BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002E08

Length=600
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_002268645.1|  PREDICTED: 60S acidic ribosomal protein P0         192   8e-62   Vitis vinifera
emb|CAN80537.1|  hypothetical protein VITISV_003812                     189   7e-61   Vitis vinifera
ref|XP_002276842.1|  PREDICTED: 60S acidic ribosomal protein P0         189   7e-61   Vitis vinifera
ref|XP_007009051.1|  Ribosomal protein L10 family protein isoform 1     188   1e-60   
ref|XP_010247657.1|  PREDICTED: 60S acidic ribosomal protein P0-like    186   5e-60   Nelumbo nucifera [Indian lotus]
gb|KHG25462.1|  60S acidic ribosomal P0                                 186   8e-60   Gossypium arboreum [tree cotton]
gb|KJB78787.1|  hypothetical protein B456_013G019000                    185   1e-59   Gossypium raimondii
gb|KHG08087.1|  60S acidic ribosomal P0                                 185   1e-59   Gossypium arboreum [tree cotton]
ref|XP_011076719.1|  PREDICTED: 60S acidic ribosomal protein P0         185   1e-59   Sesamum indicum [beniseed]
gb|KDP44812.1|  hypothetical protein JCGZ_01312                         184   1e-59   Jatropha curcas
gb|EPS69246.1|  p0 ribosomal protein-like protein                       187   2e-59   Genlisea aurea
gb|KHG25720.1|  60S acidic ribosomal P0                                 184   2e-59   Gossypium arboreum [tree cotton]
gb|KJB76159.1|  hypothetical protein B456_012G076000                    184   2e-59   Gossypium raimondii
ref|XP_010256605.1|  PREDICTED: 60S acidic ribosomal protein P0         186   2e-59   Nelumbo nucifera [Indian lotus]
ref|XP_007009052.1|  Ribosomal protein L10 family protein isoform 2     183   3e-59   
gb|KJB74260.1|  hypothetical protein B456_011G283700                    182   6e-59   Gossypium raimondii
ref|XP_006435697.1|  hypothetical protein CICLE_v10032141mg             184   6e-59   Citrus clementina [clementine]
gb|KDO69054.1|  hypothetical protein CISIN_1g020952mg                   184   7e-59   Citrus sinensis [apfelsine]
gb|KJB74261.1|  hypothetical protein B456_011G283700                    182   8e-59   Gossypium raimondii
ref|XP_004149240.1|  PREDICTED: 60S acidic ribosomal protein P0-like    182   9e-59   Cucumis sativus [cucumbers]
ref|XP_006848156.1|  hypothetical protein AMTR_s00029p00231170          182   1e-58   Amborella trichopoda
ref|XP_004165071.1|  PREDICTED: 60S acidic ribosomal protein P0-like    182   1e-58   
gb|KDO69055.1|  hypothetical protein CISIN_1g020952mg                   183   1e-58   Citrus sinensis [apfelsine]
ref|XP_008463223.1|  PREDICTED: 60S acidic ribosomal protein P0         182   1e-58   Cucumis melo [Oriental melon]
ref|XP_011084927.1|  PREDICTED: 60S acidic ribosomal protein P0-like    182   2e-58   Sesamum indicum [beniseed]
ref|XP_010534571.1|  PREDICTED: 60S acidic ribosomal protein P0-like    180   3e-58   Tarenaya hassleriana [spider flower]
ref|XP_004501267.1|  PREDICTED: 60S acidic ribosomal protein P0-like    179   5e-58   Cicer arietinum [garbanzo]
ref|XP_007222847.1|  hypothetical protein PRUPE_ppa008800mg             179   5e-58   Prunus persica
ref|XP_011072152.1|  PREDICTED: 60S acidic ribosomal protein P0-like    181   6e-58   
ref|XP_002884720.1|  60S acidic ribosomal protein P0                    181   7e-58   Arabidopsis lyrata subsp. lyrata
ref|XP_010534676.1|  PREDICTED: 60S acidic ribosomal protein P0-like    179   7e-58   Tarenaya hassleriana [spider flower]
gb|ADR71235.1|  60S acidic ribosomal protein P0A                        179   8e-58   Hevea brasiliensis [jebe]
ref|NP_187531.1|  60S acidic ribosomal protein P0-2                     181   8e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002882720.1|  60S acidic ribosomal protein P0                    181   8e-58   
ref|XP_010486703.1|  PREDICTED: 60S acidic ribosomal protein P0-3       181   1e-57   Camelina sativa [gold-of-pleasure]
ref|XP_010486773.1|  PREDICTED: 60S acidic ribosomal protein P0-3...    180   1e-57   Camelina sativa [gold-of-pleasure]
ref|XP_002526873.1|  60S acidic ribosomal protein P0, putative          178   1e-57   Ricinus communis
ref|XP_010464828.1|  PREDICTED: 60S acidic ribosomal protein P0-3...    180   1e-57   Camelina sativa [gold-of-pleasure]
ref|XP_006298124.1|  hypothetical protein CARUB_v10014186mg             180   1e-57   Capsella rubella
gb|ADR71236.1|  60S acidic ribosomal protein P0B                        178   2e-57   Hevea brasiliensis [jebe]
ref|XP_010554654.1|  PREDICTED: 60S acidic ribosomal protein P0         177   2e-57   Tarenaya hassleriana [spider flower]
ref|NP_187734.1|  60S acidic ribosomal protein P0-3                     180   2e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009344598.1|  PREDICTED: 60S acidic ribosomal protein P0         177   2e-57   Pyrus x bretschneideri [bai li]
ref|XP_010469822.1|  PREDICTED: 60S acidic ribosomal protein P0-3...    180   2e-57   Camelina sativa [gold-of-pleasure]
gb|AAM65265.1|  60S acidic ribosomal protein P0-C                       179   2e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010464557.1|  PREDICTED: 60S acidic ribosomal protein P0-3...    179   2e-57   Camelina sativa [gold-of-pleasure]
emb|CDY53103.1|  BnaCnng24330D                                          179   3e-57   Brassica napus [oilseed rape]
ref|XP_006298147.1|  hypothetical protein CARUB_v10014197mg             179   3e-57   Capsella rubella
ref|XP_008392940.1|  PREDICTED: 60S acidic ribosomal protein P0         177   3e-57   Malus domestica [apple tree]
emb|CDY07906.1|  BnaC03g36170D                                          179   3e-57   Brassica napus [oilseed rape]
ref|XP_010095082.1|  60S acidic ribosomal protein P0                    177   4e-57   Morus notabilis
ref|NP_001238374.1|  60S acidic ribosomal protein P0                    176   4e-57   Glycine max [soybeans]
ref|NP_001239676.1|  uncharacterized protein LOC100777482               176   5e-57   Glycine max [soybeans]
ref|XP_009350848.1|  PREDICTED: 60S acidic ribosomal protein P0-like    178   5e-57   Pyrus x bretschneideri [bai li]
ref|XP_011035984.1|  PREDICTED: 60S acidic ribosomal protein P0         176   5e-57   Populus euphratica
ref|XP_004490967.1|  PREDICTED: 60S acidic ribosomal protein P0-like    176   6e-57   Cicer arietinum [garbanzo]
ref|XP_004490966.1|  PREDICTED: 60S acidic ribosomal protein P0-like    176   6e-57   Cicer arietinum [garbanzo]
ref|XP_002525622.1|  60S acidic ribosomal protein P0, putative          178   6e-57   Ricinus communis
gb|KFK38515.1|  hypothetical protein AALP_AA3G123100                    177   8e-57   Arabis alpina [alpine rockcress]
ref|XP_006407706.1|  hypothetical protein EUTSA_v10021147mg             177   8e-57   Eutrema salsugineum [saltwater cress]
gb|AAM63644.1|  putative 60S acidic ribosomal protein P0                177   8e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007163525.1|  hypothetical protein PHAVU_001G241400g             178   9e-57   Phaseolus vulgaris [French bean]
ref|XP_006407705.1|  hypothetical protein EUTSA_v10021147mg             177   9e-57   
ref|XP_009146942.1|  PREDICTED: 60S acidic ribosomal protein P0-2       177   1e-56   Brassica rapa
ref|XP_008360784.1|  PREDICTED: 60S acidic ribosomal protein P0         177   1e-56   Malus domestica [apple tree]
ref|XP_010486480.1|  PREDICTED: 60S acidic ribosomal protein P0-3...    177   1e-56   Camelina sativa [gold-of-pleasure]
gb|ACJ84880.1|  unknown                                                 175   1e-56   Medicago truncatula
emb|CDX73962.1|  BnaA03g30850D                                          177   1e-56   
gb|AFK39880.1|  unknown                                                 175   1e-56   Medicago truncatula
ref|XP_003603496.1|  60S acidic ribosomal protein p0                    174   2e-56   Medicago truncatula
ref|XP_009135066.1|  PREDICTED: 60S acidic ribosomal protein P0-2...    177   2e-56   Brassica rapa
ref|XP_011042597.1|  PREDICTED: 60S acidic ribosomal protein P0-like    174   2e-56   Populus euphratica
ref|XP_002315165.1|  60S acidic ribosomal protein P0-A                  174   2e-56   
ref|XP_009123454.1|  PREDICTED: 60S acidic ribosomal protein P0-2...    176   2e-56   Brassica rapa
ref|XP_004145258.1|  PREDICTED: 60S acidic ribosomal protein P0-2...    176   3e-56   Cucumis sativus [cucumbers]
gb|AFK38760.1|  unknown                                                 174   3e-56   Lotus japonicus
ref|XP_003616595.1|  60S acidic ribosomal protein p0                    174   3e-56   Medicago truncatula
ref|XP_007157498.1|  hypothetical protein PHAVU_002G074600g             173   4e-56   Phaseolus vulgaris [French bean]
gb|KFK38306.1|  hypothetical protein AALP_AA3G096900                    175   4e-56   Arabis alpina [alpine rockcress]
gb|AAF34767.1|AF227622_1  60S acidic ribosomal protein PO               172   6e-56   Euphorbia esula [wolf's milk]
ref|XP_009389889.1|  PREDICTED: 60S acidic ribosomal protein P0         172   7e-56   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002312149.1|  60S acidic ribosomal protein P0-A                  172   8e-56   Populus trichocarpa [western balsam poplar]
gb|KHN36391.1|  60S acidic ribosomal protein P0                         180   9e-56   Glycine soja [wild soybean]
gb|ABK94988.1|  unknown                                                 172   9e-56   Populus trichocarpa [western balsam poplar]
gb|ABK95701.1|  unknown                                                 172   9e-56   Populus trichocarpa [western balsam poplar]
ref|XP_007153264.1|  hypothetical protein PHAVU_003G020600g             172   1e-55   Phaseolus vulgaris [French bean]
gb|AGV54296.1|  60S acidic ribosomal protein P0                         172   1e-55   Phaseolus vulgaris [French bean]
ref|XP_010067511.1|  PREDICTED: 60S acidic ribosomal protein P0         172   1e-55   Eucalyptus grandis [rose gum]
gb|ADU04571.1|  60S acidic ribosomal protein PO                         171   1e-55   Phaseolus vulgaris [French bean]
ref|XP_008457380.1|  PREDICTED: 60S acidic ribosomal protein P0-like    173   1e-55   Cucumis melo [Oriental melon]
gb|KHN34735.1|  60S acidic ribosomal protein P0                         179   1e-55   Glycine soja [wild soybean]
gb|EYU43500.1|  hypothetical protein MIMGU_mgv1a010103mg                174   1e-55   Erythranthe guttata [common monkey flower]
dbj|BAE71263.1|  putative 60S acidic ribosomal protein P0               171   2e-55   Trifolium pratense [peavine clover]
ref|XP_003538454.1|  PREDICTED: 60S acidic ribosomal protein P0-like    179   2e-55   Glycine max [soybeans]
ref|XP_009409427.1|  PREDICTED: 60S acidic ribosomal protein P0-like    171   2e-55   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009619762.1|  PREDICTED: 60S acidic ribosomal protein P0-like    176   2e-55   Nicotiana tomentosiformis
ref|XP_009764939.1|  PREDICTED: 60S acidic ribosomal protein P0-like    176   2e-55   Nicotiana sylvestris
ref|NP_181530.1|  60S acidic ribosomal protein P0-1                     173   3e-55   Arabidopsis thaliana [mouse-ear cress]
gb|EYU18304.1|  hypothetical protein MIMGU_mgv1a010092mg                173   3e-55   Erythranthe guttata [common monkey flower]
emb|CDP16385.1|  unnamed protein product                                174   3e-55   Coffea canephora [robusta coffee]
ref|XP_010508934.1|  PREDICTED: 60S acidic ribosomal protein P0-1       172   3e-55   Camelina sativa [gold-of-pleasure]
ref|XP_010941551.1|  PREDICTED: 60S acidic ribosomal protein P0         172   4e-55   Elaeis guineensis
ref|XP_002881693.1|  60S acidic ribosomal protein P0                    172   4e-55   
ref|XP_009399833.1|  PREDICTED: 60S acidic ribosomal protein P0-like    171   4e-55   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010926952.1|  PREDICTED: 60S acidic ribosomal protein P0         171   5e-55   Elaeis guineensis
gb|AFK46889.1|  unknown                                                 170   5e-55   Medicago truncatula
ref|XP_006411245.1|  hypothetical protein EUTSA_v10016954mg             172   5e-55   Eutrema salsugineum [saltwater cress]
gb|KCW65655.1|  hypothetical protein EUGRSUZ_G03042                     170   5e-55   Eucalyptus grandis [rose gum]
gb|KCW65657.1|  hypothetical protein EUGRSUZ_G03042                     169   7e-55   Eucalyptus grandis [rose gum]
gb|KJB76158.1|  hypothetical protein B456_012G076000                    184   7e-55   Gossypium raimondii
sp|P50345.1|RLA0_LUPLU  RecName: Full=60S acidic ribosomal protei...    172   1e-54   Lupinus luteus
ref|XP_008799093.1|  PREDICTED: 60S acidic ribosomal protein P0         169   1e-54   Phoenix dactylifera
ref|XP_004247949.1|  PREDICTED: 60S acidic ribosomal protein P0-like    171   1e-54   Solanum lycopersicum
ref|XP_010517390.1|  PREDICTED: 60S acidic ribosomal protein P0-1...    170   2e-54   Camelina sativa [gold-of-pleasure]
emb|CDY24932.1|  BnaC03g22400D                                          170   2e-54   Brassica napus [oilseed rape]
ref|XP_006360336.1|  PREDICTED: 60S acidic ribosomal protein P0-like    169   4e-54   Solanum tuberosum [potatoes]
gb|KFK36893.1|  hypothetical protein AALP_AA4G185700                    166   5e-54   Arabis alpina [alpine rockcress]
emb|CDY60988.1|  BnaA03g56530D                                          169   5e-54   Brassica napus [oilseed rape]
ref|XP_007016138.1|  Ribosomal protein L10 family protein               168   6e-54   
gb|KDP46515.1|  hypothetical protein JCGZ_08487                         172   9e-54   Jatropha curcas
gb|EYU43501.1|  hypothetical protein MIMGU_mgv1a010103mg                167   1e-53   Erythranthe guttata [common monkey flower]
ref|XP_009799989.1|  PREDICTED: 60S acidic ribosomal protein P0-like    167   1e-53   Nicotiana sylvestris
ref|XP_009133397.1|  PREDICTED: 60S acidic ribosomal protein P0-1       167   1e-53   Brassica rapa
emb|CDP14047.1|  unnamed protein product                                185   2e-53   Coffea canephora [robusta coffee]
ref|XP_010689885.1|  PREDICTED: 60S acidic ribosomal protein P0         167   2e-53   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006296009.1|  hypothetical protein CARUB_v10025153mg             167   3e-53   Capsella rubella
gb|KJB19895.1|  hypothetical protein B456_003G123400                    165   4e-53   Gossypium raimondii
ref|XP_009791710.1|  PREDICTED: 60S acidic ribosomal protein P0         184   4e-53   Nicotiana sylvestris
ref|XP_009608105.1|  PREDICTED: 60S acidic ribosomal protein P0         183   1e-52   Nicotiana tomentosiformis
ref|NP_001176776.1|  Os12g0133050                                       176   1e-52   
ref|XP_009592351.1|  PREDICTED: 60S acidic ribosomal protein P0-like    164   1e-52   Nicotiana tomentosiformis
ref|XP_006350830.1|  PREDICTED: 60S acidic ribosomal protein P0-like    164   1e-52   Solanum tuberosum [potatoes]
ref|XP_004241171.1|  PREDICTED: 60S acidic ribosomal protein P0-like    164   2e-52   Solanum lycopersicum
sp|P29764.1|RLA0_OXYRB  RecName: Full=60S acidic ribosomal protei...    164   2e-52   Oxybasis rubra [pigweed]
ref|XP_004307622.1|  PREDICTED: 60S acidic ribosomal protein P0         160   3e-52   Fragaria vesca subsp. vesca
ref|XP_004307662.1|  PREDICTED: 60S acidic ribosomal protein P0         160   3e-52   Fragaria vesca subsp. vesca
ref|NP_001275012.1|  60S acidic ribosomal protein P0-like               181   5e-52   Solanum tuberosum [potatoes]
ref|XP_004239781.1|  PREDICTED: 60S acidic ribosomal protein P0         181   6e-52   Solanum lycopersicum
gb|ABO31368.1|  60S ribosomal protein                                   161   7e-52   Gossypium hirsutum [American cotton]
ref|XP_002440235.1|  hypothetical protein SORBIDRAFT_09g028230          164   1e-51   Sorghum bicolor [broomcorn]
ref|NP_001060923.1|  Os08g0130500                                       179   3e-51   
gb|EYU19991.1|  hypothetical protein MIMGU_mgv1a0100891mg               172   4e-51   Erythranthe guttata [common monkey flower]
gb|KDO69056.1|  hypothetical protein CISIN_1g036252mg                   162   6e-51   Citrus sinensis [apfelsine]
ref|XP_006435696.1|  hypothetical protein CICLE_v10033862mg             162   6e-51   Citrus clementina [clementine]
gb|ABA91328.1|  60S acidic ribosomal protein P0, putative, expressed    178   8e-51   Oryza sativa Japonica Group [Japonica rice]
gb|EAY82182.1|  hypothetical protein OsI_37384                          178   8e-51   Oryza sativa Indica Group [Indian rice]
ref|XP_004287422.1|  PREDICTED: 60S acidic ribosomal protein P0-like    157   8e-51   Fragaria vesca subsp. vesca
emb|CBX25428.1|  hypothetical_protein                                   177   9e-51   Oryza glaberrima
gb|ABA95724.1|  60S acidic ribosomal protein P0, putative, expressed    177   9e-51   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006659092.1|  PREDICTED: 60S acidic ribosomal protein P0-like    177   1e-50   Oryza brachyantha
dbj|BAC10912.1|  putative 60S acidic ribosomal protein P0               173   3e-50   Zinnia elegans [garden zinnia]
gb|AID52928.1|  60S acidic ribosomal protein P0                         176   3e-50   Carthamus tinctorius
ref|XP_001759851.1|  predicted protein                                  157   6e-50   
ref|XP_001759592.1|  predicted protein                                  154   9e-50   
ref|XP_008779031.1|  PREDICTED: 60S acidic ribosomal protein P0-like    168   3e-49   Phoenix dactylifera
gb|AIN39821.1|  hypothetical protein                                    169   5e-48   Zoysia matrella [Japanese carpet grass]
gb|EMT02739.1|  60S acidic ribosomal protein P0                         148   7e-48   
gb|EMT17099.1|  60S acidic ribosomal protein P0                         167   2e-47   
dbj|BAJ94456.1|  predicted protein                                      167   2e-47   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ92405.1|  predicted protein                                      167   2e-47   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010234277.1|  PREDICTED: 60S acidic ribosomal protein P0         164   2e-46   Brachypodium distachyon [annual false brome]
ref|XP_004296403.1|  PREDICTED: 60S acidic ribosomal protein P0-like    164   3e-46   Fragaria vesca subsp. vesca
ref|XP_002983859.1|  hypothetical protein SELMODRAFT_268802             145   3e-46   Selaginella moellendorffii
ref|XP_002974292.1|  hypothetical protein SELMODRAFT_149765             145   4e-46   Selaginella moellendorffii
gb|ACL52455.1|  unknown                                                 163   6e-46   Zea mays [maize]
ref|NP_001141489.1|  hypothetical protein                               163   6e-46   Zea mays [maize]
gb|AFW74478.1|  hypothetical protein ZEAMMB73_076912                    161   6e-46   
gb|ACF83717.1|  unknown                                                 163   7e-46   Zea mays [maize]
ref|NP_001105482.1|  60S acidic ribosomal protein P0                    163   7e-46   Zea mays [maize]
ref|XP_002967451.1|  hypothetical protein SELMODRAFT_87354              150   7e-46   Selaginella moellendorffii
emb|CAN65663.1|  hypothetical protein VITISV_014917                     150   1e-45   Vitis vinifera
ref|XP_002960261.1|  hypothetical protein SELMODRAFT_229877             150   1e-45   Selaginella moellendorffii
ref|XP_002960810.1|  hypothetical protein SELMODRAFT_437282             143   2e-45   Selaginella moellendorffii
ref|XP_002445000.1|  hypothetical protein SORBIDRAFT_07g002560          161   2e-45   Sorghum bicolor [broomcorn]
ref|XP_004972933.1|  PREDICTED: 60S acidic ribosomal protein P0-like    156   6e-44   Setaria italica
ref|XP_004958562.1|  PREDICTED: 60S acidic ribosomal protein P0-like    156   6e-44   Setaria italica
ref|XP_010685586.1|  PREDICTED: 60S acidic ribosomal protein P0         133   3e-43   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003573632.1|  PREDICTED: 60S acidic ribosomal protein P0-like    132   4e-42   Brachypodium distachyon [annual false brome]
emb|CAN76468.1|  hypothetical protein VITISV_030042                     125   5e-42   Vitis vinifera
ref|NP_001176336.1|  Os11g0135300                                       147   2e-41   
emb|CBI25508.3|  unnamed protein product                                122   6e-41   Vitis vinifera
ref|XP_006846796.1|  hypothetical protein AMTR_s00148p00060210          149   7e-41   Amborella trichopoda
emb|CBI31491.3|  unnamed protein product                                120   3e-40   Vitis vinifera
ref|NP_001078125.1|  60S acidic ribosomal protein P0-2                  106   3e-35   Arabidopsis thaliana [mouse-ear cress]
gb|AFK45016.1|  unknown                                                 133   6e-35   Lotus japonicus
ref|XP_005650079.1|  hypothetical protein COCSUDRAFT_52908              114   2e-34   Coccomyxa subellipsoidea C-169
ref|XP_006595496.1|  PREDICTED: uncharacterized protein LOC100305...    131   2e-34   Glycine max [soybeans]
ref|XP_006575531.1|  PREDICTED: 60S acidic ribosomal protein P0-l...    130   5e-34   
ref|NP_001236064.1|  uncharacterized protein LOC100305996               129   1e-33   Glycine max [soybeans]
ref|XP_007141772.1|  hypothetical protein PHAVU_008G224500g             129   3e-33   Phaseolus vulgaris [French bean]
ref|XP_011402179.1|  60S acidic ribosomal protein P0-2                  115   8e-33   Auxenochlorella protothecoides
gb|KHN36390.1|  60S acidic ribosomal protein P0-1                     98.6    9e-33   Glycine soja [wild soybean]
ref|XP_005850392.1|  hypothetical protein CHLNCDRAFT_59607              115   3e-32   Chlorella variabilis
ref|XP_003621750.1|  60S acidic ribosomal protein P0                    123   3e-31   
gb|KIZ02211.1|  60S acidic ribosomal protein P0                         105   3e-31   Monoraphidium neglectum
gb|KDD72928.1|  hypothetical protein H632_c2720p0                       108   1e-30   Helicosporidium sp. ATCC 50920
ref|XP_004492062.1|  PREDICTED: 60S acidic ribosomal protein P0-like    121   2e-30   
emb|CBV76074.1|  60S acidic ribosomal protein P0                        107   4e-29   Polytomella sp. Pringsheim 198.80
emb|CDP06275.1|  unnamed protein product                              87.8    2e-27   Coffea canephora [robusta coffee]
gb|AFB33848.1|  hypothetical protein CL118Contig1_01                    107   1e-26   Pinus cembra [Arve]
ref|XP_010490328.1|  PREDICTED: 60S acidic ribosomal protein P0-like    109   1e-26   Camelina sativa [gold-of-pleasure]
gb|AEW08493.1|  hypothetical protein CL118Contig1_01                    107   2e-26   Pinus lambertiana
ref|XP_002597893.1|  hypothetical protein BRAFLDRAFT_97880              109   3e-26   Branchiostoma floridae
ref|XP_011196704.1|  PREDICTED: 60S acidic ribosomal protein P0         107   4e-26   Zeugodacus cucurbitae [melon fruit fly]
gb|ABV60317.1|  60S acidic ribosomal protein P0-like protein            106   5e-26   Lutzomyia longipalpis
gb|AEW08494.1|  hypothetical protein CL118Contig1_01                    106   6e-26   Pinus radiata
ref|XP_011208099.1|  PREDICTED: 60S acidic ribosomal protein P0         107   8e-26   Bactrocera dorsalis [papaya fruit fly]
ref|XP_002068394.1|  GK20443                                            107   8e-26   
ref|XP_011496436.1|  PREDICTED: 60S acidic ribosomal protein P0         106   9e-26   Ceratosolen solmsi marchali
ref|XP_004522331.1|  PREDICTED: 60S acidic ribosomal protein P0-like    107   1e-25   Ceratitis capitata [medfly]
ref|XP_001352888.1|  GA20389                                            107   1e-25   Drosophila pseudoobscura pseudoobscura
gb|AEF59081.1|  60S acidic ribosomal-like protein P0                    107   1e-25   Phragmatopoma lapidosa
ref|XP_006612127.1|  PREDICTED: 60S acidic ribosomal protein P0-like    105   2e-25   Apis dorsata [rock honeybee]
ref|XP_001958489.1|  GF10946                                            106   2e-25   Drosophila ananassae
gb|KJB32134.1|  hypothetical protein B456_005G225800                  73.9    2e-25   Gossypium raimondii
ref|XP_011297993.1|  PREDICTED: 60S acidic ribosomal protein P0         105   2e-25   Fopius arisanus
ref|XP_623106.1|  PREDICTED: 60S acidic ribosomal protein P0 isof...    105   2e-25   Apis mellifera [bee]
dbj|BAN20115.1|  ribosomal protein LP0                                  105   2e-25   Riptortus pedestris
ref|XP_003398378.1|  PREDICTED: 60S acidic ribosomal protein P0-l...    105   2e-25   Bombus terrestris [large earth bumblebee]
ref|XP_003488353.1|  PREDICTED: 60S acidic ribosomal protein P0-like    105   2e-25   Bombus impatiens
ref|XP_001607606.1|  PREDICTED: 60S acidic ribosomal protein P0         105   2e-25   Nasonia vitripennis
ref|XP_011266937.1|  PREDICTED: 60S acidic ribosomal protein P0         105   2e-25   Camponotus floridanus
ref|XP_011157010.1|  PREDICTED: 60S acidic ribosomal protein P0         105   2e-25   Solenopsis invicta [imported red fire ant]
ref|XP_003706895.1|  PREDICTED: 60S acidic ribosomal protein P0-like    105   2e-25   Megachile rotundata
ref|XP_001973718.1|  GG16244                                            107   2e-25   Drosophila erecta
ref|XP_001985147.1|  GH14667                                            107   2e-25   Drosophila grimshawi
ref|XP_001655016.1|  AAEL010821-PA                                      103   2e-25   Aedes aegypti
gb|ACR08654.1|  ribosomal protein LP0                                   107   2e-25   Drosophila silvestris
ref|XP_002040897.1|  GM22429                                            107   2e-25   Drosophila sechellia
ref|NP_524211.1|  ribosomal protein LP0, isoform A                      107   2e-25   Drosophila melanogaster
ref|XP_008544624.1|  PREDICTED: 60S acidic ribosomal protein P0         105   2e-25   Microplitis demolitor
ref|XP_002095795.1|  RpLP0                                              106   3e-25   Drosophila yakuba
gb|AAR09675.1|  similar to Drosophila melanogaster RpP0                 106   3e-25   Drosophila yakuba
ref|XP_011347099.1|  PREDICTED: 60S acidic ribosomal protein P0         104   3e-25   Ooceraea biroi
gb|AAM97779.1|  ribosomal protein P0                                    103   3e-25   Aedes albopictus [forest day mosquito]
ref|XP_011146290.1|  PREDICTED: 60S acidic ribosomal protein P0-like    104   4e-25   Harpegnathos saltator
ref|XP_002047707.1|  GJ13582                                            107   4e-25   Drosophila virilis
ref|XP_011064775.1|  PREDICTED: 60S acidic ribosomal protein P0         104   5e-25   Acromyrmex echinatior
ref|XP_001851128.1|  60S acidic ribosomal protein P0                    102   6e-25   Culex quinquefasciatus
ref|XP_002008961.1|  GI13777                                            107   6e-25   Drosophila mojavensis
ref|XP_011146226.1|  PREDICTED: 60S acidic ribosomal protein P0-like    103   6e-25   Harpegnathos saltator
emb|CBM69268.1|  venom protein Ci-40b                                   103   7e-25   Chelonus inanitus
dbj|BAM18929.1|  ribosomal protein LP0                                  104   8e-25   Papilio polytes
dbj|BAM17678.1|  ribosomal protein LP0                                  104   8e-25   Papilio xuthus [Chinese swallowtail]
emb|CAD29995.1|  ribosomal P0 protein                                   104   8e-25   Bombyx mori [silk moth]
ref|NP_001037123.1|  ribosomal protein P0                               104   8e-25   Bombyx mori [silk moth]
gb|EHJ75936.1|  ribosomal protein P0                                    105   8e-25   
gb|AIW62441.1|  60S acidic ribosomal protein                            102   1e-24   Scytodes thoracica
gb|ADT80652.1|  ribosomal protein P0                                    105   1e-24   Euphydryas aurinia [marsh fritillary]
gb|ACY95307.1|  ribosomal protein P0                                    103   1e-24   Manduca sexta [Carolina sphinx]
ref|XP_001697060.1|  acidic ribosomal protein P0                      85.9    2e-24   Chlamydomonas reinhardtii
gb|ETN64428.1|  60S acidic ribosomal protein P0                         100   2e-24   Anopheles darlingi [American malaria mosquito]
ref|XP_313349.1|  AGAP003592-PA                                         100   2e-24   Anopheles gambiae str. PEST
gb|AAL62465.1|  60S acidic ribosomal protein P0                         103   2e-24   Spodoptera frugiperda
gb|AEE62116.1|  unknown                                                 103   2e-24   Dendroctonus ponderosae
ref|XP_002958097.1|  hypothetical protein VOLCADRAFT_84328            89.4    2e-24   Volvox carteri f. nagariensis
gb|AFD93398.1|  ribosomal protein P0                                    104   2e-24   Lobesia botrana
ref|XP_009018535.1|  hypothetical protein HELRODRAFT_185645             107   2e-24   Helobdella robusta
gb|AAY66850.1|  60S acidic ribosomal protein P0                       98.2    2e-24   Ixodes scapularis [blacklegged tick]
ref|XP_002399611.1|  60S acidic ribosomal protein P0, putative        98.2    3e-24   Ixodes scapularis [blacklegged tick]
ref|XP_001626294.1|  predicted protein                                96.7    3e-24   Nematostella vectensis
gb|AFD93397.1|  ribosomal protein P0                                    104   3e-24   Eupoecilia ambiguella
gb|AGQ49465.1|  acidic ribosomal protein P0                           98.6    4e-24   Rhipicephalus microplus [cattle tick]
gb|AEL28833.1|  ribosomal protein P0                                    103   4e-24   Heliconius melpomene cythera
gb|EFX74249.1|  hypothetical protein DAPPUDRAFT_307348                  106   4e-24   Daphnia pulex
gb|ABW16870.1|  ribosomal protein P0                                  97.4    5e-24   Haemaphysalis longicornis
gb|ABM55512.1|  putative ribosomal protein P0                           101   5e-24   Maconellicoccus hirsutus [pink hibiscus mealybug]
ref|XP_008468123.1|  PREDICTED: 60S acidic ribosomal protein P0         103   6e-24   Diaphorina citri
gb|AJQ18907.1|  acidic ribosomal protein P0                           97.1    6e-24   Amblyomma cajennense
gb|AJQ18906.1|  acidic ribosomal protein P0                           97.8    6e-24   Rhipicephalus sanguineus
tpg|DAA34132.1|  TPA: ribosomal phosphoprotein P0                     97.1    6e-24   Amblyomma variegatum
gb|AJQ18908.1|  acidic ribosomal protein P0                           97.8    6e-24   Dermacentor nitens
ref|XP_005187209.1|  PREDICTED: 60S acidic ribosomal protein P0         101   9e-24   Musca domestica
gb|AAX62441.1|  ribosomal protein P0                                    100   9e-24   Lysiphlebus testaceipes
sp|Q9DG68.1|RLA0_RANSY  RecName: Full=60S acidic ribosomal protei...    103   9e-24   Rana sylvatica
gb|ABY87386.1|  60S acidic ribosomal protein P0                         101   1e-23   Haliotis diversicolor
ref|XP_006205714.1|  PREDICTED: 60S acidic ribosomal protein P0-like    103   1e-23   
dbj|BAC56446.1|  similar to acidic ribosomal phosphoprotein PO          100   1e-23   Bos taurus [bovine]
ref|XP_004648896.1|  PREDICTED: 60S acidic ribosomal protein P0-like    102   1e-23   
gb|AFD93389.1|  ribosomal protein P0                                    102   1e-23   
gb|KFB37344.1|  hypothetical protein ZHAS_00004637                    95.5    1e-23   
ref|XP_003743791.1|  PREDICTED: 60S acidic ribosomal protein P0-like  95.9    1e-23   
gb|ELT92567.1|  hypothetical protein CAPTEDRAFT_167366                  102   2e-23   
gb|AAF31449.1|AF220939_1  60S acidic ribosomal protein P0               100   2e-23   
gb|EAW98172.1|  ribosomal protein, large, P0, isoform CRA_c             102   2e-23   
emb|CEG01946.1|  Ribosomal protein L10/acidic P0                      95.5    2e-23   
gb|ADB24751.1|  acidic ribosomal phosphoprotein P0                      101   2e-23   
ref|XP_975936.1|  PREDICTED: 60S acidic ribosomal protein P0            100   2e-23   
gb|KDR14762.1|  60S acidic ribosomal protein P0                         102   2e-23   
emb|CAH04311.1|  acidic p0 ribosomal protein                            100   2e-23   
gb|ACZ65034.1|  acidic ribosomal protein                                101   2e-23   
gb|ABO38860.1|  acidic ribosomal phosphoprotein P0                      101   3e-23   
dbj|BAC56488.1|  similar to acidic ribosomal phosphoprotein PO          102   3e-23   
gb|EPZ33240.1|  Ribosomal protein L10/acidic P0 domain-containing...  95.1    3e-23   
gb|AEE61707.1|  unknown                                               99.0    3e-23   
ref|XP_006697000.1|  ribosomal protein P0-like protein                93.2    3e-23   
ref|XP_008151673.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...    104   3e-23   
gb|ADV40160.1|  60S acidic ribosomal protein P0                       96.3    4e-23   
gb|AHK09712.1|  60S acidic ribosomal protein P0                         102   4e-23   
gb|ABK32519.1|  ribosomal protein large PO subunit                      102   4e-23   
gb|AFM87759.1|  ribosomal protein, large, P0                            102   5e-23   
gb|AFQ90983.1|  ribosomal protein large P0                              100   6e-23   
ref|XP_006039721.1|  PREDICTED: 60S acidic ribosomal protein P0-like    102   6e-23   
gb|AFQ90986.1|  ribosomal protein large P0                              100   7e-23   
gb|ABW04139.1|  ribosomal protein LP0                                   102   7e-23   
gb|AAP13484.1|  acidic ribosomal phosphoprotein P0                      100   8e-23   
ref|XP_010341232.1|  PREDICTED: 60S acidic ribosomal protein P0         102   8e-23   
gb|KIM26245.1|  hypothetical protein M408DRAFT_194239                 93.6    8e-23   
gb|KFQ10333.1|  60S acidic ribosomal protein P0                         102   8e-23   
ref|XP_006096615.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    102   8e-23   
ref|XP_004591943.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    102   8e-23   
gb|KFO65132.1|  60S acidic ribosomal protein P0                         102   8e-23   
ref|XP_004611132.1|  PREDICTED: 60S acidic ribosomal protein P0-l...    102   8e-23   
ref|XP_008639852.1|  PREDICTED: 60S acidic ribosomal protein P0         102   9e-23   
ref|XP_005962036.1|  PREDICTED: 60S acidic ribosomal protein P0-l...    102   9e-23   
ref|XP_006865511.1|  PREDICTED: 60S acidic ribosomal protein P0-l...    102   9e-23   
ref|XP_004709622.1|  PREDICTED: 60S acidic ribosomal protein P0-l...    102   9e-23   
ref|XP_004691046.1|  PREDICTED: 60S acidic ribosomal protein P0-l...    102   9e-23   
ref|XP_010396743.1|  PREDICTED: 60S acidic ribosomal protein P0         102   9e-23   
ref|XP_003280011.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    102   1e-22   
ref|XP_007528642.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    102   1e-22   
ref|XP_005891538.1|  PREDICTED: 60S acidic ribosomal protein P0-l...    102   1e-22   
ref|XP_010177042.1|  PREDICTED: 60S acidic ribosomal protein P0         103   1e-22   
ref|XP_005147936.1|  PREDICTED: 60S acidic ribosomal protein P0         102   1e-22   
ref|XP_009948467.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...    103   1e-22   
gb|KFP07838.1|  60S acidic ribosomal protein P0                         103   1e-22   
ref|XP_007448240.1|  PREDICTED: 60S acidic ribosomal protein P0-l...    102   1e-22   
ref|XP_007936406.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    102   1e-22   
gb|AAI51696.1|  RPLP0 protein                                           102   1e-22   
ref|XP_002505583.1|  predicted protein                                97.1    1e-22   
ref|XP_006192756.1|  PREDICTED: 60S acidic ribosomal protein P0-l...    102   1e-22   
dbj|BAF98695.1|  ribosomal protein LP0                                  103   1e-22   
ref|XP_009685789.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...    103   1e-22   
ref|XP_009886897.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...    103   1e-22   
ref|XP_002199561.1|  PREDICTED: 60S acidic ribosomal protein P0         103   1e-22   
ref|XP_005524479.1|  PREDICTED: 60S acidic ribosomal protein P0         103   1e-22   
ref|XP_005493516.1|  PREDICTED: 60S acidic ribosomal protein P0         103   1e-22   
ref|XP_008501040.1|  PREDICTED: 60S acidic ribosomal protein P0         103   1e-22   
ref|XP_009907942.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...    103   1e-22   
ref|XP_008924020.1|  PREDICTED: 60S acidic ribosomal protein P0         103   1e-22   
ref|XP_009045933.1|  hypothetical protein LOTGIDRAFT_237709             102   1e-22   
ref|XP_005054917.1|  PREDICTED: 60S acidic ribosomal protein P0         103   1e-22   
ref|XP_010226991.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...    102   1e-22   
ref|XP_010572856.1|  PREDICTED: 60S acidic ribosomal protein P0         103   1e-22   
gb|EAW98170.1|  ribosomal protein, large, P0, isoform CRA_a             102   1e-22   
ref|XP_009285795.1|  PREDICTED: 60S acidic ribosomal protein P0         102   1e-22   
gb|AHK09710.1|  60S acidic ribosomal protein P0                         102   1e-22   
ref|XP_005233278.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...    102   1e-22   
ref|XP_004888210.1|  PREDICTED: 60S acidic ribosomal protein P0         102   1e-22   
ref|XP_001115939.2|  PREDICTED: 60S acidic ribosomal protein P0-like    102   1e-22   
gb|AAP13485.1|  acidic ribosomal phosphoprotein P0                    99.0    1e-22   
gb|KFH71275.1|  large subunit ribosomal protein LP0                   92.4    1e-22   
ref|XP_010602365.1|  PREDICTED: 60S acidic ribosomal protein P0         102   2e-22   
gb|AHW68491.1|  60S acidic ribosomal protein P0                         102   2e-22   
ref|XP_004464729.1|  PREDICTED: 60S acidic ribosomal protein P0         102   2e-22   
gb|AHK09711.1|  60S acidic ribosomal protein P0                         102   2e-22   
pdb|4W22|QQ  Chain q, Structure Of The 80s Mammalian Ribosome Bou...    100   2e-22   
ref|XP_004591942.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    102   2e-22   
gb|ETN75251.1|  ribosomal protein L10                                 97.4    2e-22   
ref|NP_990318.1|  60S acidic ribosomal protein P0                       102   2e-22   
gb|AHK09709.1|  60S acidic ribosomal protein P0                         102   2e-22   
ref|XP_005863834.1|  PREDICTED: 60S acidic ribosomal protein P0         102   2e-22   
ref|XP_004611130.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    102   2e-22   
ref|XP_002425010.1|  ribosomal P0 protein, putative                   99.8    2e-22   
emb|CBV36763.1|  60S acidic ribosomal protein P0                        102   2e-22   
ref|NP_571655.2|  60S acidic ribosomal protein P0                       102   2e-22   
gb|AFQ90984.1|  ribosomal protein large P0                            99.0    2e-22   
gb|AAH49058.1|  Rplp0 protein                                           102   2e-22   
emb|CAA33199.1|  unnamed protein product                                102   2e-22   
gb|EYC13195.1|  hypothetical protein Y032_0044g1026                   97.4    2e-22   
ref|XP_005336874.1|  PREDICTED: 60S acidic ribosomal protein P0         102   2e-22   
ref|XP_005876332.1|  PREDICTED: 60S acidic ribosomal protein P0-like    102   2e-22   
gb|AIS76467.1|  large ribosomal protein P0                              102   2e-22   
ref|XP_004281477.1|  PREDICTED: 60S acidic ribosomal protein P0         102   2e-22   
ref|XP_004315986.1|  PREDICTED: 60S acidic ribosomal protein P0         102   2e-22   
ref|XP_008407632.1|  PREDICTED: 60S acidic ribosomal protein P0         102   2e-22   
gb|AAH01127.1|  Ribosomal protein, large, P0                            102   2e-22   
ref|XP_003907291.1|  PREDICTED: 60S acidic ribosomal protein P0         102   2e-22   
ref|XP_007130059.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    102   2e-22   
ref|XP_002930016.1|  PREDICTED: 60S acidic ribosomal protein P0         102   2e-22   
ref|XP_004017462.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...    102   2e-22   
ref|XP_008582193.1|  PREDICTED: 60S acidic ribosomal protein P0         102   2e-22   
ref|XP_004636304.1|  PREDICTED: 60S acidic ribosomal protein P0         102   2e-22   
ref|XP_003789970.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    102   2e-22   
ref|XP_007434308.1|  PREDICTED: 60S acidic ribosomal protein P0-l...    102   2e-22   
ref|XP_003478429.1|  PREDICTED: 60S acidic ribosomal protein P0         102   2e-22   
ref|XP_004664195.1|  PREDICTED: 60S acidic ribosomal protein P0         102   2e-22   
ref|NP_000993.1|  60S acidic ribosomal protein P0                       102   2e-22   
gb|AAI02075.1|  Ribosomal protein, large, P0                            102   2e-22   
ref|NP_001182357.1|  acidic ribosomal phosphoprotein PO                 102   2e-22   
ref|NP_001012700.1|  60S acidic ribosomal protein P0                    102   2e-22   
gb|AAH03833.1|  Ribosomal protein, large, P0                            102   2e-22   
ref|XP_005396575.1|  PREDICTED: 60S acidic ribosomal protein P0         102   2e-22   
ref|XP_004709621.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    102   2e-22   
ref|XP_002719840.1|  PREDICTED: 60S acidic ribosomal protein P0         102   2e-22   
ref|XP_005344377.1|  PREDICTED: 60S acidic ribosomal protein P0         102   2e-22   
ref|NP_031501.1|  60S acidic ribosomal protein P0                       102   2e-22   
dbj|BAD96291.1|  ribosomal protein P0 variant                           102   2e-22   
ref|XP_010967878.1|  PREDICTED: 60S acidic ribosomal protein P0         102   2e-22   
ref|XP_005962035.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    102   2e-22   
ref|XP_007528628.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    102   2e-22   
ref|XP_004429976.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    102   2e-22   
ref|XP_005798004.1|  PREDICTED: 60S acidic ribosomal protein P0-like    102   2e-22   
ref|XP_006204865.1|  PREDICTED: 60S acidic ribosomal protein P0         102   2e-22   
ref|XP_004691044.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    102   2e-22   
ref|NP_001239066.1|  ribosomal protein, large, P0                       102   2e-22   
ref|XP_007554302.1|  PREDICTED: 60S acidic ribosomal protein P0         102   2e-22   
ref|XP_006053033.1|  PREDICTED: 60S acidic ribosomal protein P0         102   2e-22   
ref|NP_001092068.1|  60S acidic ribosomal protein P0                    102   2e-22   
gb|EMP24441.1|  60S acidic ribosomal protein P0                         102   2e-22   
ref|XP_010996948.1|  PREDICTED: 60S acidic ribosomal protein P0         102   2e-22   
ref|XP_008838692.1|  PREDICTED: 60S acidic ribosomal protein P0         102   2e-22   
ref|XP_006151601.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    102   2e-22   
ref|XP_007936405.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    102   2e-22   
ref|XP_003226041.1|  PREDICTED: 60S acidic ribosomal protein P0         102   2e-22   
ref|XP_007170980.1|  PREDICTED: 60S acidic ribosomal protein P0         102   2e-22   
ref|XP_004379079.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    102   2e-22   
ref|XP_008067488.1|  PREDICTED: 60S acidic ribosomal protein P0         102   2e-22   
ref|XP_004396730.1|  PREDICTED: 60S acidic ribosomal protein P0         102   2e-22   
ref|NP_071797.1|  60S acidic ribosomal protein P0                       102   2e-22   
ref|XP_006192755.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    102   2e-22   
ref|XP_005288756.1|  PREDICTED: 60S acidic ribosomal protein P0         102   2e-22   
ref|XP_003419310.1|  PREDICTED: 60S acidic ribosomal protein P0         102   2e-22   
ref|XP_006865510.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    102   2e-22   
ref|XP_006745368.1|  PREDICTED: 60S acidic ribosomal protein P0         102   2e-22   
ref|XP_003763170.1|  PREDICTED: 60S acidic ribosomal protein P0-like    102   2e-22   
ref|XP_005503982.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...    102   2e-22   
ref|XP_006982441.1|  PREDICTED: 60S acidic ribosomal protein P0-like    102   2e-22   
emb|CAH04309.1|  acidic p0 ribosomal protein                          99.4    2e-22   
ref|XP_006129131.1|  PREDICTED: 60S acidic ribosomal protein P0         102   2e-22   
gb|AFM89484.1|  ribosomal protein, large, P0                          99.8    2e-22   
gb|ELW63848.1|  60S acidic ribosomal protein P0                         102   2e-22   
ref|XP_001897742.1|  60S acidic ribosomal protein P0                  97.1    2e-22   
dbj|BAF83798.1|  unnamed protein product                                102   2e-22   
ref|XP_007620795.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    102   2e-22   
ref|XP_001363537.1|  PREDICTED: 60S acidic ribosomal protein P0         102   2e-22   
emb|CAH04310.1|  acidic p0 ribosomal protein                          97.8    2e-22   
ref|XP_007071837.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    102   2e-22   
ref|XP_002753119.1|  PREDICTED: 60S acidic ribosomal protein P0         102   2e-22   
ref|XP_006151600.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    102   2e-22   
ref|XP_006019892.1|  PREDICTED: 60S acidic ribosomal protein P0         102   3e-22   
ref|XP_008292997.1|  PREDICTED: 60S acidic ribosomal protein P0         102   3e-22   
ref|XP_010003135.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...    102   3e-22   
ref|XP_002733838.1|  PREDICTED: 60S acidic ribosomal protein P0-l...    102   3e-22   
gb|AEA51110.1|  60S acidic ribosomal protein P0                         101   3e-22   
gb|AFK37198.1|  unknown                                               99.8    3e-22   
gb|ADD21618.1|  ribosomal protein P0                                  94.4    3e-22   
ref|XP_005987234.1|  PREDICTED: 60S acidic ribosomal protein P0         102   3e-22   
pdb|3J39|QQ  Chain q, Structure Of The D. Melanogaster 60s Riboso...    100   3e-22   
ref|XP_005707548.1|  60S acidic ribosomal protein P0                  99.0    3e-22   
gb|ACQ57902.1|  60S acidic ribosomal protein P0                         100   3e-22   
ref|XP_004406965.1|  PREDICTED: 60S acidic ribosomal protein P0-like    100   3e-22   
gb|KFO29409.1|  60S acidic ribosomal protein P0                         103   3e-22   
ref|XP_006784596.1|  PREDICTED: 60S acidic ribosomal protein P0-like    101   3e-22   
sp|Q8NHW5.1|RLA0L_HUMAN  RecName: Full=60S acidic ribosomal prote...    101   3e-22   
gb|ACO09070.1|  60S acidic ribosomal protein P0                         101   3e-22   
gb|AFM89472.1|  ribosomal protein, large, P0                          99.4    3e-22   
ref|XP_005918671.1|  PREDICTED: 60S acidic ribosomal protein P0-like    101   3e-22   
gb|AFM88893.1|  ribosomal protein, large, P0                          99.4    3e-22   
ref|XP_004545259.1|  PREDICTED: 60S acidic ribosomal protein P0-like    101   3e-22   
gb|AFM86966.1|  ribosomal protein, large, P0                          99.4    3e-22   
gb|ADE76171.1|  unknown                                               84.0    3e-22   
gb|AFM86828.1|  ribosomal protein, large, P0                          99.4    3e-22   
gb|AFM86570.1|  ribosomal protein, large, P0                          99.4    4e-22   
gb|AFM87081.1|  ribosomal protein, large, P0                          99.4    4e-22   
gb|AFM85484.1|  ribosomal protein, large, P0                          99.4    4e-22   
gb|AFM88521.1|  ribosomal protein, large, P0                          99.4    4e-22   
gb|AFM86948.1|  ribosomal protein, large, P0                          99.4    4e-22   
gb|AFM86675.1|  ribosomal protein, large, P0                          99.4    4e-22   
ref|XP_003441603.1|  PREDICTED: 60S acidic ribosomal protein P0         101   4e-22   
gb|EFO28098.2|  60S acidic ribosomal protein P0                       96.7    4e-22   
gb|AFM87342.1|  ribosomal protein, large, P0                          99.4    4e-22   
gb|AFM85590.1|  ribosomal protein, large, P0                          99.4    4e-22   
gb|AFM86446.1|  ribosomal protein, large, P0                          99.4    4e-22   
dbj|BAD96188.1|  ribosomal protein P0 variant                           101   4e-22   
ref|XP_003135972.1|  60S acidic ribosomal protein P0                  96.7    4e-22   
gb|AFM85775.1|  ribosomal protein, large, P0                          99.0    4e-22   
emb|CCO03039.1|  ribosomal protein, large, P0                         97.8    4e-22   
gb|AFM90832.1|  ribosomal protein, large, P0                          99.0    4e-22   
gb|AFM86528.1|  ribosomal protein, large, P0                          99.4    4e-22   
ref|XP_006640161.1|  PREDICTED: 60S acidic ribosomal protein P0-like    101   4e-22   
gb|ACD65186.1|  putative 60S ribosomal protein RPLP0                  99.8    4e-22   
ref|XP_010366585.1|  PREDICTED: 60S acidic ribosomal protein P0         101   5e-22   
gb|AFM85937.1|  ribosomal protein, large, P0                          99.0    5e-22   
gb|KHJ98883.1|  ribosomal protein L10                                 96.3    5e-22   
gb|AAP20211.1|  acidic ribosomal phosphoprotein                       99.8    5e-22   
ref|NP_001080134.1|  ribosomal protein, large, P0                     99.0    5e-22   
gb|ADF97607.1|  large ribosomal protein P0                              101   5e-22   
ref|XP_008969157.1|  PREDICTED: 60S acidic ribosomal protein P0-like    100   5e-22   
ref|XP_005869587.1|  PREDICTED: 60S acidic ribosomal protein P0-like    101   6e-22   
gb|ABU63975.1|  ribosomal protein large P0-like protein                 100   6e-22   
ref|XP_007933999.1|  PREDICTED: 60S acidic ribosomal protein P0-like  97.8    6e-22   
sp|Q9PV90.1|RLA0_DANRE  RecName: Full=60S acidic ribosomal protei...    100   6e-22   
emb|CCO03025.1|  ribosomal protein, large, P0                         98.2    6e-22   
ref|XP_009641177.1|  PREDICTED: 60S acidic ribosomal protein P0         100   7e-22   
gb|AFM89459.1|  ribosomal protein, large, P0                          98.2    7e-22   
emb|CAD58927.1|  60S acidic ribosomal protein P0                      96.3    7e-22   
gb|AHB33743.1|  60S acidic ribosomal protein P0                         100   7e-22   
gb|AAH70194.1|  RPLP0 protein                                           100   7e-22   
ref|NP_001187030.1|  60S acidic ribosomal protein P0                    100   8e-22   



