6    YLEHYLDSIESLPSELQRNFTLMKELDQKNQDIKGEIDKLTQQYVQEV------SNLKSD  59

Query  222  SSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAER-  398
                +  DD     K +  I D KV LA Q Y++VD HI++LD  L +F+ +L+   +  
Sbjct  60   ERQQRL-DDINCTYKKSHMICDNKVQLATQTYEMVDKHIRRLDYELARFEADLKEKEQEI  118

Query  399  -ENAVATGSTTSNVDNNVksgrsgdsskggrkkTRLATATPAANPTGMD--------LDL  551
             EN   +          +K+    D         RL T + AA+             +D+
Sbjct  119  TENRSRSTGRKKTSRKKLKTSTLIDLVIIDVGCNRLETISSAASVIAQSQSIFNARAVDM  178

Query  552  PVDPS  566
            PVDP+
Sbjct  179  PVDPN  183



>ref|XP_010789447.1| PREDICTED: inhibitor of growth protein 5 [Notothenia coriiceps]
Length=241

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 55/192 (29%), Positives = 93/192 (48%), Gaps = 28/192 (15%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  221
            +++ +  ++E LP  LQ+ + LMRDLD   +E + + DQ  Q  +  +K      N+AS+
Sbjct  6    YLEHYLDSIENLPCELQRNFTLMRDLDNRTEEKKGEIDQLAQEYIAKVK------NLASE  59

Query  222  SSLIKFSDDALDEQKHAI----RIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRV  389
              +     + L + +HA       +D+KV LA+Q Y++VD HI++LD  L +F+ EL+  
Sbjct  60   QRV-----EHLQKIQHAYSKCKEFSDDKVQLAMQTYEMVDKHIRRLDADLARFENELKEK  114

Query  390  AEREN-------AVATGSTTSNVDNNVksgrsgdsskggrkkTRLATATPAANPTGMD--  542
             E          A+  G +    D     GR+   S     K +    +P  + T +   
Sbjct  115  LEVSGYESTEGRALKKGESRGLKDKRASRGRAKKCSDEDSPKKKKIKNSPELSDTFLPMQ  174

Query  543  ----LDLPVDPS  566
                LD+PVDP+
Sbjct  175  PSDVLDMPVDPN  186



>dbj|BAN20863.1| inhibitor of growth proteining, ing4 [Riptortus pedestris]
Length=252

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 63/114 (55%), Gaps = 9/114 (8%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  221
            +++ +  +LE LP  LQ+ + LMRDLD   Q V R  DQ      +D    +K   + S+
Sbjct  6    YLEHYLDSLEHLPIELQRNFTLMRDLDTRAQAVMRNIDQM----ADDFMANLK--GMTSE  59

Query  222  SSLIKFSDDALDEQ-KHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEEL  380
                K S+  + +Q   A    D+KV LAIQ Y+LVD HI++LD  L +F+ E+
Sbjct  60   KKKEKMSE--IQQQFNKAKEYGDDKVQLAIQTYELVDKHIRRLDSDLARFESEI  111



>ref|XP_001949522.2| PREDICTED: inhibitor of growth protein 4-like [Acyrthosiphon 
pisum]
Length=279

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 38/116 (33%), Positives = 63/116 (54%), Gaps = 7/116 (6%)
 Frame = +3

Query  45   IDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASDS  224
            ++ +  +LE LP  LQ+ + LMRDLD + QE+ R ND+       D    +   ++  ++
Sbjct  7    LEHYLDSLENLPVELQRNFTLMRDLDSTQQELIRNNDKL----TTDYMSNVNRYSVEKNN  62

Query  225  SLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVA  392
              +       D+ K      D+KV LAIQ Y+LVD +I++LD  L +F+ E++  A
Sbjct  63   DTVTSIQRQFDKAKE---YGDDKVQLAIQTYELVDNYIRKLDSDLSRFEAEIQNKA  115



>ref|XP_003632714.1| PREDICTED: PHD finger protein ING2 [Vitis vinifera]
 emb|CBI29932.3| unnamed protein product [Vitis vinifera]
Length=259

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 67/127 (53%), Gaps = 4/127 (3%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  221
            F+D++      LP  LQ+    +R+LD   Q +  Q  Q+ +  +    Q  K GN   D
Sbjct  9    FVDDYLDYASTLPAELQRLLNTIRELDERSQSMINQTRQQTKYCLGLSSQSSKKGNPEED  68

Query  222  S-SLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELR---RV  389
              +  K   D    Q +A+ +  EKV LA QA+DL+D+H+++LD+ L  F E+L+   ++
Sbjct  69   EVAFEKMRKDIEANQDNALSLCTEKVLLAQQAFDLIDSHVKRLDEDLTNFAEDLKQEGKI  128

Query  390  AERENAV  410
            +  E A+
Sbjct  129  SPDEPAI  135



>emb|CAN71661.1| hypothetical protein VITISV_016186 [Vitis vinifera]
Length=259

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 67/127 (53%), Gaps = 4/127 (3%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  221
            F+D++      LP  LQ+    +R+LD   Q +  Q  Q+ +  +    Q  K GN   D
Sbjct  9    FVDDYLDYASTLPAELQRLLNTIRELDERSQSMINQTRQQTKYCLGLSSQSSKKGNPEED  68

Query  222  S-SLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELR---RV  389
              +  K   D    Q +A+ +  EKV LA QA+DL+D+H+++LD+ L  F E+L+   ++
Sbjct  69   EVAFEKMRKDIEANQDNALSLCTEKVLLAQQAFDLIDSHVKRLDEDLTNFAEDLKQEGKI  128

Query  390  AERENAV  410
            +  E A+
Sbjct  129  SPDEPAI  135



>ref|XP_008480050.1| PREDICTED: inhibitor of growth protein 5-like [Diaphorina citri]
 ref|XP_008484273.1| PREDICTED: inhibitor of growth protein 5-like [Diaphorina citri]
Length=267

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 36/118 (31%), Positives = 69/118 (58%), Gaps = 7/118 (6%)
 Frame = +3

Query  39   SFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIAS  218
            S+++++  +L+ LP  LQ+ + LMR+LD   Q+V +  D+  +  +++MK   K     +
Sbjct  4    SYLEQYLDSLDSLPIELQRNFTLMRELDSRAQDVMKTIDRVAEDYLDNMKHYSKDKKKET  63

Query  219  DSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVA  392
             + + K+ D   +         D+KV LAIQ Y++VD +I++LD  L +F++E++  A
Sbjct  64   LAEIQKYFDKTKE-------YGDDKVQLAIQTYEMVDKYIRKLDTDLARFEQEIQEKA  114



>ref|XP_005707926.1| hypothetical protein Gasu_13700 [Galdieria sulphuraria]
 gb|EME31406.1| hypothetical protein Gasu_13700 [Galdieria sulphuraria]
Length=225

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 47/140 (34%), Positives = 76/140 (54%), Gaps = 20/140 (14%)
 Frame = +3

Query  39   SFIDEFETNLEVLPNILQKKYGLMRDLDR---SLQ-EVQRQNDQRCQLEVEDMKQRIKSG  206
            S++DE    +  LPN L++ +  +R+LD    +LQ E +R N++ CQ E    K R    
Sbjct  12   SYLDEVLGKVSSLPNDLKQHFSKIRELDARCVALQAEAERLNEE-CQ-ERGQSKSR----  65

Query  207  NIASDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELR-  383
               S  SL     +  + Q+  I + D+KV LA +AYD VD +++QLD+ L++F+  LR 
Sbjct  66   ---STESLKNIWKELEETQREMIALTDQKVKLAEKAYDSVDRNVRQLDEKLREFEAHLRA  122

Query  384  ------RVAERENAVATGST  425
                   V +R  ++ +GST
Sbjct  123  EGKWPLNVQDRRVSIGSGST  142



>ref|XP_002588507.1| hypothetical protein BRAFLDRAFT_114530 [Branchiostoma floridae]
 gb|EEN44518.1| hypothetical protein BRAFLDRAFT_114530 [Branchiostoma floridae]
Length=255

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 41/130 (32%), Positives = 66/130 (51%), Gaps = 11/130 (8%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLE--VEDMKQRIKSGNIA  215
            +++ +  ++E LP  LQ+ + LMRDLD      QR  D R ++E   ED    +K  +  
Sbjct  6    YLEHYLDSIENLPFELQRNFSLMRDLD------QRSQDLRGEIEKMAEDYVSDVKGLSPE  59

Query  216  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  395
                 +K    A ++ K      D+KV LA+Q Y++VD HI++LD  L +F+ EL+    
Sbjct  60   KRVERLKNIQSAFNKSK---EFGDDKVQLAMQTYEMVDKHIRKLDADLARFEAELKNKTV  116

Query  396  RENAVATGST  425
                V  G +
Sbjct  117  DSPTVDPGPS  126



>ref|XP_002732281.1| PREDICTED: inhibitor of growth protein 4-like [Saccoglossus kowalevskii]
Length=257

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 37/117 (32%), Positives = 67/117 (57%), Gaps = 13/117 (11%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQ---LEVEDMKQRIKSGNI  212
            +++++  +LE LP  LQ+ + LMRDLD+  Q++ +Q D         V DM +  ++ ++
Sbjct  6    YLEQYLDSLENLPYELQRNFTLMRDLDQRTQDILKQIDNLADEYIKNVRDMPREKRADHL  65

Query  213  ASDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELR  383
             +  +L   S +            D+KV LA+Q Y++VD HI++LD  L +F++EL+
Sbjct  66   RNIQNLFNKSRE----------FGDDKVQLAMQTYEMVDKHIRRLDADLARFEQELK  112



>ref|NP_001241355.1| uncharacterized protein LOC100787916 [Glycine max]
 gb|ACU23030.1| unknown [Glycine max]
 gb|KHN08157.1| PHD finger protein ING2 [Glycine soja]
Length=268

 Score = 57.8 bits (138),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 42/135 (31%), Positives = 69/135 (51%), Gaps = 12/135 (9%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  221
            ++D++      LP  LQ+    +R+LD   Q +  Q  Q+ +  +       K GN + +
Sbjct  9    YVDDYLEYASTLPAELQRLLNTVRELDDRSQSMITQTRQQTKYTMGFSSHGSKKGNHSYN  68

Query  222  SSLIKFSDDALDE---------QKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDE  374
            ++     DDA  E         Q  A+ +  EKV LA QAYDL+D+HI++LD+ L  F E
Sbjct  69   NNYGNEDDDAAIEKMRKEIEVNQDSALSLCTEKVLLARQAYDLIDSHIKRLDEDLNNFAE  128

Query  375  ELR---RVAERENAV  410
            +L+   ++A  E A+
Sbjct  129  DLKQEGKIAPDEPAI  143



>ref|XP_001948924.2| PREDICTED: inhibitor of growth protein 5-like [Acyrthosiphon 
pisum]
Length=279

 Score = 57.8 bits (138),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 62/114 (54%), Gaps = 7/114 (6%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  221
            +++ +  +LE LP  LQ+ + LMRDLD  LQE+ R  D+       D    +K  ++   
Sbjct  6    YLEHYLDSLENLPVELQRNFTLMRDLDSRLQELIRNIDKL----ANDYMSNVKRYSVEKK  61

Query  222  SSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELR  383
            +  +       D+ K     +D+KV LAIQ Y+LVD +I++LD  L  F+ E++
Sbjct  62   NETMTSIQRQFDKAKE---YSDDKVELAIQTYELVDNYIRKLDSDLSHFEAEIQ  112



>gb|KDP39713.1| hypothetical protein JCGZ_02733 [Jatropha curcas]
Length=267

 Score = 57.8 bits (138),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 41/134 (31%), Positives = 71/134 (53%), Gaps = 11/134 (8%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  221
            ++D++      LP  LQ+    +R+LD     +  Q  Q+ +  +    Q  K GN ++ 
Sbjct  9    YVDDYLEYASTLPAELQRLLNTIRELDERSHSMINQTRQQTKYCLGLASQSSKRGNGSTF  68

Query  222  SSLIKFSDDALDE--------QKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEE  377
            +++    DDA++         Q +A+ +  EKV LA QAYDL+D+HI++LD+ L  F E+
Sbjct  69   NNINNEDDDAVERMRKDIEANQDNALSLCTEKVLLARQAYDLIDSHIKRLDEDLNNFAED  128

Query  378  LR---RVAERENAV  410
            L+   ++   E AV
Sbjct  129  LKHEGKIPADEPAV  142



>ref|XP_001943164.2| PREDICTED: inhibitor of growth protein 5-like [Acyrthosiphon 
pisum]
Length=279

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 62/114 (54%), Gaps = 7/114 (6%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  221
            +++ +  +LE LP  LQ+ + LMRDLD  LQE+ R  D+       D    +K  ++   
Sbjct  6    YLEHYLDSLENLPVELQRNFTLMRDLDSRLQELIRNIDKL----ANDYMSNVKRYSVEKK  61

Query  222  SSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELR  383
            +  +       D+ K     +D+KV LAIQ Y+LVD +I++LD  L  F+ E++
Sbjct  62   NETMTSIQRQFDKAK---EYSDDKVQLAIQTYELVDNYIRKLDSDLSHFEAEIQ  112



>gb|ELU06105.1| hypothetical protein CAPTEDRAFT_227494 [Capitella teleta]
Length=245

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/135 (29%), Positives = 69/135 (51%), Gaps = 14/135 (10%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  221
            +++ +  +LE LP  LQ+ + LMRDLD   QEV ++ D      +  +K    +    S 
Sbjct  6    YLEHYLDSLETLPMELQRNFNLMRDLDSRSQEVLKEIDSMADQYMSSVKDLAPTKRTESL  65

Query  222  SSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAERE  401
             ++ K       +   +    D+KV LA+Q Y++VD HI++LD  L +F+ EL+      
Sbjct  66   KTIQK-------KFNKSREYGDDKVQLALQTYEMVDKHIRKLDADLARFEAELKE-----  113

Query  402  NAVATGSTTSNVDNN  446
               + G+   +++NN
Sbjct  114  --KSLGANVPSLNNN  126



>ref|XP_008547616.1| PREDICTED: inhibitor of growth protein 5 [Microplitis demolitor]
Length=255

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 69/130 (53%), Gaps = 7/130 (5%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  221
            +++ +  +LE LP  LQ+ + LMRDLD   Q + +  D+      +D  + IK  +   +
Sbjct  6    YLEHYLDSLEHLPIELQRNFTLMRDLDARAQGLMKDIDKL----ADDYLKNIKKESNDKN  61

Query  222  SSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAERE  401
            +  ++      ++ K      D+KV LAIQ Y+LVD HI++LD  L +F+ E++  A   
Sbjct  62   NDQLRHIQSLFNKAK---EYGDDKVQLAIQTYELVDKHIRRLDSDLARFEAEIQDKALNN  118

Query  402  NAVATGSTTS  431
            N VA  S  S
Sbjct  119  NRVAEESGAS  128



>ref|XP_009053604.1| hypothetical protein LOTGIDRAFT_214850 [Lottia gigantea]
 gb|ESO95756.1| hypothetical protein LOTGIDRAFT_214850 [Lottia gigantea]
Length=241

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 61/114 (54%), Gaps = 7/114 (6%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  221
            +++ +  +LE LP  LQ+ + LMRDLD+  Q++ ++ D        D    +K+      
Sbjct  6    YLEHYLDSLESLPGELQRNFNLMRDLDQRTQDLLKEIDGL----TTDYMTNVKTLPSEKR  61

Query  222  SSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELR  383
               +K  D    + K      D+KV LA+Q Y+LVD HI++LD  L +F+ EL+
Sbjct  62   REKLKGIDGLFSKSK---EYGDDKVQLAMQTYELVDKHIRKLDADLARFEAELK  112



>gb|AEE61445.1| unknown [Dendroctonus ponderosae]
 gb|ENN78442.1| hypothetical protein YQE_05080, partial [Dendroctonus ponderosae]
 gb|ERL87953.1| hypothetical protein D910_05341 [Dendroctonus ponderosae]
Length=270

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 65/125 (52%), Gaps = 29/125 (23%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  221
            +++ +  +LE LPN LQ+ + LM DLD+  Q + +  D    L  E ++      N+ S 
Sbjct  6    YLEHYLDSLEHLPNELQRNFTLMSDLDKRAQGLMKGIDT---LADEHLR------NVKSL  56

Query  222  SSLIKFSDDALDEQKH-----------AIRIADEKVALAIQAYDLVDTHIQQLDQYLKKF  368
            SS         DEQK            A  + D+KV LAIQ Y+LVD HI++LD  L +F
Sbjct  57   SS---------DEQKEHLDKIQNMFNKAKELGDDKVQLAIQTYELVDKHIRKLDNDLARF  107

Query  369  DEELR  383
            + E++
Sbjct  108  ETEIQ  112



>ref|XP_010269723.1| PREDICTED: PHD finger protein ING2 [Nelumbo nucifera]
 ref|XP_010269724.1| PREDICTED: PHD finger protein ING2 [Nelumbo nucifera]
 ref|XP_010269725.1| PREDICTED: PHD finger protein ING2 [Nelumbo nucifera]
 ref|XP_010269726.1| PREDICTED: PHD finger protein ING2 [Nelumbo nucifera]
 ref|XP_010269727.1| PREDICTED: PHD finger protein ING2 [Nelumbo nucifera]
Length=257

