BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002E06

Length=460
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006350186.1|  PREDICTED: serine carboxypeptidase-like 18-l...    195   2e-57   
gb|AAD01264.1|  glucose acyltransferase                                 194   1e-56   Solanum berthaultii
ref|XP_006350185.1|  PREDICTED: serine carboxypeptidase-like 18-l...    194   3e-56   Solanum tuberosum [potatoes]
ref|XP_009795830.1|  PREDICTED: serine carboxypeptidase-like 18 i...    194   4e-56   Nicotiana sylvestris
ref|XP_009614132.1|  PREDICTED: serine carboxypeptidase-like 18 i...    193   4e-56   Nicotiana tomentosiformis
ref|XP_006353974.1|  PREDICTED: serine carboxypeptidase-like 18-like    192   9e-56   Solanum tuberosum [potatoes]
gb|AAF64227.1|AF248647_1  glucose acyltransferase                       191   4e-55   Solanum pennellii
ref|XP_004248779.1|  PREDICTED: serine carboxypeptidase-like 18         191   4e-55   Solanum lycopersicum
ref|XP_004248778.1|  PREDICTED: serine carboxypeptidase-like 18         189   1e-54   Solanum lycopersicum
ref|XP_006353975.1|  PREDICTED: serine carboxypeptidase-like 18-like    188   3e-54   Solanum tuberosum [potatoes]
ref|XP_006353976.1|  PREDICTED: serine carboxypeptidase-like 18-like    188   3e-54   Solanum tuberosum [potatoes]
gb|AAD01263.1|  glucose acyltransferase                                 186   4e-53   Solanum berthaultii
gb|AAD01265.1|  glucose acyltransferase                                 186   4e-53   Solanum berthaultii
ref|XP_010030617.1|  PREDICTED: serine carboxypeptidase-like 18         184   1e-52   
gb|KCW55058.1|  hypothetical protein EUGRSUZ_I01033                     183   1e-52   Eucalyptus grandis [rose gum]
gb|KCW55074.1|  hypothetical protein EUGRSUZ_I01040                     183   2e-52   Eucalyptus grandis [rose gum]
ref|XP_010028344.1|  PREDICTED: serine carboxypeptidase-like 7          183   3e-52   Eucalyptus grandis [rose gum]
gb|KCW55073.1|  hypothetical protein EUGRSUZ_I01040                     183   5e-52   Eucalyptus grandis [rose gum]
ref|XP_010028339.1|  PREDICTED: serine carboxypeptidase-like 18         182   6e-52   Eucalyptus grandis [rose gum]
ref|XP_010040883.1|  PREDICTED: serine carboxypeptidase-like 18         179   6e-51   
ref|XP_010028343.1|  PREDICTED: serine carboxypeptidase-like 18 i...    179   7e-51   Eucalyptus grandis [rose gum]
ref|XP_010028342.1|  PREDICTED: serine carboxypeptidase-like 18 i...    178   1e-50   
ref|XP_010028346.1|  PREDICTED: serine carboxypeptidase-like 18         179   1e-50   Eucalyptus grandis [rose gum]
ref|XP_010028345.1|  PREDICTED: serine carboxypeptidase-like 18         179   1e-50   Eucalyptus grandis [rose gum]
ref|XP_010028341.1|  PREDICTED: serine carboxypeptidase-like 18 i...    178   2e-50   Eucalyptus grandis [rose gum]
ref|XP_009343183.1|  PREDICTED: serine carboxypeptidase-like 18 i...    173   2e-49   
ref|XP_002269439.1|  PREDICTED: serine carboxypeptidase-like 7          175   4e-49   Vitis vinifera
ref|XP_009343180.1|  PREDICTED: serine carboxypeptidase-like 1          175   4e-49   Pyrus x bretschneideri [bai li]
emb|CBI22419.3|  unnamed protein product                                175   4e-49   Vitis vinifera
gb|KDP44531.1|  hypothetical protein JCGZ_16364                         176   5e-49   Jatropha curcas
ref|XP_009343181.1|  PREDICTED: serine carboxypeptidase-like 1 is...    174   9e-49   
gb|KCW63578.1|  hypothetical protein EUGRSUZ_G01202                     172   1e-48   Eucalyptus grandis [rose gum]
ref|XP_008236294.1|  PREDICTED: serine carboxypeptidase-like 14         173   2e-48   Prunus mume [ume]
ref|XP_010647903.1|  PREDICTED: serine carboxypeptidase-like 13         173   2e-48   Vitis vinifera
ref|XP_007201135.1|  hypothetical protein PRUPE_ppa016992mg             172   2e-48   
emb|CBI22421.3|  unnamed protein product                                174   4e-48   Vitis vinifera
ref|XP_011457834.1|  PREDICTED: serine carboxypeptidase-like 18         172   4e-48   Fragaria vesca subsp. vesca
ref|XP_011100014.1|  PREDICTED: serine carboxypeptidase-like 18 i...    170   9e-48   
ref|XP_010692123.1|  PREDICTED: serine carboxypeptidase-like 13         171   1e-47   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002522135.1|  serine carboxypeptidase, putative                  171   1e-47   
ref|XP_006486895.1|  PREDICTED: serine carboxypeptidase-like 18-like    171   1e-47   Citrus sinensis [apfelsine]
gb|KCW63574.1|  hypothetical protein EUGRSUZ_G01198                     170   1e-47   Eucalyptus grandis [rose gum]
ref|XP_011100016.1|  PREDICTED: serine carboxypeptidase-like 18 i...    170   2e-47   Sesamum indicum [beniseed]
ref|XP_002534183.1|  serine carboxypeptidase, putative                  167   2e-47   
gb|KCW63573.1|  hypothetical protein EUGRSUZ_G01198                     170   2e-47   Eucalyptus grandis [rose gum]
gb|KCW63571.1|  hypothetical protein EUGRSUZ_G01198                     170   2e-47   Eucalyptus grandis [rose gum]
ref|XP_010065870.1|  PREDICTED: serine carboxypeptidase-like 13 i...    170   2e-47   
ref|XP_009343914.1|  PREDICTED: serine carboxypeptidase-like 7          170   3e-47   Pyrus x bretschneideri [bai li]
ref|XP_011100013.1|  PREDICTED: serine carboxypeptidase-like 13 i...    170   3e-47   
ref|XP_009375674.1|  PREDICTED: serine carboxypeptidase-like 7          170   3e-47   Pyrus x bretschneideri [bai li]
ref|XP_011100017.1|  PREDICTED: serine carboxypeptidase-like 13         170   3e-47   Sesamum indicum [beniseed]
ref|XP_010065869.1|  PREDICTED: serine carboxypeptidase-like 2 is...    170   3e-47   Eucalyptus grandis [rose gum]
ref|XP_011100015.1|  PREDICTED: serine carboxypeptidase-like 7 is...    169   5e-47   Sesamum indicum [beniseed]
ref|XP_006486896.1|  PREDICTED: serine carboxypeptidase-like 18-like    169   5e-47   Citrus sinensis [apfelsine]
gb|KCW63576.1|  hypothetical protein EUGRSUZ_G01200                     169   5e-47   Eucalyptus grandis [rose gum]
gb|KCW63570.1|  hypothetical protein EUGRSUZ_G01197                     169   5e-47   Eucalyptus grandis [rose gum]
ref|XP_010065873.1|  PREDICTED: serine carboxypeptidase-like 2          169   6e-47   Eucalyptus grandis [rose gum]
ref|XP_006422777.1|  hypothetical protein CICLE_v10028360mg             169   9e-47   Citrus clementina [clementine]
ref|XP_010065864.1|  PREDICTED: serine carboxypeptidase-like 2 is...    169   1e-46   Eucalyptus grandis [rose gum]
ref|XP_008236346.1|  PREDICTED: serine carboxypeptidase-like 18         168   1e-46   
ref|XP_010065865.1|  PREDICTED: serine carboxypeptidase-like 2 is...    169   1e-46   Eucalyptus grandis [rose gum]
ref|XP_011030311.1|  PREDICTED: serine carboxypeptidase-like 18 i...    168   1e-46   Populus euphratica
ref|XP_010065871.1|  PREDICTED: serine carboxypeptidase-like 2 is...    168   1e-46   
gb|KCW63569.1|  hypothetical protein EUGRSUZ_G01197                     168   1e-46   Eucalyptus grandis [rose gum]
ref|XP_002522133.1|  serine carboxypeptidase, putative                  169   1e-46   Ricinus communis
ref|XP_011030309.1|  PREDICTED: serine carboxypeptidase-like 18 i...    167   2e-46   Populus euphratica
ref|XP_011088733.1|  PREDICTED: serine carboxypeptidase-like 7          168   2e-46   Sesamum indicum [beniseed]
ref|XP_010682454.1|  PREDICTED: serine carboxypeptidase-like 18 i...    167   2e-46   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007200784.1|  hypothetical protein PRUPE_ppa024053mg             167   2e-46   
ref|XP_011030308.1|  PREDICTED: serine carboxypeptidase-like 18 i...    167   2e-46   Populus euphratica
ref|XP_011030310.1|  PREDICTED: serine carboxypeptidase-like 18 i...    167   4e-46   Populus euphratica
ref|XP_011030307.1|  PREDICTED: serine carboxypeptidase-like 18 i...    167   4e-46   Populus euphratica
ref|XP_006369726.1|  hypothetical protein POPTR_0001s29910g             164   4e-46   
ref|XP_006422780.1|  hypothetical protein CICLE_v10028349mg             167   4e-46   Citrus clementina [clementine]
ref|XP_002265842.1|  PREDICTED: serine carboxypeptidase-like 18         167   5e-46   Vitis vinifera
emb|CBI22424.3|  unnamed protein product                                167   5e-46   Vitis vinifera
emb|CAN74923.1|  hypothetical protein VITISV_038590                     167   5e-46   Vitis vinifera
gb|KDP44532.1|  hypothetical protein JCGZ_16365                         166   8e-46   Jatropha curcas
ref|XP_008236293.1|  PREDICTED: serine carboxypeptidase-like 18 i...    166   9e-46   
ref|XP_006369725.1|  hypothetical protein POPTR_0001s29900g             166   1e-45   
gb|EYU37560.1|  hypothetical protein MIMGU_mgv1a005845mg                166   1e-45   Erythranthe guttata [common monkey flower]
gb|EYU37561.1|  hypothetical protein MIMGU_mgv1a005963mg                166   1e-45   Erythranthe guttata [common monkey flower]
ref|XP_010094886.1|  Serine carboxypeptidase-like 18                    165   1e-45   
ref|XP_006369720.1|  hypothetical protein POPTR_0001s29840g             164   1e-45   
gb|EPS59025.1|  hypothetical protein M569_15786                         158   1e-45   Genlisea aurea
ref|XP_008236292.1|  PREDICTED: serine carboxypeptidase-like 13 i...    166   2e-45   Prunus mume [ume]
ref|XP_008236291.1|  PREDICTED: serine carboxypeptidase-like 13 i...    165   2e-45   
ref|XP_007201024.1|  hypothetical protein PRUPE_ppa006101mg             164   2e-45   
gb|KCW63567.1|  hypothetical protein EUGRSUZ_G01195                     164   2e-45   Eucalyptus grandis [rose gum]
ref|XP_002298786.2|  hypothetical protein POPTR_0001s29870g             164   3e-45   
ref|XP_002266354.2|  PREDICTED: serine carboxypeptidase-like 18         164   4e-45   Vitis vinifera
ref|XP_006486897.1|  PREDICTED: serine carboxypeptidase-like 17-like    164   4e-45   Citrus sinensis [apfelsine]
ref|XP_010065872.1|  PREDICTED: serine carboxypeptidase-like 2          164   4e-45   
emb|CBI22420.3|  unnamed protein product                                164   6e-45   Vitis vinifera
ref|XP_007201000.1|  hypothetical protein PRUPE_ppa005249mg             163   6e-45   
ref|XP_002300280.2|  hypothetical protein POPTR_0001s29810g             163   7e-45   
ref|XP_008236287.1|  PREDICTED: serine carboxypeptidase-like 13         164   7e-45   Prunus mume [ume]
ref|XP_010065879.1|  PREDICTED: serine carboxypeptidase-like 13         163   9e-45   Eucalyptus grandis [rose gum]
ref|XP_010046973.1|  PREDICTED: serine carboxypeptidase-like 18         164   9e-45   Eucalyptus grandis [rose gum]
ref|XP_004513965.1|  PREDICTED: serine carboxypeptidase-like 18-l...    162   1e-44   
ref|XP_008338878.1|  PREDICTED: serine carboxypeptidase-like 1          163   1e-44   
ref|XP_007201001.1|  hypothetical protein PRUPE_ppa005249mg             163   1e-44   
gb|KDP35359.1|  hypothetical protein JCGZ_10343                         157   1e-44   Jatropha curcas
dbj|BAF99696.1|  1-O-acylglucose:anthocyanin-O-acyltransferase- l...    163   2e-44   Gentiana triflora
ref|XP_011466202.1|  PREDICTED: serine carboxypeptidase-like 2 is...    163   2e-44   Fragaria vesca subsp. vesca
ref|XP_011458874.1|  PREDICTED: serine carboxypeptidase-like 18 i...    162   2e-44   Fragaria vesca subsp. vesca
gb|KDP35358.1|  hypothetical protein JCGZ_10342                         162   2e-44   Jatropha curcas
ref|XP_004292764.2|  PREDICTED: serine carboxypeptidase-like 7 is...    162   2e-44   Fragaria vesca subsp. vesca
ref|XP_002522137.1|  serine carboxypeptidase, putative                  162   3e-44   
gb|KCW55082.1|  hypothetical protein EUGRSUZ_I01044                     161   3e-44   Eucalyptus grandis [rose gum]
ref|XP_009614133.1|  PREDICTED: serine carboxypeptidase-like 18 i...    162   3e-44   Nicotiana tomentosiformis
ref|XP_009365383.1|  PREDICTED: serine carboxypeptidase-like 13         162   4e-44   
ref|XP_003556796.2|  PREDICTED: serine carboxypeptidase-like 17-l...    160   4e-44   
ref|XP_004513964.1|  PREDICTED: serine carboxypeptidase-like 18-l...    162   5e-44   Cicer arietinum [garbanzo]
emb|CBI19380.3|  unnamed protein product                                162   5e-44   Vitis vinifera
ref|XP_002283413.1|  PREDICTED: serine carboxypeptidase-like 2          161   5e-44   Vitis vinifera
ref|XP_010028338.1|  PREDICTED: serine carboxypeptidase-like 13         161   5e-44   Eucalyptus grandis [rose gum]
gb|KDO81469.1|  hypothetical protein CISIN_1g012276mg                   159   5e-44   Citrus sinensis [apfelsine]
gb|KDP44530.1|  hypothetical protein JCGZ_16363                         161   5e-44   Jatropha curcas
ref|XP_008236347.1|  PREDICTED: serine carboxypeptidase-like 13         162   5e-44   
ref|XP_006422770.1|  hypothetical protein CICLE_v10028371mg             161   7e-44   Citrus clementina [clementine]
ref|XP_008236280.1|  PREDICTED: serine carboxypeptidase-like 17 i...    161   7e-44   Prunus mume [ume]
ref|XP_008236275.1|  PREDICTED: serine carboxypeptidase-like 17 i...    161   7e-44   Prunus mume [ume]
ref|XP_008236281.1|  PREDICTED: serine carboxypeptidase-like 17 i...    161   7e-44   Prunus mume [ume]
ref|XP_004296446.1|  PREDICTED: serine carboxypeptidase-like 18         161   8e-44   Fragaria vesca subsp. vesca
ref|XP_010028347.1|  PREDICTED: serine carboxypeptidase-like 18         161   9e-44   Eucalyptus grandis [rose gum]
ref|XP_007199818.1|  hypothetical protein PRUPE_ppa005264mg             160   9e-44   
ref|XP_007199854.1|  hypothetical protein PRUPE_ppa005665mg             160   1e-43   
ref|XP_007199819.1|  hypothetical protein PRUPE_ppa005264mg             160   2e-43   
ref|XP_006472320.1|  PREDICTED: serine carboxypeptidase-like 18-l...    160   2e-43   
ref|XP_011069855.1|  PREDICTED: serine carboxypeptidase-like 18 i...    160   2e-43   Sesamum indicum [beniseed]
ref|XP_011069856.1|  PREDICTED: serine carboxypeptidase-like 18 i...    160   2e-43   Sesamum indicum [beniseed]
ref|XP_008236285.1|  PREDICTED: serine carboxypeptidase-like 2 is...    159   3e-43   Prunus mume [ume]
gb|KJB73513.1|  hypothetical protein B456_011G236800                    157   3e-43   Gossypium raimondii
ref|XP_008236286.1|  PREDICTED: serine carboxypeptidase-like 2 is...    159   3e-43   Prunus mume [ume]
ref|XP_002525293.1|  serine carboxypeptidase, putative                  160   4e-43   
ref|XP_006433655.1|  hypothetical protein CICLE_v10001060mg             159   5e-43   Citrus clementina [clementine]
ref|XP_009761854.1|  PREDICTED: serine carboxypeptidase-like 18         158   5e-43   Nicotiana sylvestris
gb|KDO81468.1|  hypothetical protein CISIN_1g012276mg                   159   5e-43   Citrus sinensis [apfelsine]
ref|XP_007201023.1|  hypothetical protein PRUPE_ppa005420mg             159   5e-43   Prunus persica
gb|KFK27798.1|  hypothetical protein AALP_AA8G430800                    163   5e-43   Arabis alpina [alpine rockcress]
gb|KFK27800.1|  hypothetical protein AALP_AA8G430800                    163   6e-43   Arabis alpina [alpine rockcress]
ref|XP_007200276.1|  hypothetical protein PRUPE_ppa014806mg             157   6e-43   
ref|XP_011069858.1|  PREDICTED: serine carboxypeptidase-like 18         159   6e-43   Sesamum indicum [beniseed]
gb|KFK27799.1|  hypothetical protein AALP_AA8G430800                    163   6e-43   Arabis alpina [alpine rockcress]
emb|CDY52618.1|  BnaCnng22970D                                          158   7e-43   Brassica napus [oilseed rape]
ref|XP_011466208.1|  PREDICTED: serine carboxypeptidase-like 18 i...    158   7e-43   Fragaria vesca subsp. vesca
ref|XP_008236344.1|  PREDICTED: serine carboxypeptidase-like 13         159   8e-43   
gb|KCW80986.1|  hypothetical protein EUGRSUZ_C02352                     158   1e-42   Eucalyptus grandis [rose gum]
gb|KEH33547.1|  serine carboxypeptidase-like protein                    157   1e-42   Medicago truncatula
gb|KHG24307.1|  Serine carboxypeptidase-like 18                         157   1e-42   Gossypium arboreum [tree cotton]
ref|XP_006401829.1|  hypothetical protein EUTSA_v10013495mg             157   1e-42   Eutrema salsugineum [saltwater cress]
ref|XP_010486652.1|  PREDICTED: serine carboxypeptidase-like 7 is...    157   1e-42   Camelina sativa [gold-of-pleasure]
gb|KDP41601.1|  hypothetical protein JCGZ_16008                         157   1e-42   Jatropha curcas