>ref|XP_002268645.1| PREDICTED: 60S acidic ribosomal protein P0 [Vitis vinifera]
Length=320

 Score =   192 bits (489),  Expect(2) = 8e-62, Method: Compositional matrix adjust.
 Identities = 92/101 (91%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MAVK +KA KKIAYDQKLCQLLDEY+QILIA ADNVGSNQLQNIRKGLRGDSVVLMGKNT
Sbjct  1    MAVKPSKADKKIAYDQKLCQLLDEYSQILIAAADNVGSNQLQNIRKGLRGDSVVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            M+KRSIR+HAE TGNTA LNLIPLLVGNVGLIFTKGDLKEV
Sbjct  61   MMKRSIRLHAEKTGNTAFLNLIPLLVGNVGLIFTKGDLKEV  101


 Score = 71.6 bits (174),  Expect(2) = 8e-62, Method: Compositional matrix adjust.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDV+VPPGNTGLDPS
Sbjct  102  SEEVAKYKVGAPARVGLVAPIDVIVPPGNTGLDPS  136



>emb|CAN80537.1| hypothetical protein VITISV_003812 [Vitis vinifera]
Length=320

 Score =   189 bits (481),  Expect(2) = 7e-61, Method: Compositional matrix adjust.
 Identities = 91/101 (90%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MAVK +KA KKIAYDQKLCQLLDEYTQILIA ADNVGSNQLQNIRKGLRGDSVVLMGKNT
Sbjct  1    MAVKPSKADKKIAYDQKLCQLLDEYTQILIAAADNVGSNQLQNIRKGLRGDSVVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            M+KRSIR+HAE TGN A LNLIPLLVGNVGLIFT+GDLKEV
Sbjct  61   MMKRSIRLHAEKTGNQAFLNLIPLLVGNVGLIFTRGDLKEV  101


 Score = 71.6 bits (174),  Expect(2) = 7e-61, Method: Compositional matrix adjust.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDV+VPPGNTGLDPS
Sbjct  102  SEEVAKYKVGAPARVGLVAPIDVIVPPGNTGLDPS  136



>ref|XP_002276842.1| PREDICTED: 60S acidic ribosomal protein P0 [Vitis vinifera]
Length=320

 Score =   189 bits (481),  Expect(2) = 7e-61, Method: Compositional matrix adjust.
 Identities = 91/101 (90%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MAVK +KA KKIAYDQKLCQLLDEYTQILIA ADNVGSNQLQNIRKGLRGDSVVLMGKNT
Sbjct  1    MAVKPSKADKKIAYDQKLCQLLDEYTQILIAAADNVGSNQLQNIRKGLRGDSVVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            M+KRSIR+HAE TGN A LNLIPLLVGNVGLIFT+GDLKEV
Sbjct  61   MMKRSIRLHAEKTGNQAFLNLIPLLVGNVGLIFTRGDLKEV  101


 Score = 71.6 bits (174),  Expect(2) = 7e-61, Method: Compositional matrix adjust.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDV+VPPGNTGLDPS
Sbjct  102  SEEVAKYKVGAPARVGLVAPIDVIVPPGNTGLDPS  136



>ref|XP_007009051.1| Ribosomal protein L10 family protein isoform 1 [Theobroma cacao]
 gb|EOY17861.1| Ribosomal protein L10 family protein isoform 1 [Theobroma cacao]
Length=320

 Score =   188 bits (477),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 91/101 (90%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MAVK +KA KKIAYD KLCQLLDEYTQILIA ADNVGSNQLQNIRKGLRGDSVVLMGKNT
Sbjct  1    MAVKPSKADKKIAYDAKLCQLLDEYTQILIAAADNVGSNQLQNIRKGLRGDSVVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            M+KRSIR+HAE TGNTA LNLIPLL GNVGLIFTKGDLKEV
Sbjct  61   MMKRSIRMHAEKTGNTAFLNLIPLLQGNVGLIFTKGDLKEV  101


 Score = 72.0 bits (175),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 35/35 (100%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS
Sbjct  102  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  136



>ref|XP_010247657.1| PREDICTED: 60S acidic ribosomal protein P0-like [Nelumbo nucifera]
Length=320

 Score =   186 bits (473),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MAVK +K +KK AYDQKLCQLLDEYTQIL+A ADNVGSNQLQNIRKGLRGDSVVLMGKNT
Sbjct  1    MAVKPSKTEKKAAYDQKLCQLLDEYTQILVASADNVGSNQLQNIRKGLRGDSVVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            M+KRSIR+HAE TGN A LNLIPLLVGNVGLIFTKGDLKEV
Sbjct  61   MMKRSIRLHAEKTGNKAFLNLIPLLVGNVGLIFTKGDLKEV  101


 Score = 71.6 bits (174),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGL+APIDVVVPPGNTGLDPS
Sbjct  102  SEEVAKYKVGAPARVGLIAPIDVVVPPGNTGLDPS  136



>gb|KHG25462.1| 60S acidic ribosomal P0 [Gossypium arboreum]
Length=321

 Score =   186 bits (471),  Expect(2) = 8e-60, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MAVK +KA+KKIAYD KLCQLLDEYTQILIA ADNVGSNQLQNIRKGLRGDSVVLMGKNT
Sbjct  1    MAVKPSKAEKKIAYDAKLCQLLDEYTQILIAAADNVGSNQLQNIRKGLRGDSVVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            M+KRS+R+HAE TGN A LNLIPLL GNVGLIFTKGDLKEV
Sbjct  61   MMKRSVRMHAEKTGNQAFLNLIPLLQGNVGLIFTKGDLKEV  101


 Score = 72.0 bits (175),  Expect(2) = 8e-60, Method: Compositional matrix adjust.
 Identities = 35/35 (100%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS
Sbjct  102  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  136



>gb|KJB78787.1| hypothetical protein B456_013G019000 [Gossypium raimondii]
Length=321

 Score =   185 bits (469),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MAVK +KA KKIAYD KLCQLLDEYTQILIA ADNVGSNQLQNIRKGLRGDSVVLMGKNT
Sbjct  1    MAVKPSKADKKIAYDAKLCQLLDEYTQILIAAADNVGSNQLQNIRKGLRGDSVVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            M+KRS+R+HAE TGN A LNLIPLL GNVGLIFTKGDLKEV
Sbjct  61   MMKRSVRMHAEKTGNQAFLNLIPLLQGNVGLIFTKGDLKEV  101


 Score = 72.0 bits (175),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 35/35 (100%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS
Sbjct  102  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  136



>gb|KHG08087.1| 60S acidic ribosomal P0 [Gossypium arboreum]
Length=321

 Score =   185 bits (469),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MAVK +KA KKIAYD KLCQLLDEYTQILIA ADNVGSNQLQNIRKGLRGDSVVLMGKNT
Sbjct  1    MAVKPSKADKKIAYDAKLCQLLDEYTQILIAAADNVGSNQLQNIRKGLRGDSVVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            M+KRS+R+HAE TGN A LNLIPLL GNVGLIFTKGDLKEV
Sbjct  61   MMKRSVRMHAEKTGNQAFLNLIPLLQGNVGLIFTKGDLKEV  101


 Score = 72.0 bits (175),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 35/35 (100%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS
Sbjct  102  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  136



>ref|XP_011076719.1| PREDICTED: 60S acidic ribosomal protein P0 [Sesamum indicum]
Length=321

 Score =   185 bits (469),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 87/101 (86%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MA K +K++KK+ YDQKLCQLLDEYTQ+L+AVADNVGSNQLQ+IRKGLRGDSVVLMGKNT
Sbjct  1    MAPKLSKSEKKVVYDQKLCQLLDEYTQVLVAVADNVGSNQLQSIRKGLRGDSVVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            M+KRSIR+HAE TGN AILNLIPLLVGNVGLIFTKGDLKEV
Sbjct  61   MMKRSIRMHAEKTGNNAILNLIPLLVGNVGLIFTKGDLKEV  101


 Score = 72.0 bits (175),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 35/35 (100%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS
Sbjct  102  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  136



>gb|KDP44812.1| hypothetical protein JCGZ_01312 [Jatropha curcas]
Length=321

 Score =   184 bits (468),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MA K +KA KKIAYD KLCQLLDEY+QILIA ADNVGSNQLQNIR+GLRGDSVVLMGKNT
Sbjct  1    MAAKPSKADKKIAYDAKLCQLLDEYSQILIAQADNVGSNQLQNIRRGLRGDSVVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            M+KRSIRVHAE TGNTAILNL+PLL GNVGLIFTKGDLKEV
Sbjct  61   MMKRSIRVHAEKTGNTAILNLLPLLQGNVGLIFTKGDLKEV  101


 Score = 72.0 bits (175),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 35/35 (100%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS
Sbjct  102  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  136



>gb|EPS69246.1| p0 ribosomal protein-like protein, partial [Genlisea aurea]
Length=329

 Score =   187 bits (476),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 88/102 (86%), Positives = 98/102 (96%), Gaps = 0/102 (0%)
 Frame = +2

Query  185  SMAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKN  364
            SMA K +K++KKIAYDQKLCQLLDEYTQ+L+AVADNVGSNQLQ+IR+GLRGDSVVLMGKN
Sbjct  7    SMAPKISKSEKKIAYDQKLCQLLDEYTQVLVAVADNVGSNQLQSIRRGLRGDSVVLMGKN  66

Query  365  TMIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            TM+KRSIR+H+E TGNTAILNLIPLL GNVGLIFTKGDLKEV
Sbjct  67   TMMKRSIRIHSEKTGNTAILNLIPLLAGNVGLIFTKGDLKEV  108


 Score = 68.9 bits (167),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEE+ KY+VGAPARVGLVAPIDVVVPPGNTGLDPS
Sbjct  109  SEEIGKYQVGAPARVGLVAPIDVVVPPGNTGLDPS  143



>gb|KHG25720.1| 60S acidic ribosomal P0 [Gossypium arboreum]
Length=320

 Score =   184 bits (468),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MAVK +KA KKIAYD KLCQLLDEYTQILIA ADNVGSNQLQNIRKGLRGDSVVLMGKNT
Sbjct  1    MAVKPSKADKKIAYDAKLCQLLDEYTQILIAAADNVGSNQLQNIRKGLRGDSVVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            M+KRS+R+HAE TGN A LNLIPLL GNVGLIFTKGDLKEV
Sbjct  61   MMKRSVRMHAEKTGNQAFLNLIPLLQGNVGLIFTKGDLKEV  101


 Score = 72.0 bits (175),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 35/35 (100%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS
Sbjct  102  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  136



>gb|KJB76159.1| hypothetical protein B456_012G076000 [Gossypium raimondii]
Length=320

 Score =   184 bits (468),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MAVK +KA KKIAYD KLCQLLDEYTQILIA ADNVGSNQLQNIRKGLRGDSVVLMGKNT
Sbjct  1    MAVKPSKADKKIAYDAKLCQLLDEYTQILIAAADNVGSNQLQNIRKGLRGDSVVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            M+KRS+R+HAE TGN A LNLIPLL GNVGLIFTKGDLKEV
Sbjct  61   MMKRSVRMHAEKTGNQAFLNLIPLLQGNVGLIFTKGDLKEV  101


 Score = 72.0 bits (175),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 35/35 (100%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS
Sbjct  102  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  136



>ref|XP_010256605.1| PREDICTED: 60S acidic ribosomal protein P0 [Nelumbo nucifera]
Length=319

 Score =   186 bits (472),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 87/101 (86%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MAVK +KA KKIAYD+KLC+LLD+YTQIL+A ADNVGSNQLQNIRKGLRGDSVVLMGKNT
Sbjct  1    MAVKSSKADKKIAYDKKLCELLDQYTQILVAAADNVGSNQLQNIRKGLRGDSVVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            M+KR+IR+H+E TGNTA LNLIPLLVGNVGLIFTKGDLKEV
Sbjct  61   MMKRTIRIHSERTGNTAFLNLIPLLVGNVGLIFTKGDLKEV  101


 Score = 70.5 bits (171),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEV KYKVGAPARVGLVAPIDVVVPPGNTGLDPS
Sbjct  102  SEEVGKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  136



>ref|XP_007009052.1| Ribosomal protein L10 family protein isoform 2 [Theobroma cacao]
 gb|EOY17862.1| Ribosomal protein L10 family protein isoform 2 [Theobroma cacao]
Length=321

 Score =   183 bits (465),  Expect(2) = 3e-59, Method: Compositional matrix adjust.
 Identities = 91/102 (89%), Positives = 94/102 (92%), Gaps = 1/102 (1%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MAVK +KA KKIAYD KLCQLLDEYTQILIA ADNVGSNQLQNIRKGLRGDSVVLMGKNT
Sbjct  1    MAVKPSKADKKIAYDAKLCQLLDEYTQILIAAADNVGSNQLQNIRKGLRGDSVVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLL-VGNVGLIFTKGDLKEV  490
            M+KRSIR+HAE TGNTA LNLIPLL  GNVGLIFTKGDLKEV
Sbjct  61   MMKRSIRMHAEKTGNTAFLNLIPLLQQGNVGLIFTKGDLKEV  102


 Score = 72.0 bits (175),  Expect(2) = 3e-59, Method: Compositional matrix adjust.
 Identities = 35/35 (100%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS
Sbjct  103  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  137



>gb|KJB74260.1| hypothetical protein B456_011G283700 [Gossypium raimondii]
Length=273

 Score =   182 bits (463),  Expect(2) = 6e-59, Method: Compositional matrix adjust.
 Identities = 88/101 (87%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MAVK +KA KKIAYD KLCQLLDEYTQILIA ADNVGS QLQNIRKGLRGDSVVLMGKNT
Sbjct  1    MAVKPSKADKKIAYDAKLCQLLDEYTQILIAAADNVGSKQLQNIRKGLRGDSVVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            M+KRS+R+HAE TGN A LNLIPLL GNVGLIFTKGDLKEV
Sbjct  61   MMKRSVRMHAEKTGNEAFLNLIPLLQGNVGLIFTKGDLKEV  101


 Score = 72.4 bits (176),  Expect(2) = 6e-59, Method: Compositional matrix adjust.
 Identities = 35/35 (100%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS
Sbjct  102  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  136



>ref|XP_006435697.1| hypothetical protein CICLE_v10032141mg [Citrus clementina]
 ref|XP_006486350.1| PREDICTED: 60S acidic ribosomal protein P0-like [Citrus sinensis]
 gb|ESR48937.1| hypothetical protein CICLE_v10032141mg [Citrus clementina]
Length=319

 Score =   184 bits (467),  Expect(2) = 6e-59, Method: Compositional matrix adjust.
 Identities = 87/102 (85%), Positives = 95/102 (93%), Gaps = 0/102 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            M VK +KA+KKIAYD KLCQLL+EYTQIL+A ADNVGSNQLQNIR+GLRGDSVVLMGKNT
Sbjct  1    MVVKASKAEKKIAYDAKLCQLLEEYTQILVAAADNVGSNQLQNIRRGLRGDSVVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            M+KR+IR+HAE TGNTA LNLIPLL GNVGLIFTKGDLKEVK
Sbjct  61   MMKRTIRMHAEKTGNTAFLNLIPLLQGNVGLIFTKGDLKEVK  102


 Score = 70.5 bits (171),  Expect(2) = 6e-59, Method: Compositional matrix adjust.
 Identities = 34/34 (100%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS
Sbjct  103  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  136



>gb|KDO69054.1| hypothetical protein CISIN_1g020952mg [Citrus sinensis]
Length=319

 Score =   184 bits (467),  Expect(2) = 7e-59, Method: Compositional matrix adjust.
 Identities = 87/102 (85%), Positives = 95/102 (93%), Gaps = 0/102 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            M VK +KA+KKIAYD KLCQLL+EYTQIL+A ADNVGSNQLQNIR+GLRGDSVVLMGKNT
Sbjct  1    MVVKASKAEKKIAYDAKLCQLLEEYTQILVAAADNVGSNQLQNIRRGLRGDSVVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            M+KR+IR+HAE TGNTA LNLIPLL GNVGLIFTKGDLKEVK
Sbjct  61   MMKRTIRMHAEKTGNTAFLNLIPLLQGNVGLIFTKGDLKEVK  102


 Score = 70.5 bits (171),  Expect(2) = 7e-59, Method: Compositional matrix adjust.
 Identities = 34/34 (100%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS
Sbjct  103  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  136



>gb|KJB74261.1| hypothetical protein B456_011G283700 [Gossypium raimondii]
Length=321

 Score =   182 bits (462),  Expect(2) = 8e-59, Method: Compositional matrix adjust.
 Identities = 88/101 (87%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MAVK +KA KKIAYD KLCQLLDEYTQILIA ADNVGS QLQNIRKGLRGDSVVLMGKNT
Sbjct  1    MAVKPSKADKKIAYDAKLCQLLDEYTQILIAAADNVGSKQLQNIRKGLRGDSVVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            M+KRS+R+HAE TGN A LNLIPLL GNVGLIFTKGDLKEV
Sbjct  61   MMKRSVRMHAEKTGNEAFLNLIPLLQGNVGLIFTKGDLKEV  101


 Score = 72.0 bits (175),  Expect(2) = 8e-59, Method: Compositional matrix adjust.
 Identities = 35/35 (100%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS
Sbjct  102  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  136



>ref|XP_004149240.1| PREDICTED: 60S acidic ribosomal protein P0-like [Cucumis sativus]
 gb|KGN50643.1| 60S acidic ribosomal protein PO [Cucumis sativus]
Length=320

 Score =   182 bits (462),  Expect(2) = 9e-59, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MA+K TKA+KK+AYD KLCQLLDEY+Q+L+  ADNVGSNQLQNIRKGLRGDS+VLMGKNT
Sbjct  1    MAIKPTKAEKKVAYDSKLCQLLDEYSQVLVVAADNVGSNQLQNIRKGLRGDSIVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            M+KRS+R+H+E TGN A LNL+PLLVGNVGLIFTKGDLKEV
Sbjct  61   MMKRSVRIHSEQTGNKAYLNLLPLLVGNVGLIFTKGDLKEV  101


 Score = 72.0 bits (175),  Expect(2) = 9e-59, Method: Compositional matrix adjust.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDV+VPPGNTGLDPS
Sbjct  102  SEEVAKYKVGAPARVGLVAPIDVIVPPGNTGLDPS  136



>ref|XP_006848156.1| hypothetical protein AMTR_s00029p00231170 [Amborella trichopoda]
 gb|ERN09737.1| hypothetical protein AMTR_s00029p00231170 [Amborella trichopoda]
Length=322

 Score =   182 bits (461),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MAVK +KA+KK+AYDQKLCQLLD+Y+Q+LI  ADNVGSNQLQNIRKGLRGDSVVLMGKNT
Sbjct  1    MAVKTSKAEKKVAYDQKLCQLLDQYSQVLIVAADNVGSNQLQNIRKGLRGDSVVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            M+KR+IR+H E TGN A LNLIPLLVGNVGLIFTKGDLKEV
Sbjct  61   MMKRTIRLHTEKTGNNAFLNLIPLLVGNVGLIFTKGDLKEV  101


 Score = 72.0 bits (175),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 35/35 (100%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS
Sbjct  102  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  136



>ref|XP_004165071.1| PREDICTED: 60S acidic ribosomal protein P0-like [Cucumis sativus]
Length=320

 Score =   182 bits (461),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MA+K TKA+KK+AYD KLCQLLDEY+Q+L+  ADNVGSNQLQNIRKGLRGDS+VLMGKNT
Sbjct  1    MAIKPTKAEKKVAYDSKLCQLLDEYSQVLVVAADNVGSNQLQNIRKGLRGDSIVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            M+KRS+R+H+E TGN A LNL+PLLVGNVGLIFTKGDLKEV
Sbjct  61   MMKRSVRIHSEQTGNKAYLNLLPLLVGNVGLIFTKGDLKEV  101


 Score = 71.6 bits (174),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDV+VPPGNTGLDPS
Sbjct  102  SEEVAKYKVGAPARVGLVAPIDVIVPPGNTGLDPS  136



>gb|KDO69055.1| hypothetical protein CISIN_1g020952mg [Citrus sinensis]
Length=318

 Score =   183 bits (465),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 87/102 (85%), Positives = 95/102 (93%), Gaps = 0/102 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            M VK +KA+KKIAYD KLCQLL+EYTQIL+A ADNVGSNQLQNIR+GLRGDSVVLMGKNT
Sbjct  1    MVVKASKAEKKIAYDAKLCQLLEEYTQILVAAADNVGSNQLQNIRRGLRGDSVVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            M+KR+IR+HAE TGNTA LNLIPLL GNVGLIFTKGDLKEVK
Sbjct  61   MMKRTIRMHAEKTGNTAFLNLIPLLQGNVGLIFTKGDLKEVK  102