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 69/127 (54%), Gaps = 4/127 (3%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  221
            F+D++      LP  LQ+    MR+LD   Q +  Q  ++ +  +    Q  K G+   D
Sbjct  9    FVDDYLEYSSTLPAELQRLLNTMRELDERSQAMINQTREQTKYCLGLPSQISKKGSHNDD  68

Query  222  -SSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELR---RV  389
             ++L K   +    Q++A+ +  EKV LA QAYDL+D+H+++LD+ L  F E+L+   ++
Sbjct  69   EATLEKMRKEIEANQENALSLCTEKVLLAQQAYDLIDSHVKRLDEDLNNFAEDLKQEGKI  128

Query  390  AERENAV  410
               E A+
Sbjct  129  PPDEPAI  135



>ref|XP_009030358.1| hypothetical protein HELRODRAFT_185182 [Helobdella robusta]
 gb|ESN91510.1| hypothetical protein HELRODRAFT_185182 [Helobdella robusta]
Length=255

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 53/199 (27%), Positives = 96/199 (48%), Gaps = 31/199 (16%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  221
            +++ +  +L+ LP  L++K+  MR+LD   QE+  + D+      ED    +K  N    
Sbjct  6    YLEHYLDSLDGLPKELERKFNEMRELDSCSQELNVEIDKL----AEDYLINVKGLNKQDK  61

Query  222  SSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELR----RV  389
             + +    +   + K   + +DEKV LA+Q Y+LVD HI++LD  L +F+ EL+    + 
Sbjct  62   KNHLLNIQNCFSKSK---KFSDEKVQLALQTYELVDRHIRRLDADLARFESELKVQQLKF  118

Query  390  AERENAVATGSTTSNV-------DNNVksgrsgdsskggrkkTRLATAT--PAANPTGM-  539
            A +E+   + + ++N        D +      G   K   ++  +AT+   P++ P  M 
Sbjct  119  ATQEHVTKSTNNSNNTKPGKKKNDKDSSDNECGKKRKKRAQEHNIATSNSLPSSAPLTML  178

Query  540  ----------DLDLPVDPS  566
                       LD+PVDP+
Sbjct  179  PLVPTNQHSDVLDMPVDPN  197



>ref|XP_006302707.1| hypothetical protein CARUB_v10020819mg [Capsella rubella]
 gb|EOA35605.1| hypothetical protein CARUB_v10020819mg [Capsella rubella]
Length=261

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/122 (30%), Positives = 64/122 (52%), Gaps = 7/122 (6%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGN----  209
            ++D++       P  LQ+    +R+LD   Q +  Q  Q+ +  +    Q  K GN    
Sbjct  9    YVDDYLEYASTFPAELQRLLNTVRELDERSQSLINQTRQQTKYCLGLASQSSKKGNGNHY  68

Query  210  ---IASDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEEL  380
               I  + ++ K   +    Q++A+ +  EKV LA QAYDL+D+H+++LD+ L  F E+L
Sbjct  69   SNGIDEEETIEKMRKEIESSQENALSLCTEKVLLARQAYDLIDSHVKRLDEDLNNFSEDL  128

Query  381  RR  386
            ++
Sbjct  129  KQ  130



>gb|EFX72404.1| hypothetical protein DAPPUDRAFT_308315 [Daphnia pulex]
Length=241

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 44/130 (34%), Positives = 69/130 (53%), Gaps = 17/130 (13%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  221
            +++ +  +LE LP  LQ+ + LMRDLD   Q + ++ D       ED  +      + S 
Sbjct  6    YLEHYLDSLESLPIELQRNFSLMRDLDNRAQSLMKEIDSH----AEDYLK------VVSQ  55

Query  222  SSLIKFSDDALDEQK---HAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVA  392
            +S  K  +     QK    A    D+KV LAIQ Y+LVD HI++LD  L +F+ E++   
Sbjct  56   TSPEKRKEQMERIQKLFNKAKEYGDDKVQLAIQTYELVDKHIRRLDSDLARFETEIK---  112

Query  393  ERENAVATGS  422
              +++VAT S
Sbjct  113  -EKSSVATLS  121



>ref|XP_001692129.1| hypothetical protein CHLREDRAFT_31927 [Chlamydomonas reinhardtii]
 gb|EDP04619.1| predicted protein [Chlamydomonas reinhardtii]
Length=274

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/120 (31%), Positives = 61/120 (51%), Gaps = 9/120 (8%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDM-------KQRIK  200
            ++ +F      +P  L+++  L+RDLD   Q + R+ D+ C+  + +        KQ+  
Sbjct  4    YLKDFIDRAADVPLQLRRRLALIRDLDEKAQALHREIDEHCKRTLAEKSQQHAAKKQKQA  63

Query  201  SGNIASDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEEL  380
            +G  A  S+   +  D     K  I + DEKV +A Q YD +D HI QLD  L++ D E+
Sbjct  64   AGEDAGGSAAAPY--DVESALKRLIGLGDEKVNIANQIYDFMDNHINQLDTDLQQLDGEI  121



>ref|XP_002127711.1| PREDICTED: inhibitor of growth protein 5 isoform X1 [Ciona intestinalis]
Length=240

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 39/136 (29%), Positives = 73/136 (54%), Gaps = 10/136 (7%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  221
            +++++  +LE LP  LQ+ + LMR LD+  ++++ + D R +  V + K         S 
Sbjct  6    YLEQYLDSLENLPFELQRNFQLMRQLDQRSEDIKVEIDGRTEGYVREAKS-------LSP  58

Query  222  SSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAERE  401
               +K   +  +        AD+KV LA+Q Y++VD HI++LD  L +F+ +L+   E+ 
Sbjct  59   PQRVKKIKEIQERYLKCREFADDKVQLAMQTYEMVDKHIRRLDSDLARFEADLK---EKS  115

Query  402  NAVATGSTTSNVDNNV  449
               ATG++  + D  +
Sbjct  116  IQDATGTSKGDCDVTI  131



>ref|XP_319132.3| AGAP009992-PA [Anopheles gambiae str. PEST]
 gb|EAA14095.3| AGAP009992-PA [Anopheles gambiae str. PEST]
Length=273

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 65/116 (56%), Gaps = 7/116 (6%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSG-NIAS  218
            +++ +   LE LPN L++ + LMRDLD   Q + +  D++     E +K  + S  NI++
Sbjct  6    YLEHYLDGLEHLPNELKRNFTLMRDLDSRAQVLMKSIDEKAD---EYLKSLVNSKENISN  62

Query  219  DSSLIKFSDDALDEQ-KHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELR  383
            +    K     + E    A    D+KV LAIQ Y+LVD HI++LD  L +F+ E++
Sbjct  63   EVKKEKLQ--GIQELFNKAKEYGDDKVQLAIQTYELVDKHIRRLDSDLARFEGEIQ  116



>ref|XP_010470337.1| PREDICTED: PHD finger protein ING2 isoform X2 [Camelina sativa]
Length=230

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 64/123 (52%), Gaps = 8/123 (7%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIAS-  218
            ++D++       P  LQ+    +R+LD   Q +  Q  Q+ +  +    Q  K GN  S 
Sbjct  9    YVDDYLEYASTFPAELQRLLNTVRELDERSQSLINQTRQQTKYCLGLASQSSKKGNNGSH  68

Query  219  -------DSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEE  377
                   + ++ K   +    Q++A+ +  EKV LA QAYDL+D+H+++LD+ L  F E+
Sbjct  69   YNNGLDDEETIEKMRKEIESSQENALSLCTEKVLLARQAYDLIDSHVKRLDEDLNNFAED  128

Query  378  LRR  386
            L++
Sbjct  129  LKQ  131



>ref|XP_010511155.1| PREDICTED: PHD finger protein ING2-like isoform X2 [Camelina 
sativa]
Length=230

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 64/123 (52%), Gaps = 8/123 (7%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIAS-  218
            ++D++       P  LQ+    +R+LD   Q +  Q  Q+ +  +    Q  K GN  S 
Sbjct  9    YVDDYLEYASTFPAELQRLLNTVRELDERSQSLINQTRQQTKYCLGLASQSSKKGNNGSH  68

Query  219  -------DSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEE  377
                   + ++ K   +    Q++A+ +  EKV LA QAYDL+D+H+++LD+ L  F E+
Sbjct  69   YNNGLDEEETIEKMRKEIESSQENALSLCTEKVLLARQAYDLIDSHVKRLDEDLNNFAED  128

Query  378  LRR  386
            L++
Sbjct  129  LKQ  131



>emb|CDJ90846.1| Zinc finger domain containing protein [Haemonchus contortus]
Length=235

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 67/128 (52%), Gaps = 7/128 (5%)
 Frame = +3

Query  51   EFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASDSSL  230
            ++   L+ LP  + K    MR+LD  ++++ R+ + R   +V+++K+  K   I      
Sbjct  7    KYMEKLDDLPPFICKSAAEMRELDEKVEKLVREIELRVVAQVKNLKKFTKEQRI------  60

Query  231  IKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAERENAV  410
             K+  +     K   ++ + KV LA + YD VDTHI+++DQ +  F E  R+  + E+ V
Sbjct  61   -KYYKETQAMYKEVDKLGERKVKLAQKMYDAVDTHIKEMDQQITDFHEVQRKKYKAEHGV  119

Query  411  ATGSTTSN  434
              G++ S 
Sbjct  120  NPGTSNST  127



>ref|XP_010414880.1| PREDICTED: PHD finger protein ING2-like [Camelina sativa]
Length=262

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 64/123 (52%), Gaps = 8/123 (7%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIAS-  218
            ++D++       P  LQ+    +R+LD   Q +  Q  Q+ +  +    Q  K GN  S 
Sbjct  9    YVDDYLEYASTFPAELQRLLNTVRELDERSQSLINQTRQQTKYCLGLASQSSKKGNNGSH  68

Query  219  -------DSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEE  377
                   + ++ K   +    Q++A+ +  EKV LA QAYDL+D+H+++LD+ L  F E+
Sbjct  69   YNSGLDEEETIEKMRKEIESSQENALSLCTEKVLLARQAYDLIDSHVKRLDEDLNNFAED  128

Query  378  LRR  386
            L++
Sbjct  129  LKQ  131



>ref|XP_007234440.1| PREDICTED: inhibitor of growth protein 5-like isoform X2 [Astyanax 
mexicanus]
 ref|XP_007234441.1| PREDICTED: inhibitor of growth protein 5-like isoform X3 [Astyanax 
mexicanus]
Length=235

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 47/185 (25%), Positives = 95/185 (51%), Gaps = 20/185 (11%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  221
            +++ +  ++E LP  LQ+ + LM DLD       R   ++ +++    +   K  N++S+
Sbjct  6    YLEHYLDSIEGLPFELQRNFSLMTDLD------NRTELKKVEIDNLAAEYTAKVKNLSSE  59

Query  222  SSL--IKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  395
              +  +K  ++A D+ +     +D+KV LA+Q Y++VD HI++LD  L +F+ EL+   +
Sbjct  60   ERMEHLKRIENAYDQCRE---FSDDKVLLAMQIYEMVDKHIRRLDADLARFESELKDKLD  116

Query  396  RENAVATGSTTSNVDNNVksg--------rsgdsskggrkkTRLATATPAANPTGMDLDL  551
                 ++    S  D NV+          ++ +++       + + A  A  P+ + LD+
Sbjct  117  SSGLESSDEKKSRKDKNVREKKRCSGRGQKTSNNNSPKHTAQKTSPALLAVQPSDV-LDM  175

Query  552  PVDPS  566
            PVDP+
Sbjct  176  PVDPN  180



>ref|XP_010470336.1| PREDICTED: PHD finger protein ING2 isoform X1 [Camelina sativa]
Length=262

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 64/123 (52%), Gaps = 8/123 (7%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIAS-  218
            ++D++       P  LQ+    +R+LD   Q +  Q  Q+ +  +    Q  K GN  S 
Sbjct  9    YVDDYLEYASTFPAELQRLLNTVRELDERSQSLINQTRQQTKYCLGLASQSSKKGNNGSH  68

Query  219  -------DSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEE  377
                   + ++ K   +    Q++A+ +  EKV LA QAYDL+D+H+++LD+ L  F E+
Sbjct  69   YNNGLDDEETIEKMRKEIESSQENALSLCTEKVLLARQAYDLIDSHVKRLDEDLNNFAED  128

Query  378  LRR  386
            L++
Sbjct  129  LKQ  131



>ref|XP_010511153.1| PREDICTED: PHD finger protein ING2-like isoform X1 [Camelina 
sativa]
Length=262

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 64/123 (52%), Gaps = 8/123 (7%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIAS-  218
            ++D++       P  LQ+    +R+LD   Q +  Q  Q+ +  +    Q  K GN  S 
Sbjct  9    YVDDYLEYASTFPAELQRLLNTVRELDERSQSLINQTRQQTKYCLGLASQSSKKGNNGSH  68

Query  219  -------DSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEE  377
                   + ++ K   +    Q++A+ +  EKV LA QAYDL+D+H+++LD+ L  F E+
Sbjct  69   YNNGLDEEETIEKMRKEIESSQENALSLCTEKVLLARQAYDLIDSHVKRLDEDLNNFAED  128

Query  378  LRR  386
            L++
Sbjct  129  LKQ  131



>ref|XP_005798824.1| PREDICTED: inhibitor of growth protein 4-like isoform X4 [Xiphophorus 
maculatus]
Length=238

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 52/187 (28%), Positives = 93/187 (50%), Gaps = 23/187 (12%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  221
            +++ +  ++E LP  LQ+ + LMRDLD      QR  D + Q++    +    +  ++SD
Sbjct  6    YLEHYLDSIENLPFELQRNFNLMRDLD------QRTEDLKGQIDSLAKEYTSNARTLSSD  59

Query  222  S--SLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELR-RVA  392
               SL++    +  + K      D+KV LA+Q Y++VD HI++LD  L +F+ +L+ +  
Sbjct  60   QKLSLLRQIQQSYSKCKE---FGDDKVQLAMQTYEMVDKHIRRLDTDLARFEADLKEKQI  116

Query  393  ERENAVATGSTTSNVDNNVksgrsgdsskggrkkTRLATA-----TPAAN-----PTGMD  542
            E  +  +T S    VD   K  ++  +    +      +       PA+N     P+ + 
Sbjct  117  ESTDYDSTSSKGKKVDTRQKEKKTAKTRSKVKSSDEDGSPKREFNAPASNFGNVHPSDV-  175

Query  543  LDLPVDP  563
            LD+PVDP
Sbjct  176  LDMPVDP  182



>ref|XP_003973903.1| PREDICTED: inhibitor of growth protein 5-like isoform 2 [Takifugu 
rubripes]
Length=244

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 48/192 (25%), Positives = 88/192 (46%), Gaps = 25/192 (13%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  221
            +++ +  ++E LP  LQ+ + LMRDLD       R  +++ ++E    +  +   N+AS+
Sbjct  6    YLEHYLDSIENLPCELQRNFTLMRDLD------NRTEEKKAEIEKLAEEYVVTVKNLASE  59

Query  222  SSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEEL-------  380
               ++      +        +D+KV LA+Q Y++VD HI++LD  L +F+ EL       
Sbjct  60   QR-VEHLQKIQNAYSKCKEFSDDKVQLAMQTYEMVDKHIRRLDADLARFENELKEKLEVG  118

Query  381  ----------RRVAERENAVATGSTTSNVDNNVksgrsgdsskggrkkTRLATATPAANP  530
                      R + E+  +   G   S+ D+  K        +       L+ A     P
Sbjct  119  GYESTDGRASRGLREKRGSKGRGRKGSDEDSPKKKKMKNRYLQAELPHPDLSDALLPMQP  178

Query  531  TGMDLDLPVDPS  566
            + + LD+PVDP+
Sbjct  179  SDV-LDMPVDPN  189



>ref|XP_011034361.1| PREDICTED: PHD finger protein ING2-like [Populus euphratica]
Length=273

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 63/126 (50%), Gaps = 11/126 (9%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA--  215
            ++D++      LP  LQ+    +R+LD   Q +  Q  Q+    +    Q ++ GN +  
Sbjct  9    YVDDYLEYANTLPAELQRLLNTVRELDERSQSMINQTRQQTNYCLGLASQSLRKGNGSIY  68

Query  216  ---------SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKF  368
                      D ++ K   D    Q  A+ +  EKV LA QAYDL+D+H+++LD+ L  F
Sbjct  69   NCYNTNNNEEDEAVEKMRKDIEANQDSALSLCTEKVLLARQAYDLIDSHVKRLDEDLNNF  128

Query  369  DEELRR  386
             E+L++
Sbjct  129  AEDLKQ  134



>ref|XP_007503719.1| PREDICTED: inhibitor of growth protein 4 isoform X3 [Monodelphis 
domestica]
Length=317

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 40/123 (33%), Positives = 71/123 (58%), Gaps = 9/123 (7%)
 Frame = +3

Query  21   FCCKRMS--FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQR  194
            FC K  +  +++ +  ++E LP  LQ+ + LMRDLD+  ++++ + D+   L  E M   
Sbjct  66   FCFKMAAGMYLEHYLDSIENLPFELQRNFQLMRDLDQRTEDLKAEIDK---LATEYMSS-  121