ref|XP_010048652.1|  PREDICTED: serine carboxypeptidase-like 18         158   1e-42   Eucalyptus grandis [rose gum]
gb|KJB73514.1|  hypothetical protein B456_011G236800                    157   1e-42   Gossypium raimondii
ref|XP_006401830.1|  hypothetical protein EUTSA_v10015511mg             156   2e-42   
ref|XP_004288266.1|  PREDICTED: serine carboxypeptidase-like 2 is...    157   2e-42   Fragaria vesca subsp. vesca
ref|XP_007018461.1|  Serine carboxypeptidase-like 7, putative           157   2e-42   
ref|XP_010484511.1|  PREDICTED: serine carboxypeptidase-like 7          152   2e-42   
ref|XP_011070163.1|  PREDICTED: serine carboxypeptidase-like 18         157   2e-42   Sesamum indicum [beniseed]
gb|KDO81473.1|  hypothetical protein CISIN_1g012205mg                   155   2e-42   Citrus sinensis [apfelsine]
emb|CDP20368.1|  unnamed protein product                                157   2e-42   Coffea canephora [robusta coffee]
gb|KJB73511.1|  hypothetical protein B456_011G236800                    157   2e-42   Gossypium raimondii
gb|KJB73512.1|  hypothetical protein B456_011G236800                    157   2e-42   Gossypium raimondii
gb|KDP32094.1|  hypothetical protein JCGZ_12555                         157   2e-42   Jatropha curcas
ref|XP_009120828.1|  PREDICTED: serine carboxypeptidase-like 15 i...    155   2e-42   Brassica rapa
ref|XP_003633199.2|  PREDICTED: serine carboxypeptidase-like 13 i...    157   3e-42   Vitis vinifera
ref|XP_007018464.1|  Serine carboxypeptidase-like 2, putative           155   3e-42   
ref|XP_010048542.1|  PREDICTED: serine carboxypeptidase-like 13         156   3e-42   Eucalyptus grandis [rose gum]
ref|XP_009120822.1|  PREDICTED: serine carboxypeptidase-like 15 i...    156   3e-42   Brassica rapa
gb|KDO81472.1|  hypothetical protein CISIN_1g012205mg                   155   3e-42   Citrus sinensis [apfelsine]
dbj|BAF56655.1|  serine carboxypeptitase-like protein 1                 156   4e-42   Diospyros kaki [Japanese persimmon]
emb|CDY00759.1|  BnaC03g37430D                                          150   4e-42   
gb|KCW63486.1|  hypothetical protein EUGRSUZ_G01118                     155   5e-42   Eucalyptus grandis [rose gum]
ref|XP_008452662.1|  PREDICTED: serine carboxypeptidase-like 13         156   6e-42   Cucumis melo [Oriental melon]
ref|XP_010068327.1|  PREDICTED: serine carboxypeptidase-like 18         156   6e-42   Eucalyptus grandis [rose gum]
ref|XP_004306039.2|  PREDICTED: serine carboxypeptidase-like 16 i...    152   6e-42   Fragaria vesca subsp. vesca
ref|XP_004163543.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    155   6e-42   
emb|CBI17848.3|  unnamed protein product                                157   6e-42   Vitis vinifera
ref|XP_008385684.1|  PREDICTED: uncharacterized protein LOC103448207    155   6e-42   
emb|CDY11114.1|  BnaC06g23660D                                          155   7e-42   Brassica napus [oilseed rape]
emb|CDY50564.1|  BnaA01g30780D                                          155   7e-42   Brassica napus [oilseed rape]
ref|XP_008452663.1|  PREDICTED: serine carboxypeptidase-like 13         155   7e-42   Cucumis melo [Oriental melon]
ref|XP_006433654.1|  hypothetical protein CICLE_v10001055mg             155   7e-42   Citrus clementina [clementine]
ref|XP_010046975.1|  PREDICTED: serine carboxypeptidase-like 17         156   7e-42   Eucalyptus grandis [rose gum]
gb|KDO81471.1|  hypothetical protein CISIN_1g012205mg                   155   8e-42   Citrus sinensis [apfelsine]
ref|XP_006415268.1|  hypothetical protein EUTSA_v10007570mg             155   8e-42   Eutrema salsugineum [saltwater cress]
ref|XP_010321497.1|  PREDICTED: serine carboxypeptidase-like 12         155   8e-42   Solanum lycopersicum
ref|NP_001031402.1|  serine carboxypeptidase-like 13                    154   9e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007208562.1|  hypothetical protein PRUPE_ppa024102mg             153   9e-42   
ref|XP_006594522.1|  PREDICTED: serine carboxypeptidase-like 12-like    155   9e-42   Glycine max [soybeans]
gb|KJB48751.1|  hypothetical protein B456_008G084400                    147   1e-41   Gossypium raimondii
ref|NP_001077947.1|  serine carboxypeptidase-like 13                    154   1e-41   Arabidopsis thaliana [mouse-ear cress]
gb|KFK44962.1|  hypothetical protein AALP_AA1G326200                    155   1e-41   Arabis alpina [alpine rockcress]
ref|XP_002878649.1|  hypothetical protein ARALYDRAFT_481165             154   1e-41   
ref|NP_179881.3|  serine carboxypeptidase-like 13                       154   2e-41   Arabidopsis thaliana [mouse-ear cress]
gb|KDP41600.1|  hypothetical protein JCGZ_16007                         155   2e-41   Jatropha curcas
ref|XP_007047573.1|  Serine carboxypeptidase-like 2, putative iso...    155   2e-41   
ref|XP_006415270.1|  hypothetical protein EUTSA_v10009366mg             154   2e-41   
ref|XP_010464718.1|  PREDICTED: serine carboxypeptidase-like 7 is...    154   2e-41   Camelina sativa [gold-of-pleasure]
ref|XP_010656845.1|  PREDICTED: serine carboxypeptidase-like 13         154   2e-41   Vitis vinifera
ref|NP_198467.2|  serine carboxypeptidase-like 1                        154   2e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011457835.1|  PREDICTED: serine carboxypeptidase-like 7          154   2e-41   Fragaria vesca subsp. vesca
ref|XP_006345611.1|  PREDICTED: serine carboxypeptidase-like 19-like    153   2e-41   
ref|XP_006433653.1|  hypothetical protein CICLE_v10001059mg             154   2e-41   Citrus clementina [clementine]
emb|CBI17847.3|  unnamed protein product                                155   3e-41   Vitis vinifera
dbj|BAA96893.1|  serine carboxypeptidase                                154   3e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010464717.1|  PREDICTED: serine carboxypeptidase-like 7 is...    153   3e-41   Camelina sativa [gold-of-pleasure]
ref|XP_006472315.1|  PREDICTED: serine carboxypeptidase-like 18-l...    154   4e-41   Citrus sinensis [apfelsine]
ref|XP_006472317.1|  PREDICTED: serine carboxypeptidase-like 18-l...    153   4e-41   
ref|XP_002510077.1|  serine carboxypeptidase, putative                  153   4e-41   Ricinus communis
ref|XP_008237699.1|  PREDICTED: serine carboxypeptidase-like 2          153   5e-41   Prunus mume [ume]
gb|KJB58678.1|  hypothetical protein B456_009G221000                    152   5e-41   Gossypium raimondii
ref|XP_010515304.1|  PREDICTED: serine carboxypeptidase-like 7          153   6e-41   Camelina sativa [gold-of-pleasure]
ref|XP_002268517.1|  PREDICTED: serine carboxypeptidase-like 17         153   6e-41   Vitis vinifera
ref|XP_010694002.1|  PREDICTED: serine carboxypeptidase-like 10 i...    151   6e-41   Beta vulgaris subsp. vulgaris [field beet]
emb|CDP17658.1|  unnamed protein product                                153   6e-41   Coffea canephora [robusta coffee]
ref|XP_006404766.1|  hypothetical protein EUTSA_v10000651mg             152   7e-41   Eutrema salsugineum [saltwater cress]
ref|XP_006472316.1|  PREDICTED: serine carboxypeptidase-like 18-l...    153   7e-41   Citrus sinensis [apfelsine]
gb|KDO81474.1|  hypothetical protein CISIN_1g012236mg                   153   7e-41   Citrus sinensis [apfelsine]
ref|XP_010464720.1|  PREDICTED: serine carboxypeptidase-like 7          152   8e-41   Camelina sativa [gold-of-pleasure]
emb|CDY09545.1|  BnaC05g23740D                                          152   9e-41   Brassica napus [oilseed rape]
gb|EPS73196.1|  hypothetical protein M569_01551                         152   9e-41   Genlisea aurea
ref|XP_010277008.1|  PREDICTED: serine carboxypeptidase-like 18 i...    152   9e-41   
sp|Q9C7Z9.2|SCP18_ARATH  RecName: Full=Serine carboxypeptidase-li...    152   9e-41   Arabidopsis thaliana [mouse-ear cress]
ref|NP_174619.1|  serine carboxypeptidase-like 18                       152   9e-41   
ref|XP_006345532.1|  PREDICTED: serine carboxypeptidase-like 18-l...    150   1e-40   
gb|KFK38432.1|  hypothetical protein AALP_AA3G112600                    152   1e-40   Arabis alpina [alpine rockcress]
ref|XP_009600999.1|  PREDICTED: serine carboxypeptidase-like 7 is...    152   1e-40   Nicotiana tomentosiformis
ref|XP_009601001.1|  PREDICTED: serine carboxypeptidase-like 7 is...    152   1e-40   Nicotiana tomentosiformis
ref|XP_009135216.1|  PREDICTED: serine carboxypeptidase-like 15         152   1e-40   Brassica rapa
gb|AAN60354.1|  unknown                                                 151   1e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009771130.1|  PREDICTED: serine carboxypeptidase-like 13 i...    151   1e-40   Nicotiana sylvestris
ref|XP_009114926.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    152   1e-40   Brassica rapa
ref|XP_010277006.1|  PREDICTED: serine carboxypeptidase-like 1 is...    152   1e-40   Nelumbo nucifera [Indian lotus]
ref|XP_008452659.1|  PREDICTED: serine carboxypeptidase-like 18 i...    150   1e-40   
ref|XP_008236290.1|  PREDICTED: serine carboxypeptidase-like 17 i...    152   1e-40   Prunus mume [ume]
gb|KFK41348.1|  hypothetical protein AALP_AA2G118800                    152   1e-40   Arabis alpina [alpine rockcress]
ref|XP_004289672.1|  PREDICTED: serine carboxypeptidase-like 13         152   1e-40   Fragaria vesca subsp. vesca
gb|KJB58677.1|  hypothetical protein B456_009G221000                    152   1e-40   Gossypium raimondii
gb|KFK41349.1|  hypothetical protein AALP_AA2G118800                    152   1e-40   Arabis alpina [alpine rockcress]
ref|XP_004289772.1|  PREDICTED: serine carboxypeptidase-like 18         152   1e-40   Fragaria vesca subsp. vesca
emb|CDP06920.1|  unnamed protein product                                149   1e-40   Coffea canephora [robusta coffee]
ref|XP_006472322.1|  PREDICTED: serine carboxypeptidase-like 18-like    152   2e-40   Citrus sinensis [apfelsine]
gb|KCW63482.1|  hypothetical protein EUGRSUZ_G01114                     151   2e-40   Eucalyptus grandis [rose gum]
gb|EPS64042.1|  hypothetical protein M569_10739                         145   2e-40   Genlisea aurea
ref|XP_006345531.1|  PREDICTED: serine carboxypeptidase-like 18-l...    150   2e-40   Solanum tuberosum [potatoes]
ref|XP_008452658.1|  PREDICTED: serine carboxypeptidase-like 18 i...    150   2e-40   Cucumis melo [Oriental melon]
ref|XP_006415266.1|  hypothetical protein EUTSA_v10007559mg             152   2e-40   Eutrema salsugineum [saltwater cress]
ref|XP_009771129.1|  PREDICTED: serine carboxypeptidase-like 13 i...    151   2e-40   Nicotiana sylvestris
ref|XP_009626153.1|  PREDICTED: serine carboxypeptidase-like 13         152   2e-40   Nicotiana tomentosiformis
ref|XP_010694001.1|  PREDICTED: serine carboxypeptidase-like 10 i...    151   2e-40   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004163541.1|  PREDICTED: serine carboxypeptidase-like 19-like    151   2e-40   
ref|XP_009115052.1|  PREDICTED: serine carboxypeptidase-like 14         151   2e-40   Brassica rapa
emb|CDX73832.1|  BnaA03g32150D                                          151   2e-40   
ref|XP_002882669.1|  hypothetical protein ARALYDRAFT_478377             151   2e-40   
gb|KCW54736.1|  hypothetical protein EUGRSUZ_I00690                     151   3e-40   Eucalyptus grandis [rose gum]
ref|XP_006297701.1|  hypothetical protein CARUB_v10013730mg             150   3e-40   Capsella rubella
ref|NP_001077946.1|  serine carboxypeptidase-like 13                    150   3e-40   
ref|XP_009771128.1|  PREDICTED: serine carboxypeptidase-like 13 i...    151   3e-40   Nicotiana sylvestris
ref|XP_010065819.1|  PREDICTED: serine carboxypeptidase-like 18         151   3e-40   Eucalyptus grandis [rose gum]
emb|CDY02322.1|  BnaA09g25800D                                          150   3e-40   
ref|XP_008452656.1|  PREDICTED: serine carboxypeptidase-like 13 i...    150   4e-40   Cucumis melo [Oriental melon]
ref|XP_004486284.1|  PREDICTED: serine carboxypeptidase-like 12-like    151   4e-40   Cicer arietinum [garbanzo]
ref|XP_010106921.1|  Serine carboxypeptidase-like 12                    149   4e-40   
ref|XP_008777952.1|  PREDICTED: serine carboxypeptidase-like 18 i...    145   4e-40   
ref|XP_008452657.1|  PREDICTED: serine carboxypeptidase-like 13 i...    150   4e-40   Cucumis melo [Oriental melon]
emb|CDY53115.1|  BnaCnng24430D                                          150   4e-40   Brassica napus [oilseed rape]
ref|NP_177470.4|  serine carboxypeptidase-like 6                        150   4e-40   Arabidopsis thaliana [mouse-ear cress]
gb|AAG52139.1|AC010556_21  putative serine carboxypeptidase; 1519...    150   4e-40   Arabidopsis thaliana [mouse-ear cress]
emb|CDP01267.1|  unnamed protein product                                150   5e-40   Coffea canephora [robusta coffee]
ref|XP_010030506.1|  PREDICTED: serine carboxypeptidase-like 7          151   5e-40   
ref|XP_010426467.1|  PREDICTED: serine carboxypeptidase-like 7          150   5e-40   Camelina sativa [gold-of-pleasure]
ref|XP_010656846.1|  PREDICTED: serine carboxypeptidase-like 13 i...    150   5e-40   Vitis vinifera
ref|XP_006404748.1|  hypothetical protein EUTSA_v10000461mg             149   6e-40   
emb|CDP08178.1|  unnamed protein product                                151   6e-40   Coffea canephora [robusta coffee]
ref|XP_010509544.1|  PREDICTED: serine carboxypeptidase-like 9 is...    149   6e-40   Camelina sativa [gold-of-pleasure]
emb|CDP18838.1|  unnamed protein product                                149   6e-40   Coffea canephora [robusta coffee]
ref|XP_002878648.1|  SCPL11                                             150   6e-40   
ref|XP_008452655.1|  PREDICTED: serine carboxypeptidase-like 13 i...    150   6e-40   
ref|XP_010065898.1|  PREDICTED: serine carboxypeptidase-like 18         150   6e-40   
gb|KFK39469.1|  hypothetical protein AALP_AA3G248300                    149   7e-40   
ref|XP_008777951.1|  PREDICTED: serine carboxypeptidase-like 18 i...    145   7e-40   
ref|XP_009139974.1|  PREDICTED: serine carboxypeptidase-like 13 i...    149   7e-40   
ref|XP_010320337.1|  PREDICTED: serine carboxypeptidase-like 13 i...    150   7e-40   
ref|XP_009104817.1|  PREDICTED: serine carboxypeptidase-like 2 is...    149   7e-40   
emb|CBI24085.3|  unnamed protein product                                150   8e-40   
ref|XP_010555764.1|  PREDICTED: serine carboxypeptidase-like 18         151   8e-40   
ref|XP_009343188.1|  PREDICTED: serine carboxypeptidase-like 18         150   8e-40   
gb|KFK39468.1|  hypothetical protein AALP_AA3G248300                    150   8e-40   
ref|XP_003593858.1|  Serine carboxypeptidase-like protein               150   8e-40   
ref|XP_002265154.3|  PREDICTED: serine carboxypeptidase-like 13         150   8e-40   
ref|XP_010040884.1|  PREDICTED: serine carboxypeptidase-like 18         150   9e-40   
ref|XP_009104821.1|  PREDICTED: serine carboxypeptidase-like 2 is...    149   9e-40   
ref|XP_008452664.1|  PREDICTED: serine carboxypeptidase-like 2          150   1e-39   
ref|XP_010321496.1|  PREDICTED: serine carboxypeptidase-like 13 i...    149   1e-39   
ref|XP_010484310.1|  PREDICTED: serine carboxypeptidase-like 7          149   1e-39   
ref|XP_004238557.1|  PREDICTED: uncharacterized protein LOC101252581    153   1e-39   
ref|XP_010428248.1|  PREDICTED: serine carboxypeptidase-like 2 is...    149   1e-39   
emb|CDY68233.1|  BnaAnng26570D                                          142   1e-39   
ref|XP_010321495.1|  PREDICTED: serine carboxypeptidase-like 13 i...    149   1e-39   
ref|XP_009104820.1|  PREDICTED: serine carboxypeptidase-like 2 is...    149   1e-39   
gb|KJB48748.1|  hypothetical protein B456_008G084200                    149   1e-39   
gb|KJB48749.1|  hypothetical protein B456_008G084200                    149   1e-39   
gb|AAM64902.1|  serine carboxypeptidase, putative                       144   1e-39   
ref|NP_187656.1|  serine carboxypeptidase-like 7                        149   1e-39   
ref|XP_009104818.1|  PREDICTED: serine carboxypeptidase-like 2 is...    149   1e-39   
ref|NP_177473.1|  serine carboxypeptidase-like 2                        149   1e-39   
ref|XP_010428244.1|  PREDICTED: serine carboxypeptidase-like 2 is...    149   1e-39   
ref|XP_009104819.1|  PREDICTED: serine carboxypeptidase-like 2 is...    148   1e-39   
ref|XP_006294237.1|  hypothetical protein CARUB_v10023234mg             149   2e-39   