 Score = 70.1 bits (170),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 34/34 (100%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS
Sbjct  103  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  136



>ref|XP_008463223.1| PREDICTED: 60S acidic ribosomal protein P0 [Cucumis melo]
Length=320

 Score =   182 bits (461),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MA+K TKA+KK+AYD KLCQLLDEY+Q+L+  ADNVGSNQLQNIRKGLRGDS+VLMGKNT
Sbjct  1    MAIKPTKAEKKVAYDSKLCQLLDEYSQVLVVAADNVGSNQLQNIRKGLRGDSIVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            M+KRS+R+H+E TGN A LNL+PLLVGNVGLIFTKGDLKEV
Sbjct  61   MMKRSVRIHSEQTGNKAYLNLLPLLVGNVGLIFTKGDLKEV  101


 Score = 71.6 bits (174),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDV+VPPGNTGLDPS
Sbjct  102  SEEVAKYKVGAPARVGLVAPIDVIVPPGNTGLDPS  136



>ref|XP_011084927.1| PREDICTED: 60S acidic ribosomal protein P0-like [Sesamum indicum]
Length=315

 Score =   182 bits (463),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 87/102 (85%), Positives = 96/102 (94%), Gaps = 0/102 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MA K +KA KKIAYD+KLCQL+D++TQIL+A ADNVGSNQLQNIRKGLRGDSVVLMGKNT
Sbjct  1    MAPKLSKADKKIAYDRKLCQLIDDHTQILVAAADNVGSNQLQNIRKGLRGDSVVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            M+KRSIR+HAE TGNT ILNLIPLLVGNVGLIFTKGDLKEV+
Sbjct  61   MMKRSIRIHAEKTGNTDILNLIPLLVGNVGLIFTKGDLKEVR  102


 Score = 70.1 bits (170),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 34/34 (100%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS
Sbjct  103  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  136



>ref|XP_010534571.1| PREDICTED: 60S acidic ribosomal protein P0-like [Tarenaya hassleriana]
Length=321

 Score =   180 bits (456),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 86/101 (85%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MAVK TKA+KKIAYD KLCQLLDEYTQILI  ADNVGSNQLQ+IRKGLRGDS+VLMGKNT
Sbjct  1    MAVKPTKAEKKIAYDAKLCQLLDEYTQILIVAADNVGSNQLQSIRKGLRGDSIVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            M+KRS+R+HAE T N A LNLIPLL GNVGLIFTKGDLKEV
Sbjct  61   MMKRSVRMHAEKTDNKAFLNLIPLLQGNVGLIFTKGDLKEV  101


 Score = 72.4 bits (176),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 35/35 (100%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS
Sbjct  102  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  136



>ref|XP_004501267.1| PREDICTED: 60S acidic ribosomal protein P0-like [Cicer arietinum]
Length=322

 Score =   179 bits (455),  Expect(2) = 5e-58, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MAVK TKA+KKIAYD KLCQLLD+Y+QIL+  ADNVGSNQLQ+IR GLRGDSVVLMGKNT
Sbjct  1    MAVKPTKAEKKIAYDSKLCQLLDDYSQILVVHADNVGSNQLQSIRSGLRGDSVVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            M+KRSIR+HAE TGN   LNLIPLLVGNVGLIFTKGDLKEV
Sbjct  61   MMKRSIRIHAEQTGNKTFLNLIPLLVGNVGLIFTKGDLKEV  101


 Score = 72.0 bits (175),  Expect(2) = 5e-58, Method: Compositional matrix adjust.
 Identities = 35/35 (100%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS
Sbjct  102  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  136



>ref|XP_007222847.1| hypothetical protein PRUPE_ppa008800mg [Prunus persica]
 ref|XP_008222707.1| PREDICTED: 60S acidic ribosomal protein P0 [Prunus mume]
 gb|EMJ24046.1| hypothetical protein PRUPE_ppa008800mg [Prunus persica]
Length=319

 Score =   179 bits (455),  Expect(2) = 5e-58, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MA K +KA+KKIAYD KLCQLLDEY QILI  ADNVGSNQLQNIRKGLRGDS+VLMGKNT
Sbjct  1    MAPKPSKAEKKIAYDSKLCQLLDEYGQILIVAADNVGSNQLQNIRKGLRGDSIVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            M+KRSIR+HAE TGN   LNL+PLLVGNVGLIFTKGDLKEV
Sbjct  61   MMKRSIRIHAEKTGNNVYLNLVPLLVGNVGLIFTKGDLKEV  101


 Score = 72.0 bits (175),  Expect(2) = 5e-58, Method: Compositional matrix adjust.
 Identities = 35/35 (100%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS
Sbjct  102  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  136



>ref|XP_011072152.1| PREDICTED: 60S acidic ribosomal protein P0-like [Sesamum indicum]
Length=330

 Score =   181 bits (459),  Expect(2) = 6e-58, Method: Compositional matrix adjust.
 Identities = 86/102 (84%), Positives = 95/102 (93%), Gaps = 0/102 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MA K +KA KKIAYD+KLCQL+D++TQIL+A ADNVGSNQLQNIRKGLRGDSVVLMGKNT
Sbjct  1    MAPKLSKADKKIAYDRKLCQLIDDHTQILVAAADNVGSNQLQNIRKGLRGDSVVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            M+KRSIR+HAE TGN  ILNLIPLLVGNVGLIFTKGDLKEV+
Sbjct  61   MMKRSIRIHAEKTGNADILNLIPLLVGNVGLIFTKGDLKEVR  102


 Score = 70.1 bits (170),  Expect(2) = 6e-58, Method: Compositional matrix adjust.
 Identities = 34/34 (100%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS
Sbjct  103  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  136



>ref|XP_002884720.1| 60S acidic ribosomal protein P0 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60979.1| 60S acidic ribosomal protein P0 [Arabidopsis lyrata subsp. lyrata]
Length=322

 Score =   181 bits (459),  Expect(2) = 7e-58, Method: Compositional matrix adjust.
 Identities = 85/99 (86%), Positives = 93/99 (94%), Gaps = 0/99 (0%)
 Frame = +2

Query  194  VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  373
            VK TKA+KKIAYD KLCQL+DEYTQIL+  ADNVGS QLQNIRKGLRGDSVVLMGKNTM+
Sbjct  2    VKATKAEKKIAYDTKLCQLIDEYTQILVVAADNVGSTQLQNIRKGLRGDSVVLMGKNTMM  61

Query  374  KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            KRS+R+H+ENTGNTAILNL+PLL GNVGLIFTKGDLKEV
Sbjct  62   KRSVRIHSENTGNTAILNLLPLLQGNVGLIFTKGDLKEV  100


 Score = 69.7 bits (169),  Expect(2) = 7e-58, Method: Compositional matrix adjust.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDVVV PGNTGLDPS
Sbjct  101  SEEVAKYKVGAPARVGLVAPIDVVVQPGNTGLDPS  135



>ref|XP_010534676.1| PREDICTED: 60S acidic ribosomal protein P0-like [Tarenaya hassleriana]
Length=320

 Score =   179 bits (453),  Expect(2) = 7e-58, Method: Compositional matrix adjust.
 Identities = 86/99 (87%), Positives = 91/99 (92%), Gaps = 0/99 (0%)
 Frame = +2

Query  194  VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  373
            VK TKA+KKIAYD KLCQLLDEYTQILI  ADNVGSNQLQ+IRKGLRGDS+VLMGKNTM+
Sbjct  2    VKPTKAEKKIAYDAKLCQLLDEYTQILIVAADNVGSNQLQSIRKGLRGDSIVLMGKNTMM  61

Query  374  KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            KRSIR+HAE TGN A LNLIPLL GNVGLIFTKGDLKEV
Sbjct  62   KRSIRMHAEKTGNNAYLNLIPLLQGNVGLIFTKGDLKEV  100


 Score = 72.0 bits (175),  Expect(2) = 7e-58, Method: Compositional matrix adjust.
 Identities = 35/35 (100%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS
Sbjct  101  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  135



>gb|ADR71235.1| 60S acidic ribosomal protein P0A [Hevea brasiliensis]
Length=320

 Score =   179 bits (453),  Expect(2) = 8e-58, Method: Compositional matrix adjust.
 Identities = 86/101 (85%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MA K +KA KKIAYD KLCQLLDEY+QILI  ADNVGSNQLQNIR+GLRGDSVVLMGKNT
Sbjct  1    MAGKPSKADKKIAYDAKLCQLLDEYSQILIVAADNVGSNQLQNIRQGLRGDSVVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            M+KR+IRVH+E TGNTA LNLIPLL GNVGLIFTKGDLKEV
Sbjct  61   MMKRTIRVHSEKTGNTAFLNLIPLLQGNVGLIFTKGDLKEV  101


 Score = 72.0 bits (175),  Expect(2) = 8e-58, Method: Compositional matrix adjust.
 Identities = 35/35 (100%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS
Sbjct  102  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  136



>ref|NP_187531.1| 60S acidic ribosomal protein P0-2 [Arabidopsis thaliana]
 sp|Q42112.2|RLA02_ARATH RecName: Full=60S acidic ribosomal protein P0-2 [Arabidopsis 
thaliana]
 gb|AAF14020.1|AC011436_4 putative 60S acidic ribosomal protein P0 [Arabidopsis thaliana]
 gb|AAK44040.1|AF370225_1 putative 60S acidic ribosomal protein P0 [Arabidopsis thaliana]
 gb|AAL15223.1| putative 60S acidic ribosomal protein P0 [Arabidopsis thaliana]
 gb|AEE74736.1| 60S acidic ribosomal protein P0-2 [Arabidopsis thaliana]
Length=320

 Score =   181 bits (459),  Expect(2) = 8e-58, Method: Compositional matrix adjust.
 Identities = 85/99 (86%), Positives = 93/99 (94%), Gaps = 0/99 (0%)
 Frame = +2

Query  194  VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  373
            VK TKA+KKIAYD KLCQL+DEYTQIL+  ADNVGS QLQNIRKGLRGDSVVLMGKNTM+
Sbjct  2    VKATKAEKKIAYDTKLCQLIDEYTQILVVAADNVGSTQLQNIRKGLRGDSVVLMGKNTMM  61

Query  374  KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            KRS+R+H+ENTGNTAILNL+PLL GNVGLIFTKGDLKEV
Sbjct  62   KRSVRIHSENTGNTAILNLLPLLQGNVGLIFTKGDLKEV  100


 Score = 69.7 bits (169),  Expect(2) = 8e-58, Method: Compositional matrix adjust.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDVVV PGNTGLDPS
Sbjct  101  SEEVAKYKVGAPARVGLVAPIDVVVQPGNTGLDPS  135



>ref|XP_002882720.1| 60S acidic ribosomal protein P0 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58979.1| 60S acidic ribosomal protein P0 [Arabidopsis lyrata subsp. lyrata]
Length=323

 Score =   181 bits (459),  Expect(2) = 8e-58, Method: Compositional matrix adjust.
 Identities = 85/99 (86%), Positives = 93/99 (94%), Gaps = 0/99 (0%)
 Frame = +2

Query  194  VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  373
            VK TKA+KKIAYD KLCQL+DEYTQIL+  ADNVGS QLQNIRKGLRGDSVVLMGKNTM+
Sbjct  2    VKATKAEKKIAYDTKLCQLIDEYTQILVVAADNVGSTQLQNIRKGLRGDSVVLMGKNTMM  61

Query  374  KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            KRS+R+H+ENTGNTAILNL+PLL GNVGLIFTKGDLKEV
Sbjct  62   KRSVRIHSENTGNTAILNLLPLLQGNVGLIFTKGDLKEV  100


 Score = 69.7 bits (169),  Expect(2) = 8e-58, Method: Compositional matrix adjust.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDVVV PGNTGLDPS
Sbjct  101  SEEVAKYKVGAPARVGLVAPIDVVVQPGNTGLDPS  135



>ref|XP_010486703.1| PREDICTED: 60S acidic ribosomal protein P0-3 [Camelina sativa]
Length=323

 Score =   181 bits (458),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 84/99 (85%), Positives = 93/99 (94%), Gaps = 0/99 (0%)
 Frame = +2

Query  194  VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  373
            VK TKA+KKIAYD KLCQL+DEYTQIL+  ADNVGS QLQNIRKGLRGDSVVLMGKNTM+
Sbjct  2    VKATKAEKKIAYDAKLCQLIDEYTQILVVAADNVGSTQLQNIRKGLRGDSVVLMGKNTMM  61

Query  374  KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            KRS+R+H+ENTGNTA+LNL+PLL GNVGLIFTKGDLKEV
Sbjct  62   KRSVRIHSENTGNTAVLNLLPLLQGNVGLIFTKGDLKEV  100


 Score = 69.7 bits (169),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDVVV PGNTGLDPS
Sbjct  101  SEEVAKYKVGAPARVGLVAPIDVVVQPGNTGLDPS  135



>ref|XP_010486773.1| PREDICTED: 60S acidic ribosomal protein P0-3-like [Camelina sativa]
Length=324

 Score =   180 bits (457),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 84/99 (85%), Positives = 93/99 (94%), Gaps = 0/99 (0%)
 Frame = +2

Query  194  VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  373
            VK TKA+KKIAYD KLCQL+DEYTQIL+  ADNVGS QLQNIRKGLRGDSVVLMGKNTM+
Sbjct  2    VKATKAEKKIAYDAKLCQLIDEYTQILVVAADNVGSTQLQNIRKGLRGDSVVLMGKNTMM  61

Query  374  KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            KRS+R+H+ENTGNTA+LNL+PLL GNVGLIFTKGDLKEV
Sbjct  62   KRSVRIHSENTGNTAVLNLLPLLQGNVGLIFTKGDLKEV  100


 Score = 69.7 bits (169),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDVVV PGNTGLDPS
Sbjct  101  SEEVAKYKVGAPARVGLVAPIDVVVQPGNTGLDPS  135



>ref|XP_002526873.1| 60S acidic ribosomal protein P0, putative [Ricinus communis]
 gb|EEF35504.1| 60S acidic ribosomal protein P0, putative [Ricinus communis]
Length=320

 Score =   178 bits (452),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 86/101 (85%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MA K +KA KK+AYD KLCQLLDEY+QILI  ADNVGSNQLQNIR+GLRGDSVVLMGKNT
Sbjct  1    MAGKPSKADKKLAYDAKLCQLLDEYSQILIVAADNVGSNQLQNIRRGLRGDSVVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            M+KRSIRVHA+NTGN  ILNLIPLL GNVGLIFTKGDLKEV
Sbjct  61   MMKRSIRVHADNTGNKTILNLIPLLQGNVGLIFTKGDLKEV  101


 Score = 72.0 bits (175),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 35/35 (100%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS
Sbjct  102  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  136



>ref|XP_010464828.1| PREDICTED: 60S acidic ribosomal protein P0-3-like [Camelina sativa]
Length=324

 Score =   180 bits (457),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 84/99 (85%), Positives = 93/99 (94%), Gaps = 0/99 (0%)
 Frame = +2

Query  194  VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  373
            VK TKA+KKIAYD KLCQL+DEYTQIL+  ADNVGS QLQNIRKGLRGDSVVLMGKNTM+
Sbjct  2    VKATKAEKKIAYDAKLCQLIDEYTQILVVAADNVGSTQLQNIRKGLRGDSVVLMGKNTMM  61

Query  374  KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            KRS+R+H+ENTGNTA+LNL+PLL GNVGLIFTKGDLKEV
Sbjct  62   KRSVRIHSENTGNTAVLNLLPLLQGNVGLIFTKGDLKEV  100


 Score = 69.7 bits (169),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDVVV PGNTGLDPS
Sbjct  101  SEEVAKYKVGAPARVGLVAPIDVVVQPGNTGLDPS  135



>ref|XP_006298124.1| hypothetical protein CARUB_v10014186mg [Capsella rubella]
 gb|EOA31022.1| hypothetical protein CARUB_v10014186mg [Capsella rubella]
Length=323

 Score =   180 bits (457),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 84/99 (85%), Positives = 93/99 (94%), Gaps = 0/99 (0%)
 Frame = +2

Query  194  VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  373
            VK TKA+KKIAYD KLCQL+DEYTQIL+  ADNVGS QLQNIRKGLRGDSVVLMGKNTM+
Sbjct  2    VKATKAEKKIAYDAKLCQLIDEYTQILVVAADNVGSTQLQNIRKGLRGDSVVLMGKNTMM  61

Query  374  KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            KRS+R+H+ENTGNTA+LNL+PLL GNVGLIFTKGDLKEV
Sbjct  62   KRSVRIHSENTGNTAVLNLLPLLQGNVGLIFTKGDLKEV  100


 Score = 69.7 bits (169),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDVVV PGNTGLDPS
Sbjct  101  SEEVAKYKVGAPARVGLVAPIDVVVQPGNTGLDPS  135



>gb|ADR71236.1| 60S acidic ribosomal protein P0B [Hevea brasiliensis]
Length=320

 Score =   178 bits (451),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MA K +KA KK+AYD KLCQLLDEY+QILI  ADNVGSNQLQNIR+GLRGDSVVLMGKNT
Sbjct  1    MAGKPSKADKKMAYDAKLCQLLDEYSQILIVAADNVGSNQLQNIRQGLRGDSVVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            M+KR+IRVH+E TGNTA LNLIPLL GNVGLIFTKGDLKEV
Sbjct  61   MMKRTIRVHSEKTGNTAFLNLIPLLQGNVGLIFTKGDLKEV  101


 Score = 72.0 bits (175),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 35/35 (100%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS
Sbjct  102  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  136



>ref|XP_010554654.1| PREDICTED: 60S acidic ribosomal protein P0 [Tarenaya hassleriana]
Length=320

 Score =   177 bits (449),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 86/101 (85%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MAVK TKA+KKIAYD KLCQLLDEYTQIL+  ADNVGSNQLQ+IRKGLRGDSVVLMGKNT
Sbjct  1    MAVKPTKAEKKIAYDAKLCQLLDEYTQILVVAADNVGSNQLQSIRKGLRGDSVVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            M+KRSIR+HAE TGN   LNLI LL GNVGLIFTKGDLKEV
Sbjct  61   MMKRSIRMHAEKTGNNGFLNLITLLQGNVGLIFTKGDLKEV  101


 Score = 72.4 bits (176),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 35/35 (100%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS
Sbjct  102  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  136



>ref|NP_187734.1| 60S acidic ribosomal protein P0-3 [Arabidopsis thaliana]
 sp|P57691.1|RLA03_ARATH RecName: Full=60S acidic ribosomal protein P0-3 [Arabidopsis 
thaliana]
 gb|AAG50973.1|AC073395_15 60S acidic ribosomal protein, putative; 58619-59992 [Arabidopsis 
thaliana]
 gb|AAL07229.1| putative 60S acidic ribosomal protein [Arabidopsis thaliana]
 gb|AAM14140.1| putative 60S acidic ribosomal protein [Arabidopsis thaliana]
 gb|AEE75020.1| 60S acidic ribosomal protein P0-3 [Arabidopsis thaliana]
Length=323

 Score =   180 bits (456),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 84/99 (85%), Positives = 93/99 (94%), Gaps = 0/99 (0%)
 Frame = +2

Query  194  VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  373
            VK TKA+KKIAYD KLCQL+DEYTQIL+  ADNVGS QLQNIRKGLRGDSVVLMGKNTM+
Sbjct  2    VKATKAEKKIAYDTKLCQLIDEYTQILVVAADNVGSTQLQNIRKGLRGDSVVLMGKNTMM  61

Query  374  KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            KRS+R+H+EN+GNTAILNL+PLL GNVGLIFTKGDLKEV
Sbjct  62   KRSVRIHSENSGNTAILNLLPLLQGNVGLIFTKGDLKEV  100


 Score = 69.7 bits (169),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDVVV PGNTGLDPS
Sbjct  101  SEEVAKYKVGAPARVGLVAPIDVVVQPGNTGLDPS  135



>ref|XP_009344598.1| PREDICTED: 60S acidic ribosomal protein P0 [Pyrus x bretschneideri]
Length=321

 Score =   177 bits (450),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 84/101 (83%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MA K +KA KKIAYD KLC LLDEY QILI  ADNVGS QLQNIRKGLRGDSVVLMGKNT
Sbjct  1    MAPKPSKADKKIAYDSKLCSLLDEYGQILIVAADNVGSKQLQNIRKGLRGDSVVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            M+KRS+R+HAE TGN+A LNL+PLLVGNVGLIFTKGDLKEV
Sbjct  61   MMKRSVRIHAEKTGNSAYLNLVPLLVGNVGLIFTKGDLKEV  101


 Score = 72.0 bits (175),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 35/35 (100%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS
Sbjct  102  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  136



>ref|XP_010469822.1| PREDICTED: 60S acidic ribosomal protein P0-3-like [Camelina sativa]
Length=321

 Score =   180 bits (456),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 84/99 (85%), Positives = 93/99 (94%), Gaps = 0/99 (0%)
 Frame = +2

Query  194  VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  373
            VK TKA+KKIAYD KLCQL+DEYTQIL+  ADNVGS QLQNIRKGLRGDSVVLMGKNTM+
Sbjct  2    VKATKAEKKIAYDTKLCQLIDEYTQILVVAADNVGSTQLQNIRKGLRGDSVVLMGKNTMM  61

Query  374  KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            KRS+R+H+ENTGNT+ILNL+PLL GNVGLIFTKGDLKEV
Sbjct  62   KRSVRIHSENTGNTSILNLLPLLQGNVGLIFTKGDLKEV  100


 Score = 69.7 bits (169),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDVVV PGNTGLDPS
Sbjct  101  SEEVAKYKVGAPARVGLVAPIDVVVQPGNTGLDPS  135



>gb|AAM65265.1| 60S acidic ribosomal protein P0-C [Arabidopsis thaliana]
Length=323

 Score =   179 bits (455),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 84/99 (85%), Positives = 93/99 (94%), Gaps = 0/99 (0%)
 Frame = +2

Query  194  VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  373
            VK TKA+KKIAYD KLCQL+DEYTQIL+  ADNVGS QLQNIRKGLRGDSVVLMGKNTM+
Sbjct  2    VKATKAEKKIAYDTKLCQLIDEYTQILVVAADNVGSTQLQNIRKGLRGDSVVLMGKNTMM  61

Query  374  KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            KRS+R+H+EN+GNTAILNL+PLL GNVGLIFTKGDLKEV
Sbjct  62   KRSVRIHSENSGNTAILNLLPLLQGNVGLIFTKGDLKEV  100


 Score = 70.1 bits (170),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDVVV PGNTGLDPS
Sbjct  101  SEEVAKYKVGAPARVGLVAPIDVVVQPGNTGLDPS  135



>ref|XP_010464557.1| PREDICTED: 60S acidic ribosomal protein P0-3-like [Camelina sativa]
 ref|XP_010464558.1| PREDICTED: 60S acidic ribosomal protein P0-3-like [Camelina sativa]
Length=321

 Score =   179 bits (455),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 84/99 (85%), Positives = 93/99 (94%), Gaps = 0/99 (0%)
 Frame = +2

Query  194  VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  373
            VK TKA+KKIAYD KLCQL+DEYTQIL+  ADNVGS QLQNIRKGLRGDSVVLMGKNTM+
Sbjct  2    VKATKAEKKIAYDTKLCQLIDEYTQILVVAADNVGSTQLQNIRKGLRGDSVVLMGKNTMM  61

Query  374  KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            KRS+R+H+ENTGNT+ILNL+PLL GNVGLIFTKGDLKEV
Sbjct  62   KRSVRIHSENTGNTSILNLLPLLQGNVGLIFTKGDLKEV  100


 Score = 69.7 bits (169),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDVVV PGNTGLDPS
Sbjct  101  SEEVAKYKVGAPARVGLVAPIDVVVQPGNTGLDPS  135



>emb|CDY53103.1| BnaCnng24330D [Brassica napus]
Length=323

 Score =   179 bits (454),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 84/99 (85%), Positives = 93/99 (94%), Gaps = 0/99 (0%)
 Frame = +2

Query  194  VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  373
            VK TKA+KKIAYD KLCQL+DE+TQIL+  ADNVGS QLQNIRKGLRGDSVVLMGKNTM+
Sbjct  2    VKATKAEKKIAYDAKLCQLIDEFTQILVVAADNVGSTQLQNIRKGLRGDSVVLMGKNTMM  61

Query  374  KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            KRS+++HAENTGNTAILNL+PLL GNVGLIFTKGDLKEV
Sbjct  62   KRSVKIHAENTGNTAILNLMPLLQGNVGLIFTKGDLKEV  100


 Score = 70.1 bits (170),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDVVV PGNTGLDPS
Sbjct  101  SEEVAKYKVGAPARVGLVAPIDVVVQPGNTGLDPS  135



>ref|XP_006298147.1| hypothetical protein CARUB_v10014197mg [Capsella rubella]
 gb|EOA31045.1| hypothetical protein CARUB_v10014197mg [Capsella rubella]
Length=322

 Score =   179 bits (454),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 84/99 (85%), Positives = 93/99 (94%), Gaps = 0/99 (0%)
 Frame = +2

Query  194  VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  373
            VK TKA+KKIAYD KLCQL+DEYTQIL+  ADNVGS QLQNIRKGLRGDSVVLMGKNTM+
Sbjct  2    VKATKAEKKIAYDAKLCQLIDEYTQILVVAADNVGSTQLQNIRKGLRGDSVVLMGKNTMM  61

Query  374  KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            KRS+R+H+ENTGNT+ILNL+PLL GNVGLIFTKGDLKEV
Sbjct  62   KRSVRMHSENTGNTSILNLLPLLQGNVGLIFTKGDLKEV  100


 Score = 69.7 bits (169),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDVVV PGNTGLDPS
Sbjct  101  SEEVAKYKVGAPARVGLVAPIDVVVQPGNTGLDPS  135



>ref|XP_008392940.1| PREDICTED: 60S acidic ribosomal protein P0 [Malus domestica]
Length=321

 Score =   177 bits (449),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MA K +KA KKIAYD KLC LLDEY Q+LI  ADNVGS QLQNIRKGLRGDSVVLMGKNT
Sbjct  1    MAPKPSKADKKIAYDSKLCSLLDEYGQVLIVAADNVGSKQLQNIRKGLRGDSVVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            M+KRS+R+HAE TGN+A LNL+PLLVGNVGLIFTKGDLKEV
Sbjct  61   MMKRSVRIHAEKTGNSAYLNLVPLLVGNVGLIFTKGDLKEV  101


 Score = 72.0 bits (175),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 35/35 (100%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS
Sbjct  102  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  136



>emb|CDY07906.1| BnaC03g36170D [Brassica napus]
Length=323

 Score =   179 bits (453),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 84/99 (85%), Positives = 93/99 (94%), Gaps = 0/99 (0%)
 Frame = +2

Query  194  VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  373
            VK TKA+KKIAYD KLCQL+DE+TQIL+  ADNVGS QLQNIRKGLRGDSVVLMGKNTM+
Sbjct  2    VKATKAEKKIAYDAKLCQLIDEFTQILVVAADNVGSTQLQNIRKGLRGDSVVLMGKNTMM  61

Query  374  KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            KRS+++HAENTGNTAILNL+PLL GNVGLIFTKGDLKEV
Sbjct  62   KRSVKIHAENTGNTAILNLMPLLQGNVGLIFTKGDLKEV  100


 Score = 69.7 bits (169),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDVVV PGNTGLDPS
Sbjct  101  SEEVAKYKVGAPARVGLVAPIDVVVQPGNTGLDPS  135



>ref|XP_010095082.1| 60S acidic ribosomal protein P0 [Morus notabilis]
 gb|EXB58188.1| 60S acidic ribosomal protein P0 [Morus notabilis]
Length=320

 Score =   177 bits (448),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            M  K +KA KKIAYD KLCQLLDEY+Q+LI  ADNVGSNQLQ+IR+GLRGDS+VLMGKNT
Sbjct  1    MVGKLSKADKKIAYDAKLCQLLDEYSQVLIVAADNVGSNQLQSIRRGLRGDSIVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            M+KRS+R+H+ENTGN A LNLIPLLVGNVGLIFTKGDLKEV
Sbjct  61   MMKRSVRIHSENTGNKAFLNLIPLLVGNVGLIFTKGDLKEV  101


 Score = 72.0 bits (175),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDV+VPPGNTGLDPS
Sbjct  102  SEEVAKYKVGAPARVGLVAPIDVIVPPGNTGLDPS  136



>ref|NP_001238374.1| 60S acidic ribosomal protein P0 [Glycine max]
 sp|P50346.1|RLA0_SOYBN RecName: Full=60S acidic ribosomal protein P0 [Glycine max]
 gb|AAB63814.1| acidic ribosomal protein P0 [Glycine max]
Length=320

 Score =   176 bits (447),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 84/101 (83%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MA KQTKA+KKIAYD KLC L++EY QIL+  +DNVGSNQLQNIRKGLRGDSVVLMGKNT
Sbjct  1    MAPKQTKAEKKIAYDAKLCDLMEEYGQILVVNSDNVGSNQLQNIRKGLRGDSVVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            M+KRS+R+HAE TGN A LNLIPLLVGNVGLIFTKGDLKEV
Sbjct  61   MMKRSVRMHAEKTGNNAYLNLIPLLVGNVGLIFTKGDLKEV  101


 Score = 72.0 bits (175),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 35/35 (100%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS
Sbjct  102  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  136



>ref|NP_001239676.1| uncharacterized protein LOC100777482 [Glycine max]
 gb|ACU20858.1| unknown [Glycine max]
 gb|KHN20859.1| 60S acidic ribosomal protein P0 [Glycine soja]
Length=319

 Score =   176 bits (447),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 84/101 (83%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MA KQTKA+KKIAYD KLC L++EY QIL+  +DNVGSNQLQNIRKGLRGDSVVLMGKNT
Sbjct  1    MAPKQTKAEKKIAYDAKLCDLMEEYGQILVVNSDNVGSNQLQNIRKGLRGDSVVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            M+KRS+R+HAE TGN A LNLIPLLVGNVGLIFTKGDLKEV
Sbjct  61   MMKRSVRMHAEKTGNNAYLNLIPLLVGNVGLIFTKGDLKEV  101


 Score = 72.0 bits (175),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 35/35 (100%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS
Sbjct  102  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  136



>ref|XP_009350848.1| PREDICTED: 60S acidic ribosomal protein P0-like [Pyrus x bretschneideri]
Length=321

 Score =   178 bits (451),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MA K +KA+KKIAYD KLC LLDEY Q+LI  ADNVGS QLQNIRKGLRGDSVVLMGKNT
Sbjct  1    MAPKPSKAEKKIAYDSKLCSLLDEYGQVLIVAADNVGSKQLQNIRKGLRGDSVVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            M+KRS+R+HAE TGN+A LNL+PLLVGNVGLIFTKGDLKEV
Sbjct  61   MMKRSVRIHAEKTGNSAYLNLVPLLVGNVGLIFTKGDLKEV  101


 Score = 70.1 bits (170),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEV KYKVGAPARVGLVAPIDVVVPPGNTGLDPS
Sbjct  102  SEEVGKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  136



>ref|XP_011035984.1| PREDICTED: 60S acidic ribosomal protein P0 [Populus euphratica]
Length=320

 Score =   176 bits (446),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 84/101 (83%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            M  K +KA KKIAYD KLCQLLDEY+QILIA ADNVGSNQLQNIR+GLRGDSVVLMGKNT
Sbjct  1    MVNKLSKADKKIAYDAKLCQLLDEYSQILIAAADNVGSNQLQNIRRGLRGDSVVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            M+KRS+R+H+E TGN A LNLIPLL GNVGLIFTKGDLKEV
Sbjct  61   MMKRSVRIHSEKTGNKAFLNLIPLLQGNVGLIFTKGDLKEV  101


 Score = 72.0 bits (175),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 35/35 (100%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS
Sbjct  102  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  136



>ref|XP_004490967.1| PREDICTED: 60S acidic ribosomal protein P0-like [Cicer arietinum]
Length=321

 Score =   176 bits (446),  Expect(2) = 6e-57, Method: Compositional matrix adjust.
 Identities = 84/101 (83%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MA K TKA+KKIAYD KLCQLL+EY+QIL+  ADNVGSNQLQ+IR GLRGDSVVLMGKNT
Sbjct  1    MAPKPTKAEKKIAYDSKLCQLLEEYSQILVVHADNVGSNQLQSIRSGLRGDSVVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            M+KRSIR+HAE TGN   LNLIPLLVGNVGLIFTKGDLKEV
Sbjct  61   MMKRSIRMHAEKTGNNVYLNLIPLLVGNVGLIFTKGDLKEV  101


 Score = 72.0 bits (175),  Expect(2) = 6e-57, Method: Compositional matrix adjust.
 Identities = 35/35 (100%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS
Sbjct  102  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  136



>ref|XP_004490966.1| PREDICTED: 60S acidic ribosomal protein P0-like [Cicer arietinum]
Length=321

 Score =   176 bits (446),  Expect(2) = 6e-57, Method: Compositional matrix adjust.
 Identities = 84/101 (83%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MA K TKA+KKIAYD KLCQLL+EY+QIL+  ADNVGSNQLQ+IR GLRGDSVVLMGKNT
Sbjct  1    MAPKPTKAEKKIAYDSKLCQLLEEYSQILVVHADNVGSNQLQSIRSGLRGDSVVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            M+KRSIR+HAE TGN   LNLIPLLVGNVGLIFTKGDLKEV
Sbjct  61   MMKRSIRMHAEKTGNNVYLNLIPLLVGNVGLIFTKGDLKEV  101


 Score = 72.0 bits (175),  Expect(2) = 6e-57, Method: Compositional matrix adjust.
 Identities = 35/35 (100%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS
Sbjct  102  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  136



>ref|XP_002525622.1| 60S acidic ribosomal protein P0, putative [Ricinus communis]
 gb|EEF36740.1| 60S acidic ribosomal protein P0, putative [Ricinus communis]
Length=323

 Score =   178 bits (452),  Expect(2) = 6e-57, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 94/102 (92%), Gaps = 0/102 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MAVK TKAQKK+ YD+KLC+ LDEY+QIL+  ADNVGSNQLQ+IR+GLRGDSVVLMGKNT
Sbjct  1    MAVKPTKAQKKVEYDKKLCRFLDEYSQILVVAADNVGSNQLQSIRQGLRGDSVVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            M+KRS+R+HAE TGN A LNLIPLLVGNVGLIFTKG+LKEV+
Sbjct  61   MMKRSVRLHAEKTGNNAFLNLIPLLVGNVGLIFTKGELKEVR  102


 Score = 69.7 bits (169),  Expect(2) = 6e-57, Method: Compositional matrix adjust.
 Identities = 32/34 (94%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            EE+AKYKVGAPARVGL+APIDVVVPPGNTGLDPS
Sbjct  103  EEIAKYKVGAPARVGLIAPIDVVVPPGNTGLDPS  136



>gb|KFK38515.1| hypothetical protein AALP_AA3G123100 [Arabis alpina]
Length=324

 Score =   177 bits (450),  Expect(2) = 8e-57, Method: Compositional matrix adjust.
 Identities = 84/99 (85%), Positives = 92/99 (93%), Gaps = 0/99 (0%)
 Frame = +2

Query  194  VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  373
            VK TKA+KKIAYD KLCQL+DEYTQILI  ADNVGS QLQ+IRKGLRGDSVVLMGKNTM+
Sbjct  2    VKATKAEKKIAYDAKLCQLVDEYTQILIVAADNVGSTQLQSIRKGLRGDSVVLMGKNTMM  61

Query  374  KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            KRS+R+H+ENTGNT ILNL+PLL GNVGLIFTKGDLKEV
Sbjct  62   KRSVRIHSENTGNTGILNLLPLLQGNVGLIFTKGDLKEV  100


 Score = 69.7 bits (169),  Expect(2) = 8e-57, Method: Compositional matrix adjust.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDVVV PGNTGLDPS
Sbjct  101  SEEVAKYKVGAPARVGLVAPIDVVVQPGNTGLDPS  135



>ref|XP_006407706.1| hypothetical protein EUTSA_v10021147mg [Eutrema salsugineum]
 gb|ESQ49159.1| hypothetical protein EUTSA_v10021147mg [Eutrema salsugineum]
Length=322

 Score =   177 bits (450),  Expect(2) = 8e-57, Method: Compositional matrix adjust.
 Identities = 83/99 (84%), Positives = 92/99 (93%), Gaps = 0/99 (0%)
 Frame = +2

Query  194  VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  373
            VK TKA+KKIAYD KLCQL+DEYTQIL+  ADNVGS QLQ+IRKGLRGDSVVLMGKNTM+
Sbjct  2    VKATKAEKKIAYDAKLCQLVDEYTQILVVAADNVGSTQLQSIRKGLRGDSVVLMGKNTMM  61

Query  374  KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            KRS+R+HAENTGNT I+NL+PLL GNVGLIFTKGDLKEV
Sbjct  62   KRSVRIHAENTGNTGIMNLLPLLQGNVGLIFTKGDLKEV  100