Query  195  IKSGNIASDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDE  374
             +S N     +L+K   +A  + K      D+KV LA+Q Y++VD HI++LD  L +F+ 
Sbjct  122  ARSLNSEEKLALLKQIQEAYGKCKE---FGDDKVQLAMQTYEMVDKHIRRLDTDLARFEA  178

Query  375  ELR  383
            +L+
Sbjct  179  DLK  181



>ref|XP_007503718.1| PREDICTED: inhibitor of growth protein 4 isoform X2 [Monodelphis 
domestica]
Length=318

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 40/123 (33%), Positives = 71/123 (58%), Gaps = 9/123 (7%)
 Frame = +3

Query  21   FCCKRMS--FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQR  194
            FC K  +  +++ +  ++E LP  LQ+ + LMRDLD+  ++++ + D+   L  E M   
Sbjct  66   FCFKMAAGMYLEHYLDSIENLPFELQRNFQLMRDLDQRTEDLKAEIDK---LATEYMSS-  121

Query  195  IKSGNIASDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDE  374
             +S N     +L+K   +A  + K      D+KV LA+Q Y++VD HI++LD  L +F+ 
Sbjct  122  ARSLNSEEKLALLKQIQEAYGKCKE---FGDDKVQLAMQTYEMVDKHIRRLDTDLARFEA  178

Query  375  ELR  383
            +L+
Sbjct  179  DLK  181



>gb|KFH70497.1| hypothetical protein MVEG_03347 [Mortierella verticillata NRRL 
6337]
Length=296

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 34/114 (30%), Positives = 67/114 (59%), Gaps = 7/114 (6%)
 Frame = +3

Query  36   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  215
            ++++D++   +E LP  LQ+++ LM+DLD   Q +      +    ++ +++      I 
Sbjct  15   LAYLDDYLDTVESLPLELQRQFTLMQDLDAKAQSIMASVGTKAAEFIDSVQECTPQERI-  73

Query  216  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEE  377
                L++  ++ L E   ++R  +EKVALA  AYD+VD H+++LD  L+K+++E
Sbjct  74   ---KLLQSLNEMLVE---SLRQGEEKVALATAAYDVVDRHVRRLDDDLQKYEDE  121



>ref|XP_793913.3| PREDICTED: inhibitor of growth protein 4-like [Strongylocentrotus 
purpuratus]
Length=246

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 40/132 (30%), Positives = 69/132 (52%), Gaps = 24/132 (18%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRC--------QLEVEDMKQRI  197
            +++++  ++E LP  LQ+ + LMRDLD+  QE+ +  D+           L+ E   +R+
Sbjct  6    YLEQYLDSIENLPFELQRNFTLMRDLDQRTQELAKSIDEDTVNYLKTVKDLKPEQRAERL  65

Query  198  KSGNIASDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEE  377
            K  N +   S                   D+KV LA+Q Y++VD HI++LD  L +F++E
Sbjct  66   KKINHSFTKSR---------------EYGDDKVQLAMQTYEMVDKHIRRLDADLARFEQE  110

Query  378  LR-RVAERENAV  410
            L+ R  E+ + V
Sbjct  111  LKERTLEQASPV  122



>ref|XP_003737536.1| PREDICTED: inhibitor of growth protein 4-like [Metaseiulus occidentalis]
Length=233

 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 36/125 (29%), Positives = 63/125 (50%), Gaps = 7/125 (6%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  221
            +++ +   LE LP  L + + LMRDLD  +Q++ +  D+     +++  +        S 
Sbjct  2    YLETYLDTLESLPQDLHRSFILMRDLDGKVQDILKGIDKESHNYMDNTAK-------LSP  54

Query  222  SSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAERE  401
            S   + +D        A  +AD+KV LA+  Y+ VD HI++LD  L +F+ EL+     +
Sbjct  55   SKRREATDKITKMYAKAKELADDKVQLAMSTYETVDKHIRRLDTELARFENELKEKLLSK  114

Query  402  NAVAT  416
            N   T
Sbjct  115  NGAPT  119



>ref|XP_011472032.1| PREDICTED: inhibitor of growth protein 5 [Oryzias latipes]
Length=241

 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 40/131 (31%), Positives = 74/131 (56%), Gaps = 11/131 (8%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  221
            +++ +  ++E LP  LQ+ + LMRDLD   +E + + D+  +  + ++K      N+AS+
Sbjct  6    YLEHYLDSIENLPCELQRNFTLMRDLDSRTEEKKGEIDRLAEEYISNVK------NLASE  59

Query  222  SSL--IKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  395
              +  ++   +A  + K     +D+KV LA+Q Y++VD HI++LD  L +F+ EL+   E
Sbjct  60   QRVEHLQKIQNAYSKCKE---FSDDKVQLAMQTYEMVDKHIRRLDADLARFENELKEKLE  116

Query  396  RENAVATGSTT  428
                 +T S T
Sbjct  117  LTGYDSTDSRT  127



>ref|XP_011346281.1| PREDICTED: inhibitor of growth protein 5 [Cerapachys biroi]
Length=255

 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 62/117 (53%), Gaps = 13/117 (11%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSG---NI  212
            +++ +  +LE LP  LQ+ + LMRDLD   Q + +  D+R    + ++K+         +
Sbjct  6    YLEHYLDSLEHLPIELQRNFTLMRDLDARAQSLMKDIDKRADEYLRNIKKESPEKKKEQL  65

Query  213  ASDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELR  383
            AS  SL             A    D+KV LAIQ Y+LVD HI++LD  L +F+ E++
Sbjct  66   ASIQSLFN----------KAKEYGDDKVQLAIQTYELVDKHIRRLDSDLARFEAEIQ  112



>ref|XP_001629595.1| predicted protein [Nematostella vectensis]
 gb|EDO37532.1| predicted protein [Nematostella vectensis]
Length=180

 Score = 53.9 bits (128),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 70/125 (56%), Gaps = 7/125 (6%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  221
            ++D +   +E LP  LQ+ + LM++LD+  Q++ ++ D      V +    ++  +    
Sbjct  6    YLDHYLDGIETLPFELQRNFTLMKELDQRAQDLLKEIDNMSDKYVAE----VRKMDALQR  61

Query  222  SSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAERE  401
            +  +K  ++A  + K  +   D+KV LA+Q Y++VD HI++LD  L +F+ +L+    +E
Sbjct  62   TDHLKKIENAFSKSKEYV---DDKVQLAMQTYEMVDKHIRKLDHDLARFEADLKEERAKE  118

Query  402  NAVAT  416
              +++
Sbjct  119  AGLSS  123



>ref|XP_011144411.1| PREDICTED: inhibitor of growth protein 5 isoform X4 [Harpegnathos 
saltator]
Length=254

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 42/133 (32%), Positives = 65/133 (49%), Gaps = 14/133 (11%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  221
            +++ +  +LE LP  LQ+ + LMRDLD   Q + +  D+      +D  + IK  +    
Sbjct  5    YLEHYLDSLEHLPIELQRNFTLMRDLDARAQSLMKDIDKL----ADDYLRNIKKESPEKS  60

Query  222  SSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELR------  383
               I       ++ K      D+KV LAIQ Y+LVD HI++LD  L +F+ E++      
Sbjct  61   KEQITHIQSLFNKAK---EYGDDKVQLAIQTYELVDKHIRRLDSDLARFEAEIQDKALNS  117

Query  384  -RVAERENAVATG  419
             R  E  NA   G
Sbjct  118  SRAQEEGNASKKG  130



>ref|XP_011494864.1| PREDICTED: inhibitor of growth protein 5 isoform X1 [Ceratosolen 
solmsi marchali]
Length=254

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 43/138 (31%), Positives = 67/138 (49%), Gaps = 23/138 (17%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  221
            +++ +  +LE LP  L++ + LMRDLD   Q + +  D+     +++MK           
Sbjct  6    YLEHYLDSLEHLPTELRRNFNLMRDLDARAQVLMKDIDKLADDYLKNMK-----------  54

Query  222  SSLIKFSDDALDEQ--------KHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEE  377
                K S D  +EQ          A    D+KV LAIQ Y+LVD HI++LD  L +F+ E
Sbjct  55   ----KESSDKKNEQLTRIQNLFNKAKEYGDDKVQLAIQTYELVDKHIRRLDSDLMRFEAE  110

Query  378  LRRVAERENAVATGSTTS  431
            ++  A   N     S +S
Sbjct  111  IQDKALSSNRTQEESVSS  128



>ref|XP_005798821.1| PREDICTED: inhibitor of growth protein 4-like isoform X1 [Xiphophorus 
maculatus]
Length=249

 Score = 55.1 bits (131),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 54/199 (27%), Positives = 96/199 (48%), Gaps = 34/199 (17%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  221
            +++ +  ++E LP  LQ+ + LMRDLD      QR  D + Q++    +    +  ++SD
Sbjct  6    YLEHYLDSIENLPFELQRNFNLMRDLD------QRTEDLKGQIDSLAKEYTSNARTLSSD  59

Query  222  S--SLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEEL-----  380
               SL++    +  + K      D+KV LA+Q Y++VD HI++LD  L +F+ +L     
Sbjct  60   QKLSLLRQIQQSYSKCKE---FGDDKVQLAMQTYEMVDKHIRRLDTDLARFEADLKEKQI  116

Query  381  ------------RRVAERENAVATGSTTSNVDNNVksgrsgdsskggrkkTRLATATPAA  524
                        ++V  R+    T  T S V ++ + G    + K  +   +     PA+
Sbjct  117  ESTDYDSTSSKGKKVDTRQKEKKTAKTRSKVKSSDEDGSPKSAQKKVKLFQQGEFNAPAS  176

Query  525  N-----PTGMDLDLPVDPS  566
            N     P+ + LD+PVDP+
Sbjct  177  NFGNVHPSDV-LDMPVDPN  194



>gb|EPS66711.1| hypothetical protein M569_08060 [Genlisea aurea]
Length=723

 Score = 55.8 bits (133),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 35/128 (27%), Positives = 64/128 (50%), Gaps = 5/128 (4%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQ--LEVEDMKQRIKSGNIA  215
            F+D++      LP  LQ+    +R+LD   Q +  Q  Q+ +  L +          N  
Sbjct  9    FVDDYLEYSSTLPAELQRLLNTIRELDERSQAMINQTRQQTKYCLSLASQGGLFSWKNDD  68

Query  216  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELR---R  386
             ++   K   +    Q + + +  EK+ LA QA+DL+D+H+++LD+ L  F E+L+   +
Sbjct  69   EEAMFEKLRKETEGNQDNVLSLCTEKILLARQAHDLIDSHVKRLDEDLNNFAEDLKHEGK  128

Query  387  VAERENAV  410
            ++  E AV
Sbjct  129  ISPDEPAV  136



>ref|XP_009353151.1| PREDICTED: PHD finger protein ING2 [Pyrus x bretschneideri]
Length=265

 Score = 55.1 bits (131),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 42/132 (32%), Positives = 67/132 (51%), Gaps = 9/132 (7%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGN----  209
            ++D++      LP  LQ+    +R+LD   Q +  Q  Q+ +  +    Q  K  N    
Sbjct  9    YVDDYLEYANTLPAELQRLLNTIRELDERSQSMIHQTRQQTKYCLGLSSQSSKKWNNNYN  68

Query  210  -IASDSSLI-KFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELR  383
             I  D + I K   +    Q  A+ +  EKV LA QAYDL+D+H+++LD+ L  F E+L+
Sbjct  69   NIEEDEAAIEKMRKEIESNQDSALSLCTEKVLLAQQAYDLIDSHVKRLDEDLNHFAEDLK  128

Query  384  ---RVAERENAV  410
               ++A  E AV
Sbjct  129  QEGKIAPDEPAV  140



>ref|XP_008351429.1| PREDICTED: PHD finger protein ING2-like [Malus domestica]
Length=265

 Score = 55.1 bits (131),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 42/132 (32%), Positives = 67/132 (51%), Gaps = 9/132 (7%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGN----  209
            ++D++      LP  LQ+    +R+LD   Q +  Q  Q+ +  +    Q  K  N    
Sbjct  9    YVDDYLEYANTLPAELQRLLNTIRELDERSQSMIHQTRQQTKYCLGLSSQSSKKWNNNYN  68

Query  210  -IASDSSLI-KFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELR  383
             I  D + I K   +    Q  A+ +  EKV LA QAYDL+D+H+++LD+ L  F E+L+
Sbjct  69   NIEEDEAAIEKMRKEIESNQDSALSLCTEKVLLAQQAYDLIDSHVKRLDEDLNHFAEDLK  128

Query  384  ---RVAERENAV  410
               ++A  E AV
Sbjct  129  QEGKIAPDEPAV  140



>ref|XP_002319698.1| PHD finger family protein [Populus trichocarpa]
 gb|EEE95621.1| PHD finger family protein [Populus trichocarpa]
Length=273

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 63/126 (50%), Gaps = 11/126 (9%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA--  215
            ++D++      LP  LQ+    +R+LD   Q +  Q  Q+    +    Q ++ GN +  
Sbjct  9    YVDDYLEYANTLPAELQRLLNTVRELDDRSQSMINQTRQQTNYCLGLASQSLRKGNGSIY  68

Query  216  ---------SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKF  368
                      D ++ K   D    Q  A+ +  EKV LA QAYDL+D+H+++LD+ L  F
Sbjct  69   NCYNTNNNEEDEAVEKMRKDIEANQDSALSLCTEKVLLARQAYDLIDSHVKRLDEDLNNF  128

Query  369  DEELRR  386
             E+L++
Sbjct  129  AEDLKQ  134



>gb|EKC39309.1| Inhibitor of growth protein 5 [Crassostrea gigas]
Length=243

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 64/115 (56%), Gaps = 9/115 (8%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  221
            +++ +  +LE LP  LQ+ + LMRDLD+  Q++ +  D   +  +++++           
Sbjct  6    YLEHYLDSLETLPTELQRNFNLMRDLDQRTQDLLKDIDGLAEEYLKNVRGMSPEKRTQKL  65

Query  222  SSLI-KFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELR  383
            SS+  KFS         +    D+KV LA+Q Y++VD HI++LD  L +F+ +L+
Sbjct  66   SSIENKFS--------KSREYGDDKVQLAMQTYEMVDKHIRKLDADLARFEADLK  112



>ref|XP_008183349.1| PREDICTED: inhibitor of growth protein 4-like [Acyrthosiphon 
pisum]
Length=244

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 67/126 (53%), Gaps = 13/126 (10%)
 Frame = +3

Query  39   SFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRI---KSGN  209
             ++DE + +L  LP+ L + + LM++LD   Q+V    D+     + ++K+     K   
Sbjct  5    PYLDELKNSLNNLPDELHRNFSLMQELDLRSQKVMNNIDKMANNYMSNVKEYSVDKKKET  64

Query  210  IASDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRV  389
            +AS    IK   DA      A   +D+KV L+IQ Y+LVD HI++LD  L KF  +++  
Sbjct  65   MAS----IKHHFDA------AKAYSDDKVQLSIQTYELVDKHIRKLDTELLKFKGKIQLQ  114

Query  390  AERENA  407
             +  NA
Sbjct  115  TDMRNA  120



>ref|XP_011432759.1| PREDICTED: inhibitor of growth protein 5-like [Crassostrea gigas]
Length=253

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 64/115 (56%), Gaps = 9/115 (8%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  221
            +++ +  +LE LP  LQ+ + LMRDLD+  Q++ +  D   +  +++++           
Sbjct  16   YLEHYLDSLETLPTELQRNFNLMRDLDQRTQDLLKDIDGLAEEYLKNVRGMSPEKRTQKL  75

Query  222  SSLI-KFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELR  383
            SS+  KFS         +    D+KV LA+Q Y++VD HI++LD  L +F+ +L+
Sbjct  76   SSIENKFS--------KSREYGDDKVQLAMQTYEMVDKHIRKLDADLARFEADLK  122



>emb|CDY33693.1| BnaC04g29580D [Brassica napus]
Length=152

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/129 (28%), Positives = 67/129 (52%), Gaps = 8/129 (6%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGN----  209
            ++D++       P  LQ+    +R+LD   Q +  Q  Q+ +  +  +  +  SGN    
Sbjct  9    YVDDYLEYASTFPAELQRLLNTVRELDERSQSLINQTRQQTKYCL-GLASKKGSGNNNHY  67

Query  210  ---IASDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEEL  380
               +  D ++ K   +    Q++A+ +  EKV LA QAYDL+D+H+++LD+ L  F E+L
Sbjct  68   NTGLDDDETIDKMRKEIESSQENALSLCTEKVLLARQAYDLIDSHLKRLDEDLNNFSEDL  127

Query  381  RRVAERENA  407
            ++  +  N 
Sbjct  128  KQGIDHLNP  136



>ref|XP_006362258.1| PREDICTED: PHD finger protein ING2-like [Solanum tuberosum]
Length=258

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 61/118 (52%), Gaps = 4/118 (3%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEV---QRQNDQRCQLEVEDMKQRIKSGNI  212
            F+D++      LP  LQ+    +R+LD   Q +    RQ    C L +    Q  +  N 
Sbjct  9    FVDDYLEYSSTLPAELQRLLNTIRELDERSQGIINQTRQQTNYC-LGLASQSQGSRKYNY  67