emb|CDX83199.1|  BnaA03g23070D                                          144   2e-39   
ref|XP_010509542.1|  PREDICTED: serine carboxypeptidase-like 9 is...    149   2e-39   
ref|XP_002888921.1|  hypothetical protein ARALYDRAFT_476459             148   2e-39   
gb|KFK25893.1|  hypothetical protein AALP_AA8G176200                    147   2e-39   
ref|XP_010509543.1|  PREDICTED: serine carboxypeptidase-like 9 is...    148   2e-39   
ref|XP_010694008.1|  PREDICTED: serine carboxypeptidase-like 7 is...    148   2e-39   
emb|CDY30277.1|  BnaC04g31880D                                          148   2e-39   
ref|XP_011006039.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    146   2e-39   
ref|XP_010694007.1|  PREDICTED: serine carboxypeptidase-like 7 is...    148   3e-39   
gb|KDP44547.1|  hypothetical protein JCGZ_16380                         149   3e-39   
ref|NP_973517.1|  serine carboxypeptidase-like 9                        148   3e-39   
ref|XP_009131550.1|  PREDICTED: serine carboxypeptidase-like 7 is...    148   3e-39   
emb|CDY68040.1|  BnaAnng25990D                                          148   3e-39   
emb|CDY44586.1|  BnaA04g10040D                                          148   3e-39   
ref|XP_006297708.1|  hypothetical protein CARUB_v10013737mg             148   3e-39   
ref|XP_004299781.1|  PREDICTED: serine carboxypeptidase-like 13         149   3e-39   
ref|XP_009131551.1|  PREDICTED: serine carboxypeptidase-like 7 is...    148   3e-39   
ref|XP_002893774.1|  hypothetical protein ARALYDRAFT_890934             148   3e-39   
ref|XP_009139971.1|  PREDICTED: serine carboxypeptidase-like 13 i...    148   3e-39   
emb|CDX78700.1|  BnaA03g06120D                                          148   3e-39   
ref|XP_006356866.1|  PREDICTED: uncharacterized protein LOC102592829    152   3e-39   
ref|XP_010694000.1|  PREDICTED: serine carboxypeptidase-like 7          148   3e-39   
ref|NP_179884.1|  serine carboxypeptidase-like 9                        148   3e-39   
ref|XP_008236498.1|  PREDICTED: serine carboxypeptidase-like 18         144   3e-39   
ref|XP_010694006.1|  PREDICTED: serine carboxypeptidase-like 7 is...    148   3e-39   
ref|NP_001031401.1|  serine carboxypeptidase-like 11                    145   3e-39   
ref|XP_007159376.1|  hypothetical protein PHAVU_002G233100g             148   3e-39   
ref|XP_007146212.1|  hypothetical protein PHAVU_006G021700g             148   4e-39   
ref|XP_010486651.1|  PREDICTED: serine carboxypeptidase-like 7 is...    148   4e-39   
ref|XP_006407354.1|  hypothetical protein EUTSA_v10022069mg             148   4e-39   
ref|XP_010694009.1|  PREDICTED: serine carboxypeptidase-like 7          148   4e-39   
emb|CDP06914.1|  unnamed protein product                                148   4e-39   
emb|CDP22282.1|  unnamed protein product                                142   4e-39   
gb|KCW68631.1|  hypothetical protein EUGRSUZ_F02236                     148   4e-39   
ref|XP_010939018.1|  PREDICTED: serine carboxypeptidase-like 18 i...    147   4e-39   
ref|XP_010555479.1|  PREDICTED: serine carboxypeptidase-like 7          148   4e-39   
ref|XP_010065816.1|  PREDICTED: serine carboxypeptidase-like 18 i...    148   4e-39   
emb|CDP20999.1|  unnamed protein product                                146   4e-39   
ref|XP_003602922.1|  Serine carboxypeptidase-like protein               144   4e-39   
ref|XP_009102688.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    147   4e-39   
ref|XP_010065817.1|  PREDICTED: serine carboxypeptidase-like 18         148   4e-39   
ref|XP_009140442.1|  PREDICTED: serine carboxypeptidase-like 13 i...    147   4e-39   
ref|XP_006301868.1|  hypothetical protein CARUB_v10022339mg             147   4e-39   
ref|XP_010694004.1|  PREDICTED: serine carboxypeptidase-like 7 is...    147   5e-39   
ref|XP_006376417.1|  serine carboxypeptidase S10 family protein         147   5e-39   
emb|CDX89533.1|  BnaC04g35520D                                          148   5e-39   
ref|NP_179883.1|  sinapoylglucose:anthocyanin sinapoyltransferase       147   5e-39   
ref|XP_010694003.1|  PREDICTED: serine carboxypeptidase-like 7 is...    148   5e-39   
ref|XP_003593859.1|  Serine carboxypeptidase-like protein               148   5e-39   
ref|XP_009135217.1|  PREDICTED: serine carboxypeptidase-like 14         147   5e-39   
emb|CDY38920.1|  BnaA04g13410D                                          148   5e-39   
ref|XP_008790306.1|  PREDICTED: uncharacterized protein LOC103707552    151   5e-39   
ref|XP_002522112.1|  serine carboxypeptidase, putative                  148   6e-39   
ref|NP_177472.1|  serine carboxypeptidase-like 5                        147   6e-39   
sp|Q9CAU2.2|SCP5_ARATH  RecName: Full=Serine carboxypeptidase-lik...    147   6e-39   
emb|CDX70702.1|  BnaC03g07860D                                          147   7e-39   
ref|XP_010429234.1|  PREDICTED: serine carboxypeptidase-like 12 i...    147   7e-39   
ref|XP_010061646.1|  PREDICTED: serine carboxypeptidase-like 2          147   8e-39   
ref|XP_006295774.1|  hypothetical protein CARUB_v10024896mg             147   8e-39   
ref|XP_009117322.1|  PREDICTED: serine carboxypeptidase-like 8 is...    146   8e-39   
ref|XP_009140440.1|  PREDICTED: serine carboxypeptidase-like 13 i...    147   8e-39   
ref|XP_006415267.1|  hypothetical protein EUTSA_v10007571mg             147   8e-39   
ref|NP_177474.1|  serine carboxypeptidase-like 4                        147   9e-39   
gb|AAG30990.1|AC012396_26  serine carboxypeptidase, putative            146   9e-39   
emb|CDX69437.1|  BnaA10g17860D                                          147   9e-39   
emb|CAN82418.1|  hypothetical protein VITISV_044003                     147   1e-38   
ref|XP_006403279.1|  hypothetical protein EUTSA_v10003211mg             145   1e-38   
emb|CDP06925.1|  unnamed protein product                                147   1e-38   
emb|CDY08603.1|  BnaA05g28390D                                          147   1e-38   
emb|CDX77573.1|  BnaA07g07110D                                          146   1e-38   
ref|XP_006415429.1|  hypothetical protein EUTSA_v10007675mg             146   1e-38   
ref|NP_001077945.1|  serine carboxypeptidase-like 11                    146   1e-38   
ref|XP_009121469.1|  PREDICTED: serine carboxypeptidase-like 7          147   1e-38   
emb|CDY49438.1|  BnaA09g42290D                                          146   1e-38   
ref|XP_010939014.1|  PREDICTED: serine carboxypeptidase-like 17 i...    147   1e-38   
ref|XP_010939015.1|  PREDICTED: serine carboxypeptidase-like 18 i...    146   1e-38   
ref|XP_010503611.1|  PREDICTED: serine carboxypeptidase-like 7          146   1e-38   
ref|XP_010314600.1|  PREDICTED: serine carboxypeptidase-like 11         147   1e-38   
ref|XP_010939013.1|  PREDICTED: serine carboxypeptidase-like 18 i...    146   1e-38   
emb|CDP01266.1|  unnamed protein product                                147   1e-38   
ref|NP_177471.1|  serine carboxypeptidase-like 3                        146   1e-38   
emb|CDY00943.1|  BnaC05g42570D                                          146   1e-38   
ref|XP_009117321.1|  PREDICTED: serine carboxypeptidase-like 10 i...    146   1e-38   
ref|XP_010939012.1|  PREDICTED: serine carboxypeptidase-like 17 i...    147   1e-38   
ref|XP_006840207.1|  hypothetical protein AMTR_s00089p00129670          144   1e-38   
ref|XP_010464977.1|  PREDICTED: serine carboxypeptidase-like 16         146   2e-38   
ref|XP_010108032.1|  Serine carboxypeptidase-like 7                     149   2e-38   
ref|XP_010939016.1|  PREDICTED: serine carboxypeptidase-like 18 i...    147   2e-38   
ref|NP_179880.1|  serine carboxypeptidase-like 11                       146   2e-38   
ref|XP_010429231.1|  PREDICTED: serine carboxypeptidase-like 11 i...    145   2e-38   
ref|XP_004299782.1|  PREDICTED: serine carboxypeptidase-like 13         146   2e-38   
ref|XP_006390568.1|  hypothetical protein EUTSA_v10018572mg             146   2e-38   
ref|XP_006403280.1|  hypothetical protein EUTSA_v10003211mg             145   2e-38   
ref|XP_010429230.1|  PREDICTED: serine carboxypeptidase-like 11 i...    145   2e-38   
emb|CDY59210.1|  BnaA09g54030D                                          146   2e-38   
ref|XP_011006024.1|  PREDICTED: serine carboxypeptidase-like 3 is...    146   2e-38   
ref|XP_009120840.1|  PREDICTED: serine carboxypeptidase-like 15         145   2e-38   
ref|XP_011006023.1|  PREDICTED: serine carboxypeptidase-like 3 is...    146   2e-38   
ref|NP_850033.1|  serine carboxypeptidase-like 12                       145   2e-38   
ref|XP_004238067.1|  PREDICTED: uncharacterized protein LOC101252078    149   2e-38   
ref|XP_010505114.1|  PREDICTED: serine carboxypeptidase-like 9 is...    145   2e-38   
ref|XP_008790305.1|  PREDICTED: serine carboxypeptidase-like 18         149   2e-38   
ref|NP_187832.2|  serine carboxypeptidase-like 15                       145   2e-38   
emb|CDY49647.1|  BnaC09g41250D                                          145   3e-38   
ref|XP_006403281.1|  hypothetical protein EUTSA_v10003211mg             145   3e-38   
dbj|BAF99694.1|  1-O-acylglucose:anthocyanin-O-acyltransferase          146   3e-38   
gb|AAG51076.1|AC069472_16  serine carboxypeptidase, putative; 295...    145   3e-38   
ref|NP_179876.1|  serine carboxypeptidase-like 12                       145   3e-38   
ref|XP_010065818.1|  PREDICTED: serine carboxypeptidase-like 18         146   3e-38   
ref|XP_006407566.1|  hypothetical protein EUTSA_v10020743mg             145   3e-38   
ref|XP_010505113.1|  PREDICTED: serine carboxypeptidase-like 9 is...    145   3e-38   
gb|KDP44534.1|  hypothetical protein JCGZ_16367                         145   4e-38   
ref|XP_002266615.3|  PREDICTED: serine carboxypeptidase-like 17         145   4e-38   
ref|XP_010505112.1|  PREDICTED: serine carboxypeptidase-like 9 is...    145   4e-38   
ref|XP_009139930.1|  PREDICTED: serine carboxypeptidase-like 7 is...    145   4e-38   
ref|XP_010486655.1|  PREDICTED: serine carboxypeptidase-like 7 is...    145   4e-38   
ref|XP_010686324.1|  PREDICTED: serine carboxypeptidase-like 18 i...    145   4e-38   
ref|XP_006303239.1|  hypothetical protein CARUB_v10012575mg             145   5e-38   
ref|XP_003593861.1|  Serine carboxypeptidase family protein             145   5e-38   
ref|XP_009139928.1|  PREDICTED: serine carboxypeptidase-like 7 is...    145   5e-38   
emb|CDY21591.1|  BnaC09g47010D                                          145   5e-38   
ref|XP_010416123.1|  PREDICTED: serine carboxypeptidase-like 2          145   5e-38   
ref|XP_009146838.1|  PREDICTED: serine carboxypeptidase-like 7 is...    145   5e-38   
ref|XP_010472297.1|  PREDICTED: serine carboxypeptidase-like 11 i...    144   5e-38   
ref|XP_010686326.1|  PREDICTED: serine carboxypeptidase-like 18 i...    144   5e-38   
ref|XP_009139927.1|  PREDICTED: serine carboxypeptidase-like 7 is...    145   5e-38   
ref|XP_009120797.1|  PREDICTED: serine carboxypeptidase-like 15 i...    144   5e-38   
ref|XP_002878643.1|  SCPL12                                             144   5e-38   
gb|AES63483.2|  serine carboxypeptidase-like protein                    144   6e-38   
ref|XP_006294243.1|  hypothetical protein CARUB_v10023242mg             144   6e-38   
ref|XP_010472296.1|  PREDICTED: serine carboxypeptidase-like 11 i...    144   6e-38   
dbj|BAF99698.1|  1-O-acylglucose:anthocyanin-O-acyltransferase- l...    145   6e-38   
ref|XP_010556471.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    144   6e-38   
ref|XP_009126130.1|  PREDICTED: serine carboxypeptidase-like 12 i...    145   6e-38   
ref|XP_009120791.1|  PREDICTED: serine carboxypeptidase-like 15 i...    144   6e-38   
ref|XP_003593232.1|  Serine carboxypeptidase-like protein               144   7e-38   
emb|CDX85493.1|  BnaA02g03200D                                          144   7e-38   
ref|XP_006296383.1|  hypothetical protein CARUB_v10025556mg             144   7e-38   
ref|XP_006296372.1|  hypothetical protein CARUB_v10025545mg             144   7e-38   
ref|XP_010686325.1|  PREDICTED: serine carboxypeptidase-like 7 is...    144   7e-38   
ref|XP_009764359.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    144   7e-38   
dbj|BAF99697.1|  1-O-acylglucose:anthocyanin-O-acyltransferase- l...    145   7e-38   
ref|XP_010686323.1|  PREDICTED: serine carboxypeptidase-like 2 is...    144   7e-38   
ref|XP_010320198.1|  PREDICTED: serine carboxypeptidase-like 17         145   7e-38   
ref|XP_006354895.1|  PREDICTED: serine carboxypeptidase-like 18-like    145   7e-38   
ref|XP_010498752.1|  PREDICTED: serine carboxypeptidase-like 16         144   8e-38   
ref|XP_010320345.1|  PREDICTED: serine carboxypeptidase-like 10 i...    143   8e-38   
ref|NP_566414.3|  serine carboxypeptidase-like 16                       144   8e-38   
ref|XP_010314652.1|  PREDICTED: serine carboxypeptidase-like 11         146   8e-38   
ref|XP_003604930.1|  Serine carboxypeptidase family protein             147   9e-38   
emb|CDY50563.1|  BnaA01g30770D                                          147   9e-38   
ref|XP_006294236.1|  hypothetical protein CARUB_v10023233mg             144   9e-38   
ref|XP_009784016.1|  PREDICTED: serine carboxypeptidase-like 11 i...    144   9e-38   
ref|XP_006299183.1|  hypothetical protein CARUB_v10015328mg             144   9e-38   
ref|XP_010686322.1|  PREDICTED: serine carboxypeptidase-like 7 is...    144   1e-37   
ref|XP_003573757.1|  PREDICTED: serine carboxypeptidase-like 13         144   1e-37   
emb|CDY11116.1|  BnaC06g23680D                                          147   1e-37   
ref|XP_009612197.1|  PREDICTED: serine carboxypeptidase-like 11 i...    144   1e-37   
ref|XP_002884894.1|  hypothetical protein ARALYDRAFT_897434             144   1e-37   
ref|XP_010461188.1|  PREDICTED: serine carboxypeptidase-like 18         144   1e-37   
ref|XP_010320341.1|  PREDICTED: serine carboxypeptidase-like 18 i...    144   1e-37   
ref|XP_010527656.1|  PREDICTED: serine carboxypeptidase-like 2          144   1e-37   
emb|CDY38096.1|  BnaC02g06770D                                          144   1e-37   
gb|AAK32769.1|AF361601_1  T20K9.20/T20K9.20                             140   1e-37   
ref|XP_002878652.1|  hypothetical protein ARALYDRAFT_481172             144   1e-37   
emb|CDP21040.1|  unnamed protein product                                144   1e-37   
ref|XP_010936153.1|  PREDICTED: serine carboxypeptidase-like 18 i...    144   1e-37   
ref|XP_010556480.1|  PREDICTED: serine carboxypeptidase-like 1          144   1e-37   
ref|XP_009104816.1|  PREDICTED: serine carboxypeptidase-like 2          144   1e-37   
dbj|BAF99699.1|  1-O-acylglucose:anthocyanin-O-acyltransferase- l...    144   1e-37   
emb|CDP01265.1|  unnamed protein product                                144   2e-37   
ref|XP_010417054.1|  PREDICTED: serine carboxypeptidase-like 9          143   2e-37   
gb|AES73172.2|  1-O-acylglucose:anthocyanin acyltransferase             144   2e-37   
ref|XP_006369794.1|  hypothetical protein POPTR_0001s31980g             144   2e-37   
ref|XP_010474419.1|  PREDICTED: serine carboxypeptidase-like 9          143   2e-37   
ref|XP_002300184.2|  hypothetical protein POPTR_0001s31980g             144   2e-37   
ref|XP_010320340.1|  PREDICTED: serine carboxypeptidase-like 13 i...    144   2e-37   
ref|XP_010936152.1|  PREDICTED: serine carboxypeptidase-like 18 i...    143   2e-37   
emb|CDY52617.1|  BnaCnng22960D                                          146   2e-37   
ref|XP_010556479.1|  PREDICTED: serine carboxypeptidase-like 19         143   2e-37   
ref|XP_007138067.1|  hypothetical protein PHAVU_009G177800g             144   2e-37   
ref|XP_010106920.1|  Serine carboxypeptidase-like 18                    144   2e-37   
ref|XP_002878651.1|  hypothetical protein ARALYDRAFT_900758             143   2e-37   
ref|XP_009103431.1|  PREDICTED: serine carboxypeptidase-like 10         143   2e-37   
ref|XP_010936150.1|  PREDICTED: serine carboxypeptidase-like 18 i...    143   2e-37   
ref|XP_006597032.1|  PREDICTED: uncharacterized protein LOC100794...    143   2e-37   
ref|XP_010429238.1|  PREDICTED: serine carboxypeptidase-like 9          143   2e-37   
ref|NP_001242803.1|  uncharacterized protein LOC100794342               143   2e-37   