 Score = 69.7 bits (169),  Expect(2) = 8e-57, Method: Compositional matrix adjust.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDVVV PGNTGLDPS
Sbjct  101  SEEVAKYKVGAPARVGLVAPIDVVVQPGNTGLDPS  135



>gb|AAM63644.1| putative 60S acidic ribosomal protein P0 [Arabidopsis thaliana]
Length=320

 Score =   177 bits (450),  Expect(2) = 8e-57, Method: Compositional matrix adjust.
 Identities = 84/99 (85%), Positives = 92/99 (93%), Gaps = 0/99 (0%)
 Frame = +2

Query  194  VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  373
            VK TKA+KKIAYD KLCQL+DEYTQIL+  ADNVGS QLQNIRKGL GDSVVLMGKNTM+
Sbjct  2    VKATKAEKKIAYDTKLCQLIDEYTQILVVAADNVGSTQLQNIRKGLLGDSVVLMGKNTMM  61

Query  374  KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            KRS+R+H+ENTGNTAILNL+PLL GNVGLIFTKGDLKEV
Sbjct  62   KRSVRIHSENTGNTAILNLLPLLQGNVGLIFTKGDLKEV  100


 Score = 69.7 bits (169),  Expect(2) = 8e-57, Method: Compositional matrix adjust.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDVVV PGNTGLDPS
Sbjct  101  SEEVAKYKVGAPARVGLVAPIDVVVQPGNTGLDPS  135



>ref|XP_007163525.1| hypothetical protein PHAVU_001G241400g [Phaseolus vulgaris]
 gb|ESW35519.1| hypothetical protein PHAVU_001G241400g [Phaseolus vulgaris]
Length=317

 Score =   178 bits (452),  Expect(2) = 9e-57, Method: Compositional matrix adjust.
 Identities = 83/102 (81%), Positives = 94/102 (92%), Gaps = 0/102 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MAVK TKAQKKIAYD KLC+LLD YTQIL+  ADNVGSNQLQNIR+GLRGDS+VLMGKNT
Sbjct  1    MAVKLTKAQKKIAYDAKLCRLLDNYTQILVVAADNVGSNQLQNIRQGLRGDSIVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            M+KRS+++HAE+TGN A LNL+PLLVGNVGLIFTKGD+KEV 
Sbjct  61   MMKRSVKLHAESTGNNAFLNLVPLLVGNVGLIFTKGDVKEVS  102


 Score = 68.9 bits (167),  Expect(2) = 9e-57, Method: Compositional matrix adjust.
 Identities = 33/35 (94%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SE VAKYKVGAPARVGL+APIDVVVPPGNTGLDPS
Sbjct  102  SEVVAKYKVGAPARVGLIAPIDVVVPPGNTGLDPS  136



>ref|XP_006407705.1| hypothetical protein EUTSA_v10021147mg [Eutrema salsugineum]
 gb|ESQ49158.1| hypothetical protein EUTSA_v10021147mg [Eutrema salsugineum]
Length=298

 Score =   177 bits (450),  Expect(2) = 9e-57, Method: Compositional matrix adjust.
 Identities = 83/99 (84%), Positives = 92/99 (93%), Gaps = 0/99 (0%)
 Frame = +2

Query  194  VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  373
            VK TKA+KKIAYD KLCQL+DEYTQIL+  ADNVGS QLQ+IRKGLRGDSVVLMGKNTM+
Sbjct  2    VKATKAEKKIAYDAKLCQLVDEYTQILVVAADNVGSTQLQSIRKGLRGDSVVLMGKNTMM  61

Query  374  KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            KRS+R+HAENTGNT I+NL+PLL GNVGLIFTKGDLKEV
Sbjct  62   KRSVRIHAENTGNTGIMNLLPLLQGNVGLIFTKGDLKEV  100


 Score = 69.7 bits (169),  Expect(2) = 9e-57, Method: Compositional matrix adjust.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDVVV PGNTGLDPS
Sbjct  101  SEEVAKYKVGAPARVGLVAPIDVVVQPGNTGLDPS  135



>ref|XP_009146942.1| PREDICTED: 60S acidic ribosomal protein P0-2 [Brassica rapa]
 emb|CDY44688.1| BnaA05g29180D [Brassica napus]
Length=323

 Score =   177 bits (449),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 83/99 (84%), Positives = 92/99 (93%), Gaps = 0/99 (0%)
 Frame = +2

Query  194  VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  373
            VK TKA+KKIAYD KLCQL+DE+TQIL+  ADNVGS QLQNIRKGLRGDSVVLMGKNTM+
Sbjct  2    VKATKAEKKIAYDAKLCQLIDEFTQILVVAADNVGSTQLQNIRKGLRGDSVVLMGKNTMM  61

Query  374  KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            KRS+++HAENTGNT ILNL+PLL GNVGLIFTKGDLKEV
Sbjct  62   KRSVKIHAENTGNTGILNLMPLLQGNVGLIFTKGDLKEV  100


 Score = 69.7 bits (169),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDVVV PGNTGLDPS
Sbjct  101  SEEVAKYKVGAPARVGLVAPIDVVVQPGNTGLDPS  135



>ref|XP_008360784.1| PREDICTED: 60S acidic ribosomal protein P0 [Malus domestica]
Length=321

 Score =   177 bits (449),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MA K +KA KKIAYD KLC LLDEY Q+LI  ADNVGS QLQNIRKGLRGDSVVLMGKNT
Sbjct  1    MAPKPSKADKKIAYDSKLCSLLDEYGQVLIVAADNVGSKQLQNIRKGLRGDSVVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            M+KRS+R+HAE TGN+A LNL+PLLVGNVGLIFTKGDLKEV
Sbjct  61   MMKRSVRIHAEKTGNSAYLNLVPLLVGNVGLIFTKGDLKEV  101


 Score = 70.1 bits (170),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEV KYKVGAPARVGLVAPIDVVVPPGNTGLDPS
Sbjct  102  SEEVGKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  136



>ref|XP_010486480.1| PREDICTED: 60S acidic ribosomal protein P0-3-like [Camelina sativa]
Length=321

 Score =   177 bits (448),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 83/99 (84%), Positives = 92/99 (93%), Gaps = 0/99 (0%)
 Frame = +2

Query  194  VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  373
            VK TKA+KKIAYD KLCQ +DEYTQIL+  ADNVGS QLQNIRKGLRGDSVVLMGKNTM+
Sbjct  2    VKATKAEKKIAYDTKLCQHIDEYTQILVVAADNVGSTQLQNIRKGLRGDSVVLMGKNTMM  61

Query  374  KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            KRS+R+H+ENTGNT+ILNL+PLL GNVGLIFTKGDLKEV
Sbjct  62   KRSVRIHSENTGNTSILNLLPLLQGNVGLIFTKGDLKEV  100


 Score = 69.7 bits (169),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDVVV PGNTGLDPS
Sbjct  101  SEEVAKYKVGAPARVGLVAPIDVVVQPGNTGLDPS  135



>gb|ACJ84880.1| unknown [Medicago truncatula]
Length=323

 Score =   175 bits (443),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 84/101 (83%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MAVK TKA+KK  YD KLCQL+DEYTQIL+  ADNVGS QLQNIR+GLRGDSVVLMGKNT
Sbjct  1    MAVKPTKAEKKQNYDAKLCQLIDEYTQILVVNADNVGSKQLQNIRQGLRGDSVVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            M+KRS+R+HAE TGN A LNLIPLLVGNVGLIFTKGDLKEV
Sbjct  61   MMKRSVRMHAEKTGNNAFLNLIPLLVGNVGLIFTKGDLKEV  101


 Score = 72.0 bits (175),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 35/35 (100%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS
Sbjct  102  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  136



>emb|CDX73962.1| BnaA03g30850D [Brassica napus]
Length=323

 Score =   177 bits (448),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 83/99 (84%), Positives = 92/99 (93%), Gaps = 0/99 (0%)
 Frame = +2

Query  194  VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  373
            VK TKA+KKIAYD KLCQL+DE+TQIL+  ADNVGS QLQNIRKGLRGDSVVLMGKNTM+
Sbjct  2    VKATKAEKKIAYDAKLCQLIDEFTQILVVAADNVGSTQLQNIRKGLRGDSVVLMGKNTMM  61

Query  374  KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            KRS+++HAENTGNT ILNL+PLL GNVGLIFTKGDLKEV
Sbjct  62   KRSVKIHAENTGNTGILNLMPLLQGNVGLIFTKGDLKEV  100


 Score = 69.7 bits (169),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDVVV PGNTGLDPS
Sbjct  101  SEEVAKYKVGAPARVGLVAPIDVVVQPGNTGLDPS  135



>gb|AFK39880.1| unknown [Medicago truncatula]
Length=323

 Score =   175 bits (443),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 84/101 (83%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MAVK TKA+KK  YD KLCQL+DEYTQIL+  ADNVGS QLQNIR+GLRGDSVVLMGKNT
Sbjct  1    MAVKPTKAEKKQNYDAKLCQLIDEYTQILVVNADNVGSKQLQNIRQGLRGDSVVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            M+KRS+R+HAE TGN A LNLIPLLVGNVGLIFTKGDLKEV
Sbjct  61   MMKRSVRMHAEKTGNNAFLNLIPLLVGNVGLIFTKGDLKEV  101


 Score = 72.0 bits (175),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 35/35 (100%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS
Sbjct  102  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  136



>ref|XP_003603496.1| 60S acidic ribosomal protein p0 [Medicago truncatula]
 gb|AES73747.1| 60S acidic ribosomal protein P0-1 [Medicago truncatula]
Length=323

 Score =   174 bits (442),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 84/101 (83%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MAVK TKA+KK  YD KLCQL+DEYTQIL+  ADNVGS QLQNIR+GLRGDSVVLMGKNT
Sbjct  1    MAVKPTKAEKKQNYDAKLCQLIDEYTQILVVNADNVGSKQLQNIRQGLRGDSVVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            M+KRS+R+HAE TGN A LNLIPLLVGNVGLIFTKGDLKEV
Sbjct  61   MMKRSVRMHAEKTGNNAFLNLIPLLVGNVGLIFTKGDLKEV  101


 Score = 72.0 bits (175),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 35/35 (100%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS
Sbjct  102  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  136



>ref|XP_009135066.1| PREDICTED: 60S acidic ribosomal protein P0-2-like [Brassica rapa]
Length=323

 Score =   177 bits (448),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 83/99 (84%), Positives = 92/99 (93%), Gaps = 0/99 (0%)
 Frame = +2

Query  194  VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  373
            VK TKA+KKIAYD KLCQL+DE+TQIL+  ADNVGS QLQNIRKGLRGDSVVLMGKNTM+
Sbjct  2    VKATKAEKKIAYDAKLCQLIDEFTQILVVAADNVGSTQLQNIRKGLRGDSVVLMGKNTMM  61

Query  374  KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            KRS+++HAENTGNT ILNL+PLL GNVGLIFTKGDLKEV
Sbjct  62   KRSVKIHAENTGNTGILNLMPLLQGNVGLIFTKGDLKEV  100


 Score = 69.7 bits (169),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDVVV PGNTGLDPS
Sbjct  101  SEEVAKYKVGAPARVGLVAPIDVVVQPGNTGLDPS  135



>ref|XP_011042597.1| PREDICTED: 60S acidic ribosomal protein P0-like [Populus euphratica]
Length=321

 Score =   174 bits (440),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            M  K +KA KKIAYD KLCQLLDEY+QILIA ADNVGSNQLQNIR+GLRGDSVVLMGKNT
Sbjct  1    MVNKLSKADKKIAYDAKLCQLLDEYSQILIAAADNVGSNQLQNIRRGLRGDSVVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            M+KRS+R+H+E TGN   LNLIPLL GNVGLIFTKGDLKEV
Sbjct  61   MMKRSVRIHSEKTGNKTFLNLIPLLQGNVGLIFTKGDLKEV  101


 Score = 72.4 bits (176),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 35/35 (100%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS
Sbjct  102  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  136



>ref|XP_002315165.1| 60S acidic ribosomal protein P0-A [Populus trichocarpa]
 gb|EEF01336.1| 60S acidic ribosomal protein P0-A [Populus trichocarpa]
Length=320

 Score =   174 bits (440),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            M  K +KA KKIAYD KLCQLLDEY+QILIA ADNVGS QLQNIR+GLRGDSVVLMGKNT
Sbjct  1    MVNKLSKADKKIAYDAKLCQLLDEYSQILIAAADNVGSTQLQNIRRGLRGDSVVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            M+KRS+R+H+E TGN A LNLIPLL GNVGLIFTKGDLKEV
Sbjct  61   MMKRSVRIHSEKTGNKAFLNLIPLLQGNVGLIFTKGDLKEV  101


 Score = 72.4 bits (176),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 35/35 (100%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS
Sbjct  102  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  136



>ref|XP_009123454.1| PREDICTED: 60S acidic ribosomal protein P0-2-like [Brassica rapa]
Length=323

 Score =   176 bits (446),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 82/99 (83%), Positives = 92/99 (93%), Gaps = 0/99 (0%)
 Frame = +2

Query  194  VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  373
            VK TKA+KKIAYD KLCQL+DE+TQIL+  ADNVGS QLQNIRKGLRGDSVVLMGKNTM+
Sbjct  2    VKATKAEKKIAYDAKLCQLIDEFTQILVVAADNVGSTQLQNIRKGLRGDSVVLMGKNTMM  61

Query  374  KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            KRS+++HAEN+GNT ILNL+PLL GNVGLIFTKGDLKEV
Sbjct  62   KRSVKIHAENSGNTGILNLMPLLQGNVGLIFTKGDLKEV  100


 Score = 70.1 bits (170),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDVVV PGNTGLDPS
Sbjct  101  SEEVAKYKVGAPARVGLVAPIDVVVQPGNTGLDPS  135



>ref|XP_004145258.1| PREDICTED: 60S acidic ribosomal protein P0-2-like [Cucumis sativus]
 ref|XP_004152959.1| PREDICTED: 60S acidic ribosomal protein P0-2-like [Cucumis sativus]
 ref|XP_004168551.1| PREDICTED: 60S acidic ribosomal protein P0-2-like [Cucumis sativus]
 gb|KGN65800.1| hypothetical protein Csa_1G530120 [Cucumis sativus]
Length=320

 Score =   176 bits (445),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 94/102 (92%), Gaps = 0/102 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            M +K T+AQKK  YDQKLC+LLDEY+Q+LI  ADNVGSNQLQ+IRKGLRGDS++LMGKNT
Sbjct  1    MVLKPTRAQKKTNYDQKLCRLLDEYSQVLIVGADNVGSNQLQSIRKGLRGDSIILMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            M+KRSIR+H+ENTGNTA+ NL+P LVGNVGLIFTKGDLKEVK
Sbjct  61   MMKRSIRIHSENTGNTAVTNLLPHLVGNVGLIFTKGDLKEVK  102


 Score = 70.1 bits (170),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            EEVAKYKVGAPARVGLVAPIDV+VPPGNTGLDPS
Sbjct  103  EEVAKYKVGAPARVGLVAPIDVIVPPGNTGLDPS  136



>gb|AFK38760.1| unknown [Lotus japonicus]
Length=322

 Score =   174 bits (441),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 82/99 (83%), Positives = 91/99 (92%), Gaps = 0/99 (0%)
 Frame = +2

Query  194  VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  373
            VK TKA+KKIAYD KLCQLLD+YTQIL+  ADNVGSNQLQNIR+GLRGDSVVLMGKNTM+
Sbjct  2    VKPTKAEKKIAYDAKLCQLLDDYTQILVVNADNVGSNQLQNIRRGLRGDSVVLMGKNTMM  61

Query  374  KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            KR++R+HAE +GN   LNLIPLLVGNVGLIFTKGDLKEV
Sbjct  62   KRTVRIHAEKSGNNVYLNLIPLLVGNVGLIFTKGDLKEV  100


 Score = 71.6 bits (174),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 35/35 (100%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS
Sbjct  101  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  135



>ref|XP_003616595.1| 60S acidic ribosomal protein p0 [Medicago truncatula]
 gb|AES99553.1| 60S acidic ribosomal protein P0-1 [Medicago truncatula]
Length=323

 Score =   174 bits (440),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MA K TKA+KK AYD KLCQLLDE+TQILI  ADNVGS QLQNIR GLRGDSVVLMGKNT
Sbjct  1    MAPKPTKAEKKQAYDVKLCQLLDEFTQILIVNADNVGSKQLQNIRGGLRGDSVVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            M+KRS+R+HAE TGN A LNLIPLLVGNVGLIFTKGDLKEV
Sbjct  61   MMKRSVRMHAEKTGNNAFLNLIPLLVGNVGLIFTKGDLKEV  101


 Score = 71.6 bits (174),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 35/35 (100%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS
Sbjct  102  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  136



>ref|XP_007157498.1| hypothetical protein PHAVU_002G074600g [Phaseolus vulgaris]
 gb|ESW29492.1| hypothetical protein PHAVU_002G074600g [Phaseolus vulgaris]
Length=321

 Score =   173 bits (439),  Expect(2) = 4e-56, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MA KQTKA+KKI+YD KLCQLLD+Y QIL+  ADNVGS QLQNIRKGLRGDSVVLMGKNT
Sbjct  1    MAPKQTKAEKKISYDGKLCQLLDDYGQILVVNADNVGSKQLQNIRKGLRGDSVVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            M+KRS+R+HAE TGN   L+LIPLLVGNVGLIFTKGDLKEV
Sbjct  61   MMKRSVRIHAEKTGNNVYLSLIPLLVGNVGLIFTKGDLKEV  101


 Score = 71.6 bits (174),  Expect(2) = 4e-56, Method: Compositional matrix adjust.
 Identities = 35/35 (100%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS
Sbjct  102  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  136



>gb|KFK38306.1| hypothetical protein AALP_AA3G096900 [Arabis alpina]
Length=323

 Score =   175 bits (444),  Expect(2) = 4e-56, Method: Compositional matrix adjust.
 Identities = 82/99 (83%), Positives = 92/99 (93%), Gaps = 0/99 (0%)
 Frame = +2

Query  194  VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  373
            VK TKA+KKIAYD KLCQL+DEYTQIL+  ADNVGS QLQ+IRKGLRGDSVVLMGKNTM+
Sbjct  2    VKATKAEKKIAYDAKLCQLVDEYTQILVVAADNVGSTQLQSIRKGLRGDSVVLMGKNTMM  61

Query  374  KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            KRS+R+H+E+TGNT ILNL+PLL GNVGLIFTKGDLKEV
Sbjct  62   KRSVRIHSESTGNTGILNLLPLLQGNVGLIFTKGDLKEV  100


 Score = 69.7 bits (169),  Expect(2) = 4e-56, Method: Compositional matrix adjust.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDVVV PGNTGLDPS
Sbjct  101  SEEVAKYKVGAPARVGLVAPIDVVVQPGNTGLDPS  135



>gb|AAF34767.1|AF227622_1 60S acidic ribosomal protein PO [Euphorbia esula]
Length=317

 Score =   172 bits (437),  Expect(2) = 6e-56, Method: Compositional matrix adjust.
 Identities = 80/96 (83%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = +2

Query  203  TKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIKRS  382
            +KA+KKIAYD KLCQLLD+Y+QIL+  ADNVGS QLQNIRKGLRGDSVVLMGKNTM+KRS
Sbjct  3    SKAEKKIAYDAKLCQLLDDYSQILVVAADNVGSTQLQNIRKGLRGDSVVLMGKNTMMKRS  62

Query  383  IRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            +RVH+E TGNTA LNL+PLL GNVGLIFTKGDLKEV
Sbjct  63   VRVHSEKTGNTAFLNLLPLLQGNVGLIFTKGDLKEV  98


 Score = 72.0 bits (175),  Expect(2) = 6e-56, Method: Compositional matrix adjust.
 Identities = 35/35 (100%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS
Sbjct  99   SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  133



>ref|XP_009389889.1| PREDICTED: 60S acidic ribosomal protein P0 [Musa acuminata subsp. 
malaccensis]
Length=319

 Score =   172 bits (437),  Expect(2) = 7e-56, Method: Compositional matrix adjust.
 Identities = 80/101 (79%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            M VK +KA+KK+ YD+KLC LLDEY+++LIAVADNVGSNQLQNIRKGLRGDS+VLMGKNT
Sbjct  1    MTVKLSKAEKKVVYDKKLCSLLDEYSKVLIAVADNVGSNQLQNIRKGLRGDSIVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            +I+R IR+HAE TGN   LNL+PLLVGNVGLIFTKGDLKEV
Sbjct  61   LIRRCIRIHAEKTGNKNYLNLLPLLVGNVGLIFTKGDLKEV  101


 Score = 72.0 bits (175),  Expect(2) = 7e-56, Method: Compositional matrix adjust.
 Identities = 35/35 (100%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS
Sbjct  102  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  136



>ref|XP_002312149.1| 60S acidic ribosomal protein P0-A [Populus trichocarpa]
 gb|EEE89516.1| 60S acidic ribosomal protein P0-A [Populus trichocarpa]
Length=322

 Score =   172 bits (435),  Expect(2) = 8e-56, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            M  K +KA KKIAYD KLCQLLDEY+QILIA ADNVGS QLQNIR+GLRGDSVVLMGKNT
Sbjct  1    MVNKLSKADKKIAYDAKLCQLLDEYSQILIAAADNVGSTQLQNIRRGLRGDSVVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            M+KRS+R+H+E TGN   LNLIPLL GNVGLIFTKGDLKEV
Sbjct  61   MMKRSVRIHSEKTGNKTFLNLIPLLQGNVGLIFTKGDLKEV  101


 Score = 72.4 bits (176),  Expect(2) = 8e-56, Method: Compositional matrix adjust.
 Identities = 35/35 (100%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS
Sbjct  102  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  136



>gb|KHN36391.1| 60S acidic ribosomal protein P0 [Glycine soja]
Length=321

 Score =   180 bits (456),  Expect(2) = 9e-56, Method: Compositional matrix adjust.
 Identities = 85/102 (83%), Positives = 94/102 (92%), Gaps = 0/102 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MA K TKAQKKIAYD KLC+LLD YTQIL+  ADNVGSNQLQNIR GLRGDSV+LMGKNT
Sbjct  1    MARKLTKAQKKIAYDAKLCKLLDNYTQILVVAADNVGSNQLQNIRHGLRGDSVILMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            M+KR+I++HA+NTGNT ILNLIPLLVGNVGLIFTKGD+KEVK
Sbjct  61   MMKRTIKIHAQNTGNTTILNLIPLLVGNVGLIFTKGDVKEVK  102


 Score = 63.9 bits (154),  Expect(2) = 9e-56, Method: Compositional matrix adjust.
 Identities = 31/34 (91%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            E V+KYKV APARVGLVAPIDVVVPPGNTGLDPS
Sbjct  103  EVVSKYKVAAPARVGLVAPIDVVVPPGNTGLDPS  136



>gb|ABK94988.1| unknown [Populus trichocarpa]
 gb|ABK95694.1| unknown [Populus trichocarpa]
Length=320

 Score =   172 bits (435),  Expect(2) = 9e-56, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            M  K +KA KKIAYD KLCQLLDEY+QILIA ADNVGS QLQNIR+GLRGDSVVLMGKNT
Sbjct  1    MVNKLSKADKKIAYDAKLCQLLDEYSQILIAAADNVGSTQLQNIRRGLRGDSVVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            M+KRS+R+H+E T N A LNLIPLL GNVGLIFTKGDLKEV
Sbjct  61   MMKRSVRIHSEKTANKAFLNLIPLLQGNVGLIFTKGDLKEV  101


 Score = 72.4 bits (176),  Expect(2) = 9e-56, Method: Compositional matrix adjust.
 Identities = 35/35 (100%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS
Sbjct  102  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  136



>gb|ABK95701.1| unknown [Populus trichocarpa]
Length=322

 Score =   172 bits (435),  Expect(2) = 9e-56, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            M  K +KA KKIAYD KLCQLLDEY+QILIA ADNVGS QLQNIR+GLRGDSVVLMGKNT
Sbjct  1    MVNKLSKADKKIAYDAKLCQLLDEYSQILIAAADNVGSTQLQNIRRGLRGDSVVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            M+KRS+R+H+E TGN   LNLIPLL GNVGLIFTKGDLKEV
Sbjct  61   MMKRSVRIHSEKTGNKTFLNLIPLLQGNVGLIFTKGDLKEV  101


 Score = 72.4 bits (176),  Expect(2) = 9e-56, Method: Compositional matrix adjust.
 Identities = 35/35 (100%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS
Sbjct  102  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  136



>ref|XP_007153264.1| hypothetical protein PHAVU_003G020600g [Phaseolus vulgaris]
 gb|ESW25258.1| hypothetical protein PHAVU_003G020600g [Phaseolus vulgaris]
Length=320

 Score =   172 bits (435),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MA K TKA+KKIAYD KLCQLL+EY QIL+  ADNVGS QLQNIRKGLRGDSVVLMGKNT
Sbjct  1    MAPKATKAEKKIAYDGKLCQLLEEYGQILVVNADNVGSTQLQNIRKGLRGDSVVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            M+KRS+R+H+E TGN   LNLIPLL+GNVGLIFTKGDLKEV
Sbjct  61   MMKRSVRMHSEKTGNNVYLNLIPLLIGNVGLIFTKGDLKEV  101


 Score = 72.0 bits (175),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 35/35 (100%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS
Sbjct  102  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  136



>gb|AGV54296.1| 60S acidic ribosomal protein P0 [Phaseolus vulgaris]
Length=320

 Score =   172 bits (435),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MA K TKA+KKIAYD KLCQLL+EY QIL+  ADNVGS QLQNIRKGLRGDSVVLMGKNT
Sbjct  1    MAPKATKAEKKIAYDGKLCQLLEEYGQILVVNADNVGSTQLQNIRKGLRGDSVVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            M+KRS+R+H+E TGN   LNLIPLL+GNVGLIFTKGDLKEV
Sbjct  61   MMKRSVRMHSEKTGNNVYLNLIPLLIGNVGLIFTKGDLKEV  101


 Score = 72.0 bits (175),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 35/35 (100%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS
Sbjct  102  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  136



>ref|XP_010067511.1| PREDICTED: 60S acidic ribosomal protein P0 [Eucalyptus grandis]
 gb|KCW65656.1| hypothetical protein EUGRSUZ_G03042 [Eucalyptus grandis]
Length=320

 Score =   172 bits (435),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 81/98 (83%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = +2

Query  197  KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  376
            K +KA KK+AYD KLC+L+DEY+QILI  ADNVGSNQLQNIRKGLRGDS+VLMGKNTM+K
Sbjct  3    KLSKADKKLAYDAKLCRLMDEYSQILIVAADNVGSNQLQNIRKGLRGDSLVLMGKNTMMK  62

Query  377  RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            RSIR+HAENTGN A LNL+PLL GNVGLIFTKGDLKEV
Sbjct  63   RSIRIHAENTGNNAYLNLLPLLQGNVGLIFTKGDLKEV  100


 Score = 71.6 bits (174),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDV+VPPGNTGLDPS
Sbjct  101  SEEVAKYKVGAPARVGLVAPIDVIVPPGNTGLDPS  135



>gb|ADU04571.1| 60S acidic ribosomal protein PO [Phaseolus vulgaris]
 gb|AGV54610.1| 60S acidic ribosomal protein P0 [Phaseolus vulgaris]
Length=320

 Score =   171 bits (434),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MA K TKA+KKIAYD KLCQLL+EY QIL+  ADNVGS QLQNIRKGLRGDSVVLMGKNT
Sbjct  1    MAPKATKAEKKIAYDGKLCQLLEEYGQILVVNADNVGSTQLQNIRKGLRGDSVVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            M+KRS+R+H+E TGN   LNLIPLL+GNVGLIFTKGDLKEV
Sbjct  61   MMKRSVRMHSEKTGNNVYLNLIPLLIGNVGLIFTKGDLKEV  101


 Score = 71.6 bits (174),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 35/35 (100%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS
Sbjct  102  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  136



>ref|XP_008457380.1| PREDICTED: 60S acidic ribosomal protein P0-like [Cucumis melo]
Length=320

 Score =   173 bits (439),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            M +K T+AQKK  YDQKLC+LLDEY+Q+LI  ADNVGSNQLQ+IRKGLRGDS++LMGKNT
Sbjct  1    MVLKPTRAQKKTNYDQKLCRLLDEYSQVLIVGADNVGSNQLQSIRKGLRGDSIILMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            M+KRSIR+H+E TGNTA+ NL+P LVGNVGLIFTKGDLKEVK
Sbjct  61   MMKRSIRIHSEKTGNTAVTNLLPHLVGNVGLIFTKGDLKEVK  102


 Score = 70.1 bits (170),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            EEVAKYKVGAPARVGLVAPIDV+VPPGNTGLDPS
Sbjct  103  EEVAKYKVGAPARVGLVAPIDVIVPPGNTGLDPS  136



>gb|KHN34735.1| 60S acidic ribosomal protein P0 [Glycine soja]
Length=320

 Score =   179 bits (455),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 85/102 (83%), Positives = 94/102 (92%), Gaps = 0/102 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MA K TKAQKKIAYD KLC+LLD YTQIL+  ADNVGSNQLQNIR GLRGDSV+LMGKNT
Sbjct  1    MARKLTKAQKKIAYDAKLCKLLDNYTQILVVAADNVGSNQLQNIRHGLRGDSVILMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            M+KRSI++HA+NTG+T ILNLIPLLVGNVGLIFTKGD+KEVK
Sbjct  61   MMKRSIKIHAQNTGDTTILNLIPLLVGNVGLIFTKGDVKEVK  102


 Score = 63.5 bits (153),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 30/34 (88%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            E V+KYKV APARVGLVAPIDV+VPPGNTGLDPS
Sbjct  103  EVVSKYKVAAPARVGLVAPIDVIVPPGNTGLDPS  136



>gb|EYU43500.1| hypothetical protein MIMGU_mgv1a010103mg [Erythranthe guttata]
Length=322

 Score =   174 bits (440),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 84/101 (83%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MA K +KA KKIAYD+KLC LLDEYTQ+L+AVADNVGS QLQNIR  LRGDSVVLMGKNT
Sbjct  1    MAPKVSKADKKIAYDKKLCNLLDEYTQVLVAVADNVGSTQLQNIRSALRGDSVVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            M+KRSIR+H+ENTGN AIL LI LLVGNVGLIFTKGDLKEV
Sbjct  61   MMKRSIRIHSENTGNKAILALIDLLVGNVGLIFTKGDLKEV  101


 Score = 69.7 bits (169),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            +EEVAK+KVGAPARVGLVAPIDV+VPPGNTGLDPS
Sbjct  102  TEEVAKFKVGAPARVGLVAPIDVIVPPGNTGLDPS  136



>dbj|BAE71263.1| putative 60S acidic ribosomal protein P0 [Trifolium pratense]
 dbj|BAE71276.1| putative 60S acidic ribosomal protein P0 [Trifolium pratense]
Length=321

 Score =   171 bits (433),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MA K TKA+KK  YD KLCQLLDE+ QIL+  ADNVGSNQLQ+IR+GLRGDSVVLMGKNT
Sbjct  1    MAPKATKAEKKQNYDSKLCQLLDEFNQILVVNADNVGSNQLQSIRRGLRGDSVVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            M+KRS+R+HAE TGN A LNL+PLLVGNVGLIFTKGDLKEV
Sbjct  61   MMKRSVRMHAEKTGNNAFLNLVPLLVGNVGLIFTKGDLKEV  101


 Score = 72.0 bits (175),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 35/35 (100%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS
Sbjct  102  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  136



>ref|XP_003538454.1| PREDICTED: 60S acidic ribosomal protein P0-like [Glycine max]
Length=320

 Score =   179 bits (455),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 85/102 (83%), Positives = 94/102 (92%), Gaps = 0/102 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MA K TKAQKKIAYD KLC+LLD YTQIL+  ADNVGSNQLQNIR GLRGDSV+LMGKNT
Sbjct  1    MARKLTKAQKKIAYDAKLCKLLDNYTQILVVAADNVGSNQLQNIRHGLRGDSVILMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            M+KRSI++HA+NTG+T ILNLIPLLVGNVGLIFTKGD+KEVK
Sbjct  61   MMKRSIKIHAQNTGDTTILNLIPLLVGNVGLIFTKGDVKEVK  102


 Score = 63.5 bits (153),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 30/34 (88%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            E V+KYKV APARVGLVAPIDV+VPPGNTGLDPS
Sbjct  103  EVVSKYKVAAPARVGLVAPIDVIVPPGNTGLDPS  136



>ref|XP_009409427.1| PREDICTED: 60S acidic ribosomal protein P0-like [Musa acuminata 
subsp. malaccensis]
Length=320

 Score =   171 bits (434),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 80/101 (79%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            M VK +KA+KK+ YD+KLC LLDEY+++LIAVADNVGSNQLQNIRKGLRGDS+VLMGKNT
Sbjct  1    MTVKLSKAEKKVVYDKKLCGLLDEYSKVLIAVADNVGSNQLQNIRKGLRGDSIVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            +I+R IR+HAE TGN   LNL+PLLVGNVGLIFTKGDLKEV
Sbjct  61   LIRRCIRIHAEKTGNKNYLNLLPLLVGNVGLIFTKGDLKEV  101


 Score = 72.0 bits (175),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 35/35 (100%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS
Sbjct  102  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  136



>ref|XP_009619762.1| PREDICTED: 60S acidic ribosomal protein P0-like [Nicotiana tomentosiformis]
Length=323

 Score =   176 bits (446),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 84/102 (82%), Positives = 91/102 (89%), Gaps = 0/102 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MAVKQTK QKK+AYDQKLC+ LD Y QILI  ADNVGS QLQNIRKGLRG+SVVLMGKNT
Sbjct  1    MAVKQTKTQKKVAYDQKLCKYLDLYNQILIVNADNVGSTQLQNIRKGLRGESVVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            M+KRS+R+HAE TGN   LNLIPLLVGNVGLIFTKGDLKE+K
Sbjct  61   MMKRSVRIHAEKTGNEGFLNLIPLLVGNVGLIFTKGDLKEIK  102


 Score = 66.6 bits (161),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 31/34 (91%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            EEVAKYKVGAPARVGLVAP+DV+VP GNTGLDPS
Sbjct  103  EEVAKYKVGAPARVGLVAPVDVIVPTGNTGLDPS  136



>ref|XP_009764939.1| PREDICTED: 60S acidic ribosomal protein P0-like [Nicotiana sylvestris]
Length=323

 Score =   176 bits (446),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 84/102 (82%), Positives = 91/102 (89%), Gaps = 0/102 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MAVKQTK QKK+AYDQKLC+ LD Y QILI  ADNVGS QLQNIRKGLRG+SVVLMGKNT
Sbjct  1    MAVKQTKTQKKVAYDQKLCKYLDLYNQILIVNADNVGSTQLQNIRKGLRGESVVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            M+KRS+R+HAE TGN   LNLIPLLVGNVGLIFTKGDLKE+K
Sbjct  61   MMKRSVRIHAEKTGNEGFLNLIPLLVGNVGLIFTKGDLKEIK  102


 Score = 66.6 bits (161),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 31/34 (91%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            EEVAKYKVGAPARVGLVAP+DV+VP GNTGLDPS
Sbjct  103  EEVAKYKVGAPARVGLVAPVDVIVPTGNTGLDPS  136



>ref|NP_181530.1| 60S acidic ribosomal protein P0-1 [Arabidopsis thaliana]
 sp|O04204.1|RLA01_ARATH RecName: Full=60S acidic ribosomal protein P0-1 [Arabidopsis 
thaliana]
 gb|AAB95286.1| 60S acidic ribosomal protein P0 [Arabidopsis thaliana]
 gb|AAN71918.1| putative 60S acidic ribosomal protein P0 [Arabidopsis thaliana]
 gb|AEC09763.1| 60S acidic ribosomal protein P0-1 [Arabidopsis thaliana]
Length=317

 Score =   173 bits (438),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MAVK TKA+KKI YD KLCQLL+EY+QIL+  ADNVGS QLQNIRKGLRGDSVVLMGKNT
Sbjct  1    MAVKATKAEKKIVYDSKLCQLLNEYSQILVVAADNVGSTQLQNIRKGLRGDSVVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            M+KRS+R+HA+ TGN A L+L+PLL GNVGLIFTKGDLKEV
Sbjct  61   MMKRSVRIHADKTGNQAFLSLLPLLQGNVGLIFTKGDLKEV  101


 Score = 69.7 bits (169),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDVVV PGNTGLDPS
Sbjct  102  SEEVAKYKVGAPARVGLVAPIDVVVQPGNTGLDPS  136



>gb|EYU18304.1| hypothetical protein MIMGU_mgv1a010092mg [Erythranthe guttata]
Length=322

 Score =   173 bits (438),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MA K +KA+KKIAYD+KLC LLDEYTQ+L+AVADNVGS QLQNIR  LRGDSVVLMGKNT
Sbjct  1    MAPKVSKAEKKIAYDKKLCNLLDEYTQVLVAVADNVGSTQLQNIRSALRGDSVVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            M+KRSIR+H++NTGN AIL LI LLVGNVGLIFTKGDLKEV
Sbjct  61   MMKRSIRIHSDNTGNKAILALIDLLVGNVGLIFTKGDLKEV  101