Query  213  ASDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRR  386
              D +  K   +    Q +A+ +  EKV LA QA+D++D+HI++LD+ L  F E+L++
Sbjct  68   DDDEAFEKLRKEIEGNQDNALSLCTEKVLLARQAHDIIDSHIKRLDEDLTNFAEDLKQ  125



>gb|ACU19850.1| unknown [Glycine max]
Length=45

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +3

Query  36   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQ  134
            MSF++EF+ NL+ LP ILQKKY L+RDLD+SL 
Sbjct  1    MSFLEEFQANLDSLPVILQKKYALLRDLDKSLH  33



>ref|XP_010553805.1| PREDICTED: PHD finger protein ING2 [Tarenaya hassleriana]
Length=264

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 39/122 (32%), Positives = 64/122 (52%), Gaps = 7/122 (6%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSG-----  206
            ++D++      LP  LQ+    +R+LD   Q +  Q  Q+ +L +    Q  K G     
Sbjct  9    YVDDYLEYASTLPAELQRLLNTIRELDGRSQSLINQTRQQTKLCLGLASQSSKKGVGNHY  68

Query  207  -NIASDSSLI-KFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEEL  380
             N   D   I K   +    Q++A+ +  EKV LA QAYDL+D+H+++LD+ L  F E+L
Sbjct  69   NNGHDDEETIEKMRKEIESSQENALSLCTEKVLLARQAYDLIDSHVKRLDEDLNNFAEDL  128

Query  381  RR  386
            ++
Sbjct  129  KQ  130



>ref|XP_008429672.1| PREDICTED: inhibitor of growth protein 4 isoform X1 [Poecilia 
reticulata]
Length=249

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 53/198 (27%), Positives = 94/198 (47%), Gaps = 34/198 (17%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  221
            +++ +  ++E LP  LQ+ + LMRDLD      QR  D + Q++    +    +  ++SD
Sbjct  6    YLEHYLDSIENLPFELQRNFNLMRDLD------QRTEDLKGQIDSLAKEYTSNARTLSSD  59

Query  222  S--SLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEEL-----  380
               SL++    +  + K      D+KV LA+Q Y++VD HI++LD  L +F+ +L     
Sbjct  60   QKLSLLRQIQQSYSKCKE---FGDDKVQLAMQTYEMVDKHIRRLDTDLARFEADLKEKQI  116

Query  381  ------------RRVAERENAVATGSTTSNVDNNVksgrsgdsskggrkkTRLATATPAA  524
                        ++V  R+       T S V ++ + G    + K  +   +     PA+
Sbjct  117  ESTDYDSASSKGKKVDSRQKEKKAAKTRSKVKSSDEDGSPKSAQKKVKLFQQGEFTAPAS  176

Query  525  N-----PTGMDLDLPVDP  563
            N     P+ + LD+PVDP
Sbjct  177  NFGNVHPSDV-LDMPVDP  193



>ref|XP_003385612.1| PREDICTED: inhibitor of growth protein 5-like [Amphimedon queenslandica]
Length=245

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 65/116 (56%), Gaps = 11/116 (9%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLE--VEDMKQRIKSGNIA  215
            +++ F   +E LP  LQ+ + LM+DLD      QR  D   ++E  V D K+ + + + +
Sbjct  6    YLENFLETIEHLPKELQRNFSLMKDLD------QRTKDTTNEVEEWVRDYKKVVATLSES  59

Query  216  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELR  383
               + +   D+   + K     +D+KV LA+Q Y+++D HI+ LD  L +F++EL+
Sbjct  60   ERKARLSKIDELYQKAKE---YSDDKVQLAMQMYEMIDKHIRSLDSDLGRFEQELQ  112



>ref|XP_004249145.1| PREDICTED: PHD finger protein ING2 [Solanum lycopersicum]
 ref|XP_010312052.1| PREDICTED: PHD finger protein ING2 [Solanum lycopersicum]
Length=258

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 61/118 (52%), Gaps = 4/118 (3%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEV---QRQNDQRCQLEVEDMKQRIKSGNI  212
            F+D++      LP  LQ+    +R+LD   Q +    RQ    C L +    Q  +  N 
Sbjct  9    FVDDYLEYSSTLPAELQRLLNTIRELDERSQGIINQTRQQTNYC-LGLASQSQGSRKYNY  67

Query  213  ASDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRR  386
              D +  K   +    Q +A+ +  EKV LA QA+D++D+HI++LD+ L  F E+L++
Sbjct  68   DDDEAFEKLRKEIEGNQDNALSLCTEKVLLARQAHDIIDSHIKRLDEDLANFAEDLKQ  125



>ref|XP_004147532.1| PREDICTED: PHD finger protein ING2-like [Cucumis sativus]
 ref|XP_004163664.1| PREDICTED: PHD finger protein ING2-like [Cucumis sativus]
 gb|KGN53945.1| hypothetical protein Csa_4G192170 [Cucumis sativus]
Length=263

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 41/132 (31%), Positives = 70/132 (53%), Gaps = 10/132 (8%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLD---RSLQEVQRQNDQRCQLEVEDMKQRIKSGNI  212
            ++D++      LP  LQ+    +R+LD   +S+ +  RQ  + C L +     +   GN 
Sbjct  9    YVDDYLEYASTLPAELQRLLNTIRELDDRSQSMIDQTRQQTKYC-LGLSTQSSKKGYGNS  67

Query  213  ASD---SSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELR  383
             +D   S+  K   D    Q +A+ +  EKV LA QA DL+D+HI++LD+ L  F E+L+
Sbjct  68   NTDDEESAFEKLRKDIEANQDNALSLCTEKVLLARQAGDLIDSHIKRLDEDLNNFAEDLK  127

Query  384  ---RVAERENAV  410
               +++  E A+
Sbjct  128  QEGKISPDEPAI  139



>gb|ETE65632.1| Inhibitor of growth protein 4, partial [Ophiophagus hannah]
Length=741

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 32/114 (28%), Positives = 64/114 (56%), Gaps = 7/114 (6%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  221
            +++ +  ++E LP  LQ+ + LMRDLD+  ++++ + D+     + + +       +   
Sbjct  2    YLEHYLDSIENLPFELQRNFQLMRDLDQRTEDLKSEIDKLATEYISNARTLSSEEKVG--  59

Query  222  SSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELR  383
              L+K   +A  + K      D+KV LA+Q Y++VD HI++LD  L +F+ +L+
Sbjct  60   --LLKQIQEAYGKCKE---FGDDKVQLAMQTYEMVDKHIRRLDTDLARFEADLK  108



>ref|XP_001364945.2| PREDICTED: inhibitor of growth protein 4 isoform X1 [Monodelphis 
domestica]
 ref|XP_003771263.1| PREDICTED: inhibitor of growth protein 4 isoform 1 [Sarcophilus 
harrisii]
Length=249

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 67/114 (59%), Gaps = 7/114 (6%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  221
            +++ +  ++E LP  LQ+ + LMRDLD+  ++++ + D+   L  E M    +S N    
Sbjct  6    YLEHYLDSIENLPFELQRNFQLMRDLDQRTEDLKAEIDK---LATEYMSS-ARSLNSEEK  61

Query  222  SSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELR  383
             +L+K   +A  + K      D+KV LA+Q Y++VD HI++LD  L +F+ +L+
Sbjct  62   LALLKQIQEAYGKCKE---FGDDKVQLAMQTYEMVDKHIRRLDTDLARFEADLK  112



>ref|XP_009124440.1| PREDICTED: PHD finger protein ING2 [Brassica rapa]
Length=263

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 66/125 (53%), Gaps = 11/125 (9%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLD---RSLQEVQRQNDQRCQLEVEDMKQRIKSGN-  209
            ++D++       P  LQ+    +R+LD   +SL    RQ  + C L +     +  SGN 
Sbjct  9    YVDDYLEYASTFPAELQRLLNTVRELDERSQSLINQTRQQTKYC-LGLASQSSKKGSGNN  67

Query  210  ------IASDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFD  371
                  +  D ++ K   +    Q++A+ +  EKV LA QAYDL+D+H+++LD+ L  F 
Sbjct  68   NHYNTGLDDDETVEKMRKEIESSQENALSLCTEKVLLARQAYDLIDSHLKRLDEDLNNFA  127

Query  372  EELRR  386
            E+L++
Sbjct  128  EDLKQ  132



>gb|EHJ63393.1| hypothetical protein KGM_06709 [Danaus plexippus]
Length=384

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 62/115 (54%), Gaps = 5/115 (4%)
 Frame = +3

Query  36   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  215
            M +++++   +E LP  L+ ++  MR++D S+Q     N    +  V  +    + G + 
Sbjct  1    MLYLEDYLEMIEHLPQELRDRFTEMREMDLSVQ----NNMDTLEKRVRTLFGSCRRGEVN  56

Query  216  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEEL  380
            +D +  +FSD      K  +  ADEKV LA Q YDLVD ++++LD  L KF  EL
Sbjct  57   TDQANTEFSDIKRGYNK-TLEEADEKVTLANQMYDLVDRYLRRLDTELHKFKCEL  110



>ref|XP_006443408.1| hypothetical protein CICLE_v10021354mg [Citrus clementina]
 gb|ESR56648.1| hypothetical protein CICLE_v10021354mg [Citrus clementina]
Length=301

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 62/116 (53%), Gaps = 1/116 (1%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNI-AS  218
            ++D++      LP  LQ+    +R+LD     +  Q  Q+ +  +    Q  K GN    
Sbjct  51   YVDDYLEYASTLPAELQRLLNTIRELDERSHSMINQTRQQTKYCLGLASQGNKKGNGNEE  110

Query  219  DSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRR  386
            D ++ K   +    Q +A+ +  EKV LA QAYD++D+HI++LD+ L  F E+L++
Sbjct  111  DEAIEKMRKEIEVNQDNALSLCTEKVLLARQAYDIIDSHIKRLDEDLNNFAEDLKQ  166



>ref|XP_007550173.1| PREDICTED: inhibitor of growth protein 4 isoform X1 [Poecilia 
formosa]
Length=249

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 53/198 (27%), Positives = 94/198 (47%), Gaps = 34/198 (17%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  221
            +++ +  ++E LP  LQ+ + LMRDLD      QR  D + Q++    +    +  ++SD
Sbjct  6    YLEHYLDSIENLPFELQRNFNLMRDLD------QRTEDLKGQIDSLAKEYTSNARTLSSD  59

Query  222  S--SLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEEL-----  380
               SL++    +  + K      D+KV LA+Q Y++VD HI++LD  L +F+ +L     
Sbjct  60   QKLSLLRQIQQSYSKCKE---FGDDKVQLAMQTYEMVDKHIRRLDTDLARFEADLKEKQI  116

Query  381  ------------RRVAERENAVATGSTTSNVDNNVksgrsgdsskggrkkTRLATATPAA  524
                        ++V  R+       T S V ++ + G    + K  +   +     PA+
Sbjct  117  ESTDYDSTSSKGKKVDSRQKEKKAAKTRSKVKSSDEDGSPKSAQKKVKLFQQGEFTAPAS  176

Query  525  N-----PTGMDLDLPVDP  563
            N     P+ + LD+PVDP
Sbjct  177  NFGNVHPSDV-LDMPVDP  193



>ref|XP_002525439.1| Inhibitor of growth protein, putative [Ricinus communis]
 gb|EEF36929.1| Inhibitor of growth protein, putative [Ricinus communis]
Length=266

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 41/134 (31%), Positives = 71/134 (53%), Gaps = 12/134 (9%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  221
            ++D++      LP  LQ+    +R+LD     +  Q  Q+ +  +  + Q  K GN  + 
Sbjct  9    YVDDYLEYASTLPAELQRLLNTIRELDERSHSMINQTRQQTKYCL-GLAQSSKRGNGNNY  67

Query  222  SSLIKFSDDALDEQK--------HAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEE  377
             + I   DDA++  K        +A+ +  EKV LA QA+DL+D+HI++LD+ L  F E+
Sbjct  68   HNSINEEDDAVERMKKDIEANQDNALSLCTEKVLLARQAHDLIDSHIKRLDEDLNYFAED  127

Query  378  LR---RVAERENAV  410
            L+   +++  E AV
Sbjct  128  LKHEGKISPDEPAV  141



>ref|XP_008280187.1| PREDICTED: inhibitor of growth protein 5 [Stegastes partitus]
Length=241

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/129 (29%), Positives = 69/129 (53%), Gaps = 7/129 (5%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  221
            +++ +  ++E LP  LQ+ + LMRDLD   +E + + D+  +  + ++K      N+AS+
Sbjct  6    YLEHYLDSIENLPCELQRNFTLMRDLDNRTEEKKGEIDKLAEEYIANVK------NLASE  59

Query  222  SSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAERE  401
               ++      +        +D+KV LA+Q Y++VD HI++LD  L +F+ EL+   E  
Sbjct  60   QR-VEHLQKIQNAYSKCKEFSDDKVQLAMQTYEMVDKHIRRLDADLARFENELKEKLEVS  118

Query  402  NAVATGSTT  428
               +T   T
Sbjct  119  GYESTEGRT  127



>gb|KIH54551.1| PHD-finger [Ancylostoma duodenale]
Length=236

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 50/188 (27%), Positives = 91/188 (48%), Gaps = 28/188 (15%)
 Frame = +3

Query  45   IDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASDS  224
            + ++   L+ LP  ++K    +R+LD  ++++  + + R    V+++K+  K        
Sbjct  5    LKKYMEKLDDLPPFIRKNAEEIRELDEKVEKIMHEIEVRTVAHVKNLKKTTKE-------  57

Query  225  SLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDE-ELRRVAERE  401
              +K+  +     K A ++++ KV LA + YD VDTHI+++DQ L +F E ++++ +   
Sbjct  58   QRVKWYKEVQAMYKEADKLSERKVKLAQKMYDTVDTHIKEMDQQLVEFQEFQIKKYSAGH  117

Query  402  NAVATGSTTSNVDNNVksgrsgdsskggrkkTRLATATP-AANPTG---MD---------  542
             A A    TSN DN     +   S    +   R     P A +P G   MD         
Sbjct  118  GAKA---GTSNSDNQ----KRKGSVAAIKGDKRKKPGDPKAPHPDGATFMDTFKPAAIAP  170

Query  543  LDLPVDPS  566
            +D+PVDP+
Sbjct  171  VDMPVDPN  178



>ref|XP_009015205.1| hypothetical protein HELRODRAFT_184897 [Helobdella robusta]
 gb|ESO05837.1| hypothetical protein HELRODRAFT_184897 [Helobdella robusta]
Length=246

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/128 (30%), Positives = 65/128 (51%), Gaps = 29/128 (23%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  221
            +++ +  +LE LP  L + + LMRDLD   Q++ +        E+++M          +D
Sbjct  6    YLEHYLDSLESLPMELSRNFNLMRDLDSKSQDLLK--------EIDEM----------AD  47

Query  222  SSLIKFSDDALDEQKHAI-----------RIADEKVALAIQAYDLVDTHIQQLDQYLKKF  368
            S L    D + D++K  +              D+KV LA+Q Y++VD HI++LD  L +F
Sbjct  48   SYLTNVKDLSNDKRKEQLSKIQTMFSKSKEFGDDKVQLAMQTYEMVDKHIRKLDADLARF  107

Query  369  DEELRRVA  392
            + EL+  A
Sbjct  108  EAELKEKA  115



>ref|XP_006479097.1| PREDICTED: PHD finger protein ING2-like [Citrus sinensis]
 gb|KDO55062.1| hypothetical protein CISIN_1g024980mg [Citrus sinensis]
Length=259

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 62/116 (53%), Gaps = 1/116 (1%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNI-AS  218
            ++D++      LP  LQ+    +R+LD     +  Q  Q+ +  +    Q  K GN    
Sbjct  9    YVDDYLEYASTLPAELQRLLNTIRELDERSHSMINQTRQQTKYCLGLASQGNKKGNGNEE  68

Query  219  DSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRR  386
            D ++ K   +    Q +A+ +  EKV LA QAYD++D+HI++LD+ L  F E+L++
Sbjct  69   DEAIEKMRKEIEVNQDNALSLCTEKVLLARQAYDIIDSHIKRLDEDLNNFAEDLKQ  124



>ref|XP_008305362.1| PREDICTED: inhibitor of growth protein 5 [Cynoglossus semilaevis]
Length=241

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/120 (31%), Positives = 70/120 (58%), Gaps = 11/120 (9%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  221
            +++ +  ++E LP  LQ+ + LMRDLD   +E + + D+  +  + ++K      N+AS+
Sbjct  6    YLEHYLDSIENLPCELQRNFTLMRDLDNRTEEKKGEIDKLAEEYIANVK------NLASE  59

Query  222  SSL--IKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  395
              +  ++   +A  + K     +D+KV LA+Q Y++VD HI++LD  L +F+ EL+   E
Sbjct  60   QRVEHLQKIQNAYSKCKE---FSDDKVQLAMQTYEMVDKHIRRLDADLARFENELKEKLE  116