>ref|XP_006350186.1| PREDICTED: serine carboxypeptidase-like 18-like isoform X2 [Solanum 
tuberosum]
Length=389

 Score =   195 bits (496),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
            H +VETLPGF  +LPFKL TGYIGVGE +++QLFYYF+ESE+ P+ DPL++WL GGPGCS
Sbjct  21   HFIVETLPGFDGQLPFKLETGYIGVGEEEKLQLFYYFVESERDPQNDPLIIWLIGGPGCS  80

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            GLSAF +EIGPLT +YANS+G+ P LELN ++W+KVANIIF+DQPVG GYSY++TS+AYN
Sbjct  81   GLSAFLYEIGPLTFDYANSSGNFPKLELNLHSWSKVANIIFIDQPVGAGYSYAKTSEAYN  140



>gb|AAD01264.1| glucose acyltransferase [Solanum berthaultii]
Length=456

 Score =   194 bits (494),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
            H +VETLPGF  +LPFKL TGYIGVGE +++QLFY+F+ESE+ P+ DPL++WLTGGPGCS
Sbjct  21   HFIVETLPGFDGQLPFKLETGYIGVGEEEKLQLFYFFVESERDPQNDPLMIWLTGGPGCS  80

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            GLS F +E GPLT +YANS+G+ P LELN ++WTKVANIIF+DQPVGTGYSY++TS+AYN
Sbjct  81   GLSTFLYEFGPLTFDYANSSGNFPKLELNLHSWTKVANIIFIDQPVGTGYSYAKTSEAYN  140



>ref|XP_006350185.1| PREDICTED: serine carboxypeptidase-like 18-like isoform X1 [Solanum 
tuberosum]
Length=461

 Score =   194 bits (492),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
            H +VETLPGF  +LPFKL TGYIGVGE +++QLFYYF+ESE+ P+ DPL++WL GGPGCS
Sbjct  21   HFIVETLPGFDGQLPFKLETGYIGVGEEEKLQLFYYFVESERDPQNDPLIIWLIGGPGCS  80

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            GLSAF +EIGPLT +YANS+G+ P LELN ++W+KVANIIF+DQPVG GYSY++TS+AYN
Sbjct  81   GLSAFLYEIGPLTFDYANSSGNFPKLELNLHSWSKVANIIFIDQPVGAGYSYAKTSEAYN  140



>ref|XP_009795830.1| PREDICTED: serine carboxypeptidase-like 18 isoform X1 [Nicotiana 
sylvestris]
Length=467

 Score =   194 bits (492),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 104/120 (87%), Gaps = 0/120 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
            H +VE LPGF  KLPFKL TGY+GVGE +++QL+YYF+ESE+ PE DPL+LWLTGGPGCS
Sbjct  23   HFIVENLPGFQGKLPFKLETGYVGVGEEEKVQLYYYFVESERDPENDPLMLWLTGGPGCS  82

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            GLS+F +EIGPL  +YANS+GD P LELN  +WTKVANIIF+DQP G+GYSY++TS+AYN
Sbjct  83   GLSSFVYEIGPLMFDYANSSGDFPKLELNSNSWTKVANIIFIDQPAGSGYSYAKTSEAYN  142



>ref|XP_009614132.1| PREDICTED: serine carboxypeptidase-like 18 isoform X1 [Nicotiana 
tomentosiformis]
Length=468

 Score =   193 bits (491),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 104/120 (87%), Gaps = 0/120 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
            H +VETLPGF  KLPFKL TGY+GVGE +++QL+YYF+ESE+ PE DPL+LWLTGGPGCS
Sbjct  24   HFIVETLPGFNGKLPFKLETGYVGVGEEEKVQLYYYFVESERDPENDPLMLWLTGGPGCS  83

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            GLS+F +EIGPLT +YANS GD P LEL   +WTKVANIIF+DQP G+GYSY++TS+AYN
Sbjct  84   GLSSFVYEIGPLTFDYANSIGDFPKLELKSNSWTKVANIIFIDQPAGSGYSYAKTSEAYN  143



>ref|XP_006353974.1| PREDICTED: serine carboxypeptidase-like 18-like [Solanum tuberosum]
Length=464

 Score =   192 bits (489),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
            H +VETLPGF  KLPF L TGYIGVGE  ++QLFY+F++SE+ PE DPL++WLTGGPGCS
Sbjct  20   HFIVETLPGFDGKLPFTLETGYIGVGEEGKVQLFYFFVKSERDPENDPLMIWLTGGPGCS  79

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
             LS FF+E+GPLT +YANS+G+ P LELN Y+WTKVANIIF+DQP GTGYSYS TS+AYN
Sbjct  80   ALSTFFYEMGPLTFDYANSSGNFPKLELNSYSWTKVANIIFIDQPAGTGYSYSNTSEAYN  139



>gb|AAF64227.1|AF248647_1 glucose acyltransferase [Solanum pennellii]
Length=464

 Score =   191 bits (484),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
            H +VETLPGF  KLPF L TGYI VGE +++QLFY+F++SE+ P  DPL++WLTGGPGCS
Sbjct  20   HFIVETLPGFHGKLPFTLETGYISVGEEEKVQLFYFFVQSERDPRNDPLMIWLTGGPGCS  79

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            GLS+F +EIGPLT +YANS+G+ P LELN Y+WTKVANIIF+DQP GTGYSY+ TS+AYN
Sbjct  80   GLSSFVYEIGPLTFDYANSSGNFPKLELNSYSWTKVANIIFIDQPAGTGYSYANTSEAYN  139



>ref|XP_004248779.1| PREDICTED: serine carboxypeptidase-like 18 [Solanum lycopersicum]
Length=464

 Score =   191 bits (484),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
            H +VETLPGF  KLPF L TGYI VGE +++QLFY+F++SE+ P  DPL++WLTGGPGCS
Sbjct  20   HFIVETLPGFHGKLPFTLETGYISVGEEEKVQLFYFFVQSERDPRNDPLMIWLTGGPGCS  79

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            GLS+F +EIGPLT +YANS+G+ P LELN Y+WTKVANIIF+DQP GTGYSY+ TS+AYN
Sbjct  80   GLSSFVYEIGPLTFDYANSSGNFPKLELNSYSWTKVANIIFIDQPAGTGYSYANTSEAYN  139



>ref|XP_004248778.1| PREDICTED: serine carboxypeptidase-like 18 [Solanum lycopersicum]
Length=465

 Score =   189 bits (481),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = +3

Query  105  VVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGL  284
            +VETLPGF  KL F L TGYIGVGE +++QLFY+FI+SE+ PE DPL++WLTGGPGCS L
Sbjct  23   IVETLPGFDGKLSFTLETGYIGVGEDEQVQLFYFFIQSERDPENDPLMIWLTGGPGCSAL  82

Query  285  SAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            S FF+E+GPLT +YANS+G+ P LELN Y+WTKVANIIF+DQP GTGYSY+ TS+AYN
Sbjct  83   STFFYEMGPLTFDYANSSGNFPKLELNSYSWTKVANIIFIDQPAGTGYSYANTSEAYN  140



>ref|XP_006353975.1| PREDICTED: serine carboxypeptidase-like 18-like [Solanum tuberosum]
Length=460

 Score =   188 bits (478),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 83/118 (70%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = +3

Query  105  VVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGL  284
            +VE+LPGF  KLPF L TGYIGVG+ +++QLFY+FIESE+ P+ DPL+LWLTGGPGCSGL
Sbjct  22   IVESLPGFEGKLPFTLETGYIGVGQEEKVQLFYFFIESERDPQNDPLMLWLTGGPGCSGL  81

Query  285  SAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            S   +E+GPLT +YANS+G+ P LELN Y+WTKVANIIF+DQP GTGYSY+ TS+AYN
Sbjct  82   STLLYEMGPLTFDYANSSGNFPKLELNSYSWTKVANIIFIDQPAGTGYSYANTSEAYN  139



>ref|XP_006353976.1| PREDICTED: serine carboxypeptidase-like 18-like [Solanum tuberosum]
Length=464

 Score =   188 bits (478),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
            H +VETLPGF  KLPF L TGYIGVGE +++QLFY+F+ SE+ P  DPL++WLTGGPGCS
Sbjct  20   HFIVETLPGFHGKLPFTLETGYIGVGEEEKVQLFYFFVPSERDPLNDPLMIWLTGGPGCS  79

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            GLS+F +EIGPLT +YANS G+ P LELN Y+WTKVANIIF+DQP GTGYSY+ TS+AYN
Sbjct  80   GLSSFVYEIGPLTFDYANSNGNFPKLELNSYSWTKVANIIFIDQPAGTGYSYANTSEAYN  139



>gb|AAD01263.1| glucose acyltransferase [Solanum berthaultii]
Length=464

 Score =   186 bits (471),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
            H +VETLPGF  KLPF L TGYIGVGE +++QLFY+F+ SE+ P  DPL++WLTGGPGCS
Sbjct  20   HFIVETLPGFHGKLPFTLETGYIGVGEEEKVQLFYFFVPSERDPLNDPLMIWLTGGPGCS  79

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            GLS+F +EIGPLT +YANS G+ P LELN  +WTKVANIIF+DQP GTGYSY+ TS+AYN
Sbjct  80   GLSSFVYEIGPLTFDYANSNGNFPKLELNSNSWTKVANIIFIDQPAGTGYSYANTSEAYN  139



>gb|AAD01265.1| glucose acyltransferase [Solanum berthaultii]
Length=461

 Score =   186 bits (471),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
            H +VETLPGF  KLPF L TGYIGVGE +++QLFY+F+ SE+ P  DPL++WLTGGPGCS
Sbjct  20   HFIVETLPGFHGKLPFTLETGYIGVGEEEKVQLFYFFVPSERDPLNDPLMIWLTGGPGCS  79

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            GLS+F +EIGPLT +YANS G+ P LELN  +WTKVANIIF+DQP GTGYSY+ TS+AYN
Sbjct  80   GLSSFVYEIGPLTFDYANSNGNFPKLELNSNSWTKVANIIFIDQPAGTGYSYANTSEAYN  139



>ref|XP_010030617.1| PREDICTED: serine carboxypeptidase-like 18 [Eucalyptus grandis]
Length=432

 Score =   184 bits (466),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/119 (71%), Positives = 101/119 (85%), Gaps = 0/119 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            A+VE+LPGFP  LPFKL TGY+GVGE +E+QLFYYFIESE+SP+ DPLLLWLTGGPGCS 
Sbjct  21   AIVESLPGFPGDLPFKLETGYVGVGELEEVQLFYYFIESERSPKDDPLLLWLTGGPGCSA  80

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            LS   FEIGPL  +Y+NS+G  P L+LNPY+WTK+ANIIF+D PVGTG+SY+ T  AY+
Sbjct  81   LSGLLFEIGPLQFDYSNSSGIRPILKLNPYSWTKIANIIFLDAPVGTGFSYATTWTAYD  139



>gb|KCW55058.1| hypothetical protein EUGRSUZ_I01033, partial [Eucalyptus grandis]
Length=412

 Score =   183 bits (464),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/119 (71%), Positives = 101/119 (85%), Gaps = 0/119 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            A+VE+LPGFP  LPFKL TGY+GVGE +E+QLFYYFIESE+SP+ DPLLLWLTGGPGCS 
Sbjct  21   AIVESLPGFPGDLPFKLETGYVGVGELEEVQLFYYFIESERSPKDDPLLLWLTGGPGCSA  80

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            LS   FEIGPL  +Y+NS+G  P L+LNPY+WTK+ANIIF+D PVGTG+SY+ T  AY+
Sbjct  81   LSGLLFEIGPLQFDYSNSSGIRPILKLNPYSWTKIANIIFLDAPVGTGFSYATTWTAYD  139



>gb|KCW55074.1| hypothetical protein EUGRSUZ_I01040 [Eucalyptus grandis]
Length=426

 Score =   183 bits (464),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/119 (71%), Positives = 99/119 (83%), Gaps = 0/119 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            A++E+LPGFP  LPFKL TGY+GVGE +E+QLFYYFIESE+SP  DPLLLWLTGGPGCS 
Sbjct  21   AIIESLPGFPGDLPFKLETGYVGVGELEEVQLFYYFIESERSPNDDPLLLWLTGGPGCSA  80