 Score = 69.3 bits (168),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            +EEVAK+KVGAPARVGLVAPIDV+VPPGNTGLDPS
Sbjct  102  TEEVAKFKVGAPARVGLVAPIDVIVPPGNTGLDPS  136



>emb|CDP16385.1| unnamed protein product [Coffea canephora]
Length=322

 Score =   174 bits (442),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            M VK +KA+KKIAYDQKLC+LLDEY+ ILI  ADNVGSNQLQNIR+GLR +SV+LMGKNT
Sbjct  1    MVVKHSKAEKKIAYDQKLCKLLDEYSHILIVGADNVGSNQLQNIRRGLRAESVILMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            M+KRSIRVHAENTGN   L+LIPLLVGNVGLIFTKGDLKE+
Sbjct  61   MMKRSIRVHAENTGNKNFLSLIPLLVGNVGLIFTKGDLKEI  101


 Score = 67.8 bits (164),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEV+KYKVGAPARVGL+AP DVVVPPGNTGLDPS
Sbjct  102  SEEVSKYKVGAPARVGLIAPDDVVVPPGNTGLDPS  136



>ref|XP_010508934.1| PREDICTED: 60S acidic ribosomal protein P0-1 [Camelina sativa]
Length=318

 Score =   172 bits (436),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MAVK TKA+KKI YD KLCQLL+EY QIL+  ADNVGS QLQNIRKGLRGDSVVLMGKNT
Sbjct  1    MAVKATKAEKKIVYDSKLCQLLNEYPQILVVAADNVGSTQLQNIRKGLRGDSVVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            M+KRS+R+HA+ TGN A L+L+PLL GNVGLIFTKGDLKEV
Sbjct  61   MMKRSVRIHADKTGNQAFLSLLPLLQGNVGLIFTKGDLKEV  101


 Score = 69.7 bits (169),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDVVV PGNTGLDPS
Sbjct  102  SEEVAKYKVGAPARVGLVAPIDVVVQPGNTGLDPS  136



>ref|XP_010941551.1| PREDICTED: 60S acidic ribosomal protein P0 [Elaeis guineensis]
Length=321

 Score =   172 bits (435),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            M VK +K++KKI YD+KLC+LLDEY+Q+LIA ADNVGSNQLQNIRKGLRGDSVVLMGKNT
Sbjct  1    MTVKLSKSEKKIEYDKKLCRLLDEYSQVLIAAADNVGSNQLQNIRKGLRGDSVVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            +I+R I++HAE TGN   LNL+PLLVGNVGLIFTKGDLKEV+
Sbjct  61   LIRRCIKIHAEKTGNKDYLNLLPLLVGNVGLIFTKGDLKEVR  102


 Score = 70.1 bits (170),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 34/34 (100%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS
Sbjct  103  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  136



>ref|XP_002881693.1| 60S acidic ribosomal protein P0 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57952.1| 60S acidic ribosomal protein P0 [Arabidopsis lyrata subsp. lyrata]
Length=317

 Score =   172 bits (437),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MAVK TKA+KKI YD KLCQLL+EY QIL+  ADNVGS QLQNIRKGLRGDSVVLMGKNT
Sbjct  1    MAVKGTKAEKKIVYDSKLCQLLNEYPQILVVAADNVGSTQLQNIRKGLRGDSVVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            M+KRS+R+HA+ TGN A LNL+PLL GNVGLIFTKGDLKEV
Sbjct  61   MMKRSVRLHADKTGNKAFLNLLPLLQGNVGLIFTKGDLKEV  101


 Score = 69.3 bits (168),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDVVV PGNTGLDPS
Sbjct  102  SEEVAKYKVGAPARVGLVAPIDVVVQPGNTGLDPS  136



>ref|XP_009399833.1| PREDICTED: 60S acidic ribosomal protein P0-like [Musa acuminata 
subsp. malaccensis]
Length=319

 Score =   171 bits (433),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 79/101 (78%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            M VK +KA+KK+ YD+KLC LLDEY+++LIAVADNVGSNQLQNIRKGLRGDS+VLMGKNT
Sbjct  1    MTVKLSKAEKKVVYDKKLCSLLDEYSKVLIAVADNVGSNQLQNIRKGLRGDSIVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            +I+R I++HAE TGN   LNL+PLLVGNVGLIFTKGDLKEV
Sbjct  61   LIRRCIKIHAEKTGNKNYLNLLPLLVGNVGLIFTKGDLKEV  101


 Score = 70.9 bits (172),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKY+VGAPARVGLVAPIDVVVPPGNTGLDPS
Sbjct  102  SEEVAKYQVGAPARVGLVAPIDVVVPPGNTGLDPS  136



>ref|XP_010926952.1| PREDICTED: 60S acidic ribosomal protein P0 [Elaeis guineensis]
Length=320

 Score =   171 bits (434),  Expect(2) = 5e-55, Method: Compositional matrix adjust.
 Identities = 79/102 (77%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            M VK +K++KK+ YD+KLC+LLDEY+Q+LIA ADNVGSNQLQNIRKGLRGDS+VLMGKNT
Sbjct  1    MTVKLSKSEKKVEYDKKLCRLLDEYSQVLIAAADNVGSNQLQNIRKGLRGDSIVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            MI+R I+VHA+ TGN   LNL+PLLVGNVGLIFTKGDLKEV+
Sbjct  61   MIRRCIKVHAQKTGNKECLNLLPLLVGNVGLIFTKGDLKEVR  102


 Score = 70.1 bits (170),  Expect(2) = 5e-55, Method: Compositional matrix adjust.
 Identities = 34/34 (100%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS
Sbjct  103  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  136



>gb|AFK46889.1| unknown [Medicago truncatula]
Length=323

 Score =   170 bits (430),  Expect(2) = 5e-55, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MA K TKA+KK AYD KLCQLLD++TQILI  ADNVGS QLQNIR GLRGDSVVLMGKN 
Sbjct  1    MAPKPTKAEKKQAYDVKLCQLLDKFTQILIVNADNVGSKQLQNIRGGLRGDSVVLMGKNA  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            M+KRS+R+HAE TGN A LNLIPLLVGNVGLIFTKGDLKEV
Sbjct  61   MMKRSVRMHAEKTGNNAFLNLIPLLVGNVGLIFTKGDLKEV  101


 Score = 71.6 bits (174),  Expect(2) = 5e-55, Method: Compositional matrix adjust.
 Identities = 35/35 (100%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS
Sbjct  102  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  136



>ref|XP_006411245.1| hypothetical protein EUTSA_v10016954mg [Eutrema salsugineum]
 gb|ESQ52698.1| hypothetical protein EUTSA_v10016954mg [Eutrema salsugineum]
Length=317

 Score =   172 bits (435),  Expect(2) = 5e-55, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MAVK TKA+KKI YD KLCQLL+EY QILI  ADNVGS QLQNIRKGLRGDSVVLMGKNT
Sbjct  1    MAVKATKAEKKIVYDSKLCQLLNEYPQILIVAADNVGSTQLQNIRKGLRGDSVVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            M+KRS+R+HAE TGN   L+L+PLL GNVGLIFTKGDLKEV
Sbjct  61   MMKRSVRLHAEKTGNDCFLSLLPLLQGNVGLIFTKGDLKEV  101


 Score = 69.7 bits (169),  Expect(2) = 5e-55, Method: Compositional matrix adjust.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDVVV PGNTGLDPS
Sbjct  102  SEEVAKYKVGAPARVGLVAPIDVVVQPGNTGLDPS  136



>gb|KCW65655.1| hypothetical protein EUGRSUZ_G03042 [Eucalyptus grandis]
Length=266

 Score =   170 bits (430),  Expect(2) = 5e-55, Method: Compositional matrix adjust.
 Identities = 81/98 (83%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = +2

Query  197  KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  376
            K +KA KK+AYD KLC+L+DEY+QILI  ADNVGSNQLQNIRKGLRGDS+VLMGKNTM+K
Sbjct  3    KLSKADKKLAYDAKLCRLMDEYSQILIVAADNVGSNQLQNIRKGLRGDSLVLMGKNTMMK  62

Query  377  RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            RSIR+HAENTGN A LNL+PLL GNVGLIFTKGDLKEV
Sbjct  63   RSIRIHAENTGNNAYLNLLPLLQGNVGLIFTKGDLKEV  100


 Score = 71.2 bits (173),  Expect(2) = 5e-55, Method: Compositional matrix adjust.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDV+VPPGNTGLDPS
Sbjct  101  SEEVAKYKVGAPARVGLVAPIDVIVPPGNTGLDPS  135



>gb|KCW65657.1| hypothetical protein EUGRSUZ_G03042 [Eucalyptus grandis]
Length=186

 Score =   169 bits (429),  Expect(2) = 7e-55, Method: Compositional matrix adjust.
 Identities = 81/98 (83%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = +2

Query  197  KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  376
            K +KA KK+AYD KLC+L+DEY+QILI  ADNVGSNQLQNIRKGLRGDS+VLMGKNTM+K
Sbjct  3    KLSKADKKLAYDAKLCRLMDEYSQILIVAADNVGSNQLQNIRKGLRGDSLVLMGKNTMMK  62

Query  377  RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            RSIR+HAENTGN A LNL+PLL GNVGLIFTKGDLKEV
Sbjct  63   RSIRIHAENTGNNAYLNLLPLLQGNVGLIFTKGDLKEV  100


 Score = 71.6 bits (174),  Expect(2) = 7e-55, Method: Compositional matrix adjust.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDV+VPPGNTGLDPS
Sbjct  101  SEEVAKYKVGAPARVGLVAPIDVIVPPGNTGLDPS  135



>gb|KJB76158.1| hypothetical protein B456_012G076000 [Gossypium raimondii]
Length=315

 Score =   184 bits (468),  Expect(2) = 7e-55, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MAVK +KA KKIAYD KLCQLLDEYTQILIA ADNVGSNQLQNIRKGLRGDSVVLMGKNT
Sbjct  1    MAVKPSKADKKIAYDAKLCQLLDEYTQILIAAADNVGSNQLQNIRKGLRGDSVVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            M+KRS+R+HAE TGN A LNLIPLL GNVGLIFTKGDLKEV
Sbjct  61   MMKRSVRMHAEKTGNQAFLNLIPLLQGNVGLIFTKGDLKEV  101


 Score = 56.6 bits (135),  Expect(2) = 7e-55, Method: Compositional matrix adjust.
 Identities = 29/34 (85%), Positives = 33/34 (97%), Gaps = 1/34 (3%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            +EV++ +VGAPARVGLVAPIDVVVPPGNTGLDPS
Sbjct  99   KEVSE-EVGAPARVGLVAPIDVVVPPGNTGLDPS  131



>sp|P50345.1|RLA0_LUPLU RecName: Full=60S acidic ribosomal protein P0 [Lupinus luteus]
 emb|CAA63786.1| P0 ribosomal protein [Lupinus luteus]
Length=322

 Score =   172 bits (436),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MA K TKA+KKI YD KLCQLLDEYTQIL+  ADNVGS QLQNIR+GLRGDSVVLMGKNT
Sbjct  1    MAPKATKAEKKIVYDGKLCQLLDEYTQILVVNADNVGSKQLQNIRQGLRGDSVVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            M+KRS+R+HAE TGN A LNLIPLL+GNVGLIFTKG LKEV
Sbjct  61   MMKRSVRIHAEKTGNQAFLNLIPLLIGNVGLIFTKGYLKEV  101


 Score = 68.2 bits (165),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPA VGLVAPIDVVVPPGNTGLDPS
Sbjct  102  SEEVAKYKVGAPACVGLVAPIDVVVPPGNTGLDPS  136



>ref|XP_008799093.1| PREDICTED: 60S acidic ribosomal protein P0 [Phoenix dactylifera]
Length=320

 Score =   169 bits (429),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 78/102 (76%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            M VK TKA++K+ YD+KLC+LLDEY+Q+LIA ADNVGSNQLQNIR+GLRG+SV+LMGKNT
Sbjct  1    MTVKLTKAERKLEYDKKLCRLLDEYSQVLIAAADNVGSNQLQNIRQGLRGESVILMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            +I+R I+VHAE TGN   LNL+PLLVGNVGLIFTKGDLKEV+
Sbjct  61   LIRRCIKVHAEKTGNKEYLNLLPLLVGNVGLIFTKGDLKEVR  102


 Score = 70.5 bits (171),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 34/34 (100%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS
Sbjct  103  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  136



>ref|XP_004247949.1| PREDICTED: 60S acidic ribosomal protein P0-like [Solanum lycopersicum]
Length=320

 Score =   171 bits (433),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 90/102 (88%), Gaps = 0/102 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MA+K TK++KK+ YDQKLC+ LD Y QILI  ADNVGS Q+Q IRKGLRGDSVVLMGKNT
Sbjct  1    MAIKPTKSEKKVMYDQKLCKYLDSYNQILIVNADNVGSTQMQGIRKGLRGDSVVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            M+KRS+R+HA NTGN A LNLIPLLVGNVGLIFTKGDLKE+K
Sbjct  61   MMKRSVRIHAGNTGNDAFLNLIPLLVGNVGLIFTKGDLKEIK  102


 Score = 68.9 bits (167),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 31/34 (91%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            EEVAKYKVGAPARVGL+AP+DV+VPPGNTGLDPS
Sbjct  103  EEVAKYKVGAPARVGLIAPVDVIVPPGNTGLDPS  136



>ref|XP_010517390.1| PREDICTED: 60S acidic ribosomal protein P0-1-like [Camelina sativa]
Length=318

 Score =   170 bits (431),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 80/101 (79%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MAVK TKA+KKI YD KLCQLL+EY QIL+  ADNVGS QLQNIRKGLRGDSVVLMGKNT
Sbjct  1    MAVKATKAEKKIVYDSKLCQLLNEYPQILVVAADNVGSTQLQNIRKGLRGDSVVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            M+KRS+R+HA+ TGN   LNL+PLL GNVGLIF KGDLKEV
Sbjct  61   MMKRSVRIHADKTGNQGFLNLLPLLQGNVGLIFNKGDLKEV  101


 Score = 69.7 bits (169),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDVVV PGNTGLDPS
Sbjct  102  SEEVAKYKVGAPARVGLVAPIDVVVQPGNTGLDPS  136



>emb|CDY24932.1| BnaC03g22400D [Brassica napus]
Length=319

 Score =   170 bits (431),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MAVK TKA+KKI YD KLCQLL+EY QILI  ADNVGS QLQNIRKGLRGDSVVLMGKNT
Sbjct  1    MAVKATKAEKKIVYDSKLCQLLNEYPQILIVAADNVGSTQLQNIRKGLRGDSVVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            M+KRS+++HA+ TGN   LNL+PLL GNVGLIFTKGDLKEV
Sbjct  61   MMKRSVKLHAQKTGNDGFLNLMPLLQGNVGLIFTKGDLKEV  101


 Score = 69.3 bits (168),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDVVV PGNTGLDPS
Sbjct  102  SEEVAKYKVGAPARVGLVAPIDVVVQPGNTGLDPS  136



>ref|XP_006360336.1| PREDICTED: 60S acidic ribosomal protein P0-like [Solanum tuberosum]
Length=320

 Score =   169 bits (429),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 79/102 (77%), Positives = 91/102 (89%), Gaps = 0/102 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MA+K TK +KK+ YDQKLC+ LD Y QILI  ADNVGS+Q+Q IRKGLRGDSVVLMGKNT
Sbjct  1    MAIKPTKFEKKVIYDQKLCKYLDSYNQILIVNADNVGSSQMQGIRKGLRGDSVVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            M+KRS+R+HA++TGN A LNLIPLLVGNVGLIFTKGDLKE+K
Sbjct  61   MMKRSVRIHAKSTGNDAFLNLIPLLVGNVGLIFTKGDLKEIK  102


 Score = 68.9 bits (167),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 32/34 (94%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            EEVAKYKVGAPARVGLVAP+DV+VPPGNTGLDPS
Sbjct  103  EEVAKYKVGAPARVGLVAPVDVIVPPGNTGLDPS  136



>gb|KFK36893.1| hypothetical protein AALP_AA4G185700 [Arabis alpina]
Length=318

 Score =   166 bits (421),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 77/101 (76%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MA+K TK +KKI YD KLCQLL+EY QIL+  ADNVGS QLQ+IRKGLRGDSVVLMGKNT
Sbjct  1    MAIKATKGEKKIVYDSKLCQLLNEYPQILVVAADNVGSTQLQSIRKGLRGDSVVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            M+KRS+R+HA+ TGN   L+L+PLL GNVGLIFTKGDLKEV
Sbjct  61   MMKRSVRIHADKTGNDCFLSLLPLLQGNVGLIFTKGDLKEV  101


 Score = 71.6 bits (174),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 35/35 (100%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS
Sbjct  102  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  136



>emb|CDY60988.1| BnaA03g56530D [Brassica napus]
Length=318

 Score =   169 bits (427),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 80/101 (79%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MAVK TKA+KKI YD KLCQLL+E+ QILI  ADNVGS QLQNIRKGLRGDSVVLMGKNT
Sbjct  1    MAVKATKAEKKIVYDSKLCQLLNEFPQILIVAADNVGSTQLQNIRKGLRGDSVVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            M+KRS+++HA+ TGN   LNL+PLL GNVGLIFTKGDLKEV
Sbjct  61   MMKRSVKLHAQKTGNDGFLNLMPLLQGNVGLIFTKGDLKEV  101


 Score = 69.3 bits (168),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDVVV PGNTGLDPS
Sbjct  102  SEEVAKYKVGAPARVGLVAPIDVVVQPGNTGLDPS  136



>ref|XP_007016138.1| Ribosomal protein L10 family protein [Theobroma cacao]
 gb|EOY33757.1| Ribosomal protein L10 family protein [Theobroma cacao]
Length=321

 Score =   168 bits (425),  Expect(2) = 6e-54, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 90/102 (88%), Gaps = 0/102 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            M V  +K +KK  YDQKLC+LLDEY+Q+LI  ADNVGS Q+QNIRKGLRG+SVVLMGKNT
Sbjct  1    MVVNTSKREKKEKYDQKLCRLLDEYSQVLIVAADNVGSTQVQNIRKGLRGESVVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            M+KRSIR+HAENT N AI NLIPLLVGNVGLIFTKGDLKEV+
Sbjct  61   MMKRSIRLHAENTNNEAIRNLIPLLVGNVGLIFTKGDLKEVR  102


 Score = 70.1 bits (170),  Expect(2) = 6e-54, Method: Compositional matrix adjust.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            EEVAKYKVGAPARVGL+APIDVVVPPGNTGLDPS
Sbjct  103  EEVAKYKVGAPARVGLIAPIDVVVPPGNTGLDPS  136



>gb|KDP46515.1| hypothetical protein JCGZ_08487 [Jatropha curcas]
Length=319

 Score =   172 bits (435),  Expect(2) = 9e-54, Method: Compositional matrix adjust.
 Identities = 79/102 (77%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MA+K TKAQKK  YDQKLC+LLDEY+QIL+  ADNVGSNQLQ+IR+GLRGDS+VLMGKNT
Sbjct  1    MAIKPTKAQKKTQYDQKLCRLLDEYSQILVVGADNVGSNQLQSIRRGLRGDSIVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            M+KRSI++HAE TGN A  +L+PLLVGNVGL+FTKGDLKEV+
Sbjct  61   MMKRSIKLHAEKTGNDAFNSLVPLLVGNVGLVFTKGDLKEVR  102


 Score = 65.5 bits (158),  Expect(2) = 9e-54, Method: Compositional matrix adjust.
 Identities = 31/34 (91%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            EE+AKYKVGAPARVGL+APIDVVVPPG TGLDPS
Sbjct  103  EEIAKYKVGAPARVGLIAPIDVVVPPGPTGLDPS  136



>gb|EYU43501.1| hypothetical protein MIMGU_mgv1a010103mg [Erythranthe guttata]
Length=321

 Score =   167 bits (424),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 90/101 (89%), Gaps = 1/101 (1%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MA K +KA KKIAYD+KLC LLDEYTQ+L+AVADNVGS QLQNIR  LRGDSVVLMGKNT
Sbjct  1    MAPKVSKADKKIAYDKKLCNLLDEYTQVLVAVADNVGSTQLQNIRSALRGDSVVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            M+KRSIR+H+ENTGN AIL LI LL GNVGLIFTKGDLKEV
Sbjct  61   MMKRSIRIHSENTGNKAILALIDLL-GNVGLIFTKGDLKEV  100


 Score = 69.7 bits (169),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            +EEVAK+KVGAPARVGLVAPIDV+VPPGNTGLDPS
Sbjct  101  TEEVAKFKVGAPARVGLVAPIDVIVPPGNTGLDPS  135



>ref|XP_009799989.1| PREDICTED: 60S acidic ribosomal protein P0-like [Nicotiana sylvestris]
Length=319

 Score =   167 bits (424),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MAVK TKA+KK+ YD+KLC+LLD Y QILI  ADNVGSNQLQ IRKGLRGDS+VLMGKNT
Sbjct  1    MAVKVTKAEKKVNYDKKLCKLLDTYQQILIVGADNVGSNQLQMIRKGLRGDSIVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            M+KRSIR+HAE TGN A L LIP LVGNVGLIFT+GDLKEV
Sbjct  61   MMKRSIRIHAEKTGNNAFLALIPCLVGNVGLIFTRGDLKEV  101


 Score = 69.3 bits (168),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 33/35 (94%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            S+EV+KYKVGAPARVGLVAPIDVVVPPGNTGLDPS
Sbjct  102  SDEVSKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  136



>ref|XP_009133397.1| PREDICTED: 60S acidic ribosomal protein P0-1 [Brassica rapa]
Length=319

 Score =   167 bits (424),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 80/101 (79%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MAVK TKA+KKI YD KLCQLL+E+ QILI  ADNVGS QLQNIRKGLRGDSVVLMGKNT
Sbjct  1    MAVKATKAEKKIVYDLKLCQLLNEFPQILIVAADNVGSTQLQNIRKGLRGDSVVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            M+KRS+++HA+ TGN   LNL+PLL GNVGLIFTKGDLKEV
Sbjct  61   MMKRSVKLHAQKTGNDGFLNLMPLLQGNVGLIFTKGDLKEV  101


 Score = 69.3 bits (168),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDVVV PGNTGLDPS
Sbjct  102  SEEVAKYKVGAPARVGLVAPIDVVVQPGNTGLDPS  136



>emb|CDP14047.1| unnamed protein product [Coffea canephora]
Length=320

 Score =   185 bits (469),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/101 (87%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            M  K +KA KKIAYDQKLCQLLDEY+Q+LIAVADNVGSNQLQNIRKGLRGDS+VLMGKNT
Sbjct  1    MVTKVSKADKKIAYDQKLCQLLDEYSQVLIAVADNVGSNQLQNIRKGLRGDSIVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            M+KR+IRVHAE TGN AILNLIPLLVGNVGLIFTKGDLKE+
Sbjct  61   MMKRTIRVHAEKTGNQAILNLIPLLVGNVGLIFTKGDLKEI  101


 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAP+DVVVPPGNTGLDPS
Sbjct  102  SEEVAKYKVGAPARVGLVAPVDVVVPPGNTGLDPS  136



>ref|XP_010689885.1| PREDICTED: 60S acidic ribosomal protein P0 [Beta vulgaris subsp. 
vulgaris]
Length=321

 Score =   167 bits (423),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 90/102 (88%), Gaps = 0/102 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MAVK TKA+KKIAYDQKLC LLDE++Q+LIA ADNVGSNQLQ IR GLRGDSVVLMGKNT
Sbjct  1    MAVKPTKAEKKIAYDQKLCNLLDEFSQVLIASADNVGSNQLQGIRSGLRGDSVVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            M+KRSIR+HAE TGN  +  L  LLVGNVGLIFTKGDLKEV+
Sbjct  61   MMKRSIRLHAEKTGNDNLRKLEQLLVGNVGLIFTKGDLKEVR  102


 Score = 68.9 bits (167),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 32/34 (94%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            EE++KYKVGAPARVGLVAPIDVVVPPGNTGLDPS
Sbjct  103  EEISKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  136



>ref|XP_006296009.1| hypothetical protein CARUB_v10025153mg [Capsella rubella]
 gb|EOA28907.1| hypothetical protein CARUB_v10025153mg [Capsella rubella]
Length=319

 Score =   167 bits (424),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 79/101 (78%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MAVK TKA+KK+ YD KLCQLL+EY QIL+  ADNVGS QLQNIRKGLR DSVVLMGKNT
Sbjct  1    MAVKVTKAEKKVVYDSKLCQLLNEYPQILVVAADNVGSTQLQNIRKGLRRDSVVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            M+KRS+R+HA+ TGN A L+L+PLL GNVGLIFTKGDLKEV
Sbjct  61   MMKRSVRIHADETGNQAFLSLLPLLQGNVGLIFTKGDLKEV  101


 Score = 68.2 bits (165),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 33/35 (94%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLV PIDVVV PGNTGLDPS
Sbjct  102  SEEVAKYKVGAPARVGLVTPIDVVVQPGNTGLDPS  136



>gb|KJB19895.1| hypothetical protein B456_003G123400 [Gossypium raimondii]
Length=321

 Score =   165 bits (418),  Expect(2) = 4e-53, Method: Compositional matrix adjust.
 Identities = 75/102 (74%), Positives = 87/102 (85%), Gaps = 0/102 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            M +   K +KK  YDQKLC+LLDEYTQ+L+  ADNVGS Q+QNIRKGLRGDS++LMGKNT
Sbjct  1    MVLNPAKREKKSQYDQKLCRLLDEYTQVLVVAADNVGSTQMQNIRKGLRGDSIILMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            M+KRSIR+HAE TGN A  NL+PLLVGNVG IFTKGDLKEV+
Sbjct  61   MMKRSIRLHAERTGNDAFKNLLPLLVGNVGFIFTKGDLKEVR  102


 Score = 69.7 bits (169),  Expect(2) = 4e-53, Method: Compositional matrix adjust.
 Identities = 32/34 (94%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            EE+AKYKVGAPARVGLVAPIDV+VPPGNTGLDPS
Sbjct  103  EEIAKYKVGAPARVGLVAPIDVIVPPGNTGLDPS  136



>ref|XP_009791710.1| PREDICTED: 60S acidic ribosomal protein P0 [Nicotiana sylvestris]
Length=321

 Score =   184 bits (466),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 87/101 (86%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MA K TKA+KKIAYD K+CQLLDEYTQ+L+A ADNVGS QLQNIRKGLRGDSVVLMGKNT
Sbjct  1    MAPKATKAEKKIAYDSKMCQLLDEYTQVLVAAADNVGSTQLQNIRKGLRGDSVVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            M+KR+IRVHAE TGN  ILNLIPLLVGNVGLIFTKGDLKEV
Sbjct  61   MMKRTIRVHAEKTGNNTILNLIPLLVGNVGLIFTKGDLKEV  101


 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAP+DVVVPPGNTGLDPS
Sbjct  102  SEEVAKYKVGAPARVGLVAPVDVVVPPGNTGLDPS  136



>ref|XP_009608105.1| PREDICTED: 60S acidic ribosomal protein P0 [Nicotiana tomentosiformis]
Length=320

 Score =   183 bits (464),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/101 (85%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MA K TKA+KKIAYD K+CQLLDEYTQ+L+A ADNVGS QLQNIRKGLRGDS+VLMGKNT
Sbjct  1    MAPKATKAEKKIAYDSKMCQLLDEYTQVLVAAADNVGSKQLQNIRKGLRGDSIVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            M+KR+IRVHAE TGN  ILNLIPLLVGNVGLIFTKGDLKEV
Sbjct  61   MMKRTIRVHAEKTGNNTILNLIPLLVGNVGLIFTKGDLKEV  101


 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAP+DVVVPPGNTGLDPS
Sbjct  102  SEEVAKYKVGAPARVGLVAPVDVVVPPGNTGLDPS  136



>ref|NP_001176776.1| Os12g0133050 [Oryza sativa Japonica Group]
 dbj|BAH95504.1| Os12g0133050 [Oryza sativa Japonica Group]
Length=110

 Score =   176 bits (446),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 96/102 (94%), Gaps = 0/102 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MA+K+TKA+KK+AYD+KLCQLLDEYT++LIAVADNVGSNQLQ IRKGLRGDS+VLMGKNT
Sbjct  1    MAIKRTKAEKKVAYDKKLCQLLDEYTKVLIAVADNVGSNQLQEIRKGLRGDSIVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            +I+R I+VHA+NTGN   L L+PLLVGNVGLIFTKGDLKEV+
Sbjct  61   LIRRCIKVHADNTGNKDFLELMPLLVGNVGLIFTKGDLKEVR  102



>ref|XP_009592351.1| PREDICTED: 60S acidic ribosomal protein P0-like [Nicotiana tomentosiformis]
Length=319

 Score =   164 bits (415),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 79/101 (78%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MAVK TK +KK+ YD+KLC+LLD Y QILI  ADNVGSNQLQ IRKGLRGDS+VLMGKNT
Sbjct  1    MAVKVTKGEKKVNYDKKLCKLLDTYQQILIVGADNVGSNQLQMIRKGLRGDSIVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            M+KRSIR+HAE TGN + L LIP LVGNVGLIFT+GDLKEV
Sbjct  61   MMKRSIRIHAEKTGNNSFLALIPCLVGNVGLIFTRGDLKEV  101


 Score = 69.3 bits (168),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 33/35 (94%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            S+EV+KYKVGAPARVGLVAPIDVVVPPGNTGLDPS
Sbjct  102  SDEVSKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  136



>ref|XP_006350830.1| PREDICTED: 60S acidic ribosomal protein P0-like [Solanum tuberosum]
Length=318

 Score =   164 bits (414),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MAVK TKA+KK +YD+KLC+LLD Y QILI  ADNVGSNQLQ IRKGLRGDS+VLMGKNT
Sbjct  1    MAVKVTKAEKKASYDKKLCKLLDTYQQILIVGADNVGSNQLQMIRKGLRGDSIVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            M+KRSIR+HAE TGN A L LI  LVGNVGLIFTKGDLKEV
Sbjct  61   MMKRSIRIHAEKTGNNAFLALIECLVGNVGLIFTKGDLKEV  101


 Score = 69.7 bits (169),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 33/35 (94%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            S+EV+KYKVGAPARVGLVAPIDVVVPPGNTGLDPS
Sbjct  102  SDEVSKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  136



>ref|XP_004241171.1| PREDICTED: 60S acidic ribosomal protein P0-like [Solanum lycopersicum]
Length=318

 Score =   164 bits (414),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MAVK TKA+KK+ YD+KLC+LLD Y QILI  ADNVGSNQLQ IRKGLRGDS+VLMGKNT
Sbjct  1    MAVKVTKAEKKVNYDKKLCKLLDTYQQILIVGADNVGSNQLQMIRKGLRGDSIVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            M+KRSIR+HAE TGN A L LI  LVGNVGLIFTKGDLKEV
Sbjct  61   MMKRSIRIHAEKTGNNAFLALIECLVGNVGLIFTKGDLKEV  101


 Score = 69.7 bits (169),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 33/35 (94%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            S+EV+KYKVGAPARVGLVAPIDVVVPPGNTGLDPS
Sbjct  102  SDEVSKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  136



>sp|P29764.1|RLA0_OXYRB RecName: Full=60S acidic ribosomal protein P0; AltName: Full=Light-induced 
34 kDa protein [Oxybasis rubra]
 emb|CAA33276.1| 34kD light-induced protein [Oxybasis rubra]
Length=321

 Score =   164 bits (416),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 79/102 (77%), Positives = 90/102 (88%), Gaps = 0/102 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MAVK TKA+KKIAYDQKLCQLLDEY+Q+LIA ADNVGSNQLQ IR GLRGDS+VLMGKNT
Sbjct  1    MAVKPTKAEKKIAYDQKLCQLLDEYSQVLIASADNVGSNQLQAIRIGLRGDSIVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            M+KRSIR+HAENTGN  + N+  L + NVGLIFTKGDL +V+
Sbjct  61   MMKRSIRLHAENTGNENLRNVEQLFLPNVGLIFTKGDLNQVR  102


 Score = 68.2 bits (165),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 31/34 (91%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            EE++KYKVGAPAR GLVAPIDVVVPPGNTGLDPS
Sbjct  103  EEISKYKVGAPARFGLVAPIDVVVPPGNTGLDPS  136



>ref|XP_004307622.1| PREDICTED: 60S acidic ribosomal protein P0 [Fragaria vesca subsp. 
vesca]
Length=321

 Score =   160 bits (405),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = +2

Query  197  KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  376
            K +KA+KKI YD KLC LL++Y Q+LI  ADNVGS QLQNIRKGLRGDS VLMGKNTM+K
Sbjct  3    KLSKAEKKINYDAKLCSLLEDYGQVLIVAADNVGSTQLQNIRKGLRGDSTVLMGKNTMMK  62

Query  377  RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            RSI++HA  TGN A LNL+PLLVGNVGLIFTKGDLKEV
Sbjct  63   RSIKIHAAKTGNDAYLNLVPLLVGNVGLIFTKGDLKEV  100


 Score = 72.0 bits (175),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 35/35 (100%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS
Sbjct  101  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  135



>ref|XP_004307662.1| PREDICTED: 60S acidic ribosomal protein P0 [Fragaria vesca subsp. 
vesca]
Length=321

 Score =   160 bits (405),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = +2

Query  197  KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  376
            K +KA+KKI YD KLC LL++Y Q+LI  ADNVGS QLQNIRKGLRGDS VLMGKNTM+K
Sbjct  3    KLSKAEKKINYDAKLCSLLEDYGQVLIVAADNVGSTQLQNIRKGLRGDSTVLMGKNTMMK  62

Query  377  RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            RSI++HA  TGN A LNL+PLLVGNVGLIFTKGDLKEV
Sbjct  63   RSIKIHAAKTGNDAYLNLVPLLVGNVGLIFTKGDLKEV  100


 Score = 72.0 bits (175),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 35/35 (100%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS
Sbjct  101  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  135



>ref|NP_001275012.1| 60S acidic ribosomal protein P0-like [Solanum tuberosum]
 gb|ABB29933.1| P0 ribosomal protein-like [Solanum tuberosum]
 gb|ABB87111.1| P0 ribosomal protein-like [Solanum tuberosum]
Length=320

 Score =   181 bits (459),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MA K TKA+KKIAYD K+CQLLD++TQ+L+A ADNVGSNQLQ+IRKGLRGDSVVLMGKNT
Sbjct  1    MAPKATKAEKKIAYDTKMCQLLDDFTQVLVAAADNVGSNQLQSIRKGLRGDSVVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            M+KR+IRVHAE TGN  ILNLIPLLVGNVGLIFTKGDLKEV
Sbjct  61   MMKRTIRVHAEKTGNETILNLIPLLVGNVGLIFTKGDLKEV  101


 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAP+DVVVPPGNTGLDPS
Sbjct  102  SEEVAKYKVGAPARVGLVAPVDVVVPPGNTGLDPS  136



>ref|XP_004239781.1| PREDICTED: 60S acidic ribosomal protein P0 [Solanum lycopersicum]
Length=321

 Score =   181 bits (459),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MA K TKA+KKIAYD K+CQLLD++TQ+L+A ADNVGSNQLQ+IRKGLRGDSVVLMGKNT
Sbjct  1    MAPKATKAEKKIAYDTKMCQLLDDFTQVLVAAADNVGSNQLQSIRKGLRGDSVVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            M+KR+IRVHAE TGN  ILNLIPLLVGNVGLIFTKGDLKEV
Sbjct  61   MMKRTIRVHAEKTGNETILNLIPLLVGNVGLIFTKGDLKEV  101


 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAP+DVVVPPGNTGLDPS
Sbjct  102  SEEVAKYKVGAPARVGLVAPVDVVVPPGNTGLDPS  136



>gb|ABO31368.1| 60S ribosomal protein [Gossypium hirsutum]
Length=228

 Score =   161 bits (408),  Expect(2) = 7e-52, Method: Compositional matrix adjust.
 Identities = 74/96 (77%), Positives = 85/96 (89%), Gaps = 0/96 (0%)
 Frame = +2

Query  206  KAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIKRSI  385
            K +KK  YDQKLC+LLDEYTQ+L+  ADNVGS Q+QNIRKGLRGDS++LMGKNTM+KRSI
Sbjct  3    KREKKSQYDQKLCRLLDEYTQVLVVAADNVGSTQMQNIRKGLRGDSIILMGKNTMMKRSI  62

Query  386  RVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            R+HAE TGN A  NL+PLLVGNVG IFTKGDLKEV+
Sbjct  63   RLHAERTGNDAFKNLLPLLVGNVGFIFTKGDLKEVR  98


 Score = 69.7 bits (169),  Expect(2) = 7e-52, Method: Compositional matrix adjust.
 Identities = 32/34 (94%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            EE+AKYKVGAPARVGLVAPIDV+VPPGNTGLDPS
Sbjct  99   EEIAKYKVGAPARVGLVAPIDVIVPPGNTGLDPS  132