>ref|XP_005610928.1| PREDICTED: inhibitor of growth protein 4 isoform X6 [Equus caballus]
 ref|XP_005873765.1| PREDICTED: inhibitor of growth protein 4 isoform X6 [Myotis brandtii]
Length=243

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 50/197 (25%), Positives = 89/197 (45%), Gaps = 36/197 (18%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  221
            +++ +  ++E LP  LQ+ + LMRDLD+  ++++ + D+   L  E M     + N++S+
Sbjct  6    YLEHYLDSIENLPFELQRNFQLMRDLDQRTEDLKAEIDK---LATEYMSS---ARNLSSE  59

Query  222  S--SLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELR----  383
               +L+K   +A  + K      D+KV LA+Q Y++VD HI++LD  L +F+ +L+    
Sbjct  60   EKLALLKQIQEAYGKCKE---FGDDKVQLAMQTYEMVDKHIRRLDTDLARFEADLKEKQI  116

Query  384  ----------------RVAERENAVATGSTTSNVDNNVksgrsgdsskggrkkTRLATAT  515
                            R  + + A    S   N D              G       +  
Sbjct  117  ESSDYDSSSSKGKKKGRTQKEKKAARARSKGKNSDEEAPKAAQKKLKLYGMPSVTFGSVH  176

Query  516  PAANPTGMDLDLPVDPS  566
            P+       LD+PVDP+
Sbjct  177  PSDV-----LDMPVDPN  188



>ref|XP_008143061.1| PREDICTED: inhibitor of growth protein 4 isoform X5 [Eptesicus 
fuscus]
Length=243

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 50/197 (25%), Positives = 89/197 (45%), Gaps = 36/197 (18%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  221
            +++ +  ++E LP  LQ+ + LMRDLD+  ++++ + D+   L  E M     + N++S+
Sbjct  6    YLEHYLDSIENLPFELQRNFQLMRDLDQRTEDLKAEIDK---LATEYMSS---ARNLSSE  59

Query  222  S--SLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELR----  383
               +L+K   +A  + K      D+KV LA+Q Y++VD HI++LD  L +F+ +L+    
Sbjct  60   EKLALLKQIQEAYGKCKE---FGDDKVQLAMQTYEMVDKHIRRLDTDLARFEADLKEKQI  116

Query  384  ----------------RVAERENAVATGSTTSNVDNNVksgrsgdsskggrkkTRLATAT  515
                            R  + + A    S   N D              G       +  
Sbjct  117  ESSDYDSSSSKGKKKGRAQKEKKAARARSKGKNSDEEAPKAAQKKLKLYGMPSVTFGSVH  176

Query  516  PAANPTGMDLDLPVDPS  566
            P+       LD+PVDP+
Sbjct  177  PSDV-----LDMPVDPN  188



>ref|XP_005610927.1| PREDICTED: inhibitor of growth protein 4 isoform X5 [Equus caballus]
 ref|XP_005873764.1| PREDICTED: inhibitor of growth protein 4 isoform X5 [Myotis brandtii]
 ref|XP_006757649.1| PREDICTED: inhibitor of growth protein 4 isoform X4 [Myotis davidii]
 ref|XP_006914692.1| PREDICTED: inhibitor of growth protein 4 isoform X1 [Pteropus 
alecto]
 ref|XP_008512183.1| PREDICTED: inhibitor of growth protein 4 isoform X4 [Equus przewalskii]
 ref|XP_011364156.1| PREDICTED: inhibitor of growth protein 4 isoform X3 [Pteropus 
vampyrus]
Length=245

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 70/116 (60%), Gaps = 11/116 (9%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  221
            +++ +  ++E LP  LQ+ + LMRDLD+  ++++ + D+   L  E M     + N++S+
Sbjct  6    YLEHYLDSIENLPFELQRNFQLMRDLDQRTEDLKAEIDK---LATEYMSS---ARNLSSE  59

Query  222  S--SLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELR  383
               +L+K   +A  + K      D+KV LA+Q Y++VD HI++LD  L +F+ +L+
Sbjct  60   EKLALLKQIQEAYGKCKE---FGDDKVQLAMQTYEMVDKHIRRLDTDLARFEADLK  112



>gb|ACQ58032.1| Inhibitor of growth protein 4 [Anoplopoma fimbria]
Length=249

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 56/199 (28%), Positives = 94/199 (47%), Gaps = 34/199 (17%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  221
            +++ +  ++E LP  LQ+ + LMRDLD      QR  D + Q+   D   +  + N  + 
Sbjct  6    YLEHYLDSIENLPFELQRNFNLMRDLD------QRTEDLKGQI---DSLAKEYTANARTL  56

Query  222  SSLIKFSDDALDEQKHAI--RIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEEL-----  380
            SS  K S     +Q ++      D+KV LA+Q Y++VD HI++LD  L +F+ +L     
Sbjct  57   SSEQKLSILRQIQQSYSKCKEFGDDKVQLAMQTYEMVDKHIRRLDTDLARFEADLKEKQI  116

Query  381  ------------RRVAERENAVATGSTTSNVDNNVksgrsgdsskggrkkTRLATATPAA  524
                        ++V  R+    T  T S V ++ + G    + K  +        +PA 
Sbjct  117  ESTDYDSTSSKGKKVETRQKEKKTAKTRSKVKSSDEDGSPKSAQKKVKLLQPGEFNSPAT  176

Query  525  N-----PTGMDLDLPVDPS  566
            N     P+ + LD+PVDP+
Sbjct  177  NFGNVHPSDV-LDMPVDPN  194



>ref|XP_005610926.1| PREDICTED: inhibitor of growth protein 4 isoform X4 [Equus caballus]
 ref|XP_005873763.1| PREDICTED: inhibitor of growth protein 4 isoform X4 [Myotis brandtii]
 ref|XP_006757648.1| PREDICTED: inhibitor of growth protein 4 isoform X3 [Myotis davidii]
 ref|XP_008512182.1| PREDICTED: inhibitor of growth protein 4 isoform X3 [Equus przewalskii]
Length=246

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 70/116 (60%), Gaps = 11/116 (9%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  221
            +++ +  ++E LP  LQ+ + LMRDLD+  ++++ + D+   L  E M     + N++S+
Sbjct  6    YLEHYLDSIENLPFELQRNFQLMRDLDQRTEDLKAEIDK---LATEYMSS---ARNLSSE  59

Query  222  S--SLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELR  383
               +L+K   +A  + K      D+KV LA+Q Y++VD HI++LD  L +F+ +L+
Sbjct  60   EKLALLKQIQEAYGKCKE---FGDDKVQLAMQTYEMVDKHIRRLDTDLARFEADLK  112



>ref|XP_008143060.1| PREDICTED: inhibitor of growth protein 4 isoform X4 [Eptesicus 
fuscus]
Length=245

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 70/116 (60%), Gaps = 11/116 (9%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  221
            +++ +  ++E LP  LQ+ + LMRDLD+  ++++ + D+   L  E M     + N++S+
Sbjct  6    YLEHYLDSIENLPFELQRNFQLMRDLDQRTEDLKAEIDK---LATEYMSS---ARNLSSE  59

Query  222  S--SLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELR  383
               +L+K   +A  + K      D+KV LA+Q Y++VD HI++LD  L +F+ +L+
Sbjct  60   EKLALLKQIQEAYGKCKE---FGDDKVQLAMQTYEMVDKHIRRLDTDLARFEADLK  112



>ref|XP_009605784.1| PREDICTED: PHD finger protein ING2 [Nicotiana tomentosiformis]
Length=258

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 61/118 (52%), Gaps = 4/118 (3%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEV---QRQNDQRCQLEVEDMKQRIKSGNI  212
            F+D++      LP  LQ+    +R+LD   Q +    RQ    C L +    Q  +  N 
Sbjct  9    FVDDYLEYSSTLPAELQRLLNTIRELDERSQGIINQTRQQTNYC-LGLASQNQGSRKYNY  67

Query  213  ASDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRR  386
              D +  K   +    Q +A+ +  EKV LA QA+D++D+HI++LD+ L  F E+L++
Sbjct  68   DDDEAFEKLRKEIEANQDNALSLCTEKVLLARQAHDIIDSHIKRLDEDLSNFAEDLKQ  125



>ref|XP_008143059.1| PREDICTED: inhibitor of growth protein 4 isoform X3 [Eptesicus 
fuscus]
Length=246

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 70/116 (60%), Gaps = 11/116 (9%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  221
            +++ +  ++E LP  LQ+ + LMRDLD+  ++++ + D+   L  E M     + N++S+
Sbjct  6    YLEHYLDSIENLPFELQRNFQLMRDLDQRTEDLKAEIDK---LATEYMSS---ARNLSSE  59

Query  222  S--SLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELR  383
               +L+K   +A  + K      D+KV LA+Q Y++VD HI++LD  L +F+ +L+
Sbjct  60   EKLALLKQIQEAYGKCKE---FGDDKVQLAMQTYEMVDKHIRRLDTDLARFEADLK  112



>gb|EYB85652.1| hypothetical protein Y032_0294g1639 [Ancylostoma ceylanicum]
Length=236

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 50/184 (27%), Positives = 90/184 (49%), Gaps = 20/184 (11%)
 Frame = +3

Query  45   IDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASDS  224
            + ++   L+ LP  ++K    +R+LD  ++++  + + R    V+++K+  K        
Sbjct  5    LKKYMEKLDDLPPFIRKNAEEIRELDEKVEKIMHEIEVRTVAHVKNLKKTTKE-------  57

Query  225  SLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDE-ELRRVAERE  401
              +K+  +     K A ++++ KV LA + YD VDTHI+++DQ L +F E ++++ +   
Sbjct  58   QRVKWYKEVQAMYKEADKLSERKVKLAQKMYDTVDTHIKEMDQQLVEFQEFQIKKYSAAH  117

Query  402  NAVATGSTTSNVDNNVksgrsgdsskggrkkTRLATATPAANPTGMD---------LDLP  554
             A A    TSN DN  + G         RKK     A    + T MD         +D+P
Sbjct  118  GAKA---GTSNSDNQKRKGSVAAIKGDKRKKPGDPKAPHPDSATFMDTFKPAAIAPVDMP  174

Query  555  VDPS  566
            VDP+
Sbjct  175  VDPN  178



>ref|XP_002161789.2| PREDICTED: uncharacterized protein LOC100215100 [Hydra vulgaris]
Length=446

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 43/139 (31%), Positives = 73/139 (53%), Gaps = 8/139 (6%)
 Frame = +3

Query  36   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  215
            M ++++F   +E LP  L+ ++  MR+LD  +Q      D R +    D ++       +
Sbjct  1    MLYLEDFIELIEQLPQDLRDRFTEMRELDLKVQNTIDTMDTRVRKFFTDARK-------S  53

Query  216  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRR-VA  392
                + K  ++  +  K A+  ADEKV++A Q YDLVD H+++LDQ L +F  EL    +
Sbjct  54   KPEEIEKEYENIHNCYKQALDDADEKVSMASQIYDLVDRHLRKLDQELGRFKMELEADCS  113

Query  393  ERENAVATGSTTSNVDNNV  449
                 +   STT+N DN++
Sbjct  114  GITEILEKRSTTNNEDNSL  132



>ref|XP_005610925.1| PREDICTED: inhibitor of growth protein 4 isoform X3 [Equus caballus]
 ref|XP_005873761.1| PREDICTED: inhibitor of growth protein 4 isoform X2 [Myotis brandtii]
 ref|XP_006757647.1| PREDICTED: inhibitor of growth protein 4 isoform X2 [Myotis davidii]
 ref|XP_008512181.1| PREDICTED: inhibitor of growth protein 4 isoform X2 [Equus przewalskii]
 ref|XP_011364155.1| PREDICTED: inhibitor of growth protein 4 isoform X2 [Pteropus 
vampyrus]
Length=248

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 70/116 (60%), Gaps = 11/116 (9%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  221
            +++ +  ++E LP  LQ+ + LMRDLD+  ++++ + D+   L  E M     + N++S+
Sbjct  6    YLEHYLDSIENLPFELQRNFQLMRDLDQRTEDLKAEIDK---LATEYMSS---ARNLSSE  59

Query  222  S--SLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELR  383
               +L+K   +A  + K      D+KV LA+Q Y++VD HI++LD  L +F+ +L+
Sbjct  60   EKLALLKQIQEAYGKCKE---FGDDKVQLAMQTYEMVDKHIRRLDTDLARFEADLK  112



>ref|XP_009793268.1| PREDICTED: PHD finger protein ING2 [Nicotiana sylvestris]
Length=258

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 61/118 (52%), Gaps = 4/118 (3%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEV---QRQNDQRCQLEVEDMKQRIKSGNI  212
            F+D++      LP  LQ+    +R+LD   Q +    RQ    C L +    Q  +  N 
Sbjct  9    FVDDYLEYSSTLPAELQRLLNTIRELDERSQGIINQTRQQTNYC-LGLASQNQGSRKYNY  67

Query  213  ASDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRR  386
              D +  K   +    Q +A+ +  EKV LA QA+D++D+HI++LD+ L  F E+L++
Sbjct  68   DDDEAFEKLRKEIEANQDNALSLCTEKVLLARQAHDIIDSHIKRLDEDLTNFAEDLKQ  125



>ref|XP_001496617.3| PREDICTED: inhibitor of growth protein 4 isoformX1 [Equus caballus]
 ref|XP_005873760.1| PREDICTED: inhibitor of growth protein 4 isoform X1 [Myotis brandtii]
 ref|XP_006084216.1| PREDICTED: LOW QUALITY PROTEIN: inhibitor of growth protein 4 
[Myotis lucifugus]
 ref|XP_006757646.1| PREDICTED: inhibitor of growth protein 4 isoform X1 [Myotis davidii]
 ref|XP_008512180.1| PREDICTED: inhibitor of growth protein 4 isoform X1 [Equus przewalskii]
 ref|XP_011364154.1| PREDICTED: inhibitor of growth protein 4 isoform X1 [Pteropus 
vampyrus]
 gb|ELK10395.1| Inhibitor of growth protein 4 [Pteropus alecto]
 gb|ELK34889.1| Inhibitor of growth protein 4 [Myotis davidii]
Length=249

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 70/116 (60%), Gaps = 11/116 (9%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  221
            +++ +  ++E LP  LQ+ + LMRDLD+  ++++ + D+   L  E M     + N++S+
Sbjct  6    YLEHYLDSIENLPFELQRNFQLMRDLDQRTEDLKAEIDK---LATEYMSS---ARNLSSE  59

Query  222  S--SLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELR  383
               +L+K   +A  + K      D+KV LA+Q Y++VD HI++LD  L +F+ +L+
Sbjct  60   EKLALLKQIQEAYGKCKE---FGDDKVQLAMQTYEMVDKHIRRLDTDLARFEADLK  112



>ref|XP_010672062.1| PREDICTED: PHD finger protein ING2 [Beta vulgaris subsp. vulgaris]
Length=263

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 36/117 (31%), Positives = 63/117 (54%), Gaps = 2/117 (2%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  221
            ++D++      LP  LQ+    +R+LD   Q +  Q  Q+ +L +    Q  K  +   D
Sbjct  9    YVDDYLEYASTLPAELQRLLNTIRELDERSQGMINQTRQQTKLCLGISSQSSKKWHNGED  68

Query  222  S--SLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRR  386
               ++ K + +    Q +A  +  EKV LA QAYDL+D+HI++LD+ L  F ++L++
Sbjct  69   DEVAIEKLTKEIESTQDNAFSLCTEKVLLARQAYDLIDSHIKRLDEDLNYFADDLKQ  125



>ref|XP_008143058.1| PREDICTED: inhibitor of growth protein 4 isoform X2 [Eptesicus 
fuscus]
Length=248

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 70/116 (60%), Gaps = 11/116 (9%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  221
            +++ +  ++E LP  LQ+ + LMRDLD+  ++++ + D+   L  E M     + N++S+
Sbjct  6    YLEHYLDSIENLPFELQRNFQLMRDLDQRTEDLKAEIDK---LATEYMSS---ARNLSSE  59

Query  222  S--SLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELR  383
               +L+K   +A  + K      D+KV LA+Q Y++VD HI++LD  L +F+ +L+
Sbjct  60   EKLALLKQIQEAYGKCKE---FGDDKVQLAMQTYEMVDKHIRRLDTDLARFEADLK  112



>ref|XP_008143057.1| PREDICTED: inhibitor of growth protein 4 isoform X1 [Eptesicus 
fuscus]
Length=249

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 70/116 (60%), Gaps = 11/116 (9%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  221
            +++ +  ++E LP  LQ+ + LMRDLD+  ++++ + D+   L  E M     + N++S+
Sbjct  6    YLEHYLDSIENLPFELQRNFQLMRDLDQRTEDLKAEIDK---LATEYMSS---ARNLSSE  59

Query  222  S--SLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELR  383
               +L+K   +A  + K      D+KV LA+Q Y++VD HI++LD  L +F+ +L+
Sbjct  60   EKLALLKQIQEAYGKCKE---FGDDKVQLAMQTYEMVDKHIRRLDTDLARFEADLK  112



>ref|XP_006267091.1| PREDICTED: d-2-hydroxyglutarate dehydrogenase, mitochondrial 
[Alligator mississippiensis]
Length=787