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            LS   FEIGPL  +Y+NS+G  P  ELNPY+WTK+ANIIF+D PVGTG+SY+ T  AYN
Sbjct  81   LSGLLFEIGPLQFDYSNSSGIRPLFELNPYSWTKIANIIFLDAPVGTGFSYAMTWAAYN  139



>ref|XP_010028344.1| PREDICTED: serine carboxypeptidase-like 7 [Eucalyptus grandis]
Length=465

 Score =   183 bits (465),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 84/119 (71%), Positives = 99/119 (83%), Gaps = 0/119 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            A++E+LPGFP  LPFKL TGY+GVGE +E+QLFYYFIESE+SP  DPLLLWLTGGPGCS 
Sbjct  21   AIIESLPGFPGDLPFKLETGYVGVGELEEVQLFYYFIESERSPNDDPLLLWLTGGPGCSA  80

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            LS   FEIGPL  +Y+NS+G  P  ELNPY+WTK+ANIIF+D PVGTG+SY+ T  AYN
Sbjct  81   LSGLLFEIGPLQFDYSNSSGIRPLFELNPYSWTKIANIIFLDAPVGTGFSYAMTWAAYN  139



>gb|KCW55073.1| hypothetical protein EUGRSUZ_I01040 [Eucalyptus grandis]
Length=484

 Score =   183 bits (464),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 84/119 (71%), Positives = 99/119 (83%), Gaps = 0/119 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            A++E+LPGFP  LPFKL TGY+GVGE +E+QLFYYFIESE+SP  DPLLLWLTGGPGCS 
Sbjct  21   AIIESLPGFPGDLPFKLETGYVGVGELEEVQLFYYFIESERSPNDDPLLLWLTGGPGCSA  80

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            LS   FEIGPL  +Y+NS+G  P  ELNPY+WTK+ANIIF+D PVGTG+SY+ T  AYN
Sbjct  81   LSGLLFEIGPLQFDYSNSSGIRPLFELNPYSWTKIANIIFLDAPVGTGFSYAMTWAAYN  139



>ref|XP_010028339.1| PREDICTED: serine carboxypeptidase-like 18 [Eucalyptus grandis]
Length=464

 Score =   182 bits (463),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 82/119 (69%), Positives = 102/119 (86%), Gaps = 0/119 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            A++E+LPGFP  LPFKL TGY+GVGE +E+QLFYYFIESE+SP+ DPLLLWLTGGPGCS 
Sbjct  21   AIIESLPGFPEDLPFKLETGYVGVGELEEVQLFYYFIESERSPKDDPLLLWLTGGPGCSA  80

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            LS   +EIGPL  +Y+NS+G+ P L+LNPY+WTK+ANIIF+D PVGTG+SY+ T  AY+
Sbjct  81   LSGLLYEIGPLQFDYSNSSGNRPVLKLNPYSWTKIANIIFLDAPVGTGFSYATTWTAYD  139



>ref|XP_010040883.1| PREDICTED: serine carboxypeptidase-like 18 [Eucalyptus grandis]
 gb|KCW44821.1| hypothetical protein EUGRSUZ_L01608 [Eucalyptus grandis]
Length=418

 Score =   179 bits (453),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 102/119 (86%), Gaps = 0/119 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            A+VE++PGFP +LPFKL TGY+GVGE +E+QLFYYFIESE+SP+ DPLLLWLTGGPGCS 
Sbjct  21   AIVESIPGFPGELPFKLETGYVGVGELEEVQLFYYFIESERSPKDDPLLLWLTGGPGCSS  80

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            LS   +EIGP+  ++++S+G  P L+ NPY+WTKVANIIF+D PVGTG+SY+ TS AY+
Sbjct  81   LSGLIYEIGPMQFDFSSSSGTKPILKYNPYSWTKVANIIFLDAPVGTGFSYATTSTAYD  139



>ref|XP_010028343.1| PREDICTED: serine carboxypeptidase-like 18 isoform X3 [Eucalyptus 
grandis]
Length=426

 Score =   179 bits (453),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 82/119 (69%), Positives = 99/119 (83%), Gaps = 0/119 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            AVV++LPGF   LPFKL TGY+GVGE QE+QLFYYFIESE+SP+ DPLLLWLTGGPGCS 
Sbjct  21   AVVKSLPGFSGDLPFKLETGYVGVGELQEVQLFYYFIESERSPKDDPLLLWLTGGPGCSA  80

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            LS   FEIGPL  +Y++S+ + P L+LNPY+WTK+ANIIF+D PVGTG+SY+    AYN
Sbjct  81   LSGLLFEIGPLQFDYSDSSENRPVLKLNPYSWTKIANIIFLDAPVGTGFSYATAWRAYN  139



>ref|XP_010028342.1| PREDICTED: serine carboxypeptidase-like 18 isoform X2 [Eucalyptus 
grandis]
Length=430

 Score =   178 bits (452),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 82/119 (69%), Positives = 99/119 (83%), Gaps = 0/119 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            AVV++LPGF   LPFKL TGY+GVGE QE+QLFYYFIESE+SP+ DPLLLWLTGGPGCS 
Sbjct  21   AVVKSLPGFSGDLPFKLETGYVGVGELQEVQLFYYFIESERSPKDDPLLLWLTGGPGCSA  80

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            LS   FEIGPL  +Y++S+ + P L+LNPY+WTK+ANIIF+D PVGTG+SY+    AYN
Sbjct  81   LSGLLFEIGPLQFDYSDSSENRPVLKLNPYSWTKIANIIFLDAPVGTGFSYATAWRAYN  139



>ref|XP_010028346.1| PREDICTED: serine carboxypeptidase-like 18 [Eucalyptus grandis]
 gb|KCW55075.1| hypothetical protein EUGRSUZ_I01041 [Eucalyptus grandis]
Length=464

 Score =   179 bits (453),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 102/119 (86%), Gaps = 0/119 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            A+VE+LPGFP +LPFKL TGY+GVGE +E+QLFYYFIESE+SP+ DPLL+WLTGGPGCS 
Sbjct  21   AIVESLPGFPGELPFKLETGYVGVGELEEVQLFYYFIESERSPKRDPLLVWLTGGPGCSS  80

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            LS+  +EIGP+  ++++S+G  P L+ NPY+WTKVAN+IF+D PVGTG+SY+ T  AYN
Sbjct  81   LSSLIYEIGPMQFDFSSSSGTKPILKYNPYSWTKVANVIFLDAPVGTGFSYATTDTAYN  139



>ref|XP_010028345.1| PREDICTED: serine carboxypeptidase-like 18 [Eucalyptus grandis]
 gb|KCW55077.1| hypothetical protein EUGRSUZ_I01042 [Eucalyptus grandis]
Length=464

 Score =   179 bits (453),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 101/119 (85%), Gaps = 0/119 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            A+VE+LPGFP +LPFKL TGY+GVGE +E+QLFYYFIESE+SP+ DPLLLWLTGGPGCS 
Sbjct  21   AIVESLPGFPGELPFKLETGYVGVGELEEVQLFYYFIESERSPKDDPLLLWLTGGPGCSS  80

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            LS   +EIGP+  ++++S+G  P L+ NPY+WTK+ANIIF+D PVGTG+SY+ T  AYN
Sbjct  81   LSGLIYEIGPMQFDFSSSSGTKPILKYNPYSWTKIANIIFLDAPVGTGFSYATTPTAYN  139



>ref|XP_010028341.1| PREDICTED: serine carboxypeptidase-like 18 isoform X1 [Eucalyptus 
grandis]
Length=464

 Score =   178 bits (452),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/119 (69%), Positives = 99/119 (83%), Gaps = 0/119 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            AVV++LPGF   LPFKL TGY+GVGE QE+QLFYYFIESE+SP+ DPLLLWLTGGPGCS 
Sbjct  21   AVVKSLPGFSGDLPFKLETGYVGVGELQEVQLFYYFIESERSPKDDPLLLWLTGGPGCSA  80

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            LS   FEIGPL  +Y++S+ + P L+LNPY+WTK+ANIIF+D PVGTG+SY+    AYN
Sbjct  81   LSGLLFEIGPLQFDYSDSSENRPVLKLNPYSWTKIANIIFLDAPVGTGFSYATAWRAYN  139



>ref|XP_009343183.1| PREDICTED: serine carboxypeptidase-like 18 isoform X3 [Pyrus 
x bretschneideri]
Length=371

 Score =   173 bits (439),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 79/117 (68%), Positives = 96/117 (82%), Gaps = 0/117 (0%)
 Frame = +3

Query  105  VVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGL  284
            ++  LPGFP  LPFKL TGY+GVG+  ++QLFYYFIESE SPE DPL+LWLTGGPGCS  
Sbjct  22   IITALPGFPGNLPFKLETGYVGVGDIDDVQLFYYFIESEGSPEYDPLVLWLTGGPGCSAF  81

Query  285  SAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAY  455
            SA  +EIGPL+ +YA+S G+ P L+LNPY+WTKVANIIFVD PVGTG+SY++T   Y
Sbjct  82   SALVYEIGPLSFDYADSIGNKPKLKLNPYSWTKVANIIFVDAPVGTGFSYAKTWRGY  138



>ref|XP_002269439.1| PREDICTED: serine carboxypeptidase-like 7 [Vitis vinifera]
Length=488

 Score =   175 bits (444),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 80/120 (67%), Positives = 97/120 (81%), Gaps = 0/120 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
             ++VETLPGFP KLPFKL TGYI VG+  ++QLFYYFIESE++P  DPL+LWLTGGPGCS
Sbjct  43   QSIVETLPGFPGKLPFKLETGYISVGDVDDVQLFYYFIESERNPRLDPLVLWLTGGPGCS  102

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            G SA  +EIGPL  +     G +P L+LNPY+WTKVA+IIF+D PVGTG+SY+ETS  YN
Sbjct  103  GFSALVYEIGPLAFDVEGYDGILPTLKLNPYSWTKVASIIFIDAPVGTGFSYAETSYGYN  162



>ref|XP_009343180.1| PREDICTED: serine carboxypeptidase-like 1 [Pyrus x bretschneideri]
Length=470

 Score =   175 bits (443),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 79/117 (68%), Positives = 97/117 (83%), Gaps = 0/117 (0%)
 Frame = +3

Query  105  VVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGL  284
            ++  LPGFP+ LPFKL TGY+GVG+  ++QLFYYFIESE SPE DPL+LWLTGGPGCS  
Sbjct  22   IITALPGFPSNLPFKLETGYVGVGDMDDVQLFYYFIESEGSPEYDPLVLWLTGGPGCSAF  81

Query  285  SAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAY  455
            SA  +EIGPL+ +YA+S G+ P L+LNPY+WTKVANIIFVD PVGTG+SY++T   Y
Sbjct  82   SALVYEIGPLSFDYADSIGNKPKLKLNPYSWTKVANIIFVDAPVGTGFSYAKTWRGY  138



>emb|CBI22419.3| unnamed protein product [Vitis vinifera]
Length=463

 Score =   175 bits (443),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 80/120 (67%), Positives = 97/120 (81%), Gaps = 0/120 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
             ++VETLPGFP KLPFKL TGYI VG+  ++QLFYYFIESE++P  DPL+LWLTGGPGCS
Sbjct  18   QSIVETLPGFPGKLPFKLETGYISVGDVDDVQLFYYFIESERNPRLDPLVLWLTGGPGCS  77

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            G SA  +EIGPL  +     G +P L+LNPY+WTKVA+IIF+D PVGTG+SY+ETS  YN
Sbjct  78   GFSALVYEIGPLAFDVEGYDGILPTLKLNPYSWTKVASIIFIDAPVGTGFSYAETSYGYN  137



>gb|KDP44531.1| hypothetical protein JCGZ_16364 [Jatropha curcas]
Length=549

 Score =   176 bits (446),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 82/120 (68%), Positives = 98/120 (82%), Gaps = 1/120 (1%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
             ++++TLPGFP  LPFKL TGYIGVG+  E+QLFYYF+ESE +P+ DPLLLWLTGGPGCS
Sbjct  21   QSIIKTLPGFPGNLPFKLETGYIGVGQLDEVQLFYYFVESEGNPQEDPLLLWLTGGPGCS  80

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            G SA  +EIGPL+ NYA S    P LELNPY+WTKVA+IIF+D PVGTG+SY+ TS AY 
Sbjct  81   GFSALVYEIGPLSFNYAKSRVK-PTLELNPYSWTKVASIIFLDAPVGTGFSYATTSQAYQ  139



>ref|XP_009343181.1| PREDICTED: serine carboxypeptidase-like 1 isoform X1 [Pyrus x 
bretschneideri]
Length=470

 Score =   174 bits (441),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 79/117 (68%), Positives = 96/117 (82%), Gaps = 0/117 (0%)
 Frame = +3

Query  105  VVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGL  284
            ++  LPGFP  LPFKL TGY+GVG+  ++QLFYYFIESE SPE DPL+LWLTGGPGCS  
Sbjct  22   IITALPGFPGNLPFKLETGYVGVGDIDDVQLFYYFIESEGSPEYDPLVLWLTGGPGCSAF  81

Query  285  SAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAY  455
            SA  +EIGPL+ +YA+S G+ P L+LNPY+WTKVANIIFVD PVGTG+SY++T   Y
Sbjct  82   SALVYEIGPLSFDYADSIGNKPKLKLNPYSWTKVANIIFVDAPVGTGFSYAKTWRGY  138



>gb|KCW63578.1| hypothetical protein EUGRSUZ_G01202 [Eucalyptus grandis]
Length=420

 Score =   172 bits (437),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 77/120 (64%), Positives = 97/120 (81%), Gaps = 0/120 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
              VV++LPG P  LPF L TGYIG GE +++QLFYYF++SE+SP+ DPL+LWLTGGPGCS
Sbjct  22   QTVVKSLPGLPGDLPFYLETGYIGAGEREDVQLFYYFVKSERSPKDDPLVLWLTGGPGCS  81

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
             LSA  +EIGP T +Y  ST D P L+LN Y+WTKVANIIF+DQPVGTG+SY+ + ++YN
Sbjct  82   ALSAILYEIGPFTFDYDKSTRDRPALKLNEYSWTKVANIIFLDQPVGTGFSYANSWESYN  141



>ref|XP_008236294.1| PREDICTED: serine carboxypeptidase-like 14 [Prunus mume]
Length=463

 Score =   173 bits (438),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 100/118 (85%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            + ++TLPGF  +LPFKL TGY+GVG+  ++QLFYYFIESE+SP+ DPL+LWLTGGPGCSG
Sbjct  21   STIDTLPGFSGELPFKLETGYVGVGDLDDVQLFYYFIESERSPKEDPLVLWLTGGPGCSG  80

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAY  455
             S   ++IGP+  NYANS+G+ P L LNPY+WTKVANIIF+DQPVG+G+SY+++ + Y
Sbjct  81   FSGLAYQIGPIMFNYANSSGNEPTLVLNPYSWTKVANIIFLDQPVGSGFSYAKSWEGY  138



>ref|XP_010647903.1| PREDICTED: serine carboxypeptidase-like 13 [Vitis vinifera]
Length=464

 Score =   173 bits (438),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 98/119 (82%), Gaps = 0/119 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            ++++TLPGF   LPFKL TGY+GVG+S +IQLFYYFIESE++P  DPL+LWLTGGPGCS 
Sbjct  19   SIIKTLPGFEGDLPFKLETGYVGVGKSDDIQLFYYFIESERNPSLDPLMLWLTGGPGCSA  78

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
             S   +EIGPL  +YAN +GDIP L  NPY+WTKVA+IIF+D PVG+G+SY+++S+ Y 
Sbjct  79   FSGLVYEIGPLIFDYANRSGDIPALLSNPYSWTKVASIIFLDSPVGSGFSYAQSSEGYR  137



>ref|XP_007201135.1| hypothetical protein PRUPE_ppa016992mg, partial [Prunus persica]
 gb|EMJ02334.1| hypothetical protein PRUPE_ppa016992mg, partial [Prunus persica]
Length=450

 Score =   172 bits (437),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 99/118 (84%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            + ++TLPGF  +LPFKL TGY+GVG+  ++QLFYYFIESE+SP+ DPL+LWLTGGPGCSG
Sbjct  8    STIDTLPGFSGELPFKLETGYVGVGDLDDVQLFYYFIESERSPKEDPLVLWLTGGPGCSG  67

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAY  455
             S   ++IGP+  NYANS+G+ P L LNPY+WTKVANIIF+DQPVG+G+SY+++   Y
Sbjct  68   FSGLAYQIGPIMFNYANSSGNEPTLMLNPYSWTKVANIIFLDQPVGSGFSYAKSWQGY  125



>emb|CBI22421.3| unnamed protein product [Vitis vinifera]
Length=589

 Score =   174 bits (441),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 98/119 (82%), Gaps = 0/119 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            ++++TLPGF   LPFKL TGY+GVG+S +IQLFYYFIESE++P  DPL+LWLTGGPGCS 
Sbjct  144  SIIKTLPGFEGDLPFKLETGYVGVGKSDDIQLFYYFIESERNPSLDPLMLWLTGGPGCSA  203