>ref|XP_002440235.1| hypothetical protein SORBIDRAFT_09g028230 [Sorghum bicolor]
 gb|EES18665.1| hypothetical protein SORBIDRAFT_09g028230 [Sorghum bicolor]
Length=319

 Score =   164 bits (414),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 76/102 (75%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MA+K+TKA+KKIAYD+KLC LLDEYT++L+A+ADNVGS QLQ+IR+GLRGDS+VLMGKNT
Sbjct  1    MAIKRTKAEKKIAYDKKLCALLDEYTKVLVALADNVGSKQLQDIRRGLRGDSIVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            +I+R I+V+AE TGN A   L+ LLVGNVGLIFTKGDLKEV+
Sbjct  61   LIRRCIKVYAEKTGNNAFDPLMDLLVGNVGLIFTKGDLKEVR  102


 Score = 66.6 bits (161),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 32/34 (94%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            EEVAKYKVGAPARVGLVAP+DVVV PGNTGLDPS
Sbjct  103  EEVAKYKVGAPARVGLVAPVDVVVSPGNTGLDPS  136



>ref|NP_001060923.1| Os08g0130500 [Oryza sativa Japonica Group]
 sp|P41095.3|RLA0_ORYSJ RecName: Full=60S acidic ribosomal protein P0 [Oryza sativa Japonica 
Group]
 pdb|3J61|QQ Chain q, Localization Of The Large Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
 dbj|BAA04668.1| acidic ribosomal protein P0 [Oryza sativa Japonica Group]
 dbj|BAC66723.1| 60S acidic ribosomal protein P0 [Oryza sativa Japonica Group]
 dbj|BAF22837.1| Os08g0130500 [Oryza sativa Japonica Group]
 dbj|BAG89244.1| unnamed protein product [Oryza sativa Japonica Group]
Length=319

 Score =   179 bits (454),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 96/102 (94%), Gaps = 0/102 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MA+K+TKA+KK+AYD+KLCQLLDEYT++LIAVADNVGSNQLQ IRKGLRGDS+VLMGKNT
Sbjct  1    MAIKRTKAEKKVAYDKKLCQLLDEYTKVLIAVADNVGSNQLQEIRKGLRGDSIVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            +I+R I+VHA+NTGN   L L+PLLVGNVGLIFTKGDLKEV+
Sbjct  61   LIRRCIKVHADNTGNKEFLELMPLLVGNVGLIFTKGDLKEVR  102



>gb|EYU19991.1| hypothetical protein MIMGU_mgv1a0100891mg, partial [Erythranthe 
guttata]
Length=109

 Score =   172 bits (435),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 84/101 (83%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MA K +KA KKIAYD+KLC LLDEYTQ+L+AVADNVGS QLQNIR  LRGDSVVLMGKNT
Sbjct  1    MAPKVSKADKKIAYDKKLCNLLDEYTQVLVAVADNVGSTQLQNIRSALRGDSVVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            M+KRSIR+H+ENTGN AIL LI LLVGNVGLIFTKGDLKEV
Sbjct  61   MMKRSIRIHSENTGNKAILALIDLLVGNVGLIFTKGDLKEV  101



>gb|KDO69056.1| hypothetical protein CISIN_1g036252mg [Citrus sinensis]
Length=318

 Score =   162 bits (410),  Expect(2) = 6e-51, Method: Compositional matrix adjust.
 Identities = 76/101 (75%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MA + +KA+KKIAYD +LC+LL+EY+QILI  ADNVGSNQLQ+IR GLR  S+VLMGKNT
Sbjct  1    MATRLSKAEKKIAYDARLCKLLEEYSQILIVAADNVGSNQLQHIRAGLRDHSIVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            M+KRSIR+HAE TGN  +LNLIPLL GNVG+IFTKGDLKEV
Sbjct  61   MMKRSIRLHAERTGNRDLLNLIPLLQGNVGMIFTKGDLKEV  101


 Score = 65.9 bits (159),  Expect(2) = 6e-51, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            S+EV+K+KV APARVGLVAPIDVVVPPGNTGLDPS
Sbjct  102  SDEVSKHKVAAPARVGLVAPIDVVVPPGNTGLDPS  136



>ref|XP_006435696.1| hypothetical protein CICLE_v10033862mg [Citrus clementina]
 ref|XP_006486351.1| PREDICTED: 60S acidic ribosomal protein P0-like [Citrus sinensis]
 gb|ESR48936.1| hypothetical protein CICLE_v10033862mg [Citrus clementina]
Length=318

 Score =   162 bits (410),  Expect(2) = 6e-51, Method: Compositional matrix adjust.
 Identities = 76/101 (75%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MA + +KA+KKIAYD +LC+LL+EY+QILI  ADNVGSNQLQ+IR GLR  S+VLMGKNT
Sbjct  1    MATRLSKAEKKIAYDARLCKLLEEYSQILIVAADNVGSNQLQHIRAGLRDHSIVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            M+KRSIR+HAE TGN  +LNLIPLL GNVG+IFTKGDLKEV
Sbjct  61   MMKRSIRLHAERTGNRDLLNLIPLLQGNVGMIFTKGDLKEV  101


 Score = 65.9 bits (159),  Expect(2) = 6e-51, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            S+EV+K+KV APARVGLVAPIDVVVPPGNTGLDPS
Sbjct  102  SDEVSKHKVAAPARVGLVAPIDVVVPPGNTGLDPS  136



>gb|ABA91328.1| 60S acidic ribosomal protein P0, putative, expressed [Oryza sativa 
Japonica Group]
 gb|EAY79838.1| hypothetical protein OsI_34997 [Oryza sativa Indica Group]
 gb|EAZ41411.1| hypothetical protein OsJ_25933 [Oryza sativa Japonica Group]
Length=320

 Score =   178 bits (451),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 96/102 (94%), Gaps = 0/102 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MA+K+TKA+KK+AYD+KLCQLLDEYT++LIAVADNVGSNQLQ IRKGLRGDS+VLMGKNT
Sbjct  1    MAIKRTKAEKKVAYDKKLCQLLDEYTKVLIAVADNVGSNQLQEIRKGLRGDSIVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            +I+R I+VHA+NTGN   L L+PLLVGNVGLIFTKGDLKEV+
Sbjct  61   LIRRCIKVHADNTGNKDFLELMPLLVGNVGLIFTKGDLKEVR  102



>gb|EAY82182.1| hypothetical protein OsI_37384 [Oryza sativa Indica Group]
 emb|CBX24392.1| hypothetical_protein [Oryza glaberrima]
Length=320

 Score =   178 bits (451),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 96/102 (94%), Gaps = 0/102 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MA+K+TKA+KK+AYD+KLCQLLDEYT++LIAVADNVGSNQLQ IRKGLRGDS+VLMGKNT
Sbjct  1    MAIKRTKAEKKVAYDKKLCQLLDEYTKVLIAVADNVGSNQLQEIRKGLRGDSIVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            +I+R I+VHA+NTGN   L L+PLLVGNVGLIFTKGDLKEV+
Sbjct  61   LIRRCIKVHADNTGNKDFLELMPLLVGNVGLIFTKGDLKEVR  102



>ref|XP_004287422.1| PREDICTED: 60S acidic ribosomal protein P0-like [Fragaria vesca 
subsp. vesca]
Length=321

 Score =   157 bits (398),  Expect(2) = 8e-51, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = +2

Query  197  KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  376
            K +KA KK  YD KLC+LLD+Y Q+L+  ADNVGS QLQNIRKGLRGDS VLMGKNTM+K
Sbjct  3    KLSKADKKTNYDAKLCKLLDDYGQVLVVAADNVGSTQLQNIRKGLRGDSTVLMGKNTMMK  62

Query  377  RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            RSI++HA  TGN A L+L+PLLVGNVGLIFTKGDLKEV+
Sbjct  63   RSIKIHAARTGNDAYLSLVPLLVGNVGLIFTKGDLKEVR  101


 Score = 70.1 bits (170),  Expect(2) = 8e-51, Method: Compositional matrix adjust.
 Identities = 34/34 (100%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS
Sbjct  102  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  135



>emb|CBX25428.1| hypothetical_protein [Oryza glaberrima]
Length=322

 Score =   177 bits (450),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 96/102 (94%), Gaps = 0/102 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MA+K+TKA+KK+AYD+KLCQLLDEYT++LIAVADNVGSNQLQ IRKGLRGDS+VLMGKNT
Sbjct  1    MAIKRTKAEKKVAYDKKLCQLLDEYTKVLIAVADNVGSNQLQEIRKGLRGDSIVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            +I+R I+VHA+NTGN   L L+PLLVGNVGLIFTKGDLKEV+
Sbjct  61   LIRRCIKVHADNTGNKDFLELMPLLVGNVGLIFTKGDLKEVR  102



>gb|ABA95724.1| 60S acidic ribosomal protein P0, putative, expressed [Oryza sativa 
Japonica Group]
 gb|EAZ19563.1| hypothetical protein OsJ_35136 [Oryza sativa Japonica Group]
Length=320

 Score =   177 bits (450),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 96/102 (94%), Gaps = 0/102 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MA+K+TKA+KK+AYD+KLCQLLDEYT++LIAVADNVGSNQLQ IRKGLRGDS+VLMGKNT
Sbjct  1    MAIKRTKAEKKVAYDKKLCQLLDEYTKVLIAVADNVGSNQLQEIRKGLRGDSIVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            +I+R I+VHA+NTGN   L L+PLLVGNVGLIFTKGDLKEV+
Sbjct  61   LIRRCIKVHADNTGNKDFLELMPLLVGNVGLIFTKGDLKEVR  102



>ref|XP_006659092.1| PREDICTED: 60S acidic ribosomal protein P0-like [Oryza brachyantha]
Length=319

 Score =   177 bits (450),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 95/102 (93%), Gaps = 0/102 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MA+K+TKA+KK+AYD+KLCQLLDEYT++LIAVADNVGSNQLQ IRKGLRGDS+VLMGKNT
Sbjct  1    MAIKRTKAEKKVAYDKKLCQLLDEYTKVLIAVADNVGSNQLQEIRKGLRGDSIVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            +I+R I+VHAE TGN   L L+PLLVGNVGLIFTKGDLKEV+
Sbjct  61   LIRRCIKVHAEQTGNKEFLELMPLLVGNVGLIFTKGDLKEVR  102



>dbj|BAC10912.1| putative 60S acidic ribosomal protein P0 [Zinnia elegans]
Length=203

 Score =   173 bits (438),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 82/99 (83%), Positives = 92/99 (93%), Gaps = 0/99 (0%)
 Frame = +2

Query  197  KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  376
            K +KA KKIAYDQKLCQLLD+Y Q+L+A ADNVGSNQLQNIR+GLRGDSV+LMGKNTM+K
Sbjct  3    KVSKADKKIAYDQKLCQLLDDYNQVLVAAADNVGSNQLQNIRQGLRGDSVILMGKNTMMK  62

Query  377  RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            RSIR+H+E TGN A LNLIPLLVGNVGLIFTKGDLKEV+
Sbjct  63   RSIRMHSEKTGNKAYLNLIPLLVGNVGLIFTKGDLKEVR  101



>gb|AID52928.1| 60S acidic ribosomal protein P0 [Carthamus tinctorius]
Length=321

 Score =   176 bits (447),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 82/99 (83%), Positives = 92/99 (93%), Gaps = 0/99 (0%)
 Frame = +2

Query  197  KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  376
            K +KA KKIAYDQKLCQLLD+YTQ+L+A ADNVGSNQLQNIR GLRGDSV+LMGKNTM+K
Sbjct  3    KVSKADKKIAYDQKLCQLLDDYTQVLVAAADNVGSNQLQNIRHGLRGDSVILMGKNTMMK  62

Query  377  RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            RS+R+H+E TGN A LNLIPLLVGNVGLIFTKGDLKEV+
Sbjct  63   RSVRMHSEKTGNKAFLNLIPLLVGNVGLIFTKGDLKEVR  101



>ref|XP_001759851.1| predicted protein [Physcomitrella patens]
 gb|EDQ75355.1| predicted protein [Physcomitrella patens]
Length=318

 Score =   157 bits (396),  Expect(2) = 6e-50, Method: Compositional matrix adjust.
 Identities = 75/102 (74%), Positives = 86/102 (84%), Gaps = 0/102 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            M  K TKA+KK+ YD+KL QLL+EYTQ+LI  ADNVGS QLQ+IRKGLR DS+VLMGKNT
Sbjct  1    MGFKGTKAEKKVLYDKKLIQLLEEYTQVLICAADNVGSKQLQSIRKGLRPDSIVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            M+KRSIR+HAE TGN     L+P LVGNVGLIFTKGDLKEV+
Sbjct  61   MMKRSIRIHAEKTGNKDYEELLPALVGNVGLIFTKGDLKEVR  102


 Score = 67.4 bits (163),  Expect(2) = 6e-50, Method: Compositional matrix adjust.
 Identities = 31/34 (91%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            EE+ KYKVGAPARVGLVAPIDV+VPPGNTGLDPS
Sbjct  103  EEIGKYKVGAPARVGLVAPIDVIVPPGNTGLDPS  136



>ref|XP_001759592.1| predicted protein [Physcomitrella patens]
 gb|EDQ75504.1| predicted protein [Physcomitrella patens]
Length=319

 Score =   154 bits (390),  Expect(2) = 9e-50, Method: Compositional matrix adjust.
 Identities = 74/102 (73%), Positives = 84/102 (82%), Gaps = 0/102 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            M  K TKA+KK  YD+KL QLL+EY+Q+LI  ADNVGS QLQ IRKGLR DS+VLMGKNT
Sbjct  1    MGFKGTKAEKKALYDKKLVQLLEEYSQVLICAADNVGSKQLQEIRKGLRPDSIVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            M+KRSIR+HAE TGN     L+P LVGNVGLIFTKGDLKEV+
Sbjct  61   MMKRSIRIHAEKTGNKDYEELLPALVGNVGLIFTKGDLKEVR  102


 Score = 69.7 bits (169),  Expect(2) = 9e-50, Method: Compositional matrix adjust.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            EE+AKYKVGAPARVGLVAPIDVVVPPGNTGLDPS
Sbjct  103  EEIAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  136



>ref|XP_008779031.1| PREDICTED: 60S acidic ribosomal protein P0-like [Phoenix dactylifera]
Length=128

 Score =   168 bits (425),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 78/102 (76%), Positives = 91/102 (89%), Gaps = 0/102 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            M VK +K++KK+ YD+KLC LLDEY+Q+LIA ADNVGSNQLQNIR GLRGDSVVLMGKNT
Sbjct  1    MTVKLSKSEKKVEYDKKLCSLLDEYSQVLIAAADNVGSNQLQNIRSGLRGDSVVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            +I+R I++HAE TGN   LNL+PLLVGNVGLIFTKGDLKEV+
Sbjct  61   LIRRCIKIHAEKTGNKDYLNLLPLLVGNVGLIFTKGDLKEVR  102



>gb|AIN39821.1| hypothetical protein, partial [Zoysia matrella]
Length=262

 Score =   169 bits (428),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MA+K+TKA+KKIAYD+KLCQLLDEYT++L+AVADNVGS QLQ+IR+GLRGDSVVLMGKNT
Sbjct  1    MAIKRTKAEKKIAYDKKLCQLLDEYTKVLVAVADNVGSKQLQDIRRGLRGDSVVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            +I+R I+VHAE TGNT    L  LLVGNVGLIFTKGDLKEV+
Sbjct  61   LIRRCIKVHAEKTGNTEFEQLSKLLVGNVGLIFTKGDLKEVR  102



>gb|EMT02739.1| 60S acidic ribosomal protein P0 [Aegilops tauschii]
Length=322

 Score =   148 bits (373),  Expect(2) = 7e-48, Method: Compositional matrix adjust.
 Identities = 70/103 (68%), Positives = 87/103 (84%), Gaps = 1/103 (1%)
 Frame = +2

Query  188  MAVKQ-TKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKN  364
            MA+K+ +K  KK AYDQKLCQLLDEY+++L+A ADNVGS+QL  IR+G+RG+SV+LMGKN
Sbjct  1    MAIKKPSKTDKKHAYDQKLCQLLDEYSRVLVASADNVGSSQLAEIRRGIRGESVMLMGKN  60

Query  365  TMIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            T+I+R I  HAE +GN  +  LIPLL GNVGLIFTKGDLKEV+
Sbjct  61   TLIRRCIAAHAERSGNADVKALIPLLQGNVGLIFTKGDLKEVR  103


 Score = 69.7 bits (169),  Expect(2) = 7e-48, Method: Compositional matrix adjust.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            EEVAKYKVGAPARVGL+APIDVVVPPGNTGLDPS
Sbjct  104  EEVAKYKVGAPARVGLIAPIDVVVPPGNTGLDPS  137



>gb|EMT17099.1| 60S acidic ribosomal protein P0 [Aegilops tauschii]
Length=320

 Score =   167 bits (424),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 92/102 (90%), Gaps = 0/102 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MA+K+TKA+KKIAYDQKLCQLL+EYT++LIAVADNVGS QLQ IRKGLRGDS+VLMGKNT
Sbjct  1    MAIKRTKAEKKIAYDQKLCQLLEEYTKVLIAVADNVGSKQLQEIRKGLRGDSIVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            +I+R I+VH+E TGN   L L  LLVGNVGLIFTKGDLKEV+
Sbjct  61   LIRRCIKVHSEKTGNKDFLELSNLLVGNVGLIFTKGDLKEVR  102


 Score = 48.5 bits (114),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            EEVAKYKVGAPARVGLVAP+DVVVPPGNTGLDPS
Sbjct  103  EEVAKYKVGAPARVGLVAPVDVVVPPGNTGLDPS  136



>dbj|BAJ94456.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=320

 Score =   167 bits (424),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 92/102 (90%), Gaps = 0/102 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MA+K+TKA+KKIAYDQKLCQLL+EYT++LIAVADNVGS QLQ IRKGLRGDS+VLMGKNT
Sbjct  1    MAIKRTKAEKKIAYDQKLCQLLEEYTKVLIAVADNVGSKQLQEIRKGLRGDSIVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            +I+R I+VH+E TGN   L L  LLVGNVGLIFTKGDLKEV+
Sbjct  61   LIRRCIKVHSEKTGNKDFLELSNLLVGNVGLIFTKGDLKEVR  102


 Score = 48.5 bits (114),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            EEVAKYKVGAPARVGLVAP+DVVVPPGNTGLDPS
Sbjct  103  EEVAKYKVGAPARVGLVAPVDVVVPPGNTGLDPS  136



>dbj|BAJ92405.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=320

 Score =   167 bits (424),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 92/102 (90%), Gaps = 0/102 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MA+K+TKA+KKIAYDQKLCQLL+EYT++LIAVADNVGS QLQ IRKGLRGDS+VLMGKNT
Sbjct  1    MAIKRTKAEKKIAYDQKLCQLLEEYTKVLIAVADNVGSKQLQEIRKGLRGDSIVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            +I+R I+VH+E TGN   L L  LLVGNVGLIFTKGDLKEV+
Sbjct  61   LIRRCIKVHSEKTGNKDFLELSNLLVGNVGLIFTKGDLKEVR  102


 Score = 48.5 bits (114),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            EEVAKYKVGAPARVGLVAP+DVVVPPGNTGLDPS
Sbjct  103  EEVAKYKVGAPARVGLVAPVDVVVPPGNTGLDPS  136



>ref|XP_010234277.1| PREDICTED: 60S acidic ribosomal protein P0 [Brachypodium distachyon]
Length=321

 Score =   164 bits (415),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/102 (76%), Positives = 92/102 (90%), Gaps = 0/102 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MA+K+TKA+KKIAYD+KLCQLL+EY+++LIAVADNVGS QLQ IRKGLRGDSVVLMGKNT
Sbjct  1    MAIKRTKAEKKIAYDKKLCQLLEEYSKVLIAVADNVGSKQLQEIRKGLRGDSVVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            +I+R I+VH+E TGN   L L  LL+GNVGLIFTKGDLKEV+
Sbjct  61   LIRRCIKVHSEKTGNKDYLELSNLLIGNVGLIFTKGDLKEVR  102


 Score = 48.1 bits (113),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            EEVAKYKVGAPARVGLVAP+DVVVPPGNTGLDPS
Sbjct  103  EEVAKYKVGAPARVGLVAPVDVVVPPGNTGLDPS  136



>ref|XP_004296403.1| PREDICTED: 60S acidic ribosomal protein P0-like [Fragaria vesca 
subsp. vesca]
Length=319

 Score =   164 bits (414),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 80/99 (81%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = +2

Query  197  KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  376
            K +KA+KKI YD KLC+ LDEY QILI  ADNVGSNQLQNIR+GLRG SVVLMGKNTM+K
Sbjct  3    KLSKAEKKINYDAKLCKHLDEYGQILIVAADNVGSNQLQNIRQGLRGHSVVLMGKNTMMK  62

Query  377  RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            RSI++HAE T N AILNL+PLLVGNVGLIFTKGDLKEVK
Sbjct  63   RSIKIHAEKTRNDAILNLVPLLVGNVGLIFTKGDLKEVK  101


 Score = 48.1 bits (113),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            EEVAKYKVGAPARVGLVAP+DVVVPPGNTGLDPS
Sbjct  102  EEVAKYKVGAPARVGLVAPVDVVVPPGNTGLDPS  135



>ref|XP_002983859.1| hypothetical protein SELMODRAFT_268802 [Selaginella moellendorffii]
 gb|EFJ14871.1| hypothetical protein SELMODRAFT_268802 [Selaginella moellendorffii]
Length=322

 Score =   145 bits (367),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 69/102 (68%), Positives = 85/102 (83%), Gaps = 0/102 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            M  K TK +KK  YD+K+  LL+ YT+ LI  ADNVGS QLQ IR+GLR +SVVLMGKNT
Sbjct  1    MGFKGTKQEKKEIYDRKMVDLLENYTKALICAADNVGSTQLQQIRRGLRPESVVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            ++KR+IR +AE +GNTA+L+L+PLLVGNVGLIFTKGDLKEV+
Sbjct  61   LMKRTIRTYAERSGNTAVLSLMPLLVGNVGLIFTKGDLKEVR  102


 Score = 66.2 bits (160),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 31/34 (91%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            EEVAKYKVGAPARVGLVAPIDV +PPG+TGLDPS
Sbjct  103  EEVAKYKVGAPARVGLVAPIDVTIPPGSTGLDPS  136



>ref|XP_002974292.1| hypothetical protein SELMODRAFT_149765 [Selaginella moellendorffii]
 ref|XP_002985667.1| hypothetical protein SELMODRAFT_181962 [Selaginella moellendorffii]
 gb|EFJ13245.1| hypothetical protein SELMODRAFT_181962 [Selaginella moellendorffii]
 gb|EFJ24514.1| hypothetical protein SELMODRAFT_149765 [Selaginella moellendorffii]
Length=318

 Score =   145 bits (366),  Expect(2) = 4e-46, Method: Compositional matrix adjust.
 Identities = 68/102 (67%), Positives = 85/102 (83%), Gaps = 0/102 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            M  K TK +KK  YD+K+  LL+ Y++ LI  ADNVGSNQLQ IR+GLR +SVVLMGKNT
Sbjct  1    MGFKGTKQEKKEVYDRKMVDLLETYSKALICAADNVGSNQLQQIRRGLRPESVVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            ++KR+IR +AE +GNT +L+L+PLLVGNVGLIFTKGDLKEV+
Sbjct  61   LMKRTIRTYAEKSGNTTVLSLMPLLVGNVGLIFTKGDLKEVR  102


 Score = 66.2 bits (160),  Expect(2) = 4e-46, Method: Compositional matrix adjust.
 Identities = 31/34 (91%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            EEVAKYKVGAPARVGLVAPIDV +PPG+TGLDPS
Sbjct  103  EEVAKYKVGAPARVGLVAPIDVTIPPGSTGLDPS  136



>gb|ACL52455.1| unknown [Zea mays]
Length=319

 Score =   163 bits (412),  Expect(2) = 6e-46, Method: Compositional matrix adjust.
 Identities = 77/102 (75%), Positives = 92/102 (90%), Gaps = 0/102 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MA+K+TKA+KKIAYD+KLC LLDEYT++LIA+ADNVGS QLQ+IR+GLRGDSVVLMGKNT
Sbjct  1    MAIKRTKAEKKIAYDKKLCSLLDEYTKVLIALADNVGSKQLQDIRRGLRGDSVVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            +I+R I+V+AE TGN     L+ LLVGNVGLIFTKGDLKEV+
Sbjct  61   LIRRCIKVYAEKTGNHTFDPLMDLLVGNVGLIFTKGDLKEVR  102


 Score = 48.1 bits (113),  Expect(2) = 6e-46, Method: Compositional matrix adjust.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            EEVAKYKVGAPARVGLVAP+DVVVPPGNTGLDPS
Sbjct  103  EEVAKYKVGAPARVGLVAPVDVVVPPGNTGLDPS  136



>ref|NP_001141489.1| hypothetical protein [Zea mays]
 gb|ACF86473.1| unknown [Zea mays]
 gb|AFW61287.1| hypothetical protein ZEAMMB73_391125 [Zea mays]
Length=319

 Score =   163 bits (412),  Expect(2) = 6e-46, Method: Compositional matrix adjust.
 Identities = 77/102 (75%), Positives = 92/102 (90%), Gaps = 0/102 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MA+K+TKA+KKIAYD+KLC LLDEYT++LIA+ADNVGS QLQ+IR+GLRGDSVVLMGKNT
Sbjct  1    MAIKRTKAEKKIAYDKKLCSLLDEYTKVLIALADNVGSKQLQDIRRGLRGDSVVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            +I+R I+V+AE TGN     L+ LLVGNVGLIFTKGDLKEV+
Sbjct  61   LIRRCIKVYAEKTGNHTFDPLMDLLVGNVGLIFTKGDLKEVR  102


 Score = 48.1 bits (113),  Expect(2) = 6e-46, Method: Compositional matrix adjust.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            EEVAKYKVGAPARVGLVAP+DVVVPPGNTGLDPS
Sbjct  103  EEVAKYKVGAPARVGLVAPVDVVVPPGNTGLDPS  136



>gb|AFW74478.1| hypothetical protein ZEAMMB73_076912 [Zea mays]
Length=197

 Score =   161 bits (408),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 77/102 (75%), Positives = 92/102 (90%), Gaps = 0/102 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MA+K+TKA+KKIAYD+KLC LLDEYT++LIA+ADNVGS QLQ+IR+GLRGDSVVLMGKNT
Sbjct  1    MAIKRTKAEKKIAYDKKLCSLLDEYTKVLIALADNVGSKQLQDIRRGLRGDSVVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            +I+R I+V+AE TGN     L+ LLVGNVGLIFTKGDLKEV+
Sbjct  61   LIRRCIKVYAEKTGNHTFDPLMDLLVGNVGLIFTKGDLKEVR  102


 Score = 48.1 bits (113),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            EEVAKYKVGAPARVGLVAP+DVVVPPGNTGLDPS
Sbjct  103  EEVAKYKVGAPARVGLVAPVDVVVPPGNTGLDPS  136



>gb|ACF83717.1| unknown [Zea mays]
 gb|AFW74477.1| 60S acidic ribosomal protein P0 [Zea mays]
Length=319

 Score =   163 bits (412),  Expect(2) = 7e-46, Method: Compositional matrix adjust.
 Identities = 77/102 (75%), Positives = 92/102 (90%), Gaps = 0/102 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MA+K+TKA+KKIAYD+KLC LLDEYT++LIA+ADNVGS QLQ+IR+GLRGDSVVLMGKNT
Sbjct  1    MAIKRTKAEKKIAYDKKLCSLLDEYTKVLIALADNVGSKQLQDIRRGLRGDSVVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            +I+R I+V+AE TGN     L+ LLVGNVGLIFTKGDLKEV+
Sbjct  61   LIRRCIKVYAEKTGNHTFDPLMDLLVGNVGLIFTKGDLKEVR  102


 Score = 48.1 bits (113),  Expect(2) = 7e-46, Method: Compositional matrix adjust.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            EEVAKYKVGAPARVGLVAP+DVVVPPGNTGLDPS
Sbjct  103  EEVAKYKVGAPARVGLVAPVDVVVPPGNTGLDPS  136



>ref|NP_001105482.1| 60S acidic ribosomal protein P0 [Zea mays]
 sp|O24573.3|RLA0_MAIZE RecName: Full=60S acidic ribosomal protein P0 [Zea mays]
 emb|CAA69256.1| 60S acidic ribosomal protein P0 [Zea mays]
Length=319

 Score =   163 bits (412),  Expect(2) = 7e-46, Method: Compositional matrix adjust.
 Identities = 77/102 (75%), Positives = 92/102 (90%), Gaps = 0/102 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MA+K+TKA+KKIAYD+KLC LLDEYT++LIA+ADNVGS QLQ+IR+GLRGDSVVLMGKNT
Sbjct  1    MAIKRTKAEKKIAYDKKLCSLLDEYTKVLIALADNVGSKQLQDIRRGLRGDSVVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            +I+R I+V+AE TGN     L+ LLVGNVGLIFTKGDLKEV+
Sbjct  61   LIRRCIKVYAEKTGNHTFDPLMDLLVGNVGLIFTKGDLKEVR  102


 Score = 48.1 bits (113),  Expect(2) = 7e-46, Method: Compositional matrix adjust.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            EEVAKYKVGAPARVGLVAP+DVVVPPGNTGLDPS
Sbjct  103  EEVAKYKVGAPARVGLVAPVDVVVPPGNTGLDPS  136



>ref|XP_002967451.1| hypothetical protein SELMODRAFT_87354 [Selaginella moellendorffii]
 gb|EFJ32050.1| hypothetical protein SELMODRAFT_87354 [Selaginella moellendorffii]
Length=323

 Score =   150 bits (380),  Expect(2) = 7e-46, Method: Compositional matrix adjust.
 Identities = 71/102 (70%), Positives = 85/102 (83%), Gaps = 0/102 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            M  K TK +KK AYD KLC+ LD+Y + LI  ADNVGSNQ+Q IR+GLR DSVVLMGKNT
Sbjct  1    MGFKGTKLEKKEAYDLKLCKYLDDYARALICAADNVGSNQMQQIRQGLRPDSVVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            ++KR+IR +AE TGN  +LNLIPLLVGNVGL+FT+GDLKEV+
Sbjct  61   LMKRTIRKYAEKTGNRDVLNLIPLLVGNVGLVFTRGDLKEVR  102


 Score = 60.1 bits (144),  Expect(2) = 7e-46, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            E +AKYKVGAPARVGLVAPIDV + PG+TGLDPS
Sbjct  103  EVIAKYKVGAPARVGLVAPIDVTIQPGSTGLDPS  136



>emb|CAN65663.1| hypothetical protein VITISV_014917 [Vitis vinifera]
Length=379

 Score =   150 bits (380),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 71/101 (70%), Positives = 85/101 (84%), Gaps = 0/101 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MAVK ++A+KK+ YDQKLC+LLDEY+QILI   DN+GS QLQ+I + LRG SVVLMG NT
Sbjct  1    MAVKLSRAKKKVQYDQKLCRLLDEYSQILIVAVDNMGSKQLQDIHRALRGHSVVLMGNNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            M+KRS+R+H E TGN A L+LIPLLVGN+GLIFTK DLK V
Sbjct  61   MMKRSVRLHVEMTGNKAFLSLIPLLVGNIGLIFTKEDLKGV  101


 Score = 59.7 bits (143),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            S+EVAKYK GAPAR G+VAPIDVV+ PG+TGLDP+
Sbjct  102  SDEVAKYKXGAPARXGVVAPIDVVIQPGSTGLDPA  136



>ref|XP_002960261.1| hypothetical protein SELMODRAFT_229877 [Selaginella moellendorffii]
 gb|EFJ37800.1| hypothetical protein SELMODRAFT_229877 [Selaginella moellendorffii]
Length=323

 Score =   150 bits (378),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 71/102 (70%), Positives = 85/102 (83%), Gaps = 0/102 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            M  K TK +KK AYD KLC+ LD+Y + LI  ADNVGSNQ+Q IR+GLR DSVVLMGKNT
Sbjct  1    MGFKGTKLEKKEAYDLKLCKYLDDYGRALICAADNVGSNQMQQIRQGLRPDSVVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            ++KR+IR +AE TGN  +LNLIPLLVGNVGL+FT+GDLKEV+
Sbjct  61   LMKRTIRKYAEKTGNRDVLNLIPLLVGNVGLVFTRGDLKEVR  102


 Score = 60.1 bits (144),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            E +AKYKVGAPARVGLVAPIDV + PG+TGLDPS
Sbjct  103  EVIAKYKVGAPARVGLVAPIDVTIQPGSTGLDPS  136



>ref|XP_002960810.1| hypothetical protein SELMODRAFT_437282 [Selaginella moellendorffii]
 gb|EFJ38349.1| hypothetical protein SELMODRAFT_437282 [Selaginella moellendorffii]
Length=321

 Score =   143 bits (361),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 68/102 (67%), Positives = 84/102 (82%), Gaps = 0/102 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            M  K TK +KK  YD+K+  LL+ YT+ LI  ADNVGS QLQ IR+GLR +SVVLMGKNT
Sbjct  1    MGFKGTKQEKKEIYDRKMVDLLENYTKALICAADNVGSTQLQQIRRGLRPESVVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            ++KR+IR +AE +GN A+L+L+PLLVGNVGLIFTKGDLKEV+
Sbjct  61   LMKRTIRTYAERSGNMAVLSLMPLLVGNVGLIFTKGDLKEVR  102


 Score = 66.2 bits (160),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 31/34 (91%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            EEVAKYKVGAPARVGLVAPIDV +PPG+TGLDPS
Sbjct  103  EEVAKYKVGAPARVGLVAPIDVTIPPGSTGLDPS  136



>ref|XP_002445000.1| hypothetical protein SORBIDRAFT_07g002560 [Sorghum bicolor]
 gb|EES14495.1| hypothetical protein SORBIDRAFT_07g002560 [Sorghum bicolor]
Length=319

 Score =   161 bits (407),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/102 (75%), Positives = 91/102 (89%), Gaps = 0/102 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MA+K+TKA+KKIAYD+KLC LLDEYT++LIA+ADNVGS QLQ+IR+GLRGDSVVLMGKNT
Sbjct  1    MAIKRTKAEKKIAYDKKLCSLLDEYTKVLIALADNVGSKQLQDIRRGLRGDSVVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            +I+R I+ +AE TGN     L+ LLVGNVGLIFTKGDLKEV+
Sbjct  61   LIRRCIKAYAEKTGNHTFDPLMDLLVGNVGLIFTKGDLKEVR  102


 Score = 47.8 bits (112),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            EEVAKYKVGAPARVGLVAP+DVVVPPGNTGLDPS
Sbjct  103  EEVAKYKVGAPARVGLVAPVDVVVPPGNTGLDPS  136



>ref|XP_004972933.1| PREDICTED: 60S acidic ribosomal protein P0-like [Setaria italica]
Length=319

 Score =   156 bits (395),  Expect(2) = 6e-44, Method: Compositional matrix adjust.
 Identities = 74/102 (73%), Positives = 90/102 (88%), Gaps = 0/102 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MA+K+TKA+KK AYD+KLC LLDEYT++LIA+ADNVGS QLQ+IR+GLRGDSVVLMGKNT
Sbjct  1    MAIKRTKAEKKQAYDRKLCSLLDEYTKVLIALADNVGSKQLQDIRRGLRGDSVVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            +I+R I+ +A+ TGN     L+ LLVGNVGLIFTKGDLKEV+
Sbjct  61   LIRRCIKAYADKTGNHTFDPLMDLLVGNVGLIFTKGDLKEVR  102


 Score = 48.1 bits (113),  Expect(2) = 6e-44, Method: Compositional matrix adjust.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            EEVAKYKVGAPARVGLVAP+DVVVPPGNTGLDPS
Sbjct  103  EEVAKYKVGAPARVGLVAPVDVVVPPGNTGLDPS  136



>ref|XP_004958562.1| PREDICTED: 60S acidic ribosomal protein P0-like [Setaria italica]
Length=319

 Score =   156 bits (395),  Expect(2) = 6e-44, Method: Compositional matrix adjust.
 Identities = 74/102 (73%), Positives = 90/102 (88%), Gaps = 0/102 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MA+K+TKA+KK AYD+KLC LLDEYT++LIA+ADNVGS QLQ+IR+GLRGDSVVLMGKNT
Sbjct  1    MAIKRTKAEKKQAYDRKLCSLLDEYTKVLIALADNVGSKQLQDIRRGLRGDSVVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            +I+R I+ +A+ TGN     L+ LLVGNVGLIFTKGDLKEV+
Sbjct  61   LIRRCIKAYADKTGNHTFDPLMDLLVGNVGLIFTKGDLKEVR  102


 Score = 48.1 bits (113),  Expect(2) = 6e-44, Method: Compositional matrix adjust.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            EEVAKYKVGAPARVGLVAP+DVVVPPGNTGLDPS
Sbjct  103  EEVAKYKVGAPARVGLVAPVDVVVPPGNTGLDPS  136