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 34/126 (27%), Positives = 67/126 (53%), Gaps = 7/126 (6%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  221
            +++ +  ++E LP  LQ+ + LMR+LD+  ++ + + D      +  +K  +    +   
Sbjct  6    YLEHYLDSIENLPCELQRNFQLMRELDQRTEDKKAEIDSLAAEYIASVKSMLPEQRVEH-  64

Query  222  SSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAERE  401
               IK   +A  + K     +D+KV LA+Q Y++VD HI++LD  L +F+ +L+   E  
Sbjct  65   ---IKKIQNAYSKCKE---YSDDKVQLAMQTYEMVDKHIRRLDADLARFEADLKDKLEAS  118

Query  402  NAVATG  419
            +  + G
Sbjct  119  DFESPG  124



>ref|XP_008681775.1| PREDICTED: inhibitor of growth protein 4 isoform X4 [Ursus maritimus]
Length=244

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 49/191 (26%), Positives = 91/191 (48%), Gaps = 25/191 (13%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  221
            +++ +  ++E LP  LQ+ + LMRDLD+  ++++ + D+   L  E M    +S +    
Sbjct  6    YLEHYLDSIENLPFELQRNFQLMRDLDQRTEDLKAEIDK---LATEYMSS-ARSLSSEEK  61

Query  222  SSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELR------  383
             +L+K   +A  + K      D+KV LA+Q Y++VD HI++LD  L +F+ +L+      
Sbjct  62   LALLKQIQEAYGKCKE---FGDDKVQLAMQTYEMVDKHIRRLDTDLARFEADLKEKQIES  118

Query  384  ----------RVAERENAVATGSTTSNVDNNVksgrsgdsskggrkkTRLAT-ATPAANP  530
                      R  + + A    S   N D      +          +  + + A  + +P
Sbjct  119  SDYDSSSSKGRTQKEKKAARARSKGKNSDEEAPKAQKKLKLVRTSPEYGMPSVAFGSVHP  178

Query  531  TGMDLDLPVDP  563
            + + LD+PVDP
Sbjct  179  SDV-LDMPVDP  188



>ref|XP_006258138.1| PREDICTED: inhibitor of growth protein 3 isoform X4 [Alligator 
mississippiensis]
Length=134

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 44/138 (32%), Positives = 68/138 (49%), Gaps = 14/138 (10%)
 Frame = +3

Query  36   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  215
            M +++++   +E LP  L+ ++  MR++D  +Q    Q +QR      + K+        
Sbjct  1    MLYLEDYLEMIEQLPMDLRDRFTEMREMDLQVQNAMDQLEQRVNEFFMNAKKNKPEWREE  60

Query  216  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELR----  383
              +S+ K    AL++       ADEKV LA Q YDLVD H+++LDQ L KF  EL     
Sbjct  61   QMTSIKKDYYKALED-------ADEKVQLANQIYDLVDRHLRKLDQELAKFKMELEADNA  113

Query  384  ---RVAERENAVATGSTT  428
                + ER N V    +T
Sbjct  114  GITEILERRNEVEVERST  131



>ref|XP_004596432.1| PREDICTED: inhibitor of growth protein 4 isoform X3 [Ochotona 
princeps]
Length=245

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 50/193 (26%), Positives = 91/193 (47%), Gaps = 26/193 (13%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  221
            +++ +  ++E LP  LQ+ + LMRDLD+  ++++ + D+   L  E M    +S +    
Sbjct  6    YLEHYLDSIENLPFELQRNFQLMRDLDQRTEDLKAEIDK---LATEYMSS-ARSLSPEEK  61

Query  222  SSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELR------  383
             +L+K   +A  + K      D+KV LA+Q Y++VD HI++LD  L +F+ +L+      
Sbjct  62   LALLKQIQEAYGKCKE---FGDDKVQLAMQTYEMVDKHIRRLDTDLARFEADLKEKQIES  118

Query  384  ----------RVAERENAVATGSTTSNVDNNVksgrsgdss--kggrkkTRLATATPAAN  527
                      R  + + A    S   N D              +   +    A A  + +
Sbjct  119  SDCDSSSSKGRTQKEKKAARARSKGKNSDEEAPKAAQKKLKLVRTSPEYGMPAVAFGSVH  178

Query  528  PTGMDLDLPVDPS  566
            P+ + LD+PVDP+
Sbjct  179  PSDV-LDMPVDPN  190



>ref|XP_005338394.1| PREDICTED: inhibitor of growth protein 4 isoform X5 [Ictidomys 
tridecemlineatus]
Length=243

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 50/197 (25%), Positives = 91/197 (46%), Gaps = 36/197 (18%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  221
            +++ +  ++E LP  LQ+ + LMRDLD+  ++++ + D+   L  E M     + N++S+
Sbjct  6    YLEHYLDSIENLPFELQRNFQLMRDLDQRTEDLKAEIDK---LATEYMSS---ARNLSSE  59

Query  222  S--SLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELR----  383
               +L++   +A  + K      D+KV LA+Q Y++VD HI++LD  L +F+ +L+    
Sbjct  60   EKLALLRQIQEAYGKCKE---FGDDKVQLAMQTYEMVDKHIRRLDTDLARFEADLKEKQI  116

Query  384  ----------------RVAERENAVATGSTTSNVDNNVksgrsgdsskggrkkTRLATAT  515
                            R  + + A    S   N D          S + G       +  
Sbjct  117  ESSDYDSSSSKGKKKGRTQKEKKAARARSKGKNSDEEAPKAAQKKSPEYGMPSVTFGSVH  176

Query  516  PAANPTGMDLDLPVDPS  566
            P+       LD+PVDP+
Sbjct  177  PSDV-----LDMPVDPN  188



>ref|XP_011144407.1| PREDICTED: inhibitor of growth protein 5 isoform X1 [Harpegnathos 
saltator]
Length=323

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 60/126 (48%), Gaps = 14/126 (11%)
 Frame = +3

Query  63   NLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASDSSLIKFS  242
             LE LP  LQ+ + LMRDLD   Q + +  D+      +D  + IK  +       I   
Sbjct  81   GLEHLPIELQRNFTLMRDLDARAQSLMKDIDKL----ADDYLRNIKKESPEKSKEQITHI  136

Query  243  DDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELR-------RVAERE  401
                ++ K      D+KV LAIQ Y+LVD HI++LD  L +F+ E++       R  E  
Sbjct  137  QSLFNKAK---EYGDDKVQLAIQTYELVDKHIRRLDSDLARFEAEIQDKALNSSRAQEEG  193

Query  402  NAVATG  419
            NA   G
Sbjct  194  NASKKG  199



>ref|XP_011144410.1| PREDICTED: inhibitor of growth protein 5 isoform X3 [Harpegnathos 
saltator]
Length=275

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 43/132 (33%), Positives = 62/132 (47%), Gaps = 14/132 (11%)
 Frame = +3

Query  45   IDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASDS  224
             D  +  LE LP  LQ+ + LMRDLD   Q + +  D+      +D  + IK  +     
Sbjct  27   FDSRKKGLEHLPIELQRNFTLMRDLDARAQSLMKDIDKL----ADDYLRNIKKESPEKSK  82

Query  225  SLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELR-------  383
              I       ++ K      D+KV LAIQ Y+LVD HI++LD  L +F+ E++       
Sbjct  83   EQITHIQSLFNKAK---EYGDDKVQLAIQTYELVDKHIRRLDSDLARFEAEIQDKALNSS  139

Query  384  RVAERENAVATG  419
            R  E  NA   G
Sbjct  140  RAQEEGNASKKG  151



>ref|XP_004493148.1| PREDICTED: PHD finger protein ING2-like [Cicer arietinum]
Length=261

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 68/137 (50%), Gaps = 14/137 (10%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSG-----  206
            ++D++      LP  LQ+ +  +R+LD   Q +  Q  Q+ +  +       K G     
Sbjct  9    YVDDYLEYANTLPAELQRLFNTVRELDERSQSMINQTRQQTKYCMGVSSHGSKKGNHNHN  68

Query  207  ------NIASDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKF  368
                  N   D+S+ K   +    Q  A+ +  EKV LA QAYDL+D+H+++LD+ L  F
Sbjct  69   YNNSYANEDDDASIEKLLKEIEANQDSALSLCTEKVLLARQAYDLIDSHVKRLDEDLNNF  128

Query  369  DEELR---RVAERENAV  410
             E+L+   ++ + E A+
Sbjct  129  AEDLKQEGKIPQDEPAI  145



>ref|XP_004557236.1| PREDICTED: inhibitor of growth protein 5-like [Maylandia zebra]
Length=240

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 35/118 (30%), Positives = 66/118 (56%), Gaps = 7/118 (6%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  221
            +++ +  ++E LP  LQ+ + LMRDLD   +E + + D+  +  + ++K      N+AS+
Sbjct  6    YLEHYLDSIENLPCELQRNFTLMRDLDNRTEEKKGEIDKLAEEYIANVK------NLASE  59

Query  222  SSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  395
               ++      +        +D+KV LA+Q Y++VD HI++LD  L +F+ EL+   E
Sbjct  60   QR-VEHLQKIQNAYSKCKEFSDDKVQLAMQTYEMVDKHIRRLDADLARFENELKEKLE  116



>ref|XP_003439967.1| PREDICTED: inhibitor of growth protein 5-like isoform 1 [Oreochromis 
niloticus]
 ref|XP_006790225.1| PREDICTED: inhibitor of growth protein 5-like [Neolamprologus 
brichardi]
Length=240

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 35/118 (30%), Positives = 66/118 (56%), Gaps = 7/118 (6%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  221
            +++ +  ++E LP  LQ+ + LMRDLD   +E + + D+  +  + ++K      N+AS+
Sbjct  6    YLEHYLDSIENLPCELQRNFTLMRDLDNRTEEKKGEIDKLAEEYIANVK------NLASE  59

Query  222  SSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  395
               ++      +        +D+KV LA+Q Y++VD HI++LD  L +F+ EL+   E
Sbjct  60   QR-VEHLQKIQNAYSKCKEFSDDKVQLAMQTYEMVDKHIRRLDADLARFENELKEKLE  116



>ref|XP_005732313.1| PREDICTED: inhibitor of growth protein 5-like [Pundamilia nyererei]
Length=240

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 35/118 (30%), Positives = 66/118 (56%), Gaps = 7/118 (6%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  221
            +++ +  ++E LP  LQ+ + LMRDLD   +E + + D+  +  + ++K      N+AS+
Sbjct  6    YLEHYLDSIENLPCELQRNFTLMRDLDNRTEEKKGEIDKLAEEYIANVK------NLASE  59

Query  222  SSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  395
               ++      +        +D+KV LA+Q Y++VD HI++LD  L +F+ EL+   E
Sbjct  60   QR-VEHLQKIQNAYSKCKEFSDDKVQLAMQTYEMVDKHIRRLDADLARFENELKEKLE  116



>ref|XP_011144409.1| PREDICTED: inhibitor of growth protein 5 isoform X2 [Harpegnathos 
saltator]
Length=277

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 60/126 (48%), Gaps = 14/126 (11%)
 Frame = +3

Query  63   NLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASDSSLIKFS  242
             LE LP  LQ+ + LMRDLD   Q + +  D+      +D  + IK  +       I   
Sbjct  35   GLEHLPIELQRNFTLMRDLDARAQSLMKDIDKL----ADDYLRNIKKESPEKSKEQITHI  90

Query  243  DDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELR-------RVAERE  401
                ++ K      D+KV LAIQ Y+LVD HI++LD  L +F+ E++       R  E  
Sbjct  91   QSLFNKAK---EYGDDKVQLAIQTYELVDKHIRRLDSDLARFEAEIQDKALNSSRAQEEG  147

Query  402  NAVATG  419
            NA   G
Sbjct  148  NASKKG  153



>ref|XP_007550686.1| PREDICTED: inhibitor of growth protein 5 [Poecilia formosa]
 ref|XP_008405626.1| PREDICTED: inhibitor of growth protein 5 [Poecilia reticulata]
Length=240

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 35/118 (30%), Positives = 66/118 (56%), Gaps = 7/118 (6%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  221
            +++ +  ++E LP  LQ+ + LMRDLD   +E + + D+  +  + ++K      N+AS+
Sbjct  6    YLEHYLDSIENLPCELQRNFTLMRDLDNRTEEKKGEIDKLAEEYIANVK------NLASE  59

Query  222  SSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  395
               ++      +        +D+KV LA+Q Y++VD HI++LD  L +F+ EL+   E
Sbjct  60   QR-VEHLQKIQNAYSKCKEFSDDKVQLAMQTYEMVDKHIRRLDADLARFENELKEKLE  116



>gb|KFK33297.1| hypothetical protein AALP_AA6G356700 [Arabis alpina]
Length=145

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 64/121 (53%), Gaps = 7/121 (6%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLD---RSLQEVQRQNDQRCQLEVEDMK---QRIKS  203
            ++D++       P  LQ+    +R+LD   +SL    RQ  + C L +   K       +
Sbjct  9    YVDDYLEYASTFPAELQRLLNTVRELDERSQSLINQTRQQTKYC-LGIASQKGNGNHYNN  67

Query  204  GNIASDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELR  383
            G    D ++ K   +    Q++A+ +  EKV LA QAYDL+D+H+++LD+ L  F E+L+
Sbjct  68   GCNDEDETIEKMRKEIESSQENALSLCTEKVLLARQAYDLIDSHVKRLDEDLNNFAEDLK  127

Query  384  R  386
            +
Sbjct  128  Q  128



>ref|XP_007234439.1| PREDICTED: inhibitor of growth protein 5-like isoform X1 [Astyanax 
mexicanus]
Length=247

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 47/178 (26%), Positives = 90/178 (51%), Gaps = 20/178 (11%)
 Frame = +3

Query  63   NLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASDSSL--IK  236
             +E LP  LQ+ + LM DLD       R   ++ +++    +   K  N++S+  +  +K
Sbjct  25   GIEGLPFELQRNFSLMTDLD------NRTELKKVEIDNLAAEYTAKVKNLSSEERMEHLK  78

Query  237  FSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAERENAVAT  416
              ++A D+ +     +D+KV LA+Q Y++VD HI++LD  L +F+ EL+   +     ++
Sbjct  79   RIENAYDQCRE---FSDDKVLLAMQIYEMVDKHIRRLDADLARFESELKDKLDSSGLESS  135

Query  417  GSTTSNVDNNVksg--------rsgdsskggrkkTRLATATPAANPTGMDLDLPVDPS  566
                S  D NV+          ++ +++       + + A  A  P+ + LD+PVDP+
Sbjct  136  DEKKSRKDKNVREKKRCSGRGQKTSNNNSPKHTAQKTSPALLAVQPSDV-LDMPVDPN  192



>emb|CBY31229.1| unnamed protein product [Oikopleura dioica]
 emb|CBY10278.1| unnamed protein product [Oikopleura dioica]
Length=218

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 42/143 (29%), Positives = 73/143 (51%), Gaps = 27/143 (19%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLD------RSLQEVQRQNDQRCQLEV--EDMKQRI  197
            ++++F  +L+ LP  L K +  MR++D      +SL E    +  R   E+   +MK+ +
Sbjct  7    YLEQFIESLDPLPGELSKSFKDMREMDEKVEQQKSLAEKMINDYNRTAHEMAESEMKEHV  66

Query  198  KSGNIASDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEE  377
            K    A  +               A ++ ++KV+LA Q Y++VD HI++LD  L +F+ E
Sbjct  67   KKIEAAWQT---------------ASKLQEDKVSLATQTYEMVDKHIRRLDSDLSRFESE  111

Query  378  LRRVAERENAVATGSTTSNVDNN  446
            L   AER   + +GS T++  N 
Sbjct  112  L---AER-GGLDSGSPTNDKKNG  130



>ref|NP_001007169.1| inhibitor of growth [Danio rerio]
 gb|AAH79501.1| Inhibitor of growth family, member 5b [Danio rerio]
Length=239

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 48/189 (25%), Positives = 95/189 (50%), Gaps = 24/189 (13%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  221
            +++ +  ++E LP  LQ+ + LM DLD+  +  + +  +     +E +K      N+AS+
Sbjct  6    YLEHYLDSIEGLPCELQRNFSLMEDLDKRTEAKKAEISELASEYIEKVK------NLASE  59

Query  222  SSL--IKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  395
              +  +K  D A ++ K     +D+KV LA+Q Y++VD HI++LD  L +F+ +L+   +
Sbjct  60   ERVQHLKKIDSAYNKCK---EFSDDKVQLAMQIYEMVDKHIRRLDAELARFENDLQEKLD  116

Query  396  RENAVATGSTTSNVDNNV------------ksgrsgdsskggrkkTRLATATPAANPTGM  539
              +  ++    S  D N+             S +     K  +    ++ +  A +P+ +
Sbjct  117  SGSQDSSDEKQSRKDKNMKDKRGSHARDKKTSDQDSPKQKKMKNGPNISESLLAMHPSDV  176

Query  540  DLDLPVDPS  566
             LD+PVDP+
Sbjct  177  -LDMPVDPN  184



>emb|CAD59105.1| novel protein similar to human candidate tumor suppressor p33 
ING1 (inhibitor of growth 1) [Danio rerio]
Length=239