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
             S   +EIGPL  +YAN +GDIP L  NPY+WTKVA+IIF+D PVG+G+SY+++S+ Y 
Sbjct  204  FSGLVYEIGPLIFDYANRSGDIPALLSNPYSWTKVASIIFLDSPVGSGFSYAQSSEGYR  262



>ref|XP_011457834.1| PREDICTED: serine carboxypeptidase-like 18 [Fragaria vesca subsp. 
vesca]
Length=465

 Score =   172 bits (436),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 81/120 (68%), Positives = 100/120 (83%), Gaps = 1/120 (1%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            +++ TLPGF   LPFKL TGY+GVG+  ++QLFYYFIESE SPE DPL+LWLTGGPGCSG
Sbjct  19   SIINTLPGFSGDLPFKLETGYVGVGDLDDVQLFYYFIESEGSPEYDPLVLWLTGGPGCSG  78

Query  282  LSAFFFE-IGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
             SA  +E IGPL+ + ANSTG+ P L+LNPY+WTKVANIIF+D PVGTGYSY++T + Y+
Sbjct  79   FSALVYESIGPLSFDAANSTGNKPQLKLNPYSWTKVANIIFLDAPVGTGYSYAKTWEGYS  138



>ref|XP_011100014.1| PREDICTED: serine carboxypeptidase-like 18 isoform X2 [Sesamum 
indicum]
Length=416

 Score =   170 bits (431),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 91/120 (76%), Gaps = 0/120 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
             +++ TLPGF   LPFKL TGYIGVGE  E+QLFYYFIESE  P+TDPL+LWLTGGPGCS
Sbjct  24   QSIINTLPGFHGTLPFKLETGYIGVGEEDEVQLFYYFIESENDPQTDPLILWLTGGPGCS  83

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            G S   +EIGPL  +     G  P    NPY+WTKVANIIF+D PVGTG+SY+ TS+AYN
Sbjct  84   GFSGLVYEIGPLAFDLEAFDGSFPSFITNPYSWTKVANIIFIDSPVGTGFSYATTSEAYN  143



>ref|XP_010692123.1| PREDICTED: serine carboxypeptidase-like 13 [Beta vulgaris subsp. 
vulgaris]
Length=455

 Score =   171 bits (433),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 80/127 (63%), Positives = 102/127 (80%), Gaps = 10/127 (8%)
 Frame = +3

Query  105  VVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGL  284
            VV++LPGF   LPFKLHTGYIGVG ++E+QLFYYFIESE+ PETDP++LWLTGGPGC+ L
Sbjct  28   VVKSLPGFSGNLPFKLHTGYIGVGRAEEVQLFYYFIESERDPETDPIMLWLTGGPGCTSL  87

Query  285  SAFFFE-IGPLTINY---------ANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSY  434
            SA FFE IGPL+ NY         +N   ++P L+LNPY+WTKV N++FV+ PVGTG+SY
Sbjct  88   SAIFFEHIGPLSFNYTGVYFNRTTSNWETNLPALQLNPYSWTKVVNLLFVEAPVGTGFSY  147

Query  435  SETSDAY  455
            S T+++Y
Sbjct  148  SSTAESY  154



>ref|XP_002522135.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF40335.1| serine carboxypeptidase, putative [Ricinus communis]
Length=478

 Score =   171 bits (434),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 97/120 (81%), Gaps = 0/120 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
             +++++LPGF   LPF L TGYIGVG+ +E+QLFYYF+ESE+SPE DPL+LWLTGGPGCS
Sbjct  29   QSIIKSLPGFDGNLPFFLETGYIGVGKMEEVQLFYYFVESERSPENDPLMLWLTGGPGCS  88

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
              S   +E+GPL  NY +S  + P  ELNPY+WTKVANIIF+D PVGTG+SY++T +AY+
Sbjct  89   AFSGLVYEVGPLKFNYVDSKHNKPVFELNPYSWTKVANIIFLDSPVGTGFSYAKTGEAYH  148



>ref|XP_006486895.1| PREDICTED: serine carboxypeptidase-like 18-like [Citrus sinensis]
Length=476

 Score =   171 bits (433),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 91/119 (76%), Gaps = 0/119 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
            H  V  LPGF   LPFKL TGYIGVGE+ ++QLFYYFIESE+SPE DPL+LWLTGGPGCS
Sbjct  27   HQTVAALPGFDGHLPFKLETGYIGVGENDDVQLFYYFIESERSPEDDPLVLWLTGGPGCS  86

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAY  455
            G S   FEIGPL  +Y NS   +P   LN Y+WTKVANIIF+D PVGTG+SY+ + + Y
Sbjct  87   GFSGLVFEIGPLVFDYENSKASLPRFSLNQYSWTKVANIIFLDAPVGTGFSYANSWEGY  145



>gb|KCW63574.1| hypothetical protein EUGRSUZ_G01198 [Eucalyptus grandis]
Length=436

 Score =   170 bits (431),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 93/120 (78%), Gaps = 0/120 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
              VV++LPG P  LPF L TGYIGVGE  ++QLFYYF+ESE+SP  DPL+LWLTGGPGCS
Sbjct  25   QTVVKSLPGLPGDLPFYLETGYIGVGELDDVQLFYYFVESERSPRDDPLVLWLTGGPGCS  84

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
             LS   +EIGP T NY  ST   P L+LN Y+WTKVANIIF+DQPVGTG+SY+   ++YN
Sbjct  85   ALSGLIYEIGPFTFNYEKSTRFRPSLKLNDYSWTKVANIIFLDQPVGTGFSYANNWESYN  144



>ref|XP_011100016.1| PREDICTED: serine carboxypeptidase-like 18 isoform X2 [Sesamum 
indicum]
Length=416

 Score =   170 bits (430),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 90/120 (75%), Gaps = 0/120 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
             +++ TLPGF   LPFKL TGYIGVGE  E+QLFYYFIESE  P+TDPL+LWLTGGPGCS
Sbjct  24   QSIINTLPGFHGTLPFKLETGYIGVGEEDEVQLFYYFIESENDPQTDPLILWLTGGPGCS  83

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            G S   +EIGPL  +     G  P    NPY+WTKVANIIF+D PVGTG+SY+ TS AYN
Sbjct  84   GFSGLVYEIGPLAFDVEAFDGSFPSFITNPYSWTKVANIIFIDSPVGTGFSYATTSQAYN  143



>ref|XP_002534183.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF28200.1| serine carboxypeptidase, putative [Ricinus communis]
Length=329

 Score =   167 bits (424),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 77/118 (65%), Positives = 94/118 (80%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
             VV TLPGF  +LPF L TGYIGVGES E QLFYYF+ES++SP  DPL+LWLTGGPGCS 
Sbjct  32   TVVTTLPGFDGELPFYLETGYIGVGESNESQLFYYFVESQRSPAVDPLMLWLTGGPGCSV  91

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAY  455
            LSAFF+E GP+T +Y+N  G +P L LNP+AWT+  NI++VD P+GTG+SYS T + Y
Sbjct  92   LSAFFYESGPVTFDYSNYNGSLPSLHLNPFAWTQGINILYVDAPIGTGFSYSTTQENY  149



>gb|KCW63573.1| hypothetical protein EUGRSUZ_G01198 [Eucalyptus grandis]
Length=441

 Score =   170 bits (430),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 93/120 (78%), Gaps = 0/120 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
              VV++LPG P  LPF L TGYIGVGE  ++QLFYYF+ESE+SP  DPL+LWLTGGPGCS
Sbjct  25   QTVVKSLPGLPGDLPFYLETGYIGVGELDDVQLFYYFVESERSPRDDPLVLWLTGGPGCS  84

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
             LS   +EIGP T NY  ST   P L+LN Y+WTKVANIIF+DQPVGTG+SY+   ++YN
Sbjct  85   ALSGLIYEIGPFTFNYEKSTRFRPSLKLNDYSWTKVANIIFLDQPVGTGFSYANNWESYN  144



>gb|KCW63571.1| hypothetical protein EUGRSUZ_G01198 [Eucalyptus grandis]
Length=471

 Score =   170 bits (431),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 93/120 (78%), Gaps = 0/120 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
              VV++LPG P  LPF L TGYIGVGE  ++QLFYYF+ESE+SP  DPL+LWLTGGPGCS
Sbjct  25   QTVVKSLPGLPGDLPFYLETGYIGVGELDDVQLFYYFVESERSPRDDPLVLWLTGGPGCS  84

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
             LS   +EIGP T NY  ST   P L+LN Y+WTKVANIIF+DQPVGTG+SY+   ++YN
Sbjct  85   ALSGLIYEIGPFTFNYEKSTRFRPSLKLNDYSWTKVANIIFLDQPVGTGFSYANNWESYN  144



>ref|XP_010065870.1| PREDICTED: serine carboxypeptidase-like 13 isoform X2 [Eucalyptus 
grandis]
Length=441

 Score =   170 bits (430),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 93/120 (78%), Gaps = 0/120 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
              VV++LPG P  LPF L TGYIGVGE  ++QLFYYF+ESE+SP  DPL+LWLTGGPGCS
Sbjct  25   QTVVKSLPGLPGDLPFYLETGYIGVGELDDVQLFYYFVESERSPRDDPLVLWLTGGPGCS  84

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
             LS   +EIGP T NY  ST   P L+LN Y+WTKVANIIF+DQPVGTG+SY+   ++YN
Sbjct  85   ALSGLIYEIGPFTFNYEKSTRFRPSLKLNDYSWTKVANIIFLDQPVGTGFSYANNWESYN  144



>ref|XP_009343914.1| PREDICTED: serine carboxypeptidase-like 7 [Pyrus x bretschneideri]
Length=462

 Score =   170 bits (431),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 76/120 (63%), Positives = 96/120 (80%), Gaps = 1/120 (1%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            +++ +LPGFP  LPFKL TGY+GVG+  ++QLFYYFIESE+SPE DPL+LWLTGGP CSG
Sbjct  22   SIINSLPGFPGDLPFKLETGYVGVGDDDDVQLFYYFIESERSPENDPLVLWLTGGPACSG  81

Query  282  LSAF-FFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
                 +  IGPL+ +YA+S G+ P L+LNPY+WTKVANIIF+D PVGTG+SY+ T   YN
Sbjct  82   FHTLVYVNIGPLSFDYAHSIGNKPKLKLNPYSWTKVANIIFIDAPVGTGFSYATTWKGYN  141



>ref|XP_011100013.1| PREDICTED: serine carboxypeptidase-like 13 isoform X1 [Sesamum 
indicum]
Length=467

 Score =   170 bits (431),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 91/120 (76%), Gaps = 0/120 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
             +++ TLPGF   LPFKL TGYIGVGE  E+QLFYYFIESE  P+TDPL+LWLTGGPGCS
Sbjct  24   QSIINTLPGFHGTLPFKLETGYIGVGEEDEVQLFYYFIESENDPQTDPLILWLTGGPGCS  83

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            G S   +EIGPL  +     G  P    NPY+WTKVANIIF+D PVGTG+SY+ TS+AYN
Sbjct  84   GFSGLVYEIGPLAFDLEAFDGSFPSFITNPYSWTKVANIIFIDSPVGTGFSYATTSEAYN  143



>ref|XP_009375674.1| PREDICTED: serine carboxypeptidase-like 7 [Pyrus x bretschneideri]
Length=462

 Score =   170 bits (430),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 76/120 (63%), Positives = 96/120 (80%), Gaps = 1/120 (1%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            +++ +LPGFP  LPFKL TGY+GVG+  ++QLFYYFIESE+SPE DPL+LWLTGGP CSG
Sbjct  22   SIINSLPGFPGDLPFKLETGYVGVGDDDDVQLFYYFIESERSPENDPLVLWLTGGPACSG  81

Query  282  LSAF-FFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
                 +  IGPL+ +YA+S G+ P L+LNPY+WTKVANIIF+D PVGTG+SY+ T   YN
Sbjct  82   FHTLVYVNIGPLSFDYAHSIGNKPKLKLNPYSWTKVANIIFIDAPVGTGFSYATTWKGYN  141



>ref|XP_011100017.1| PREDICTED: serine carboxypeptidase-like 13 [Sesamum indicum]
Length=467

 Score =   170 bits (430),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 77/120 (64%), Positives = 92/120 (77%), Gaps = 0/120 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
             +++ TLPGF   LPFKL TGYIGVGE  E+QLFYYFIESE  P+TDPL+LWLTGGPGC+
Sbjct  24   QSIINTLPGFHGTLPFKLETGYIGVGEEDEVQLFYYFIESENDPQTDPLILWLTGGPGCT  83

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            G SA  +EIGPL  +     G  P    NPY+WTKVANIIF+D PVGTG+SY+ T++AYN
Sbjct  84   GFSALVYEIGPLAFDLEAFDGSFPSFITNPYSWTKVANIIFIDSPVGTGFSYATTTEAYN  143



>ref|XP_010065869.1| PREDICTED: serine carboxypeptidase-like 2 isoform X1 [Eucalyptus 
grandis]
 gb|KCW63572.1| hypothetical protein EUGRSUZ_G01198 [Eucalyptus grandis]
Length=470

 Score =   170 bits (430),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 93/120 (78%), Gaps = 0/120 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
              VV++LPG P  LPF L TGYIGVGE  ++QLFYYF+ESE+SP  DPL+LWLTGGPGCS
Sbjct  25   QTVVKSLPGLPGDLPFYLETGYIGVGELDDVQLFYYFVESERSPRDDPLVLWLTGGPGCS  84

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
             LS   +EIGP T NY  ST   P L+LN Y+WTKVANIIF+DQPVGTG+SY+   ++YN
Sbjct  85   ALSGLIYEIGPFTFNYEKSTRFRPSLKLNDYSWTKVANIIFLDQPVGTGFSYANNWESYN  144



>ref|XP_011100015.1| PREDICTED: serine carboxypeptidase-like 7 isoform X1 [Sesamum 
indicum]
Length=467

 Score =   169 bits (429),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 90/120 (75%), Gaps = 0/120 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
             +++ TLPGF   LPFKL TGYIGVGE  E+QLFYYFIESE  P+TDPL+LWLTGGPGCS
Sbjct  24   QSIINTLPGFHGTLPFKLETGYIGVGEEDEVQLFYYFIESENDPQTDPLILWLTGGPGCS  83

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            G S   +EIGPL  +     G  P    NPY+WTKVANIIF+D PVGTG+SY+ TS AYN
Sbjct  84   GFSGLVYEIGPLAFDVEAFDGSFPSFITNPYSWTKVANIIFIDSPVGTGFSYATTSQAYN  143



>ref|XP_006486896.1| PREDICTED: serine carboxypeptidase-like 18-like [Citrus sinensis]
Length=470

 Score =   169 bits (429),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 93/119 (78%), Gaps = 0/119 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
              ++ TLPGF   LPFKL TGYIGVG++ ++QLFYYFIESE+SPE DPL+LWLTGGPGCS
Sbjct  21   QQIITTLPGFDGDLPFKLETGYIGVGQNDDVQLFYYFIESERSPEDDPLVLWLTGGPGCS  80

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAY  455
            G S   FEIGPL+ +Y  S  ++P   LNPY+WTKVAN+IF+D PVGTG+SY+ T   Y
Sbjct  81   GFSGLVFEIGPLSFDYEKSKVNLPKFLLNPYSWTKVANVIFLDAPVGTGFSYANTWQGY  139



>gb|KCW63576.1| hypothetical protein EUGRSUZ_G01200 [Eucalyptus grandis]
Length=436

 Score =   169 bits (427),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 76/120 (63%), Positives = 93/120 (78%), Gaps = 0/120 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
              VV++LPG P  LPF L TGYIGVGE  ++QLFYYF+ESE+SP  DPL+LWLTGGPGCS
Sbjct  25   QTVVKSLPGLPGDLPFHLETGYIGVGELDDVQLFYYFVESERSPRDDPLVLWLTGGPGCS  84

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
             LS   +EIGP T NY  S+   P L+LN Y+WTKVANIIF+DQP+GTG+SY+   ++YN
Sbjct  85   ALSGLIYEIGPFTFNYEKSSRFRPALKLNDYSWTKVANIIFLDQPIGTGFSYANNWESYN  144



>gb|KCW63570.1| hypothetical protein EUGRSUZ_G01197 [Eucalyptus grandis]
Length=436

 Score =   169 bits (427),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 77/120 (64%), Positives = 93/120 (78%), Gaps = 0/120 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
              VV++LPG P  LPF L TGYIGVGE  ++QLFYYF+ESE+SP  DPL+LWLTGGPGCS
Sbjct  25   QTVVKSLPGLPGDLPFYLETGYIGVGELDDVQLFYYFVESERSPRDDPLVLWLTGGPGCS  84

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
             LS   +EIGP T NY  S+   P L+LN Y+WTKVANIIF+DQPVGTG+SY+   ++YN
Sbjct  85   ALSGLIYEIGPFTFNYEKSSRFRPALKLNDYSWTKVANIIFLDQPVGTGFSYANNWESYN  144