>ref|XP_010685586.1| PREDICTED: 60S acidic ribosomal protein P0 [Beta vulgaris subsp. 
vulgaris]
Length=324

 Score =   133 bits (334),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 62/97 (64%), Positives = 82/97 (85%), Gaps = 0/97 (0%)
 Frame = +2

Query  200  QTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIKR  379
            ++K +KK  Y  KL +L+D+Y+++L+ +ADNVGSNQLQ IR+GLRGDS+VLMGKNT++KR
Sbjct  9    RSKMEKKEIYSAKLRRLIDDYSKVLVVLADNVGSNQLQQIRQGLRGDSIVLMGKNTLMKR  68

Query  380  SIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            +++ H + TGN AI  L+ LLVGNVGLIFTKGDLKEV
Sbjct  69   ALKTHMDETGNKAIKPLMNLLVGNVGLIFTKGDLKEV  105


 Score = 69.3 bits (168),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEE+ KYKVGAPARVGLVAPIDVV+PPGNTGLDPS
Sbjct  106  SEELGKYKVGAPARVGLVAPIDVVIPPGNTGLDPS  140



>ref|XP_003573632.1| PREDICTED: 60S acidic ribosomal protein P0-like [Brachypodium 
distachyon]
Length=323

 Score =   132 bits (332),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 62/90 (69%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = +2

Query  224  AYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIKRSIRVHAEN  403
            AYD+KLCQLLDEY ++L+A A++VGS QL  IR+G+RG+SV+LMGKNT+I+R I VHA +
Sbjct  16   AYDKKLCQLLDEYPKVLVASANHVGSTQLAAIRRGIRGESVMLMGKNTLIRRCINVHAVD  75

Query  404  TGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            TGN  I  L+PLL GNVGLIFTKGDLKEV+
Sbjct  76   TGNENIKALVPLLQGNVGLIFTKGDLKEVR  105


 Score = 65.9 bits (159),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 31/34 (91%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            EEVAKYKVGAPARVGL+APIDVVVP GNTGLDP+
Sbjct  106  EEVAKYKVGAPARVGLIAPIDVVVPAGNTGLDPT  139



>emb|CAN76468.1| hypothetical protein VITISV_030042 [Vitis vinifera]
Length=303

 Score =   125 bits (313),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 59/66 (89%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MAVK +KA KKIAYDQKLCQLLDEY+QILIA ADNVGSNQLQNIRKGLRGDSVVLMGKNT
Sbjct  1    MAVKPSKADKKIAYDQKLCQLLDEYSQILIAAADNVGSNQLQNIRKGLRGDSVVLMGKNT  60

Query  368  MIKRSI  385
            M+KR I
Sbjct  61   MMKRMI  66


 Score = 73.2 bits (178),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 35/38 (92%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = +3

Query  483  RK*SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            R+ SEEVAKYKVGAPARVGLVAPIDV+VPPGNTGLDPS
Sbjct  82   REVSEEVAKYKVGAPARVGLVAPIDVIVPPGNTGLDPS  119



>ref|NP_001176336.1| Os11g0135300 [Oryza sativa Japonica Group]
 dbj|BAH95064.1| Os11g0135300 [Oryza sativa Japonica Group]
Length=119

 Score =   147 bits (371),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 67/86 (78%), Positives = 80/86 (93%), Gaps = 0/86 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MA+K+TKA+KK+AYD+KLCQLLDEYT++LIAVADNVGSNQLQ IRKGLRGDS+VLMGKNT
Sbjct  1    MAIKRTKAEKKVAYDKKLCQLLDEYTKVLIAVADNVGSNQLQEIRKGLRGDSIVLMGKNT  60

Query  368  MIKRSIRVHAENTGNTAILNLIPLLV  445
            +I+R I+VHA+NTGN   L L+PLLV
Sbjct  61   LIRRCIKVHADNTGNKDFLELMPLLV  86



>emb|CBI25508.3| unnamed protein product [Vitis vinifera]
Length=292

 Score =   122 bits (307),  Expect(2) = 6e-41, Method: Compositional matrix adjust.
 Identities = 65/101 (64%), Positives = 68/101 (67%), Gaps = 28/101 (28%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MAVK +KA KKIAYDQKLCQLLDEY+QILIA ADN                         
Sbjct  1    MAVKPSKADKKIAYDQKLCQLLDEYSQILIAAADN-------------------------  35

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
               RSIR+HAE TGNTA LNLIPLLVGNVGLIFTKGDLKEV
Sbjct  36   ---RSIRLHAEKTGNTAFLNLIPLLVGNVGLIFTKGDLKEV  73


 Score = 71.6 bits (174),  Expect(2) = 6e-41, Method: Compositional matrix adjust.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDV+VPPGNTGLDPS
Sbjct  74   SEEVAKYKVGAPARVGLVAPIDVIVPPGNTGLDPS  108



>ref|XP_006846796.1| hypothetical protein AMTR_s00148p00060210 [Amborella trichopoda]
 gb|ERN08377.1| hypothetical protein AMTR_s00148p00060210 [Amborella trichopoda]
Length=232

 Score =   149 bits (377),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 88/109 (81%), Gaps = 0/109 (0%)
 Frame = +2

Query  164  FDYLLTVSMAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDS  343
            F +     +AVK +K +KK+AYD K+CQLLD+Y Q+L+A ADN+ SNQLQN+RKG+  DS
Sbjct  14   FLWRHYFGVAVKSSKREKKLAYDHKVCQLLDQYNQVLVAEADNIRSNQLQNVRKGVSQDS  73

Query  344  VVLMGKNTMIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            VV+M KNT+++++I+ HAE TGN A LNLIPLL GNV LIFTKGDLKEV
Sbjct  74   VVIMSKNTVLRQTIKAHAEKTGNKAYLNLIPLLYGNVSLIFTKGDLKEV  122



>emb|CBI31491.3| unnamed protein product [Vitis vinifera]
Length=292

 Score =   120 bits (301),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 67/101 (66%), Gaps = 28/101 (28%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MAVK +KA KKIAYDQKLCQLLDEYTQILIA ADN                         
Sbjct  1    MAVKPSKADKKIAYDQKLCQLLDEYTQILIAAADN-------------------------  35

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
               RSIR+HAE TGN A LNLIPLLVGNVGLIFT+GDLKEV
Sbjct  36   ---RSIRLHAEKTGNQAFLNLIPLLVGNVGLIFTRGDLKEV  73


 Score = 71.6 bits (174),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDV+VPPGNTGLDPS
Sbjct  74   SEEVAKYKVGAPARVGLVAPIDVIVPPGNTGLDPS  108



>ref|NP_001078125.1| 60S acidic ribosomal protein P0-2 [Arabidopsis thaliana]
 gb|AEE74737.1| 60S acidic ribosomal protein P0-2 [Arabidopsis thaliana]
Length=287

 Score =   106 bits (264),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 63/99 (64%), Gaps = 33/99 (33%)
 Frame = +2

Query  194  VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  373
            VK TKA+KKIAYD KLCQL+DEYTQIL+                                
Sbjct  2    VKATKAEKKIAYDTKLCQLIDEYTQILV--------------------------------  29

Query  374  KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
             RS+R+H+ENTGNTAILNL+PLL GNVGLIFTKGDLKEV
Sbjct  30   -RSVRIHSENTGNTAILNLLPLLQGNVGLIFTKGDLKEV  67


 Score = 69.7 bits (169),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVAKYKVGAPARVGLVAPIDVVV PGNTGLDPS
Sbjct  68   SEEVAKYKVGAPARVGLVAPIDVVVQPGNTGLDPS  102



>gb|AFK45016.1| unknown [Lotus japonicus]
Length=187

 Score =   133 bits (334),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 68/101 (67%), Positives = 80/101 (79%), Gaps = 4/101 (4%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MA K +KA    AYD K+ +LL EY+Q+L+  ADNVGSNQLQ IR+ L GDSVV+MGKNT
Sbjct  1    MAGKVSKA----AYDAKMWKLLREYSQVLVVSADNVGSNQLQGIRRALHGDSVVVMGKNT  56

Query  368  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            ++KRSI   AE TGN A LNL+PLLVGNV LIFTKGDL+EV
Sbjct  57   LMKRSIIDDAEKTGNKAFLNLVPLLVGNVALIFTKGDLREV  97



>ref|XP_005650079.1| hypothetical protein COCSUDRAFT_52908 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE25535.1| hypothetical protein COCSUDRAFT_52908 [Coccomyxa subellipsoidea 
C-169]
Length=319

 Score =   114 bits (286),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 70/96 (73%), Gaps = 2/96 (2%)
 Frame = +2

Query  212  QKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLR--GDSVVLMGKNTMIKRSI  385
             KK  YD+KLC LLD Y +  +  ADNVGS Q  +IR+GLR  GDS+VLMGKNTM+KRSI
Sbjct  8    SKKEEYDEKLCGLLDGYDKCFVVHADNVGSRQFMDIRRGLRDVGDSIVLMGKNTMMKRSI  67

Query  386  RVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            R++ E TG+     L+  LVGNVGLIFTK DL E++
Sbjct  68   RLYCEKTGDDKWPALLDHLVGNVGLIFTKADLAELR  103


 Score = 58.2 bits (139),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            +E+ KYKVGAPARVGLVAP  VVVP GNTGLDPS
Sbjct  104  DEIEKYKVGAPARVGLVAPNSVVVPAGNTGLDPS  137



>ref|XP_006595496.1| PREDICTED: uncharacterized protein LOC100305996 isoform X1 [Glycine 
max]
 gb|KHN20858.1| 60S acidic ribosomal protein P0 [Glycine soja]
Length=187

 Score =   131 bits (330),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/91 (68%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = +2

Query  218  KIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIKRSIRVHA  397
            K AYD K+ +LL EY+Q+L+  +DNVGSNQLQ IR+GL  DSVV+MGKN+M+KRSI + A
Sbjct  7    KAAYDAKMLKLLKEYSQVLVVSSDNVGSNQLQGIRRGLNADSVVVMGKNSMMKRSIILDA  66

Query  398  ENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            + TGN A LNL+PLLVGNV LIFTKGDL+EV
Sbjct  67   QKTGNKAFLNLVPLLVGNVALIFTKGDLREV  97



>ref|XP_006575531.1| PREDICTED: 60S acidic ribosomal protein P0-like isoform X1 [Glycine 
max]
 ref|XP_006575532.1| PREDICTED: 60S acidic ribosomal protein P0-like isoform X2 [Glycine 
max]
 gb|KHN48551.1| 60S acidic ribosomal protein P0 [Glycine soja]
Length=187

 Score =   130 bits (328),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 62/91 (68%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = +2

Query  218  KIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIKRSIRVHA  397
            K AYD K+ +LL EY+Q+L+  +DNVGSNQLQ IR+GL  DSVV+MGKN+M+KRSI + A
Sbjct  7    KAAYDAKMLKLLREYSQVLVVSSDNVGSNQLQGIRRGLNADSVVVMGKNSMMKRSIILDA  66

Query  398  ENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            + TGN A LNL+PLLVGNV LIFTKGDL+EV
Sbjct  67   KKTGNKAFLNLVPLLVGNVALIFTKGDLREV  97



>ref|NP_001236064.1| uncharacterized protein LOC100305996 [Glycine max]
 gb|ACU13955.1| unknown [Glycine max]
Length=187

 Score =   129 bits (325),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = +2

Query  218  KIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIKRSIRVHA  397
            K AYD K+ +LL EY+Q+L+  +DNVGSNQLQ IR+GL  DSVV+MGK++M+KRSI + A
Sbjct  7    KAAYDAKMLKLLKEYSQVLVVSSDNVGSNQLQGIRRGLNADSVVVMGKSSMMKRSIILDA  66

Query  398  ENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            + TGN A LNL+PLLVGNV LIFTKGDL+EV
Sbjct  67   QKTGNKAFLNLVPLLVGNVALIFTKGDLREV  97



>ref|XP_007141772.1| hypothetical protein PHAVU_008G224500g [Phaseolus vulgaris]
 gb|ESW13766.1| hypothetical protein PHAVU_008G224500g [Phaseolus vulgaris]
Length=188

 Score =   129 bits (323),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = +2

Query  218  KIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIKRSIRVHA  397
            K AYD K+ +LL EY+Q+L+  +DNVGSNQLQ IR+GL  DSVV+MGKN+++KRSI + A
Sbjct  7    KAAYDAKMLKLLREYSQVLVISSDNVGSNQLQGIRRGLHADSVVVMGKNSLMKRSIILDA  66

Query  398  ENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            + TGN A LNL+PLLVGNV LIFTKGD++EV
Sbjct  67   QKTGNKAFLNLVPLLVGNVALIFTKGDIREV  97



>ref|XP_011402179.1| 60S acidic ribosomal protein P0-2 [Auxenochlorella protothecoides]
 gb|KFM29126.1| 60S acidic ribosomal protein P0-2 [Auxenochlorella protothecoides]
Length=273

 Score =   115 bits (289),  Expect(2) = 8e-33, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 71/93 (76%), Gaps = 0/93 (0%)
 Frame = +2

Query  215  KKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIKRSIRVH  394
            KK AYD KLC+LLD +T+  +  ADNVGS Q+ NIR GLR +S VLMGKNT+I+R +R++
Sbjct  9    KKEAYDAKLCELLDTHTKAFLVHADNVGSMQMMNIRAGLRENSTVLMGKNTLIRRCLRLY  68

Query  395  AENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
             E TGN   L L+  LVGNVGLIFT+GDL EV+
Sbjct  69   VERTGNEQWLVLLDHLVGNVGLIFTQGDLNEVR  101


 Score = 51.6 bits (122),  Expect(2) = 8e-33, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            +++ ++KVGAPARVGLVAP DV V  GNTG+DPS
Sbjct  102  DKIQEFKVGAPARVGLVAPNDVTVYAGNTGMDPS  135



>gb|KHN36390.1| 60S acidic ribosomal protein P0-1 [Glycine soja]
Length=153

 Score = 98.6 bits (244),  Expect(2) = 9e-33, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            MAV  TKA+KK++YD KLCQLL++YTQIL+  ADNVGSNQL+NIRK LRGDSVVLM  NT
Sbjct  1    MAVIPTKAEKKVSYDVKLCQLLEDYTQILVVAADNVGSNQLENIRKDLRGDSVVLMRNNT  60

Query  368  M  370
            M
Sbjct  61   M  61


 Score = 68.6 bits (166),  Expect(2) = 9e-33, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEVA+YK+GAPARVGLVAPIDV VPPGNTGLDPS
Sbjct  68   SEEVARYKLGAPARVGLVAPIDVAVPPGNTGLDPS  102



>ref|XP_005850392.1| hypothetical protein CHLNCDRAFT_59607 [Chlorella variabilis]
 gb|EFN58290.1| hypothetical protein CHLNCDRAFT_59607 [Chlorella variabilis]
Length=314

 Score =   115 bits (287),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 70/97 (72%), Gaps = 0/97 (0%)
 Frame = +2

Query  203  TKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIKRS  382
            TK  KK AYD KLC+++D Y +  +  ADNVGS Q  +IR  +R  S +LMGKNTM++RS
Sbjct  5    TKLVKKEAYDAKLCEMMDTYDRAFLVHADNVGSKQFMDIRAAIRDHSRILMGKNTMMRRS  64

Query  383  IRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            IR++ E TGN   L L+  +VGNVGLIFTKGDL EV+
Sbjct  65   IRLYCERTGNDQWLQLLGHMVGNVGLIFTKGDLNEVR  101


 Score = 50.4 bits (119),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +3

Query  501  VAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            +  +KVGAPARVGLVAP DV +P GNTG+DPS
Sbjct  104  IDDFKVGAPARVGLVAPNDVTIPGGNTGMDPS  135



>ref|XP_003621750.1| 60S acidic ribosomal protein P0 [Medicago truncatula]
 gb|AES77968.1| ribosomal protein L10 family protein [Medicago truncatula]
Length=188

 Score =   123 bits (309),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 75/92 (82%), Gaps = 1/92 (1%)
 Frame = +2

Query  218  KIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIKRSIRVHA  397
            K AYD K+ +LL EYTQ+L+  +DNVGSNQLQ IR+ L  DSVV+MGKN+++KRSI   A
Sbjct  7    KAAYDAKMGKLLREYTQVLVVSSDNVGSNQLQGIRRALHEDSVVVMGKNSLMKRSIIQAA  66

Query  398  ENTGNT-AILNLIPLLVGNVGLIFTKGDLKEV  490
            E TGN+ A LNL+PLLVGNV LIFTKGDL++V
Sbjct  67   EKTGNSHAFLNLVPLLVGNVALIFTKGDLRDV  98



>gb|KIZ02211.1| 60S acidic ribosomal protein P0 [Monoraphidium neglectum]
Length=313

 Score =   105 bits (262),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 65/97 (67%), Gaps = 0/97 (0%)
 Frame = +2

Query  203  TKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIKRS  382
            TK +KK AY  +LC  LD Y +  I  ADNVGS Q  +IR  LR +S++LMGKNTM+KRS
Sbjct  5    TKLEKKEAYHARLCDYLDTYEKAFIVHADNVGSKQFSDIRAALRPESLILMGKNTMMKRS  64

Query  383  IRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            IR++ E   +     L+  LVGNVG+IFTK DL  VK
Sbjct  65   IRLYCEEKEDDRWAPLLDELVGNVGIIFTKADLASVK  101


 Score = 56.6 bits (135),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            +E+AKYKVGAPARVGLVAP DV +P G TG+DPS
Sbjct  102  DEIAKYKVGAPARVGLVAPNDVTIPGGGTGMDPS  135



>gb|KDD72928.1| hypothetical protein H632_c2720p0, partial [Helicosporidium sp. 
ATCC 50920]
Length=273

 Score =   108 bits (269),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 68/93 (73%), Gaps = 0/93 (0%)
 Frame = +2

Query  215  KKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIKRSIRVH  394
            +  A+  KLC LLD Y++ L+  ADNVGS Q+ +IR GLRGDSV+LMGK TMI+R IR +
Sbjct  5    QPTAFGAKLCDLLDTYSKALVVHADNVGSKQMMDIRAGLRGDSVLLMGKKTMIRRCIRQY  64

Query  395  AENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
             + TGN   + L+ LL GNVG+IFTK DL +++
Sbjct  65   VDRTGNDQWVPLLDLLEGNVGIIFTKADLNDLR  97


 Score = 52.0 bits (123),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            + V+KY VGAPARVG+VAP DV +  GNTG+DPS
Sbjct  98   DRVSKYTVGAPARVGVVAPTDVTIYAGNTGMDPS  131



>ref|XP_004492062.1| PREDICTED: 60S acidic ribosomal protein P0-like [Cicer arietinum]
Length=188

 Score =   121 bits (303),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 74/92 (80%), Gaps = 1/92 (1%)
 Frame = +2

Query  218  KIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIKRSIRVHA  397
            K AYD K+ +LL EYT++L+  +DNVGSNQLQ IR+ L  DSVV+MGKN+++KRSI   A
Sbjct  7    KAAYDAKMGKLLREYTRVLVVSSDNVGSNQLQGIRRALHEDSVVVMGKNSLMKRSIIQEA  66

Query  398  ENTG-NTAILNLIPLLVGNVGLIFTKGDLKEV  490
            E TG N A LNL+PLLVGNV LIFTKGDL++V
Sbjct  67   ERTGNNNAFLNLVPLLVGNVALIFTKGDLRDV  98



>emb|CBV76074.1| 60S acidic ribosomal protein P0 [Polytomella sp. Pringsheim 198.80]
Length=314

 Score =   107 bits (266),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 68/97 (70%), Gaps = 0/97 (0%)
 Frame = +2

Query  203  TKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIKRS  382
            +K  KK AY +++C LL  + +  I  ADNVGS Q Q+IRK LR  S++LMGKNTMIKRS
Sbjct  5    SKLAKKEAYHERICDLLKTFQKAFIVGADNVGSQQFQDIRKALRPQSIILMGKNTMIKRS  64

Query  383  IRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            I+++ E TG+     L+  LVGNVG++FT  DL +VK
Sbjct  65   IKIYCEETGDNKWAALLDHLVGNVGIVFTNQDLNQVK  101


 Score = 48.1 bits (113),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            +E+AKYKVGAPARVG  A  +V V  G+TG+DPS
Sbjct  102  DEIAKYKVGAPARVGATATEEVTVKAGSTGMDPS  135



>emb|CDP06275.1| unnamed protein product [Coffea canephora]
Length=247

 Score = 87.8 bits (216),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 41/47 (87%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +2

Query  353  MGKNTMIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            MGKNTM+KRSIRVHAE TGN A LNLIPLLVGNVGLIFTKGDLKE+ 
Sbjct  1    MGKNTMMKRSIRVHAEKTGNGAFLNLIPLLVGNVGLIFTKGDLKEIS  47


 Score = 61.2 bits (147),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            SEEV+KYKVGAPAR GL+A +DVVVPPGNTG DPS
Sbjct  47   SEEVSKYKVGAPARAGLIAAVDVVVPPGNTGPDPS  81



>gb|AFB33848.1| hypothetical protein CL118Contig1_01, partial [Pinus cembra]
 gb|AFB33849.1| hypothetical protein CL118Contig1_01, partial [Pinus cembra]
 gb|AFB33850.1| hypothetical protein CL118Contig1_01, partial [Pinus cembra]
 gb|AFB33851.1| hypothetical protein CL118Contig1_01, partial [Pinus cembra]
 gb|AFB33852.1| hypothetical protein CL118Contig1_01, partial [Pinus cembra]
 gb|AFB33853.1| hypothetical protein CL118Contig1_01, partial [Pinus cembra]
 gb|AFB33854.1| hypothetical protein CL118Contig1_01, partial [Pinus cembra]
Length=71

 Score =   107 bits (268),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            M  K TKA+KK+ YD+KLC LL++Y+Q+L+ VADNVGS QLQ+IR GLR DSVVLMGKNT
Sbjct  2    MGFKGTKAEKKVVYDKKLCDLLEQYSQVLVCVADNVGSKQLQSIRAGLRPDSVVLMGKNT  61

Query  368  MIKRSIRVHA  397
            M+KRSIR++A
Sbjct  62   MMKRSIRLYA  71



>ref|XP_010490328.1| PREDICTED: 60S acidic ribosomal protein P0-like [Camelina sativa]
Length=127

 Score =   109 bits (272),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 59/70 (84%), Gaps = 2/70 (3%)
 Frame = +2

Query  194  VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  373
            VK TKA+KKIAYD KLCQL+DEYTQIL+  ADNVGS QLQNIRKGLRGDSVVLMGKNTM+
Sbjct  2    VKATKAEKKIAYDTKLCQLIDEYTQILVVAADNVGSTQLQNIRKGLRGDSVVLMGKNTMM  61

Query  374  KRSIRVHAEN  403
               +R H  N
Sbjct  62   --ILRKHIPN  69



>gb|AEW08493.1| hypothetical protein CL118Contig1_01, partial [Pinus lambertiana]
Length=71

 Score =   107 bits (267),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            M  K TKA+KK+ YD+KLC LL++Y+Q+L+ VADNVGS QLQ+IR GLR DSVVLMGKNT
Sbjct  2    MGFKGTKAEKKVLYDKKLCDLLEQYSQVLVCVADNVGSKQLQSIRAGLRPDSVVLMGKNT  61

Query  368  MIKRSIRVHA  397
            M+KRSIR++A
Sbjct  62   MMKRSIRLYA  71



>ref|XP_002597893.1| hypothetical protein BRAFLDRAFT_97880 [Branchiostoma floridae]
 gb|EEN53905.1| hypothetical protein BRAFLDRAFT_97880 [Branchiostoma floridae]
Length=314

 Score =   109 bits (272),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 71/100 (71%), Gaps = 2/100 (2%)
 Frame = +2

Query  194  VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  373
            V++ KA  K  Y  K+ +LLDEY +  I  ADNVGSNQ+Q IR  LRG   +LMGKNTM+
Sbjct  2    VREDKATWKSNYFLKIVRLLDEYPKCFIVGADNVGSNQMQRIRMSLRGTGEILMGKNTMM  61

Query  374  KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            +++IR H EN  N A+  ++P + GNVG +FTKGDLKEV+
Sbjct  62   RKAIRGHMEN--NPALEKILPHISGNVGFVFTKGDLKEVR  99


 Score = 35.8 bits (81),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDP  593
            +++ + KV APA+ G +AP+DV + P NTGL P
Sbjct  100  DKILENKVEAPAKAGAIAPVDVYLDPLNTGLGP  132



>ref|XP_011196704.1| PREDICTED: 60S acidic ribosomal protein P0 [Bactrocera cucurbitae]
Length=316

 Score =   107 bits (268),  Expect(2) = 4e-26, Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 69/100 (69%), Gaps = 2/100 (2%)
 Frame = +2

Query  194  VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  373
            V++ KA  K  Y  K+ +L DEY +  I  ADNVGS Q+QNIR  LRG  VVLMGKNTM+
Sbjct  2    VRENKAAWKAQYFLKVVELFDEYPKCFIVGADNVGSKQMQNIRTSLRGLGVVLMGKNTMM  61

Query  374  KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            +++IR H EN  N  +  L+P + GNVG +FTKGDL EV+
Sbjct  62   RKAIRGHLEN--NAQLEKLLPHIKGNVGFVFTKGDLAEVR  99


 Score = 37.0 bits (84),  Expect(2) = 4e-26, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDP  593
            +++ + KV APAR G +AP+ V++P  NTGL P
Sbjct  100  DKLLESKVRAPARAGAIAPLHVIIPAQNTGLGP  132



>gb|ABV60317.1| 60S acidic ribosomal protein P0-like protein [Lutzomyia longipalpis]
Length=317

 Score =   106 bits (264),  Expect(2) = 5e-26, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 68/99 (69%), Gaps = 2/99 (2%)
 Frame = +2

Query  197  KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  376
            ++ KA  K  Y  K+ QL DEY +  I  ADNVGS Q+Q IR  LRG +VVLMGKNTM++
Sbjct  3    RENKAAWKANYFVKVVQLFDEYPKCFIVGADNVGSRQMQTIRTSLRGLAVVLMGKNTMMR  62

Query  377  RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            ++IR H EN  N  +  L+P + GNVG +FTKGDL EV+
Sbjct  63   KAIRGHLENNAN--LEKLLPHIRGNVGFVFTKGDLNEVR  99


 Score = 38.5 bits (88),  Expect(2) = 5e-26, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDP  593
            +++ + KV APAR G +AP++V++P  NTGL P
Sbjct  100  DKLTESKVRAPARAGAIAPLEVIIPAQNTGLGP  132



>gb|AEW08494.1| hypothetical protein CL118Contig1_01, partial [Pinus radiata]
 gb|AFB33855.1| hypothetical protein CL118Contig1_01, partial [Pinus mugo]
 gb|AFB33856.1| hypothetical protein CL118Contig1_01, partial [Pinus mugo]
 gb|AFB33857.1| hypothetical protein CL118Contig1_01, partial [Pinus mugo]
 gb|AFB33858.1| hypothetical protein CL118Contig1_01, partial [Pinus mugo]
 gb|AFG45202.1| hypothetical protein CL118Contig1_01, partial [Pinus taeda]
 gb|AFG45203.1| hypothetical protein CL118Contig1_01, partial [Pinus taeda]
 gb|AFG45204.1| hypothetical protein CL118Contig1_01, partial [Pinus taeda]
 gb|AFG45205.1| hypothetical protein CL118Contig1_01, partial [Pinus taeda]
 gb|AFG45206.1| hypothetical protein CL118Contig1_01, partial [Pinus taeda]
 gb|AFG45207.1| hypothetical protein CL118Contig1_01, partial [Pinus taeda]
 gb|AFG45208.1| hypothetical protein CL118Contig1_01, partial [Pinus taeda]
 gb|AFG45209.1| hypothetical protein CL118Contig1_01, partial [Pinus taeda]
 gb|AFG45210.1| hypothetical protein CL118Contig1_01, partial [Pinus taeda]
 gb|AFG45211.1| hypothetical protein CL118Contig1_01, partial [Pinus taeda]
 gb|AFG45212.1| hypothetical protein CL118Contig1_01, partial [Pinus taeda]
 gb|AFG45213.1| hypothetical protein CL118Contig1_01, partial [Pinus taeda]
 gb|AFG45214.1| hypothetical protein CL118Contig1_01, partial [Pinus taeda]
Length=71

 Score =   106 bits (264),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = +2

Query  188  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  367
            M  K TKA+KK+ YD+K+C LL++Y+Q+L+ VADNVGS QLQ IR GLR DSVVLMGKNT
Sbjct  2    MGFKGTKAEKKVVYDKKICDLLEQYSQVLVCVADNVGSKQLQGIRAGLRPDSVVLMGKNT  61

Query  368  MIKRSIRVHA  397
            M+KRSIR++A
Sbjct  62   MMKRSIRLYA  71



>ref|XP_011208099.1| PREDICTED: 60S acidic ribosomal protein P0 [Bactrocera dorsalis]
Length=317

 Score =   107 bits (268),  Expect(2) = 8e-26, Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 69/100 (69%), Gaps = 2/100 (2%)
 Frame = +2

Query  194  VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  373
            V++ KA  K  Y  K+ +L DEY +  I  ADNVGS Q+QNIR  LRG  VVLMGKNTM+
Sbjct  2    VRENKAAWKAQYFLKVVELFDEYPKCFIVGADNVGSKQMQNIRTSLRGLGVVLMGKNTMM  61

Query  374  KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            +++IR H EN  N  +  L+P + GNVG +FTKGDL EV+
Sbjct  62   RKAIRGHLEN--NAQLEKLLPHIKGNVGFVFTKGDLAEVR  99


 Score = 36.2 bits (82),  Expect(2) = 8e-26, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDP  593
            +++ + KV APAR G +AP+ VV+P  NTGL P
Sbjct  100  DKLLESKVRAPARAGAIAPLPVVIPAQNTGLGP  132



>ref|XP_002068394.1| GK20443 [Drosophila willistoni]
 gb|EDW79380.1| GK20443 [Drosophila willistoni]
Length=317

 Score =   107 bits (268),  Expect(2) = 8e-26, Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 70/100 (70%), Gaps = 2/100 (2%)
 Frame = +2

Query  194  VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  373
            V++ KA  K  Y  K+ +L DE+ +  I  ADNVGS Q+QNIR  LRG +VVLMGKNTM+
Sbjct  2    VRENKAAWKAQYFIKVVELFDEFPKCFIVGADNVGSKQMQNIRTSLRGLAVVLMGKNTMM  61

Query  374  KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            +++IR H EN  N  +  L+P + GNVG +FTKGDL EV+
Sbjct  62   RKAIRGHLEN--NPQLEKLLPYIKGNVGFVFTKGDLAEVR  99


 Score = 36.2 bits (82),  Expect(2) = 8e-26, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDP  593
            +++ + KV APAR G +AP++V++P  NTGL P
Sbjct  100  DKLLESKVRAPARPGAIAPLNVIIPAQNTGLGP  132



>ref|XP_011496436.1| PREDICTED: 60S acidic ribosomal protein P0 [Ceratosolen solmsi 
marchali]
Length=318

 Score =   106 bits (264),  Expect(2) = 9e-26, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 69/99 (70%), Gaps = 2/99 (2%)
 Frame = +2

Query  197  KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  376
            ++ KA  K  Y  KL QLLD+Y +  I  ADNVGS Q+Q IR  LRG +VVLMGKNTM++
Sbjct  3    REDKATWKAGYFNKLIQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGTAVVLMGKNTMMR  62

Query  377  RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            ++IR H E   N A+  L+P + GNVG +FT+GDL EV+
Sbjct  63   KAIRGHIER--NAALEKLLPHIRGNVGFVFTRGDLVEVR  99


 Score = 37.4 bits (85),  Expect(2) = 9e-26, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDP  593
            +++ + KV APAR G +AP+ VV+P  NTGL P
Sbjct  100  DKLLENKVRAPARAGAIAPLSVVIPAQNTGLGP  132



>ref|XP_004522331.1| PREDICTED: 60S acidic ribosomal protein P0-like [Ceratitis capitata]
 sp|Q9U3U0.1|RLA0_CERCA RecName: Full=60S acidic ribosomal protein P0; Short=CcP0 [Ceratitis 
capitata]
 emb|CAB63647.1| P0 protein [Ceratitis capitata]
Length=317

 Score =   107 bits (268),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 69/100 (69%), Gaps = 2/100 (2%)
 Frame = +2

Query  194  VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  373
            V++ KA  K  Y  K+ +L DEY +  I  ADNVGS Q+QNIR  LRG  VVLMGKNTM+
Sbjct  2    VRENKAAWKAQYFLKVVELFDEYPKCFIVGADNVGSKQMQNIRTSLRGLGVVLMGKNTMM  61

Query  374  KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            +++IR H EN  N  +  L+P + GNVG +FTKGDL EV+
Sbjct  62   RKAIRGHLEN--NAQLEKLLPHIKGNVGFVFTKGDLAEVR  99


 Score = 35.8 bits (81),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDP  593
            +++ + KV APAR G +AP+ V++P  NTGL P
Sbjct  100  DKLLESKVRAPARAGAIAPLPVIIPAQNTGLGP  132



>ref|XP_001352888.1| GA20389 [Drosophila pseudoobscura pseudoobscura]
 gb|EAL30389.1| GA20389 [Drosophila pseudoobscura pseudoobscura]
Length=317

 Score =   107 bits (267),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 70/100 (70%), Gaps = 2/100 (2%)
 Frame = +2

Query  194  VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  373
            V++ KA  K  Y  K+ +L DE+ +  I  ADNVGS Q+QNIR  LRG +VVLMGKNTM+
Sbjct  2    VRENKAAWKAQYFVKVVELFDEFPKCFIVGADNVGSKQMQNIRTSLRGLAVVLMGKNTMM  61

Query  374  KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            +++IR H EN  N  +  L+P + GNVG +FTKGDL EV+
Sbjct  62   RKAIRGHLEN--NPQLEKLLPHIKGNVGFVFTKGDLAEVR  99


 Score = 36.2 bits (82),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDP  593
            +++ + KV APAR G +AP++V++P  NTGL P
Sbjct  100  DKLLESKVRAPARPGAIAPLNVIIPAQNTGLGP  132



>gb|AEF59081.1| 60S acidic ribosomal-like protein P0 [Phragmatopoma lapidosa]
Length=152

 Score =   107 bits (267),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 72/100 (72%), Gaps = 2/100 (2%)
 Frame = +2

Query  194  VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  373
            VK+ +   K  Y  K+ QLLDEY ++ I  ADNVGS Q+Q IR  LRGD+VVLMGKNTM+
Sbjct  2    VKEDRGTWKSNYFMKIIQLLDEYPKLFIVGADNVGSKQMQQIRIALRGDAVVLMGKNTMM  61

Query  374  KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            +++IR H EN  N+A+  L+P + GNVG +FTK DL +++
Sbjct  62   RKAIRGHLEN--NSALEKLLPHIKGNVGFVFTKCDLSDIR  99



>ref|XP_006612127.1| PREDICTED: 60S acidic ribosomal protein P0-like [Apis dorsata]
Length=317

 Score =   105 bits (263),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 70/99 (71%), Gaps = 2/99 (2%)
 Frame = +2

Query  197  KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  376
            ++ KA  K  Y  KL QLLD+Y +  I  ADNVGS Q+Q IR  LRG++VVLMGKNTM++
Sbjct  3    REDKATWKSNYFTKLVQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGNAVVLMGKNTMMR  62

Query  377  RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            ++IR H E   N A+  L+P + GNVG +FT+GDL EV+
Sbjct  63   KAIRGHIER--NAALEKLLPHIRGNVGFVFTRGDLIEVR  99


 Score = 37.0 bits (84),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDP  593
            +++ + KV APAR G +AP+ V++P  NTGL P
Sbjct  100  DKLLENKVRAPARAGAIAPLSVIIPAQNTGLGP  132



>ref|XP_001958489.1| GF10946 [Drosophila ananassae]
 gb|EDV41295.1| GF10946 [Drosophila ananassae]
Length=317

 Score =   106 bits (265),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 70/100 (70%), Gaps = 2/100 (2%)
 Frame = +2

Query  194  VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  373
            V++ KA  K  Y  K+ +L DE+ +  I  ADNVGS Q+QNIR  LRG +VVLMGKNTM+
Sbjct  2    VRENKAAWKAQYFIKVVELFDEFPKCFIVGADNVGSKQMQNIRTSLRGLAVVLMGKNTMM  61

Query  374  KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            +++IR H EN  N  +  L+P + GNVG +FTKGDL EV+
Sbjct  62   RKAIRGHLEN--NPQLEKLLPHIKGNVGFVFTKGDLAEVR  99


 Score = 36.2 bits (82),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDP  593
            +++ + KV APAR G +AP++V++P  NTGL P
Sbjct  100  DKLLESKVRAPARPGAIAPLNVIIPAQNTGLGP  132