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 49/189 (26%), Positives = 96/189 (51%), Gaps = 24/189 (13%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  221
            +++ +  ++E LP  LQ+ + LM DLD+  +  + +  +     +E +K      N+AS+
Sbjct  6    YLEHYLDSIEGLPCELQRNFSLMEDLDKRTEAKKAEISELASEYIEKVK------NLASE  59

Query  222  SSL--IKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  395
              +  +K  D A ++ K     +D+KV LA+Q Y++VD HI++LD  L +F+ +L+   +
Sbjct  60   ERVQHLKKIDSAYNKCK---EFSDDKVQLAMQIYEMVDKHIRRLDAELARFENDLQEKLD  116

Query  396  RENAVATGSTTSNVDNNVk------------sgrsgdsskggrkkTRLATATPAANPTGM  539
              +  ++    S  D N+K            S +     K  +    ++ +  A +P+ +
Sbjct  117  SGSQDSSDEKQSRKDKNMKDKRGSHARDKKASDQDSPKQKKMKNGPNISESLLAMHPSDV  176

Query  540  DLDLPVDPS  566
             LD+PVDP+
Sbjct  177  -LDMPVDPN  184



>ref|XP_008681774.1| PREDICTED: inhibitor of growth protein 4 isoform X3 [Ursus maritimus]
Length=245

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 49/192 (26%), Positives = 91/192 (47%), Gaps = 26/192 (14%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  221
            +++ +  ++E LP  LQ+ + LMRDLD+  ++++ + D+   L  E M    +S +    
Sbjct  6    YLEHYLDSIENLPFELQRNFQLMRDLDQRTEDLKAEIDK---LATEYMSS-ARSLSSEEK  61

Query  222  SSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELR------  383
             +L+K   +A  + K      D+KV LA+Q Y++VD HI++LD  L +F+ +L+      
Sbjct  62   LALLKQIQEAYGKCKE---FGDDKVQLAMQTYEMVDKHIRRLDTDLARFEADLKEKQIES  118

Query  384  -----------RVAERENAVATGSTTSNVDNNVksgrsgdsskggrkkTRLAT-ATPAAN  527
                       R  + + A    S   N D      +          +  + + A  + +
Sbjct  119  SDYDSSSSKEGRTQKEKKAARARSKGKNSDEEAPKAQKKLKLVRTSPEYGMPSVAFGSVH  178

Query  528  PTGMDLDLPVDP  563
            P+ + LD+PVDP
Sbjct  179  PSDV-LDMPVDP  189



>ref|XP_011494865.1| PREDICTED: inhibitor of growth protein 4 isoform X2 [Ceratosolen 
solmsi marchali]
Length=251

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 43/131 (33%), Positives = 62/131 (47%), Gaps = 23/131 (18%)
 Frame = +3

Query  63   NLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASDSSLIKFS  242
             LE LP  L++ + LMRDLD   Q + +  D+     +++MK               K S
Sbjct  10   GLEHLPTELRRNFNLMRDLDARAQVLMKDIDKLADDYLKNMK---------------KES  54

Query  243  DDALDEQ--------KHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAER  398
             D  +EQ          A    D+KV LAIQ Y+LVD HI++LD  L +F+ E++  A  
Sbjct  55   SDKKNEQLTRIQNLFNKAKEYGDDKVQLAIQTYELVDKHIRRLDSDLMRFEAEIQDKALS  114

Query  399  ENAVATGSTTS  431
             N     S +S
Sbjct  115  SNRTQEESVSS  125



>ref|XP_010729341.1| PREDICTED: inhibitor of growth protein 5 isoform X1 [Larimichthys 
crocea]
 ref|XP_010729342.1| PREDICTED: inhibitor of growth protein 5 isoform X2 [Larimichthys 
crocea]
Length=241

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 68/116 (59%), Gaps = 11/116 (9%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  221
            +++ +  ++E LP  LQ+ + LMRDLD   +E + + D+  +  +  +K      N+AS+
Sbjct  6    YLEHYLDSIENLPCELQRNFTLMRDLDNRTEEKKGEIDKLAEEYIATVK------NLASE  59

Query  222  SSL--IKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELR  383
              +  ++   +A  + K     +D+KV LA+Q Y++VD HI++LD  L +F+ EL+
Sbjct  60   QRVEHLQKIQNAYSKCKE---FSDDKVQLAMQTYEMVDKHIRRLDADLARFENELK  112



>ref|XP_005815652.1| PREDICTED: inhibitor of growth protein 5-like [Xiphophorus maculatus]
Length=240

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 67/119 (56%), Gaps = 7/119 (6%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  221
            +++ +  ++E LP  LQ+ + LMRDLD   +E + + D+  +  + ++K      N+AS 
Sbjct  6    YLEHYLDSIENLPCELQRNFTLMRDLDNRTEEKKGEIDKLAEEYIANVK------NLAS-  58

Query  222  SSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAER  398
            +  ++      +        +D+KV LA+Q Y++VD HI++LD  L +F+ EL+   E+
Sbjct  59   AQRVEHLQKIQNAYSKCKEFSDDKVQLAMQTYEMVDKHIRRLDADLARFENELKEKLEQ  117



>ref|XP_001745679.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ89650.1| predicted protein [Monosiga brevicollis MX1]
Length=191

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 40/135 (30%), Positives = 65/135 (48%), Gaps = 8/135 (6%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  221
             + +F   +  LP  L +KY  +R LD+ +Q +  + DQ C   ++D+ +      +   
Sbjct  5    LLSQFLERVGELPGELDRKYSDLRTLDQDVQSLLVEIDQGCNQLLQDLGKVTGPERMRRL  64

Query  222  SSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAERE  401
              L    +DALD       ++D K+ALA+ +Y+ VD HI+ LD  L K D   + + E  
Sbjct  65   RHLRSQFEDALD-------MSDRKIALAVDSYETVDKHIRDLDGDLSKMDAN-QALTEGA  116

Query  402  NAVATGSTTSNVDNN  446
             AVA       +D N
Sbjct  117  QAVAQKKEEMAIDPN  131



>ref|XP_008143063.1| PREDICTED: inhibitor of growth protein 4 isoform X7 [Eptesicus 
fuscus]
Length=179

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 67/116 (58%), Gaps = 11/116 (9%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  221
            +++ +  ++E LP  LQ+ + LMRDLD      QR  D + +++    +    + N++S+
Sbjct  6    YLEHYLDSIENLPFELQRNFQLMRDLD------QRTEDLKAEIDKLATEYMSSARNLSSE  59

Query  222  S--SLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELR  383
               +L+K   +A  + K      D+KV LA+Q Y++VD HI++LD  L +F+ +L+
Sbjct  60   EKLALLKQIQEAYGKCKE---FGDDKVQLAMQTYEMVDKHIRRLDTDLARFEADLK  112



>ref|XP_005610930.1| PREDICTED: inhibitor of growth protein 4 isoform X8 [Equus caballus]
Length=179

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 70/116 (60%), Gaps = 11/116 (9%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  221
            +++ +  ++E LP  LQ+ + LMRDLD+  ++++ + D+   L  E M     + N++S+
Sbjct  6    YLEHYLDSIENLPFELQRNFQLMRDLDQRTEDLKAEIDK---LATEYMSS---ARNLSSE  59

Query  222  S--SLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELR  383
               +L+K   +A  + K      D+KV LA+Q Y++VD HI++LD  L +F+ +L+
Sbjct  60   EKLALLKQIQEAYGKCKE---FGDDKVQLAMQTYEMVDKHIRRLDTDLARFEADLK  112



>ref|XP_004596433.1| PREDICTED: inhibitor of growth protein 4 isoform X4 [Ochotona 
princeps]
Length=242

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 51/194 (26%), Positives = 90/194 (46%), Gaps = 31/194 (16%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  221
            +++ +  ++E LP  LQ+ + LMRDLD+  ++++ + D+   L  E M    +S +    
Sbjct  6    YLEHYLDSIENLPFELQRNFQLMRDLDQRTEDLKAEIDK---LATEYMSS-ARSLSPEEK  61

Query  222  SSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELR------  383
             +L+K   +A  + K      D+KV LA+Q Y++VD HI++LD  L +F+ +L+      
Sbjct  62   LALLKQIQEAYGKCKE---FGDDKVQLAMQTYEMVDKHIRRLDTDLARFEADLKEKQIES  118

Query  384  -------------RVAERENAVATGSTTSNVDNNVksgrsgdsskggrkkTRLATATPAA  524
                         R  + + A    S   N D              G      A A  + 
Sbjct  119  SDCDSSSSKGKKSRTQKEKKAARARSKGKNSDEEAPKAAQKKLKLYGMP----AVAFGSV  174

Query  525  NPTGMDLDLPVDPS  566
            +P+ + LD+PVDP+
Sbjct  175  HPSDV-LDMPVDPN  187



>ref|XP_009531554.1| hypothetical protein PHYSODRAFT_511954 [Phytophthora sojae]
 gb|EGZ14125.1| hypothetical protein PHYSODRAFT_511954 [Phytophthora sojae]
Length=285

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 42/138 (30%), Positives = 78/138 (57%), Gaps = 26/138 (19%)
 Frame = +3

Query  39   SFIDEFETNLEVLPNILQKKYGLMRDLDRS-------LQEVQ-------RQND-QRC--Q  167
            ++++++  ++ +LP+ L++ + LMR+LD+S       L+E Q       RQ   +RC   
Sbjct  3    TYVEDYLESMYLLPSELKRNFDLMRELDKSSYPLLDELKESQKAYLTGARQKVLERCADS  62

Query  168  LEVEDMKQRIKSGNIASDSSLIKFSDDALDEQKHAIRIA--DEKVALAIQAYDLVDTHIQ  341
             + E  +Q ++   I +D  + K       ++KHA+ +   DEKVA+A Q+YD+VD HI+
Sbjct  63   TKGEPTEQELRE-LIGADDEIAKL------QEKHALVVQKLDEKVAIAAQSYDIVDHHIR  115

Query  342  QLDQYLKKFDEELRRVAE  395
            +LD+ L+ +   L+   E
Sbjct  116  RLDRDLENYASLLKNSGE  133



>gb|KIZ07723.1| Inhibitor of growth protein 3 [Monoraphidium neglectum]
Length=230

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 63/118 (53%), Gaps = 12/118 (10%)
 Frame = +3

Query  39   SFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQ----LEVEDMKQRIKSG  206
            S++ ++   +  +P  LQ+ + L+RDLD  +  +Q   + +C+        + KQR K+ 
Sbjct  3    SYLKKYVDRVHDVPPQLQRLFKLIRDLDERVAALQAAVEDKCRDSLAGSAPNKKQRTKAE  62

Query  207  NIASDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEEL  380
                D       +   D QK  + +++EKV +A Q YD VD HI+QLD+ L+ FD +L
Sbjct  63   AAQRD-------EINADMQK-ILSLSEEKVRIAAQCYDFVDGHIRQLDEDLRAFDGDL  112



>ref|XP_007903167.1| PREDICTED: inhibitor of growth protein 3 isoform X1 [Callorhinchus 
milii]
Length=413

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 64/119 (54%), Gaps = 15/119 (13%)
 Frame = +3

Query  36   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  215
            M +++++   +E LP  L+ ++  MR++D  +Q    Q           ++QR+    + 
Sbjct  1    MLYLEDYLEMIEQLPMDLRDRFTEMREMDLQVQNAMDQ-----------LEQRVNEFFVN  49

Query  216  SDSSLIKFSDDALDEQKH----AIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEEL  380
            +  +  ++ D+ ++  K     A+  ADEKV LA Q YDLVD H+++LDQ L KF  EL
Sbjct  50   AKKNKPEWRDEQMEAIKKDYYKALEDADEKVQLANQIYDLVDRHLRKLDQELAKFKMEL  108



>ref|XP_004915827.1| PREDICTED: inhibitor of growth protein 4 isoform X5 [Xenopus 
(Silurana) tropicalis]
Length=270

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 55/196 (28%), Positives = 92/196 (47%), Gaps = 32/196 (16%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQ---LEVEDMKQRIKSGNI  212
            +++ +  ++E LP  LQ+ + LMRDLD      QR  D +C    L  + M    +S N 
Sbjct  31   YLEHYLDSIENLPFELQRNFQLMRDLD------QRTEDLKCHIDRLSCQYMSN-ARSMNS  83

Query  213  ASDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRR--  386
                 L++   +A  + K      D+KV LA+Q Y++VD HI++LD  L +F+ +L+   
Sbjct  84   EEKLQLLRQVQEAYGKCK---EYGDDKVQLAMQTYEMVDKHIRRLDTDLARFEADLKEKH  140

Query  387  --------VAERENAVATGSTTSNVDNNVksgrsgdsskggrkkTRLATA---TPAAN--  527
                     + +E         + V + VK+     +    +K   + TA    PA N  
Sbjct  141  IESSDYDSCSSKEGRGQKEKKAAKVRSKVKNSDDEAAKNTQKKIKLVQTAEYGAPAGNFG  200

Query  528  ---PTGMDLDLPVDPS  566
               P+ + LD+PVDP+
Sbjct  201  KVHPSDV-LDMPVDPN  215



>ref|XP_008441974.1| PREDICTED: PHD finger protein ING2 [Cucumis melo]
Length=263

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 70/131 (53%), Gaps = 8/131 (6%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLD---RSLQEVQRQNDQRC-QLEVEDMKQRIK-SG  206
            ++D++      LP  LQ+    +R+LD   +S+ +  RQ  + C  L  +  K+    S 
Sbjct  9    YVDDYLEYASTLPAELQRLLNTIRELDDRSQSMIDQTRQQTKYCLGLSTQSSKKGYGNSN  68

Query  207  NIASDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELR-  383
            N   +S+  K   D    Q +A+ +  EKV LA QA DL+D+HI++LD+ L  F E+L+ 
Sbjct  69   NEDEESAFEKLRKDIEANQDNALSLCTEKVLLARQAGDLIDSHIKRLDEDLNNFAEDLKQ  128

Query  384  --RVAERENAV  410
              +++  E A+
Sbjct  129  EGKISPDEPAI  139



>ref|XP_008209258.1| PREDICTED: inhibitor of growth protein 4 isoform X2 [Nasonia 
vitripennis]
Length=249

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 37/110 (34%), Positives = 58/110 (53%), Gaps = 7/110 (6%)
 Frame = +3

Query  54   FETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASDSSLI  233
            +++ LE LP  L++ + LMRDLD   Q + +  D+   L  E +K   K      +  L 
Sbjct  5    YDSGLEHLPTELRRNFNLMRDLDTRAQLLMKDIDK---LADEYLKNMKKEATEQKNEKLT  61

Query  234  KFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELR  383
            +  +        A    D+KV LAIQ Y+LVD HI++LD  L +F+ E++
Sbjct  62   RIQNLF----NKAKEYGDDKVQLAIQTYELVDKHIRRLDSDLMRFEAEIQ  107



>ref|XP_002163181.2| PREDICTED: inhibitor of growth protein 4-like, partial [Hydra 
vulgaris]
Length=204

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 50/180 (28%), Positives = 85/180 (47%), Gaps = 19/180 (11%)
 Frame = +3

Query  63   NLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASDSSLIKFS  242
             +E LP  LQ+ + L +DLD+   ++    D+ C    E+   ++K    A         
Sbjct  2    GIEGLPYDLQRNFSLQKDLDQRAHDLLDDIDKLC----EEYISKVKDLPAAERKDFFSKI  57

Query  243  DDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAERENAVATGS  422
            + A  + +      D+KV LA+Q Y++VD HI++LD  L +F+EEL+   +++       
Sbjct  58   EKAFQKSRE---YGDDKVQLAVQTYEMVDKHIRRLDSDLSRFEEELKSQRQQQQEQQQQQ  114

Query  423  TTSNVDN---------NVksgrsgdsskggrkkTRLAT-ATPAAN-PTGMD-LDLPVDPS  566
            +    DN         ++K  +     +    K+ L T ATP     T M+ LD+PVDP+
Sbjct  115  SGEETDNRKRKLEKNESLKKKKIKKDEQIEIPKSNLVTSATPLITMATDMNVLDMPVDPN  174



>gb|KDP42993.1| hypothetical protein JCGZ_25179 [Jatropha curcas]
Length=267

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 64/122 (52%), Gaps = 8/122 (7%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGN-IAS  218
            ++D++      LP  LQ+    +++LD     +  Q  Q+ +  +    Q  K GN IA 
Sbjct  9    YVDDYLEYASTLPAELQRLLNTIKELDERSHSILNQTRQQTKYCLGLASQSSKRGNGIAF  68

Query  219  DSS-------LIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEE  377
            ++S       + +   D    Q +A+ +  EKV LA QAYDL+D+HI++LD+ L  F E+
Sbjct  69   NNSNSEEDDVVERMRKDIEANQDNALSLCTEKVLLARQAYDLIDSHIKRLDEDLNNFAED  128

Query  378  LR  383
            L+
Sbjct  129  LK  130



>ref|XP_005923335.1| PREDICTED: inhibitor of growth protein 5-like [Haplochromis burtoni]
Length=212