>ref|XP_010065873.1| PREDICTED: serine carboxypeptidase-like 2 [Eucalyptus grandis]
 gb|KCW63566.1| hypothetical protein EUGRSUZ_G01194 [Eucalyptus grandis]
Length=470

 Score =   169 bits (428),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 93/120 (78%), Gaps = 0/120 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
              VV+ LPG P  LPF L TGYIGVGE  ++QLFYYF+ESE+SP  DPL+LWLTGGPGCS
Sbjct  25   QTVVKLLPGLPGDLPFYLETGYIGVGELDDVQLFYYFVESERSPRDDPLVLWLTGGPGCS  84

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
             LS   +EIGP T NY  ST   P L+LN Y+WTKVANIIF+DQPVGTG+SY+ + ++YN
Sbjct  85   ALSGLIYEIGPFTFNYEKSTRFRPALKLNDYSWTKVANIIFLDQPVGTGFSYANSWESYN  144



>ref|XP_006422777.1| hypothetical protein CICLE_v10028360mg [Citrus clementina]
 gb|ESR36017.1| hypothetical protein CICLE_v10028360mg [Citrus clementina]
Length=470

 Score =   169 bits (427),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 93/119 (78%), Gaps = 0/119 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
              ++ TLPGF   LPFKL TGYIGVG++ ++QLFYYFIESE+SPE DPL+LWL+GGPGCS
Sbjct  21   QQIITTLPGFDGDLPFKLETGYIGVGQNDDVQLFYYFIESERSPEDDPLVLWLSGGPGCS  80

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAY  455
            G S   FEIGPL+ +Y  S  ++P   LNPY+WTKVANIIF+D PVGTG+SY+ T   Y
Sbjct  81   GFSGLVFEIGPLSFDYEKSKVNLPKFLLNPYSWTKVANIIFLDAPVGTGFSYANTWQGY  139



>ref|XP_010065864.1| PREDICTED: serine carboxypeptidase-like 2 isoform X1 [Eucalyptus 
grandis]
Length=471

 Score =   169 bits (427),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 76/120 (63%), Positives = 93/120 (78%), Gaps = 0/120 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
              VV++LPG P  LPF L TGYIGVGE  ++QLFYYF+ESE+SP  DPL+LWLTGGPGCS
Sbjct  25   QTVVKSLPGLPGDLPFHLETGYIGVGELDDVQLFYYFVESERSPRDDPLVLWLTGGPGCS  84

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
             LS   +EIGP T NY  S+   P L+LN Y+WTKVANIIF+DQP+GTG+SY+   ++YN
Sbjct  85   ALSGLIYEIGPFTFNYEKSSRFRPALKLNDYSWTKVANIIFLDQPIGTGFSYANNWESYN  144



>ref|XP_008236346.1| PREDICTED: serine carboxypeptidase-like 18 [Prunus mume]
Length=444

 Score =   168 bits (426),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 76/120 (63%), Positives = 97/120 (81%), Gaps = 1/120 (1%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            +++ TLPGF   LPFKL TGY+GVG   +IQLFY+FIESE+SP+ DPLLLWL+GGPGCS 
Sbjct  21   SIINTLPGFSGNLPFKLETGYVGVGNLDDIQLFYFFIESERSPKEDPLLLWLSGGPGCSS  80

Query  282  LSAFFFE-IGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
             +A  ++ IGPL  NYANS+G+ P   LNPYAWTK+AN+IF+DQPVGTGYSY+++ + Y 
Sbjct  81   FTAMVYDSIGPLIFNYANSSGNEPTFLLNPYAWTKIANVIFLDQPVGTGYSYAKSWEEYR  140



>ref|XP_010065865.1| PREDICTED: serine carboxypeptidase-like 2 isoform X2 [Eucalyptus 
grandis]
 gb|KCW63575.1| hypothetical protein EUGRSUZ_G01200 [Eucalyptus grandis]
Length=470

 Score =   169 bits (427),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 76/120 (63%), Positives = 93/120 (78%), Gaps = 0/120 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
              VV++LPG P  LPF L TGYIGVGE  ++QLFYYF+ESE+SP  DPL+LWLTGGPGCS
Sbjct  25   QTVVKSLPGLPGDLPFHLETGYIGVGELDDVQLFYYFVESERSPRDDPLVLWLTGGPGCS  84

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
             LS   +EIGP T NY  S+   P L+LN Y+WTKVANIIF+DQP+GTG+SY+   ++YN
Sbjct  85   ALSGLIYEIGPFTFNYEKSSRFRPALKLNDYSWTKVANIIFLDQPIGTGFSYANNWESYN  144



>ref|XP_011030311.1| PREDICTED: serine carboxypeptidase-like 18 isoform X2 [Populus 
euphratica]
Length=446

 Score =   168 bits (425),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 98/120 (82%), Gaps = 1/120 (1%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            +++++LPGF   LPF L TGYIGVGE + +QLFYYF+ESE+SP+ DPL+LWLTGGPGCS 
Sbjct  35   SIIKSLPGFHGNLPFVLETGYIGVGELEAVQLFYYFVESERSPKDDPLVLWLTGGPGCSA  94

Query  282  LSAFFFEIGPLTINYANST-GDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            LS F +EIGPL+ +YA S+ G  P L LNPY+WTK+ANIIFVD PVGTG+SYS T + Y+
Sbjct  95   LSGFIYEIGPLSFDYAKSSGGGKPVLALNPYSWTKIANIIFVDAPVGTGFSYSTTWEGYD  154



>ref|XP_010065871.1| PREDICTED: serine carboxypeptidase-like 2 isoform X3 [Eucalyptus 
grandis]
Length=470

 Score =   168 bits (426),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 77/120 (64%), Positives = 93/120 (78%), Gaps = 0/120 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
              VV++LPG P  LPF L TGYIGVGE  ++QLFYYF+ESE+SP  DPL+LWLTGGPGCS
Sbjct  25   QTVVKSLPGLPGDLPFYLETGYIGVGELDDVQLFYYFVESERSPRDDPLVLWLTGGPGCS  84

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
             LS   +EIGP T NY  S+   P L+LN Y+WTKVANIIF+DQPVGTG+SY+   ++YN
Sbjct  85   ALSGLIYEIGPFTFNYEKSSRFRPALKLNDYSWTKVANIIFLDQPVGTGFSYANNWESYN  144



>gb|KCW63569.1| hypothetical protein EUGRSUZ_G01197 [Eucalyptus grandis]
Length=470

 Score =   168 bits (426),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 77/120 (64%), Positives = 93/120 (78%), Gaps = 0/120 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
              VV++LPG P  LPF L TGYIGVGE  ++QLFYYF+ESE+SP  DPL+LWLTGGPGCS
Sbjct  25   QTVVKSLPGLPGDLPFYLETGYIGVGELDDVQLFYYFVESERSPRDDPLVLWLTGGPGCS  84

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
             LS   +EIGP T NY  S+   P L+LN Y+WTKVANIIF+DQPVGTG+SY+   ++YN
Sbjct  85   ALSGLIYEIGPFTFNYEKSSRFRPALKLNDYSWTKVANIIFLDQPVGTGFSYANNWESYN  144



>ref|XP_002522133.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF40333.1| serine carboxypeptidase, putative [Ricinus communis]
Length=480

 Score =   169 bits (427),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 96/120 (80%), Gaps = 0/120 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
              +V+TLPGFP KLPFK+ TGY+GVGE +++QLFYYF ESE+ P  DPL+LWLTGGPGCS
Sbjct  36   QTIVDTLPGFPGKLPFKMETGYVGVGEMEDVQLFYYFFESERDPTFDPLVLWLTGGPGCS  95

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            G SA  FE GPL I Y   TG +P L+LNP++WTKVA+II++D PVG+G+SY+ T++  N
Sbjct  96   GFSAIAFENGPLAIAYDTYTGGLPSLKLNPFSWTKVASIIYIDAPVGSGFSYATTNEGAN  155



>ref|XP_011030309.1| PREDICTED: serine carboxypeptidase-like 18 isoform X3 [Populus 
euphratica]
Length=446

 Score =   167 bits (424),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 98/120 (82%), Gaps = 1/120 (1%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            +++++LPGF   LPF L TGYIGVGE + +QLFYYF+ESE+SP+ DPL+LWLTGGPGCS 
Sbjct  35   SIIKSLPGFHGNLPFVLETGYIGVGELEAVQLFYYFVESERSPKDDPLVLWLTGGPGCSA  94

Query  282  LSAFFFEIGPLTINYANST-GDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            LS F +EIGPL+ +YA S+ G  P L LNPY+WTK+ANIIFVD PVGTG+SYS T + Y+
Sbjct  95   LSGFIYEIGPLSFDYAKSSGGGKPVLALNPYSWTKIANIIFVDAPVGTGFSYSTTWEGYD  154



>ref|XP_011088733.1| PREDICTED: serine carboxypeptidase-like 7 [Sesamum indicum]
Length=493

 Score =   168 bits (426),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/120 (63%), Positives = 90/120 (75%), Gaps = 0/120 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
             +++ TLPGF   LPFKL TGYIGVGE+ E+QLFYYFI+SE  PE DPL+LWLTGGPGCS
Sbjct  26   QSIINTLPGFHGTLPFKLETGYIGVGENDEVQLFYYFIQSENDPERDPLILWLTGGPGCS  85

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            G S   +EIGPL  +     G  P   LNPY+WTK+ANIIF+D PVGTG+SY+ T  AYN
Sbjct  86   GFSGLVYEIGPLAFDLEAFDGSFPSFTLNPYSWTKIANIIFIDSPVGTGFSYATTPQAYN  145



>ref|XP_010682454.1| PREDICTED: serine carboxypeptidase-like 18 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=459

 Score =   167 bits (424),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 93/118 (79%), Gaps = 2/118 (2%)
 Frame = +3

Query  108  VETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGLS  287
            ++TLPGF   LPF L TGYIGVG+S+E+QLFYYFIESE+  E DP+L+WLTGGPGCS  S
Sbjct  34   IKTLPGFTGNLPFNLETGYIGVGKSEEVQLFYYFIESERDVERDPVLIWLTGGPGCSAYS  93

Query  288  AFFFEIGPLTINYAN--STGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAY  455
               +EIGPLT NY+   S   IP  +LNPY+WTKVA+IIF+D PVGTG+SY  TSDAY
Sbjct  94   GLVYEIGPLTFNYSAPYSEASIPKFQLNPYSWTKVASIIFLDSPVGTGFSYGTTSDAY  151



>ref|XP_007200784.1| hypothetical protein PRUPE_ppa024053mg [Prunus persica]
 gb|EMJ01983.1| hypothetical protein PRUPE_ppa024053mg [Prunus persica]
Length=456

 Score =   167 bits (424),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/120 (63%), Positives = 97/120 (81%), Gaps = 1/120 (1%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            +++ TLPGF   LPFKL TGY+GVG   +IQLFY+FIESE+SP+ DPLLLWL+GGPGCS 
Sbjct  22   SIINTLPGFSGDLPFKLETGYVGVGNLDDIQLFYFFIESERSPKEDPLLLWLSGGPGCSS  81

Query  282  LSAFFFE-IGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
             +A  ++ IGPL  NYANS+G+ P   LNPYAWTK+AN+IF+DQPVGTGYSY+++ + Y 
Sbjct  82   FTAMVYDSIGPLIFNYANSSGNEPTFLLNPYAWTKIANVIFLDQPVGTGYSYAKSWEEYR  141



>ref|XP_011030308.1| PREDICTED: serine carboxypeptidase-like 18 isoform X2 [Populus 
euphratica]
Length=455

 Score =   167 bits (424),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 98/120 (82%), Gaps = 1/120 (1%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            +++++LPGF   LPF L TGYIGVGE + +QLFYYF+ESE+SP+ DPL+LWLTGGPGCS 
Sbjct  35   SIIKSLPGFHGNLPFVLETGYIGVGELEAVQLFYYFVESERSPKDDPLVLWLTGGPGCSA  94

Query  282  LSAFFFEIGPLTINYANST-GDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            LS F +EIGPL+ +YA S+ G  P L LNPY+WTK+ANIIFVD PVGTG+SYS T + Y+
Sbjct  95   LSGFIYEIGPLSFDYAKSSGGGKPVLALNPYSWTKIANIIFVDAPVGTGFSYSTTWEGYD  154



>ref|XP_011030310.1| PREDICTED: serine carboxypeptidase-like 18 isoform X1 [Populus 
euphratica]
Length=484

 Score =   167 bits (424),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 98/120 (82%), Gaps = 1/120 (1%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            +++++LPGF   LPF L TGYIGVGE + +QLFYYF+ESE+SP+ DPL+LWLTGGPGCS 
Sbjct  35   SIIKSLPGFHGNLPFVLETGYIGVGELEAVQLFYYFVESERSPKDDPLVLWLTGGPGCSA  94

Query  282  LSAFFFEIGPLTINYANST-GDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            LS F +EIGPL+ +YA S+ G  P L LNPY+WTK+ANIIFVD PVGTG+SYS T + Y+
Sbjct  95   LSGFIYEIGPLSFDYAKSSGGGKPVLALNPYSWTKIANIIFVDAPVGTGFSYSTTWEGYD  154



>ref|XP_011030307.1| PREDICTED: serine carboxypeptidase-like 18 isoform X1 [Populus 
euphratica]
Length=484

 Score =   167 bits (423),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 98/120 (82%), Gaps = 1/120 (1%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            +++++LPGF   LPF L TGYIGVGE + +QLFYYF+ESE+SP+ DPL+LWLTGGPGCS 
Sbjct  35   SIIKSLPGFHGNLPFVLETGYIGVGELEAVQLFYYFVESERSPKDDPLVLWLTGGPGCSA  94

Query  282  LSAFFFEIGPLTINYANST-GDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            LS F +EIGPL+ +YA S+ G  P L LNPY+WTK+ANIIFVD PVGTG+SYS T + Y+
Sbjct  95   LSGFIYEIGPLSFDYAKSSGGGKPVLALNPYSWTKIANIIFVDAPVGTGFSYSTTWEGYD  154



>ref|XP_006369726.1| hypothetical protein POPTR_0001s29910g [Populus trichocarpa]
 gb|ERP66295.1| hypothetical protein POPTR_0001s29910g [Populus trichocarpa]
Length=334

 Score =   164 bits (415),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 77/120 (64%), Positives = 96/120 (80%), Gaps = 1/120 (1%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            +++++LPGF   LPF L TGYIGVGE + +QLFYYFIESE+SP+ DPL+LWLTGGPGCS 
Sbjct  35   SIIKSLPGFDGNLPFVLETGYIGVGELEAVQLFYYFIESERSPKDDPLVLWLTGGPGCSA  94

Query  282  LSAFFFEIGPLTINYANST-GDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            LS   +EIGPL+ +YA S+ G  P   LNPY+WTK+ANIIFVD PVGTG+SYS T + Y+
Sbjct  95   LSGIIYEIGPLSFDYAKSSGGGKPVFALNPYSWTKIANIIFVDAPVGTGFSYSTTWEGYH  154



>ref|XP_006422780.1| hypothetical protein CICLE_v10028349mg [Citrus clementina]
 gb|ESR36020.1| hypothetical protein CICLE_v10028349mg [Citrus clementina]
Length=476

 Score =   167 bits (423),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 90/119 (76%), Gaps = 0/119 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
            H  V TLPGF   LPFKL TGYIGVG+  ++QLFYYFIESE+SPE DPL+LWLTGGPGCS
Sbjct  27   HQTVATLPGFDGHLPFKLETGYIGVGDDDDVQLFYYFIESERSPEDDPLVLWLTGGPGCS  86

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAY  455
            G S   FEIGPL  +Y +S   +P   LN Y+WTKVAN+IF+D PVGTG+SY+ +   Y
Sbjct  87   GFSGLVFEIGPLVFDYESSRPSLPRFSLNQYSWTKVANVIFLDAPVGTGFSYANSWQGY  145



>ref|XP_002265842.1| PREDICTED: serine carboxypeptidase-like 18 [Vitis vinifera]
Length=491

 Score =   167 bits (423),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 92/119 (77%), Gaps = 0/119 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
             ++V+TLPGF  +LPFKL TGY+ VGE  +++LFYYFIESE+ P  DPL+LWLTGGPGCS
Sbjct  42   QSIVDTLPGFSGELPFKLETGYVSVGELNDVELFYYFIESERDPARDPLILWLTGGPGCS  101

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAY  455
            G S   +EIGPL  NY    G +P LELNPY+WTKVA+IIF+D PVGTG+SY+   D Y
Sbjct  102  GFSGLVYEIGPLRFNYTAFNGSLPSLELNPYSWTKVASIIFLDAPVGTGFSYATNPDDY  160



>emb|CBI22424.3| unnamed protein product [Vitis vinifera]
Length=507

 Score =   167 bits (423),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 92/119 (77%), Gaps = 0/119 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
             ++V+TLPGF  +LPFKL TGY+ VGE  +++LFYYFIESE+ P  DPL+LWLTGGPGCS
Sbjct  58   QSIVDTLPGFSGELPFKLETGYVSVGELNDVELFYYFIESERDPARDPLILWLTGGPGCS  117