>gb|KJB32134.1| hypothetical protein B456_005G225800 [Gossypium raimondii]
Length=100

 Score = 73.9 bits (180),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +2

Query  353  MGKNTMIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEV  490
            MGK+TM+KRSIR+HAE TGN A LNLIPLL  +VGL+FTKGDLK+V
Sbjct  1    MGKSTMMKRSIRMHAEMTGNQAFLNLIPLLQEDVGLMFTKGDLKQV  46


 Score = 68.9 bits (167),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 33/35 (94%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +3

Query  492  SEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPS  596
            +EEVAKYKVGAP RVGLVAPIDVVVPPGNTGLDPS
Sbjct  47   NEEVAKYKVGAPVRVGLVAPIDVVVPPGNTGLDPS  81



>ref|XP_011297993.1| PREDICTED: 60S acidic ribosomal protein P0 [Fopius arisanus]
Length=317

 Score =   105 bits (263),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 69/99 (70%), Gaps = 2/99 (2%)
 Frame = +2

Query  197  KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  376
            ++ KA  K  Y  KL QLLD+Y +  I  ADNVGS Q+Q IR  LRG +VVLMGKNTM++
Sbjct  3    REDKASWKSNYFTKLIQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGSAVVLMGKNTMMR  62

Query  377  RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            ++IR H E   N A+  L+P + GNVG +FT+GDL EV+
Sbjct  63   KAIRGHIER--NAALEKLLPHIRGNVGFVFTRGDLVEVR  99


 Score = 37.0 bits (84),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDP  593
            +++ + KV APAR G +AP+ V++P  NTGL P
Sbjct  100  DKLLENKVRAPARAGAIAPLSVIIPAQNTGLGP  132



>ref|XP_623106.1| PREDICTED: 60S acidic ribosomal protein P0 isoformX1 [Apis mellifera]
 ref|XP_003695681.1| PREDICTED: 60S acidic ribosomal protein P0-like [Apis florea]
 ref|XP_006562125.1| PREDICTED: 60S acidic ribosomal protein P0 isoform X2 [Apis mellifera]
Length=317

 Score =   105 bits (263),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 70/99 (71%), Gaps = 2/99 (2%)
 Frame = +2

Query  197  KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  376
            ++ KA  K  Y  KL QLLD+Y +  I  ADNVGS Q+Q IR  LRG++VVLMGKNTM++
Sbjct  3    REDKATWKSNYFTKLVQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGNAVVLMGKNTMMR  62

Query  377  RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            ++IR H E   N A+  L+P + GNVG +FT+GDL EV+
Sbjct  63   KAIRGHIER--NAALEKLLPHIRGNVGFVFTRGDLIEVR  99


 Score = 37.0 bits (84),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDP  593
            +++ + KV APAR G +AP+ V++P  NTGL P
Sbjct  100  DKLLENKVRAPARAGAIAPLSVIIPAQNTGLGP  132



>dbj|BAN20115.1| ribosomal protein LP0 [Riptortus pedestris]
Length=315

 Score =   105 bits (263),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 69/99 (70%), Gaps = 2/99 (2%)
 Frame = +2

Query  197  KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  376
            K+ KA  K  Y  KL QLL+EY +  I  ADNVGS Q+Q IR  LRG +VVLMGKNTM++
Sbjct  3    KEDKATWKSHYFSKLIQLLEEYPKCFIVGADNVGSKQMQQIRMSLRGSAVVLMGKNTMMR  62

Query  377  RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            ++IR H E   N A+  L+P + GNVG +FT+G+L EV+
Sbjct  63   KAIRGHIER--NQALEKLLPHIKGNVGFVFTRGELTEVR  99


 Score = 37.0 bits (84),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 23/33 (70%), Gaps = 0/33 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDP  593
            E++ + KV APAR G +AP  VV+P  NTGL P
Sbjct  100  EKLLQNKVRAPARAGAIAPCPVVIPAQNTGLGP  132



>ref|XP_003398378.1| PREDICTED: 60S acidic ribosomal protein P0-like isoform 1 [Bombus 
terrestris]
 ref|XP_003398379.1| PREDICTED: 60S acidic ribosomal protein P0-like isoform 2 [Bombus 
terrestris]
Length=317

 Score =   105 bits (262),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 70/99 (71%), Gaps = 2/99 (2%)
 Frame = +2

Query  197  KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  376
            ++ KA  K  Y  KL QLLD+Y +  I  ADNVGS Q+Q IR  LRG++VVLMGKNTM++
Sbjct  3    REDKATWKSNYFTKLVQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGNAVVLMGKNTMMR  62

Query  377  RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            ++IR H E   N A+  L+P + GNVG +FT+GDL EV+
Sbjct  63   KAIRGHIER--NAALEKLLPHIRGNVGFVFTRGDLIEVR  99


 Score = 37.0 bits (84),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDP  593
            +++ + KV APAR G +AP+ V++P  NTGL P
Sbjct  100  DKLLENKVRAPARAGAIAPLSVIIPAQNTGLGP  132



>ref|XP_003488353.1| PREDICTED: 60S acidic ribosomal protein P0-like [Bombus impatiens]
Length=317

 Score =   105 bits (262),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 70/99 (71%), Gaps = 2/99 (2%)
 Frame = +2

Query  197  KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  376
            ++ KA  K  Y  KL QLLD+Y +  I  ADNVGS Q+Q IR  LRG++VVLMGKNTM++
Sbjct  3    REDKATWKSNYFTKLVQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGNAVVLMGKNTMMR  62

Query  377  RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            ++IR H E   N A+  L+P + GNVG +FT+GDL EV+
Sbjct  63   KAIRGHIER--NAALEKLLPHIRGNVGFVFTRGDLIEVR  99


 Score = 37.0 bits (84),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDP  593
            +++ + KV APAR G +AP+ V++P  NTGL P
Sbjct  100  DKLLENKVRAPARAGAIAPLSVIIPAQNTGLGP  132



>ref|XP_001607606.1| PREDICTED: 60S acidic ribosomal protein P0 [Nasonia vitripennis]
Length=316

 Score =   105 bits (262),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 69/99 (70%), Gaps = 2/99 (2%)
 Frame = +2

Query  197  KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  376
            ++ KA  K  Y  KL QLLD+Y +  I  ADNVGS Q+Q IR  LRG +VVLMGKNTM++
Sbjct  3    REDKASWKAGYFSKLIQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGTAVVLMGKNTMMR  62

Query  377  RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            ++I+ H E   N A+  L+P + GNVG +FT+GDL EV+
Sbjct  63   KAIKGHIER--NAALEKLLPHIRGNVGFVFTRGDLVEVR  99


 Score = 37.0 bits (84),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDP  593
            +++ + KV APAR G +AP+ V++P  NTGL P
Sbjct  100  DKLLENKVRAPARAGAIAPLSVIIPAQNTGLGP  132



>ref|XP_011266937.1| PREDICTED: 60S acidic ribosomal protein P0 [Camponotus floridanus]
 gb|EFN61067.1| 60S acidic ribosomal protein P0 [Camponotus floridanus]
Length=318

 Score =   105 bits (262),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 70/99 (71%), Gaps = 2/99 (2%)
 Frame = +2

Query  197  KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  376
            ++ KA  K  Y  KL QLLD+Y +  I  ADNVGS Q+Q IR  LRG++VVLMGKNTM++
Sbjct  3    REDKATWKSNYFTKLVQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGNAVVLMGKNTMMR  62

Query  377  RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            ++IR H E   N A+  L+P + GNVG +FT+GDL EV+
Sbjct  63   KAIRGHIER--NAALEKLLPHIRGNVGFVFTRGDLIEVR  99


 Score = 37.0 bits (84),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDP  593
            +++ + KV APAR G +AP+ V++P  NTGL P
Sbjct  100  DKLLENKVRAPARAGAIAPLSVIIPAQNTGLGP  132



>ref|XP_011157010.1| PREDICTED: 60S acidic ribosomal protein P0 [Solenopsis invicta]
 gb|EFZ19789.1| hypothetical protein SINV_09784 [Solenopsis invicta]
Length=318

 Score =   105 bits (262),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 70/99 (71%), Gaps = 2/99 (2%)
 Frame = +2

Query  197  KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  376
            ++ KA  K  Y  KL QLLD+Y +  I  ADNVGS Q+Q IR  LRG++VVLMGKNTM++
Sbjct  3    REDKATWKSNYFTKLVQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGNAVVLMGKNTMMR  62

Query  377  RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            ++IR H E   N A+  L+P + GNVG +FT+GDL EV+
Sbjct  63   KAIRGHIER--NAALEKLLPHIRGNVGFVFTRGDLIEVR  99


 Score = 37.0 bits (84),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDP  593
            +++ + KV APAR G +AP+ V++P  NTGL P
Sbjct  100  DKLLENKVRAPARAGAIAPLSVIIPAQNTGLGP  132



>ref|XP_003706895.1| PREDICTED: 60S acidic ribosomal protein P0-like [Megachile rotundata]
Length=316

 Score =   105 bits (262),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 70/99 (71%), Gaps = 2/99 (2%)
 Frame = +2

Query  197  KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  376
            ++ KA  K  Y  KL QLLD+Y +  I  ADNVGS Q+Q IR  LRG++VVLMGKNTM++
Sbjct  3    REDKATWKSNYFTKLVQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGNAVVLMGKNTMMR  62

Query  377  RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            ++IR H E   N A+  L+P + GNVG +FT+GDL EV+
Sbjct  63   KAIRGHIER--NAALEKLLPHIRGNVGFVFTRGDLIEVR  99


 Score = 37.0 bits (84),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDP  593
            +++ + KV APAR G +AP+ V++P  NTGL P
Sbjct  100  DKLLENKVRAPARAGAIAPLSVIIPAQNTGLGP  132



>ref|XP_001973718.1| GG16244 [Drosophila erecta]
 gb|EDV52744.1| GG16244 [Drosophila erecta]
Length=317

 Score =   107 bits (266),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 70/100 (70%), Gaps = 2/100 (2%)
 Frame = +2

Query  194  VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  373
            V++ KA  K  Y  K+ +L DE+ +  I  ADNVGS Q+QNIR  LRG +VVLMGKNTM+
Sbjct  2    VRENKAAWKAQYFIKVVELFDEFPKCFIVGADNVGSKQMQNIRTSLRGLAVVLMGKNTMM  61

Query  374  KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            +++IR H EN  N  +  L+P + GNVG +FTKGDL EV+
Sbjct  62   RKAIRGHLEN--NPQLEKLLPHIKGNVGFVFTKGDLAEVR  99


 Score = 35.4 bits (80),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDP  593
            +++ + KV APAR G +AP+ V++P  NTGL P
Sbjct  100  DKLLESKVRAPARPGAIAPLHVIIPAQNTGLGP  132



>ref|XP_001985147.1| GH14667 [Drosophila grimshawi]
 gb|EDV97495.1| GH14667 [Drosophila grimshawi]
Length=318

 Score =   107 bits (266),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 70/100 (70%), Gaps = 2/100 (2%)
 Frame = +2

Query  194  VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  373
            V++ KA  K  Y  K+ +L DE+ +  I  ADNVGS Q+QNIR  LRG +VVLMGKNTM+
Sbjct  2    VRENKAAWKAQYFVKVVELFDEFPKCFIVGADNVGSKQMQNIRTSLRGLAVVLMGKNTMM  61

Query  374  KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            +++IR H EN  N  +  L+P + GNVG +FTKGDL EV+
Sbjct  62   RKAIRGHLEN--NPQLEKLLPHIKGNVGFVFTKGDLAEVR  99


 Score = 35.4 bits (80),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDP  593
            +++ + KV APAR G +AP+ V++P  NTGL P
Sbjct  100  DKLLESKVRAPARPGAIAPLHVIIPAQNTGLGP  132



>ref|XP_001655016.1| AAEL010821-PA [Aedes aegypti]
 gb|ABF18228.1| ribosomal protein P0 [Aedes aegypti]
 gb|EAT37166.1| AAEL010821-PA [Aedes aegypti]
Length=315

 Score =   103 bits (258),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 69/99 (70%), Gaps = 2/99 (2%)
 Frame = +2

Query  197  KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  376
            ++ KA  K  Y  K+ QLLDEY +  I  ADNVGS Q+Q IR  LRG +VVLMGKNTM++
Sbjct  3    REDKATWKANYFVKIVQLLDEYPKCFIVGADNVGSRQMQTIRISLRGTAVVLMGKNTMMR  62

Query  377  RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            ++IR H E   N+ +  L+P + GNVG +FTKGDL EV+
Sbjct  63   KAIRGHLEE--NSNLEKLLPHIKGNVGFVFTKGDLVEVR  99


 Score = 38.5 bits (88),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDP  593
            +++ + KV APAR G +AP++VV+P  NTGL P
Sbjct  100  DKLMESKVRAPARAGAIAPLEVVIPAQNTGLGP  132



>gb|ACR08654.1| ribosomal protein LP0, partial [Drosophila silvestris]
Length=208

 Score =   107 bits (266),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 70/100 (70%), Gaps = 2/100 (2%)
 Frame = +2

Query  194  VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  373
            V++ KA  K  Y  K+ +L DE+ +  I  ADNVGS Q+QNIR  LRG +VVLMGKNTM+
Sbjct  2    VRENKAAWKAQYFVKVVELFDEFPKCFIVGADNVGSKQMQNIRTSLRGLAVVLMGKNTMM  61

Query  374  KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            +++IR H EN  N  +  L+P + GNVG +FTKGDL EV+
Sbjct  62   RKAIRGHLEN--NPQLEKLLPHIKGNVGFVFTKGDLAEVR  99


 Score = 35.4 bits (80),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDP  593
            +++ + KV APAR G +AP+ V++P  NTGL P
Sbjct  100  DKLLESKVRAPARPGAIAPLHVIIPAQNTGLGP  132



>ref|XP_002040897.1| GM22429 [Drosophila sechellia]
 ref|XP_002085890.1| GD15019 [Drosophila simulans]
 gb|EDW44450.1| GM22429 [Drosophila sechellia]
 gb|EDX11475.1| GD15019 [Drosophila simulans]
Length=317

 Score =   107 bits (266),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 70/100 (70%), Gaps = 2/100 (2%)
 Frame = +2

Query  194  VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  373
            V++ KA  K  Y  K+ +L DE+ +  I  ADNVGS Q+QNIR  LRG +VVLMGKNTM+
Sbjct  2    VRENKAAWKAQYFIKVVELFDEFPKCFIVGADNVGSKQMQNIRTSLRGLAVVLMGKNTMM  61

Query  374  KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            +++IR H EN  N  +  L+P + GNVG +FTKGDL EV+
Sbjct  62   RKAIRGHLEN--NPQLEKLLPHIKGNVGFVFTKGDLAEVR  99


 Score = 35.4 bits (80),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDP  593
            +++ + KV APAR G +AP+ V++P  NTGL P
Sbjct  100  DKLLESKVRAPARPGAIAPLHVIIPAQNTGLGP  132



>ref|NP_524211.1| ribosomal protein LP0, isoform A [Drosophila melanogaster]
 ref|NP_001262202.1| ribosomal protein LP0, isoform B [Drosophila melanogaster]
 sp|P19889.1|RLA0_DROME RecName: Full=60S acidic ribosomal protein P0; AltName: Full=Apurinic-apyrimidinic 
endonuclease; AltName: Full=DNA-(apurinic 
or apyrimidinic site) lyase [Drosophila melanogaster]
 gb|AAA53372.1| DNA repair protein [Drosophila melanogaster]
 gb|AAF51807.1| ribosomal protein LP0, isoform A [Drosophila melanogaster]
 gb|AAL68335.1| RE74511p [Drosophila melanogaster]
 gb|AAX33595.1| GH01513p [Drosophila melanogaster]
 gb|AGB94895.1| ribosomal protein LP0, isoform B [Drosophila melanogaster]
Length=317

 Score =   107 bits (266),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 70/100 (70%), Gaps = 2/100 (2%)
 Frame = +2

Query  194  VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  373
            V++ KA  K  Y  K+ +L DE+ +  I  ADNVGS Q+QNIR  LRG +VVLMGKNTM+
Sbjct  2    VRENKAAWKAQYFIKVVELFDEFPKCFIVGADNVGSKQMQNIRTSLRGLAVVLMGKNTMM  61

Query  374  KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            +++IR H EN  N  +  L+P + GNVG +FTKGDL EV+
Sbjct  62   RKAIRGHLEN--NPQLEKLLPHIKGNVGFVFTKGDLAEVR  99


 Score = 35.4 bits (80),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDP  593
            +++ + KV APAR G +AP+ V++P  NTGL P
Sbjct  100  DKLLESKVRAPARPGAIAPLHVIIPAQNTGLGP  132



>ref|XP_008544624.1| PREDICTED: 60S acidic ribosomal protein P0 [Microplitis demolitor]
Length=316

 Score =   105 bits (261),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 69/99 (70%), Gaps = 2/99 (2%)
 Frame = +2

Query  197  KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  376
            ++ KA  K  Y  KL QLLD+Y +  I  ADNVGS Q+Q IR  LRG +VVLMGKNTM++
Sbjct  3    REDKASWKSNYFLKLIQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGSAVVLMGKNTMMR  62

Query  377  RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            ++IR H E   N A+  L+P + GNVG +FT+GDL EV+
Sbjct  63   KAIRGHIER--NAALEKLLPHIRGNVGFVFTRGDLVEVR  99


 Score = 37.4 bits (85),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDP  593
            +++ + KV APAR G +AP+ V++P  NTGL P
Sbjct  100  DKLVENKVRAPARAGAIAPLSVIIPAQNTGLGP  132



>ref|XP_002095795.1| RpLP0 [Drosophila yakuba]
 gb|EDW95507.1| RpLP0 [Drosophila yakuba]
Length=317

 Score =   106 bits (265),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 70/100 (70%), Gaps = 2/100 (2%)
 Frame = +2

Query  194  VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  373
            V++ KA  K  Y  K+ +L DE+ +  I  ADNVGS Q+QNIR  LRG +VVLMGKNTM+
Sbjct  2    VRENKAAWKAQYFIKVVELFDEFPKCFIVGADNVGSKQMQNIRTSLRGLAVVLMGKNTMM  61

Query  374  KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            +++IR H EN  N  +  L+P + GNVG +FTKGDL EV+
Sbjct  62   RKAIRGHLEN--NPQLEKLLPHIKGNVGFVFTKGDLAEVR  99


 Score = 35.4 bits (80),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDP  593
            +++ + KV APAR G +AP+ V++P  NTGL P
Sbjct  100  DKLLESKVRAPARPGAIAPLHVIIPAQNTGLGP  132



>gb|AAR09675.1| similar to Drosophila melanogaster RpP0, partial [Drosophila 
yakuba]
Length=245

 Score =   106 bits (265),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 70/100 (70%), Gaps = 2/100 (2%)
 Frame = +2

Query  194  VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  373
            V++ KA  K  Y  K+ +L DE+ +  I  ADNVGS Q+QNIR  LRG +VVLMGKNTM+
Sbjct  2    VRENKAAWKAQYFIKVVELFDEFPKCFIVGADNVGSKQMQNIRTSLRGLAVVLMGKNTMM  61

Query  374  KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            +++IR H EN  N  +  L+P + GNVG +FTKGDL EV+
Sbjct  62   RKAIRGHLEN--NPQLEKLLPHIKGNVGFVFTKGDLAEVR  99


 Score = 35.4 bits (80),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDP  593
            +++ + KV APAR G +AP+ V++P  NTGL P
Sbjct  100  DKLLESKVRAPARPGAIAPLHVIIPAQNTGLGP  132



>ref|XP_011347099.1| PREDICTED: 60S acidic ribosomal protein P0 [Cerapachys biroi]
 gb|EZA49150.1| 60S acidic ribosomal protein P0 [Cerapachys biroi]
Length=317

 Score =   104 bits (260),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 70/99 (71%), Gaps = 2/99 (2%)
 Frame = +2

Query  197  KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  376
            ++ KA  K  Y  KL QLLD++ +  I  ADNVGS Q+Q IR  LRG++VVLMGKNTM++
Sbjct  3    REDKATWKSQYFTKLVQLLDDFPKCFIVGADNVGSKQMQQIRMSLRGNAVVLMGKNTMMR  62

Query  377  RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            ++IR H E   N A+  L+P + GNVG +FT+GDL EV+
Sbjct  63   KAIRGHIER--NAALEKLLPHIRGNVGFVFTRGDLIEVR  99


 Score = 37.4 bits (85),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDP  593
            +++ + KV APAR G +AP+ V++P  NTGL P
Sbjct  100  DKLLENKVRAPARAGAIAPLSVIIPAQNTGLGP  132



>gb|AAM97779.1| ribosomal protein P0 [Aedes albopictus]
Length=315

 Score =   103 bits (258),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 69/99 (70%), Gaps = 2/99 (2%)
 Frame = +2

Query  197  KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  376
            ++ KA  K  Y  K+ QLLDEY +  I  ADNVGS Q+Q IR  LRG +VVLMGKNTM++
Sbjct  3    REDKATWKANYFVKIVQLLDEYPKCFIVGADNVGSRQMQTIRISLRGTAVVLMGKNTMMR  62

Query  377  RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            ++IR H E   N+ +  L+P + GNVG +FTKGDL EV+
Sbjct  63   KAIRGHLEE--NSNLEKLLPHVKGNVGFVFTKGDLVEVR  99


 Score = 38.1 bits (87),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDP  593
            +++ + KV APAR G +AP++V++P  NTGL P
Sbjct  100  DKLMESKVRAPARAGAIAPLEVIIPAQNTGLGP  132



>ref|XP_011146290.1| PREDICTED: 60S acidic ribosomal protein P0-like [Harpegnathos 
saltator]
 gb|EFN80029.1| 60S acidic ribosomal protein P0 [Harpegnathos saltator]
Length=316

 Score =   104 bits (259),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 69/99 (70%), Gaps = 2/99 (2%)
 Frame = +2

Query  197  KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  376
            ++ K   K  Y  KL QLLD+Y +  I  ADNVGS Q+Q IR  LRG++VVLMGKNTM++
Sbjct  3    REDKTTWKSNYFTKLVQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGNAVVLMGKNTMMR  62

Query  377  RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            ++IR H E   N A+  L+P + GNVG +FT+GDL EV+
Sbjct  63   KAIRGHVER--NAALEKLLPHIRGNVGFVFTRGDLIEVR  99


 Score = 37.4 bits (85),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDP  593
            +++ + KV APAR G +AP+ VV+P  NTGL P
Sbjct  100  DKLLENKVRAPARAGAIAPLSVVIPAQNTGLGP  132



>ref|XP_002047707.1| GJ13582 [Drosophila virilis]
 gb|EDW70049.1| GJ13582 [Drosophila virilis]
Length=317

 Score =   107 bits (266),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 70/100 (70%), Gaps = 2/100 (2%)
 Frame = +2

Query  194  VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  373
            V++ KA  K  Y  K+ +L DE+ +  I  ADNVGS Q+QNIR  LRG +VVLMGKNTM+
Sbjct  2    VRENKAAWKAQYFIKVVELFDEFPKCFIVGADNVGSKQMQNIRTSLRGLAVVLMGKNTMM  61

Query  374  KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            +++IR H EN  N  +  L+P + GNVG +FTKGDL EV+
Sbjct  62   RKAIRGHLEN--NPQLEKLLPHIKGNVGFVFTKGDLAEVR  99


 Score = 34.7 bits (78),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDP  593
            +++ + KV APAR G +AP+ VV+P  NTGL P
Sbjct  100  DKLLESKVRAPARPGAIAPLPVVIPAQNTGLGP  132



>ref|XP_011064775.1| PREDICTED: 60S acidic ribosomal protein P0 [Acromyrmex echinatior]
 gb|EGI58991.1| 60S acidic ribosomal protein P0 [Acromyrmex echinatior]
Length=318

 Score =   104 bits (259),  Expect(2) = 5e-25, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 70/99 (71%), Gaps = 2/99 (2%)
 Frame = +2

Query  197  KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  376
            ++ KA  K  Y  KL QLLD++ +  I  ADNVGS Q+Q IR  LRG++VVLMGKNTM++
Sbjct  3    REDKATWKSNYFTKLVQLLDDFPKCFIVGADNVGSKQMQQIRMSLRGNAVVLMGKNTMMR  62

Query  377  RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            ++IR H E   N A+  L+P + GNVG +FT+GDL EV+
Sbjct  63   KAIRGHIER--NAALEKLLPHIRGNVGFVFTRGDLIEVR  99


 Score = 37.0 bits (84),  Expect(2) = 5e-25, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDP  593
            +++ + KV APAR G +AP+ V++P  NTGL P
Sbjct  100  DKLLENKVRAPARAGAIAPLSVIIPAQNTGLGP  132



>ref|XP_001851128.1| 60S acidic ribosomal protein P0 [Culex quinquefasciatus]
 gb|EDS33081.1| 60S acidic ribosomal protein P0 [Culex quinquefasciatus]
Length=315

 Score =   102 bits (255),  Expect(2) = 6e-25, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 69/99 (70%), Gaps = 2/99 (2%)
 Frame = +2

Query  197  KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  376
            ++ K   K  Y  K+ QLLDEY +  I  ADNVGS Q+Q IR  LRG ++VLMGKNTM++
Sbjct  3    REDKTTWKANYFVKIVQLLDEYPKCFIVGADNVGSRQMQTIRISLRGSAIVLMGKNTMMR  62

Query  377  RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            ++IR H EN  N+ +  L+P + GNVG +FTKGDL +++
Sbjct  63   KAIRGHLEN--NSNLEKLLPHIRGNVGFVFTKGDLADIR  99


 Score = 38.1 bits (87),  Expect(2) = 6e-25, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDP  593
            +++ + KV APAR G +AP++V++P  NTGL P
Sbjct  100  DKLMESKVRAPARAGAIAPLEVIIPAQNTGLGP  132



>ref|XP_002008961.1| GI13777 [Drosophila mojavensis]
 gb|EDW19437.1| GI13777 [Drosophila mojavensis]
Length=317

 Score =   107 bits (266),  Expect(2) = 6e-25, Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 70/100 (70%), Gaps = 2/100 (2%)
 Frame = +2

Query  194  VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  373
            V++ KA  K  Y  K+ +L DE+ +  I  ADNVGS Q+QNIR  LRG +VVLMGKNTM+
Sbjct  2    VRENKAAWKAQYFIKVVELFDEFPKCFIVGADNVGSKQMQNIRTSLRGLAVVLMGKNTMM  61

Query  374  KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            +++IR H EN  N  +  L+P + GNVG +FTKGDL EV+
Sbjct  62   RKAIRGHLEN--NPQLEKLLPHIKGNVGFVFTKGDLAEVR  99


 Score = 34.3 bits (77),  Expect(2) = 6e-25, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDP  593
            +++ + KV APAR G +AP+ V++P  NTGL P
Sbjct  100  DKLLESKVRAPARPGAIAPLPVIIPAQNTGLGP  132



>ref|XP_011146226.1| PREDICTED: 60S acidic ribosomal protein P0-like [Harpegnathos 
saltator]
 gb|EFN79997.1| 60S acidic ribosomal protein P0 [Harpegnathos saltator]
Length=316

 Score =   103 bits (257),  Expect(2) = 6e-25, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 68/99 (69%), Gaps = 2/99 (2%)
 Frame = +2

Query  197  KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  376
            ++ K   K  Y  KL QLLD+Y +  I  ADNVGS Q+Q IR  LRG+ VVLMGKNTM++
Sbjct  3    REDKTTWKSNYFTKLVQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGNGVVLMGKNTMMR  62

Query  377  RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            ++IR H E   N A+  L+P + GNVG +FT+GDL EV+
Sbjct  63   KAIRGHVER--NAALEKLLPHIRGNVGFVFTRGDLIEVR  99


 Score = 37.4 bits (85),  Expect(2) = 6e-25, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDP  593
            +++ + KV APAR G +AP+ VV+P  NTGL P
Sbjct  100  DKLLENKVRAPARAGAIAPLSVVIPAQNTGLGP  132



>emb|CBM69268.1| venom protein Ci-40b [Chelonus inanitus]
Length=316

 Score =   103 bits (258),  Expect(2) = 7e-25, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 70/99 (71%), Gaps = 2/99 (2%)
 Frame = +2

Query  197  KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  376
            ++ KA  K  Y  KL QLL++Y +  I  ADNVGS Q+Q IR  LRG++VVLMGKNTM++
Sbjct  3    REDKATWKSNYFTKLIQLLEDYPKCFIVGADNVGSKQMQQIRMSLRGNAVVLMGKNTMMR  62

Query  377  RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            ++IR H E   N A+  L+P + GNVG +FT+GDL EV+
Sbjct  63   KAIRGHIER--NAALEKLLPHIRGNVGFVFTRGDLVEVR  99


 Score = 37.0 bits (84),  Expect(2) = 7e-25, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDP  593
            +++ + KV APAR G +AP+ VV+P  NTGL P
Sbjct  100  DKLLENKVRAPARAGAMAPLSVVIPAQNTGLGP  132



>dbj|BAM18929.1| ribosomal protein LP0 [Papilio polytes]
Length=317

 Score =   104 bits (260),  Expect(2) = 8e-25, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 70/99 (71%), Gaps = 2/99 (2%)
 Frame = +2

Query  197  KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  376
            ++ KA  K  Y  K+ QLLDEY +  +  ADNVGS Q+Q IR  LRG S+VLMGKNTM++
Sbjct  3    REDKATWKTNYFTKIIQLLDEYPKCFLVGADNVGSTQMQQIRISLRGHSIVLMGKNTMMR  62

Query  377  RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            ++I+ H +N  N A+  L+P + GNVG +FT+GDL EV+
Sbjct  63   KAIKDHLDN--NPALEKLLPHIKGNVGFVFTRGDLVEVR  99


 Score = 35.8 bits (81),  Expect(2) = 8e-25, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDP  593
            +++ + KV APAR G +AP+ VV+P  NTGL P
Sbjct  100  DKLLENKVRAPARPGAIAPLSVVIPAHNTGLGP  132



>dbj|BAM17678.1| ribosomal protein LP0 [Papilio xuthus]
Length=316

 Score =   104 bits (260),  Expect(2) = 8e-25, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 70/99 (71%), Gaps = 2/99 (2%)
 Frame = +2

Query  197  KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  376
            ++ KA  K  Y  K+ QLLDEY +  +  ADNVGS Q+Q IR  LRG S+VLMGKNTM++
Sbjct  3    REDKATWKTNYFTKIIQLLDEYPKCFLVGADNVGSTQMQQIRISLRGHSIVLMGKNTMMR  62

Query  377  RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            ++I+ H +N  N A+  L+P + GNVG +FT+GDL EV+
Sbjct  63   KAIKDHLDN--NPALEKLLPHIKGNVGFVFTRGDLVEVR  99


 Score = 35.8 bits (81),  Expect(2) = 8e-25, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDP  593
            +++ + KV APAR G +AP+ VV+P  NTGL P
Sbjct  100  DKLLENKVRAPARPGAIAPLSVVIPAHNTGLGP  132



>emb|CAD29995.1| ribosomal P0 protein [Bombyx mori]
Length=316

 Score =   104 bits (259),  Expect(2) = 8e-25, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 70/99 (71%), Gaps = 2/99 (2%)
 Frame = +2

Query  197  KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  376
            ++ KA  K  Y  K+ QLLDEY +  I  ADNVGS Q+Q IR  LRG S+VLMGKNTM++
Sbjct  3    REDKATWKSNYFVKIIQLLDEYPKCFIVGADNVGSQQMQQIRISLRGSSIVLMGKNTMMR  62

Query  377  RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            ++I+ H +N  N A+  L+P + GNVG +FT+GDL EV+
Sbjct  63   KAIKDHLDN--NPALEKLLPHIKGNVGFVFTRGDLVEVR  99


 Score = 36.2 bits (82),  Expect(2) = 8e-25, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDP  593
            +++ + KV APAR G +AP+ VV+P  NTGL P
Sbjct  100  DKLLENKVQAPARPGAIAPLSVVIPAHNTGLGP  132



>ref|NP_001037123.1| ribosomal protein P0 [Bombyx mori]
 gb|AAV34809.1| ribosomal protein P0 [Bombyx mori]
Length=316

 Score =   104 bits (259),  Expect(2) = 8e-25, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 70/99 (71%), Gaps = 2/99 (2%)
 Frame = +2

Query  197  KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  376
            ++ KA  K  Y  K+ QLLDEY +  I  ADNVGS Q+Q IR  LRG S+VLMGKNTM++
Sbjct  3    REDKATWKSNYFVKIIQLLDEYPKCFIVGADNVGSQQMQQIRISLRGSSIVLMGKNTMMR  62

Query  377  RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            ++I+ H +N  N A+  L+P + GNVG +FT+GDL EV+
Sbjct  63   KAIKDHLDN--NPALEKLLPHIKGNVGFVFTRGDLVEVR  99


 Score = 36.2 bits (82),  Expect(2) = 8e-25, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDP  593
            +++ + KV APAR G +AP+ VV+P  NTGL P
Sbjct  100  DKLLENKVQAPARPGAIAPLSVVIPAHNTGLGP  132



>gb|EHJ75936.1| ribosomal protein P0 [Danaus plexippus]
Length=316

 Score =   105 bits (262),  Expect(2) = 8e-25, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 69/99 (70%), Gaps = 2/99 (2%)
 Frame = +2

Query  197  KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  376
            ++ KA  K  Y  K+ QLLDEY +  I  ADNVGS Q+Q IR  LRG S+VLMGKNTM++
Sbjct  3    REDKASWKTNYFTKIIQLLDEYPKCFIVGADNVGSQQMQQIRISLRGSSIVLMGKNTMMR  62

Query  377  RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            ++I+ H E   N A+  L+P + GNVG +FT+GDL EV+
Sbjct  63   KAIKDHLET--NPALEKLLPHIKGNVGFVFTRGDLVEVR  99


 Score = 35.0 bits (79),  Expect(2) = 8e-25, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDP  593
            +++ + KV APAR G +AP+ VV+P  NTGL P
Sbjct  100  DKLLENKVRAPARPGAIAPLAVVIPAHNTGLGP  132



>gb|AIW62441.1| 60S acidic ribosomal protein [Scytodes thoracica]
Length=320

 Score =   102 bits (253),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 68/99 (69%), Gaps = 2/99 (2%)
 Frame = +2

Query  197  KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  376
            ++ +A  K  Y  KL QLLDEY +  I   D+VGS Q+Q IR  LR D+V+LMGKNTMI+
Sbjct  3    REDRATWKSNYFMKLVQLLDEYPKCFIVGVDDVGSRQMQQIRLSLRKDAVLLMGKNTMIR  62

Query  377  RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            ++IR H EN  N A+  +IP + GNVG +FTK DL EV+
Sbjct  63   KAIRGHMEN--NPALEKIIPHIRGNVGFVFTKEDLVEVR  99


 Score = 38.5 bits (88),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 23/33 (70%), Gaps = 0/33 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDP  593
            +++   KV APAR G +AP DV++ P NTGL P
Sbjct  100  DKIIDNKVKAPARAGAIAPCDVILQPQNTGLGP  132



>gb|ADT80652.1| ribosomal protein P0 [Euphydryas aurinia]
Length=316

 Score =   105 bits (261),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 69/99 (70%), Gaps = 2/99 (2%)
 Frame = +2

Query  197  KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  376
            ++ KA  K  Y  K+ QLLDEY +  I  ADNVGS Q+Q IR  LRG S+VLMGKNTM++
Sbjct  3    REDKATWKTNYFTKIIQLLDEYPKCFIVGADNVGSQQMQQIRISLRGHSIVLMGKNTMMR  62

Query  377  RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            ++I+ H E   N A+  L+P + GNVG +FT+GDL EV+
Sbjct  63   KAIKDHLET--NPALEKLLPHIKGNVGFVFTRGDLVEVR  99


 Score = 35.0 bits (79),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDP  593
            +++ + KV APAR G +AP+ VV+P  NTGL P
Sbjct  100  DKLLENKVRAPARPGAIAPLAVVIPAHNTGLGP  132



>gb|ACY95307.1| ribosomal protein P0 [Manduca sexta]
Length=317

 Score =   103 bits (258),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 70/99 (71%), Gaps = 2/99 (2%)
 Frame = +2

Query  197  KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  376
            ++ KA  K  Y  K+ QLLDEY +  I  ADNVGS Q+Q IR  LRG S+VLMGKNTM++
Sbjct  3    REDKATWKTNYFTKIIQLLDEYPKCFIVGADNVGSQQMQQIRISLRGHSIVLMGKNTMMR  62

Query  377  RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVK  493
            ++I+ H +N  N A+  L+P + GNVG +FT+GDL +V+
Sbjct  63   KAIKDHLDN--NPALEKLLPHIKGNVGFVFTRGDLVDVR  99


 Score = 36.2 bits (82),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = +3

Query  495  EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDP  593
            +++ + KV APAR G +AP+ VV+P  NTGL P
Sbjct  100  DKLLENKVQAPARPGAIAPLSVVIPAHNTGLGP  132



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 788578232940