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 70/122 (57%), Gaps = 15/122 (12%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  221
            +++ +  ++E LP  LQ+ + LMRDLD   +E + + D+  +  + ++K      N+AS+
Sbjct  6    YLEHYLDSIENLPCELQRNFTLMRDLDNRTEEKKGEIDKLAEEYIANVK------NLASE  59

Query  222  SSLIKFSDDALDEQKHAI----RIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRV  389
              +     + L + ++A       +D+KV LA+Q Y++VD HI++LD  L +F+ EL+  
Sbjct  60   QRV-----EHLQKIQNAYSKCKEFSDDKVQLAMQTYEMVDKHIRRLDADLARFENELKEK  114

Query  390  AE  395
             E
Sbjct  115  LE  116



>ref|XP_011364157.1| PREDICTED: inhibitor of growth protein 4 isoform X4 [Pteropus 
vampyrus]
Length=219

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 70/116 (60%), Gaps = 11/116 (9%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  221
            +++ +  ++E LP  LQ+ + LMRDLD+  ++++ + D+   L  E M     + N++S+
Sbjct  6    YLEHYLDSIENLPFELQRNFQLMRDLDQRTEDLKAEIDK---LATEYMSS---ARNLSSE  59

Query  222  S--SLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELR  383
               +L+K   +A  + K      D+KV LA+Q Y++VD HI++LD  L +F+ +L+
Sbjct  60   EKLALLKQIQEAYGKCKE---FGDDKVQLAMQTYEMVDKHIRRLDTDLARFEADLK  112



>ref|XP_001602605.2| PREDICTED: inhibitor of growth protein 5 isoform X1 [Nasonia 
vitripennis]
Length=254

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 60/114 (53%), Gaps = 7/114 (6%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  221
            +++ +  +LE LP  L++ + LMRDLD   Q + +  D+   L  E +K   K      +
Sbjct  6    YLEHYLDSLEHLPTELRRNFNLMRDLDTRAQLLMKDIDK---LADEYLKNMKKEATEQKN  62

Query  222  SSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELR  383
              L +  +        A    D+KV LAIQ Y+LVD HI++LD  L +F+ E++
Sbjct  63   EKLTRIQNLF----NKAKEYGDDKVQLAIQTYELVDKHIRRLDSDLMRFEAEIQ  112



>ref|XP_005338393.1| PREDICTED: inhibitor of growth protein 4 isoform X4 [Ictidomys 
tridecemlineatus]
 ref|XP_006862715.1| PREDICTED: inhibitor of growth protein 4 isoform X4 [Chrysochloris 
asiatica]
Length=245

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 70/116 (60%), Gaps = 11/116 (9%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  221
            +++ +  ++E LP  LQ+ + LMRDLD+  ++++ + D+   L  E M     + N++S+
Sbjct  6    YLEHYLDSIENLPFELQRNFQLMRDLDQRTEDLKAEIDK---LATEYMSS---ARNLSSE  59

Query  222  S--SLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELR  383
               +L++   +A  + K      D+KV LA+Q Y++VD HI++LD  L +F+ +L+
Sbjct  60   EKLALLRQIQEAYGKCKE---FGDDKVQLAMQTYEMVDKHIRRLDTDLARFEADLK  112



>ref|XP_005338395.1| PREDICTED: inhibitor of growth protein 4 isoform X6 [Ictidomys 
tridecemlineatus]
Length=243

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 49/197 (25%), Positives = 89/197 (45%), Gaps = 36/197 (18%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  221
            +++ +  ++E LP  LQ+ + LMRDLD+  ++++ + D+   L  E M     + N++S+
Sbjct  6    YLEHYLDSIENLPFELQRNFQLMRDLDQRTEDLKAEIDK---LATEYMSS---ARNLSSE  59

Query  222  S--SLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELR----  383
               +L++   +A  + K      D+KV LA+Q Y++VD HI++LD  L +F+ +L+    
Sbjct  60   EKLALLRQIQEAYGKCKE---FGDDKVQLAMQTYEMVDKHIRRLDTDLARFEADLKEKQI  116

Query  384  ----------------RVAERENAVATGSTTSNVDNNVksgrsgdsskggrkkTRLATAT  515
                            R  + + A    S   N D              G       +  
Sbjct  117  ESSDYDSSSSKGKKKGRTQKEKKAARARSKGKNSDEEAPKAAQKKLKLYGMPSVTFGSVH  176

Query  516  PAANPTGMDLDLPVDPS  566
            P+       LD+PVDP+
Sbjct  177  PSDV-----LDMPVDPN  188



>ref|XP_008071440.1| PREDICTED: inhibitor of growth protein 4 [Tarsius syrichta]
Length=166

 Score = 51.6 bits (122),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 70/116 (60%), Gaps = 11/116 (9%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  221
            +++ +  ++E LP  LQ+ + LMRDLD+  ++++ + D+   L  E M     + N++S+
Sbjct  6    YLEHYLDSIENLPFELQRNFQLMRDLDQRTEDLKAEIDK---LATEYMSS---ARNLSSE  59

Query  222  S--SLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELR  383
               +L+K   +A  + K      D+KV LA+Q Y++VD HI++LD  L +F+ +L+
Sbjct  60   EKLALLKQIQEAYGKCKE---FGDDKVQLAMQTYEMVDKHIRRLDTDLARFEADLK  112



>ref|XP_011144412.1| PREDICTED: inhibitor of growth protein 4 isoform X5 [Harpegnathos 
saltator]
Length=244

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 60/126 (48%), Gaps = 14/126 (11%)
 Frame = +3

Query  63   NLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASDSSLIKFS  242
             LE LP  LQ+ + LMRDLD   Q + +  D+      +D  + IK  +       I   
Sbjct  81   GLEHLPIELQRNFTLMRDLDARAQSLMKDIDKLA----DDYLRNIKKESPEKSKEQITHI  136

Query  243  DDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELR-------RVAERE  401
                ++ K      D+KV LAIQ Y+LVD HI++LD  L +F+ E++       R  E  
Sbjct  137  QSLFNKAK---EYGDDKVQLAIQTYELVDKHIRRLDSDLARFEAEIQDKALNSSRAQEEG  193

Query  402  NAVATG  419
            NA   G
Sbjct  194  NASKKG  199



>ref|XP_010293971.1| PREDICTED: inhibitor of growth protein 4 isoform X1 [Phaethon 
lepturus]
Length=244

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 63/112 (56%), Gaps = 11/112 (10%)
 Frame = +3

Query  54   FETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASDS--S  227
            F   +E LP  LQ+ + LMRDLD+  ++++ + D+     + + +       ++SD    
Sbjct  5    FPAGIENLPFELQRNFQLMRDLDQRTEDLKSEIDKLATEYISNAR------TLSSDEKLG  58

Query  228  LIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELR  383
            L+K   +A  + K      D+KV LA+Q Y++VD HI++LD  L +F+ +L+
Sbjct  59   LLKQIQEAYGKCKE---FGDDKVQLAMQTYEMVDKHIRRLDTDLARFEADLK  107



>ref|XP_008939061.1| PREDICTED: inhibitor of growth protein 4 [Merops nubicus]
Length=244

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 63/112 (56%), Gaps = 11/112 (10%)
 Frame = +3

Query  54   FETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASDS--S  227
            F   +E LP  LQ+ + LMRDLD+  ++++ + D+     + + +       ++S+    
Sbjct  5    FPAGIENLPFELQRNFQLMRDLDQRTEDLKSEIDKLATEYISNAR------TLSSEEKLG  58

Query  228  LIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELR  383
            L+K   DA  + K      D+KV LA+Q Y++VD HI++LD  L +F+ +L+
Sbjct  59   LLKQIQDAYGKCKE---FGDDKVQLAMQTYEMVDKHIRRLDTDLARFEADLK  107



>ref|XP_005338391.1| PREDICTED: inhibitor of growth protein 4 isoform X2 [Ictidomys 
tridecemlineatus]
 ref|XP_006862713.1| PREDICTED: inhibitor of growth protein 4 isoform X2 [Chrysochloris 
asiatica]
Length=248

 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 70/116 (60%), Gaps = 11/116 (9%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  221
            +++ +  ++E LP  LQ+ + LMRDLD+  ++++ + D+   L  E M     + N++S+
Sbjct  6    YLEHYLDSIENLPFELQRNFQLMRDLDQRTEDLKAEIDK---LATEYMSS---ARNLSSE  59

Query  222  S--SLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELR  383
               +L++   +A  + K      D+KV LA+Q Y++VD HI++LD  L +F+ +L+
Sbjct  60   EKLALLRQIQEAYGKCKE---FGDDKVQLAMQTYEMVDKHIRRLDTDLARFEADLK  112



>ref|XP_005338390.1| PREDICTED: inhibitor of growth protein 4 isoform X1 [Ictidomys 
tridecemlineatus]
 ref|XP_006862712.1| PREDICTED: inhibitor of growth protein 4 isoform X1 [Chrysochloris 
asiatica]
Length=249

 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 70/116 (60%), Gaps = 11/116 (9%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  221
            +++ +  ++E LP  LQ+ + LMRDLD+  ++++ + D+   L  E M     + N++S+
Sbjct  6    YLEHYLDSIENLPFELQRNFQLMRDLDQRTEDLKAEIDK---LATEYMSS---ARNLSSE  59

Query  222  S--SLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELR  383
               +L++   +A  + K      D+KV LA+Q Y++VD HI++LD  L +F+ +L+
Sbjct  60   EKLALLRQIQEAYGKCKE---FGDDKVQLAMQTYEMVDKHIRRLDTDLARFEADLK  112



>ref|XP_011309401.1| PREDICTED: inhibitor of growth protein 5 [Fopius arisanus]
Length=256

 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 42/133 (32%), Positives = 67/133 (50%), Gaps = 13/133 (10%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  221
            +++ +  +LE LP  LQ+ + LMRDLD   Q + +  D+     ++++K+          
Sbjct  6    YLEHYLDSLEHLPIELQRNFTLMRDLDARAQGLMKDIDKLADDYLKNLKKE---------  56

Query  222  SSLIKFSDDALDEQK---HAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVA  392
             S  K  +  +  Q     A    D+KV LAIQ Y+LVD HI++LD  L +F+ E++  A
Sbjct  57   -SPEKRKEQLMHIQSLFNKAKEYGDDKVQLAIQTYELVDKHIRRLDSDLARFEAEIQDKA  115

Query  393  ERENAVATGSTTS  431
               N V   S  S
Sbjct  116  LSSNRVQEESGAS  128



>ref|XP_010112433.1| PHD finger protein ING2 [Morus notabilis]
 gb|EXC33620.1| PHD finger protein ING2 [Morus notabilis]
Length=275

 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 39/134 (29%), Positives = 71/134 (53%), Gaps = 15/134 (11%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  221
            F+D++      LP  LQ+    +R+LD   Q +  Q   + +  +   K+    GN+ + 
Sbjct  9    FVDDYLEYASTLPAELQRLLNTIRELDDRSQSMINQTRHQTKYCLGLSKK----GNVNNY  64

Query  222  SSLIKFSDDALDE--------QKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEE  377
             +  +  + A+D+        Q +A+ +  EKV LA QAYDL+D+HI++LD+ L  F E+
Sbjct  65   YNNNEEEESAIDKMRKEIEANQDNALNLCTEKVLLAQQAYDLIDSHIKRLDEDLTHFAED  124

Query  378  LR---RVAERENAV  410
            L+   +++  E A+
Sbjct  125  LKQEGKISPDEPAI  138



>ref|XP_005798822.1| PREDICTED: inhibitor of growth protein 4-like isoform X2 [Xiphophorus 
maculatus]
Length=248

 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 53/197 (27%), Positives = 94/197 (48%), Gaps = 33/197 (17%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  221
            +++ +  ++E LP  LQ+ + LMRDLD      QR  D + Q++    +    +  ++SD
Sbjct  6    YLEHYLDSIENLPFELQRNFNLMRDLD------QRTEDLKGQIDSLAKEYTSNARTLSSD  59

Query  222  S--SLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELR----  383
               SL++    +  + K      D+KV LA+Q Y++VD HI++LD  L +F+ +L+    
Sbjct  60   QKLSLLRQIQQSYSKCKE---FGDDKVQLAMQTYEMVDKHIRRLDTDLARFEADLKEKQI  116

Query  384  ------------RVAERENAVATGSTTSNVDNNVksgrsgdsskggrkkTRLATATPAAN  527
                        +   R+    T  T S V ++ + G    + K  +   +     PA+N
Sbjct  117  ESTDYDSTSSKGKKDTRQKEKKTAKTRSKVKSSDEDGSPKSAQKKVKLFQQGEFNAPASN  176

Query  528  -----PTGMDLDLPVDP  563
                 P+ + LD+PVDP
Sbjct  177  FGNVHPSDV-LDMPVDP  192



>ref|XP_004610513.1| PREDICTED: inhibitor of growth protein 4 isoform X3 [Sorex araneus]
Length=242

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 49/193 (25%), Positives = 85/193 (44%), Gaps = 31/193 (16%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  221
            +++ +  ++E LP  LQ+ + LMRDLD+  ++++ + D+   L  E M    +S +    
Sbjct  6    YLEHYLDSIENLPFELQRNFQLMRDLDQRTEDLKAEIDK---LATEYMSS-ARSLSSEEK  61

Query  222  SSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELR------  383
             +L+K   +A  + K      D+KV LA+Q Y++VD HI++LD  L +F+ +L+      
Sbjct  62   LALLKQIQEAYGKCKE---FGDDKVQLAMQTYEMVDKHIRRLDTDLARFEADLKEKQIES  118

Query  384  -------------RVAERENAVATGSTTSNVDNNVksgrsgdsskggrkkTRLATATPAA  524
                         R  + + A    S   N D              G       +  P+ 
Sbjct  119  SDYDSSSSKGKKSRTQKEKKAARARSKGKNSDEEAPKATQKKLKLYGMPSVTFGSVHPSD  178

Query  525  NPTGMDLDLPVDP  563
                  LD+PVDP
Sbjct  179  V-----LDMPVDP  186



>ref|XP_005338392.1| PREDICTED: inhibitor of growth protein 4 isoform X3 [Ictidomys 
tridecemlineatus]
 ref|XP_006862714.1| PREDICTED: inhibitor of growth protein 4 isoform X3 [Chrysochloris 
asiatica]
Length=246

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 70/116 (60%), Gaps = 11/116 (9%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  221
            +++ +  ++E LP  LQ+ + LMRDLD+  ++++ + D+   L  E M     + N++S+
Sbjct  6    YLEHYLDSIENLPFELQRNFQLMRDLDQRTEDLKAEIDK---LATEYMSS---ARNLSSE  59

Query  222  S--SLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELR  383
               +L++   +A  + K      D+KV LA+Q Y++VD HI++LD  L +F+ +L+
Sbjct  60   EKLALLRQIQEAYGKCKE---FGDDKVQLAMQTYEMVDKHIRRLDTDLARFEADLK  112



>ref|XP_010134965.1| PREDICTED: inhibitor of growth protein 4 [Buceros rhinoceros 
silvestris]
Length=244

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 63/112 (56%), Gaps = 11/112 (10%)
 Frame = +3

Query  54   FETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASDS--S  227
            F   +E LP  LQ+ + LMRDLD+  ++++ + D+     + + +       ++S+    
Sbjct  5    FPAGIENLPFELQRNFQLMRDLDQRTEDLKSEIDKLATEYISNAR------TLSSEEKLG  58

Query  228  LIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELR  383
            L+K   DA  + K      D+KV LA+Q Y++VD HI++LD  L +F+ +L+
Sbjct  59   LLKQIQDAYGKCKE---FGDDKVQLAMQTYEMVDKHIRRLDTDLARFEADLK  107



>emb|CDQ71398.1| unnamed protein product [Oncorhynchus mykiss]
Length=241

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 34/118 (29%), Positives = 65/118 (55%), Gaps = 7/118 (6%)
 Frame = +3

Query  42   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  221
            +++ +  ++E LP  LQ+ + LMRDLD   +E + + D+  +  +  ++      N+A++
Sbjct  6    YLEHYLDSIENLPCELQRNFSLMRDLDNRTEEKKGEIDKLAEEYISSVR------NLATE  59

Query  222  SSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  395
              ++          K     +D+KV LA+Q Y++VD HI++LD  L +F+ EL+   E
Sbjct  60   QRVVHLQKIQSAYCK-CKEFSDDKVQLAMQTYEMVDKHIRRLDADLARFENELKEKLE  116



>emb|CCD78730.1| putative inhibitor of growth family, member 5 [Schistosoma mansoni]
Length=217

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 36/118 (31%), Positives = 64/118 (54%), Gaps = 13/118 (11%)
 Frame = +3

Query  36   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVE---DMKQRIKSG  206
            M ++ ++  +LE LP  L++++ +MRDLD+ +Q++ RQ  QR     E   +M +  +  
Sbjct  1    MEYLQKYMEDLEHLPPHLRQEFEIMRDLDQKVQDIIRQTQQRTTYLYEHAYEMSKEERKA  60

Query  207  NIASDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEEL  380
             I    SL K   +          I+++KV+ A  AY+LVD  I++LD  + +F + L
Sbjct  61   QIEQIQSLFKKGKE----------ISNDKVSRAESAYELVDKQIRRLDADMFEFKKAL  108



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1023687230320