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAY  455
            G S   +EIGPL  NY    G +P LELNPY+WTKVA+IIF+D PVGTG+SY+   D Y
Sbjct  118  GFSGLVYEIGPLRFNYTAFNGSLPSLELNPYSWTKVASIIFLDAPVGTGFSYATNPDDY  176



>emb|CAN74923.1| hypothetical protein VITISV_038590 [Vitis vinifera]
Length=499

 Score =   167 bits (423),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 92/119 (77%), Gaps = 0/119 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
             ++V+TLPGF  +LPFKL TGY+ VGE  +++LFYYFIESE+ P  DPL+LWLTGGPGCS
Sbjct  42   QSIVDTLPGFSGELPFKLETGYVSVGELNDVELFYYFIESERDPARDPLILWLTGGPGCS  101

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAY  455
            G S   +EIGPL  NY    G +P LELNPY+WTKVA+IIF+D PVGTG+SY+   D Y
Sbjct  102  GFSGLVYEIGPLRFNYTAFNGSLPSLELNPYSWTKVASIIFLDAPVGTGFSYATNPDDY  160



>gb|KDP44532.1| hypothetical protein JCGZ_16365 [Jatropha curcas]
Length=472

 Score =   166 bits (421),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 93/120 (78%), Gaps = 0/120 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
              ++ETLPGFP KLPFK+ TGYI VGE Q+++LFYYF ESE+ P  DPL+LWLTGGPGCS
Sbjct  28   QTIIETLPGFPGKLPFKMETGYISVGEMQDVELFYYFFESERDPIYDPLVLWLTGGPGCS  87

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            G SA  FE GPL I     +G +P L+LNPY+WTKVA+IIF+D PVG G+SY+ T++  N
Sbjct  88   GFSAIAFENGPLAIARDTYSGGLPSLKLNPYSWTKVASIIFIDAPVGAGFSYATTAEGRN  147



>ref|XP_008236293.1| PREDICTED: serine carboxypeptidase-like 18 isoform X3 [Prunus 
mume]
Length=439

 Score =   166 bits (419),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 97/119 (82%), Gaps = 1/119 (1%)
 Frame = +3

Query  105  VVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGL  284
            +++TLPGF   LPFKL TGY+GVG   ++QLFYYF ESE SPE DPL+LWLTGGPGCS  
Sbjct  32   IIKTLPGFRGDLPFKLETGYVGVGGMDDVQLFYYFFESEGSPEYDPLVLWLTGGPGCSAF  91

Query  285  SAFFFE-IGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            SA  +E +GPL+ +YA+S G+ P LELNPY+WTKVANIIF+D PVGTG+SY++T + Y+
Sbjct  92   SAIVYENLGPLSFDYAHSIGNKPKLELNPYSWTKVANIIFLDAPVGTGFSYAKTWEGYS  150



>ref|XP_006369725.1| hypothetical protein POPTR_0001s29900g [Populus trichocarpa]
 gb|ERP66294.1| hypothetical protein POPTR_0001s29900g [Populus trichocarpa]
Length=441

 Score =   166 bits (419),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 97/120 (81%), Gaps = 1/120 (1%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            +++++LPGF   LPF L TGYIGVGE + +QLFYYFIESE+SP+ DPL+LWLTGGPGCS 
Sbjct  20   SIIKSLPGFDGNLPFVLETGYIGVGELEAVQLFYYFIESERSPKDDPLVLWLTGGPGCSA  79

Query  282  LSAFFFEIGPLTINYANST-GDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            LS   +EIGPL+ +YA S+ G  P L LNPY+WTK+ANIIFVD PVGTG+SYS T + Y+
Sbjct  80   LSGIIYEIGPLSFDYAKSSGGGKPVLALNPYSWTKIANIIFVDAPVGTGFSYSTTWEGYH  139



>gb|EYU37560.1| hypothetical protein MIMGU_mgv1a005845mg [Erythranthe guttata]
Length=468

 Score =   166 bits (419),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 90/119 (76%), Gaps = 0/119 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
             + V TLPG+P  LPFKL TGYIGVG+  E+QLFYYF+ESE+ P  DPL+ WLTGGPGCS
Sbjct  24   QSTVNTLPGYPGPLPFKLETGYIGVGDDDEVQLFYYFVESERDPRKDPLIFWLTGGPGCS  83

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAY  455
            G S   +EIGPL  +  +  G  P   LNPY+WTK+A+IIF+D PVGTG+SY+ TS++Y
Sbjct  84   GFSGLVYEIGPLAFDVVDFDGSFPSFTLNPYSWTKIASIIFIDSPVGTGFSYTNTSESY  142



>gb|EYU37561.1| hypothetical protein MIMGU_mgv1a005963mg [Erythranthe guttata]
Length=463

 Score =   166 bits (419),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 90/119 (76%), Gaps = 0/119 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
             + V TLPG+P  LPFKL TGYIGVG+  E+QLFYYF+ESE+ P  DPL+ WLTGGPGCS
Sbjct  19   QSTVNTLPGYPGPLPFKLETGYIGVGDDDEVQLFYYFVESERDPRKDPLIFWLTGGPGCS  78

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAY  455
            G S   +EIGPL  +  +  G  P   LNPY+WTK+A+IIF+D PVGTG+SY+ TS++Y
Sbjct  79   GFSGLVYEIGPLAFDVVDFDGSFPSFTLNPYSWTKIASIIFIDSPVGTGFSYTNTSESY  137



>ref|XP_010094886.1| Serine carboxypeptidase-like 18 [Morus notabilis]
 gb|EXB57415.1| Serine carboxypeptidase-like 18 [Morus notabilis]
Length=427

 Score =   165 bits (417),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 95/119 (80%), Gaps = 0/119 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
             +++ TL  F   LPFKL TGY+GVG+++++QLFYYF+ESE+SPE DPLLLWLTGGP CS
Sbjct  32   RSIINTLTDFSGDLPFKLETGYVGVGDAEDLQLFYYFVESERSPENDPLLLWLTGGPCCS  91

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAY  455
             +SA  +EIGPL+ +Y+NS  D   L LNPY+WTKVANIIF+D P GTG+SYS +S+ Y
Sbjct  92   SVSALLYEIGPLSFDYSNSNTDTAPLILNPYSWTKVANIIFLDAPAGTGFSYSISSEGY  150



>ref|XP_006369720.1| hypothetical protein POPTR_0001s29840g [Populus trichocarpa]
 gb|ERP66289.1| hypothetical protein POPTR_0001s29840g [Populus trichocarpa]
Length=409

 Score =   164 bits (416),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 77/120 (64%), Positives = 96/120 (80%), Gaps = 1/120 (1%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            +++++LPGF   LPF L TGYIGVGE + +QLFYYFIESE+SP+ DPL+LWLTGGPGCS 
Sbjct  20   SIIKSLPGFDGNLPFVLETGYIGVGELEAVQLFYYFIESERSPKDDPLVLWLTGGPGCSA  79

Query  282  LSAFFFEIGPLTINYANST-GDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            LS   +EIGPL+ +YA S+ G  P   LNPY+WTK+ANIIFVD PVGTG+SYS T + Y+
Sbjct  80   LSGIIYEIGPLSFDYAKSSGGGKPVFALNPYSWTKIANIIFVDAPVGTGFSYSTTGEGYH  139



>gb|EPS59025.1| hypothetical protein M569_15786, partial [Genlisea aurea]
Length=188

 Score =   158 bits (400),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 93/119 (78%), Gaps = 3/119 (3%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
             +VETLPGF  +LPFKL TGYIGVGE++E QLFYYF+ESE+ P+TDP+++WLTGGPGC+G
Sbjct  22   RIVETLPGFTGRLPFKLETGYIGVGENEETQLFYYFVESERDPDTDPVVIWLTGGPGCTG  81

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            L+A  +EIGP+TI      G +P LEL  Y+WTK+A+IIF+D PV TG+SYS     Y 
Sbjct  82   LTALVYEIGPVTI---VGNGSMPYLELRSYSWTKIASIIFIDSPVVTGFSYSTRRIDYR  137



>ref|XP_008236292.1| PREDICTED: serine carboxypeptidase-like 13 isoform X2 [Prunus 
mume]
Length=480

 Score =   166 bits (419),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 97/119 (82%), Gaps = 1/119 (1%)
 Frame = +3

Query  105  VVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGL  284
            +++TLPGF   LPFKL TGY+GVG   ++QLFYYF ESE SPE DPL+LWLTGGPGCS  
Sbjct  32   IIKTLPGFRGDLPFKLETGYVGVGGMDDVQLFYYFFESEGSPEYDPLVLWLTGGPGCSAF  91

Query  285  SAFFFE-IGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            SA  +E +GPL+ +YA+S G+ P LELNPY+WTKVANIIF+D PVGTG+SY++T + Y+
Sbjct  92   SAIVYENLGPLSFDYAHSIGNKPKLELNPYSWTKVANIIFLDAPVGTGFSYAKTWEGYS  150



>ref|XP_008236291.1| PREDICTED: serine carboxypeptidase-like 13 isoform X1 [Prunus 
mume]
Length=480

 Score =   165 bits (418),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 97/119 (82%), Gaps = 1/119 (1%)
 Frame = +3

Query  105  VVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGL  284
            +++TLPGF   LPFKL TGY+GVG   ++QLFYYF ESE SPE DPL+LWLTGGPGCS  
Sbjct  32   IIKTLPGFRGDLPFKLETGYVGVGGMDDVQLFYYFFESEGSPEYDPLVLWLTGGPGCSAF  91

Query  285  SAFFFE-IGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            SA  +E +GPL+ +YA+S G+ P LELNPY+WTKVANIIF+D PVGTG+SY++T + Y+
Sbjct  92   SAIVYENLGPLSFDYAHSIGNKPKLELNPYSWTKVANIIFLDAPVGTGFSYAKTWEGYS  150



>ref|XP_007201024.1| hypothetical protein PRUPE_ppa006101mg [Prunus persica]
 gb|EMJ02223.1| hypothetical protein PRUPE_ppa006101mg [Prunus persica]
Length=427

 Score =   164 bits (415),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 91/120 (76%), Gaps = 0/120 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
              +++ LPGF   LPFKL TGY GVG   E+QLFYYFIESE+SPE DPLLLW+TGGP CS
Sbjct  35   QTIIKNLPGFSGDLPFKLETGYFGVGNKDELQLFYYFIESERSPENDPLLLWITGGPRCS  94

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
              S   +EIGP++ ++ + T D  +L LNPY+WTK+ANIIF+D P GTG+SYS T+D YN
Sbjct  95   AFSGLVYEIGPISFSFTSITKDPAELVLNPYSWTKLANIIFLDAPAGTGFSYSTTTDGYN  154



>gb|KCW63567.1| hypothetical protein EUGRSUZ_G01195 [Eucalyptus grandis]
Length=436

 Score =   164 bits (416),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 91/120 (76%), Gaps = 0/120 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
              VV++LPG P  LPF L TGYIGVGE  ++QLFYYF+ESE+SP  D L+LWLTGGPGCS
Sbjct  25   QTVVKSLPGLPGDLPFHLETGYIGVGELDDVQLFYYFVESERSPRDDHLVLWLTGGPGCS  84

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
             LS   +EIGP T NY NS+   P L+ N Y+WTKVANIIF+DQPV TG+SY+   ++YN
Sbjct  85   ALSGLIYEIGPFTFNYENSSRFRPTLKFNDYSWTKVANIIFLDQPVRTGFSYANNWESYN  144



>ref|XP_002298786.2| hypothetical protein POPTR_0001s29870g [Populus trichocarpa]
 gb|EEE83591.2| hypothetical protein POPTR_0001s29870g [Populus trichocarpa]
Length=469

 Score =   164 bits (416),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 77/120 (64%), Positives = 96/120 (80%), Gaps = 1/120 (1%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            +++++LPGF   LPF L TGYIGVGE + +QLFYYFIESE+SP+ DPL+LWLTGGPGCS 
Sbjct  20   SIIKSLPGFDGNLPFVLETGYIGVGELEAVQLFYYFIESERSPKDDPLVLWLTGGPGCSA  79

Query  282  LSAFFFEIGPLTINYANST-GDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            LS   +EIGPL+ +YA S+ G  P   LNPY+WTK+ANIIFVD PVGTG+SYS T + Y+
Sbjct  80   LSGLIYEIGPLSFDYAKSSGGGKPVFALNPYSWTKIANIIFVDAPVGTGFSYSTTGEGYH  139



>ref|XP_002266354.2| PREDICTED: serine carboxypeptidase-like 18 [Vitis vinifera]
Length=468

 Score =   164 bits (416),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 69/116 (59%), Positives = 93/116 (80%), Gaps = 0/116 (0%)
 Frame = +3

Query  111  ETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGLSA  290
            + LPGFP  LPFKL TGY+GV +  ++QLFYYF++SE++P  DPLLLWLTGGPGCS  S 
Sbjct  27   KALPGFPGNLPFKLETGYVGVDDMDDVQLFYYFVKSERNPRDDPLLLWLTGGPGCSAFSG  86

Query  291  FFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
              +E+GPL+ +YA S  ++P  +LNPY+WTK+A++IF+D PVGTG+SYS T++ YN
Sbjct  87   LVYEVGPLSFDYAKSNENLPTFKLNPYSWTKLASMIFLDAPVGTGFSYSRTAEGYN  142



>ref|XP_006486897.1| PREDICTED: serine carboxypeptidase-like 17-like [Citrus sinensis]
Length=468

 Score =   164 bits (416),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 90/112 (80%), Gaps = 0/112 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
              ++ TLPGF   LPFKL TGYIGVGE+ ++QLFYYFIESE+SPE DPL+LWL+GGPGCS
Sbjct  21   RQIITTLPGFDGDLPFKLETGYIGVGENDDVQLFYYFIESERSPEDDPLVLWLSGGPGCS  80

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSY  434
            G SA  +++GPL  +Y NS  + P L LNPY+WTKVA+IIF+D P GTG+SY
Sbjct  81   GFSALAYQLGPLAFDYENSRENSPKLLLNPYSWTKVASIIFIDAPAGTGFSY  132



>ref|XP_010065872.1| PREDICTED: serine carboxypeptidase-like 2 [Eucalyptus grandis]
Length=470

 Score =   164 bits (416),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 91/120 (76%), Gaps = 0/120 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
              VV++LPG P  LPF L TGYIGVGE  ++QLFYYF+ESE+SP  D L+LWLTGGPGCS
Sbjct  25   QTVVKSLPGLPGDLPFHLETGYIGVGELDDVQLFYYFVESERSPRDDHLVLWLTGGPGCS  84

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
             LS   +EIGP T NY NS+   P L+ N Y+WTKVANIIF+DQPV TG+SY+   ++YN
Sbjct  85   ALSGLIYEIGPFTFNYENSSRFRPTLKFNDYSWTKVANIIFLDQPVRTGFSYANNWESYN  144



>emb|CBI22420.3| unnamed protein product [Vitis vinifera]
Length=503

 Score =   164 bits (416),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 69/116 (59%), Positives = 93/116 (80%), Gaps = 0/116 (0%)
 Frame = +3

Query  111  ETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGLSA  290
            + LPGFP  LPFKL TGY+GV +  ++QLFYYF++SE++P  DPLLLWLTGGPGCS  S 
Sbjct  63   KALPGFPGNLPFKLETGYVGVDDMDDVQLFYYFVKSERNPRDDPLLLWLTGGPGCSAFSG  122

Query  291  FFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
              +E+GPL+ +YA S  ++P  +LNPY+WTK+A++IF+D PVGTG+SYS T++ YN
Sbjct  123  LVYEVGPLSFDYAKSNENLPTFKLNPYSWTKLASMIFLDAPVGTGFSYSRTAEGYN  178



>ref|XP_007201000.1| hypothetical protein PRUPE_ppa005249mg [Prunus persica]
 gb|EMJ02199.1| hypothetical protein PRUPE_ppa005249mg [Prunus persica]
Length=429

 Score =   163 bits (412),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 94/119 (79%), Gaps = 1/119 (1%)
 Frame = +3

Query  105  VVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGL  284
            +V+TLPGF   LPFKL TGY+GVG   ++QLFYYF ESE SPE DPL+LWL GGPGCS  
Sbjct  22   IVKTLPGFRGDLPFKLETGYVGVGSMDDVQLFYYFFESEGSPEYDPLVLWLNGGPGCSAF  81

Query  285  SAFFFE-IGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            S   +E +GPL+ +YA+S G+ P L+LNPY+WTKVANIIF+D PVGTG+SY++  + YN
Sbjct  82   SGLVYENLGPLSFDYAHSIGNKPKLKLNPYSWTKVANIIFLDAPVGTGFSYAKNWEGYN  140



>ref|XP_002300280.2| hypothetical protein POPTR_0001s29810g [Populus trichocarpa]
 gb|EEE85085.2| hypothetical protein POPTR_0001s29810g [Populus trichocarpa]
Length=446

 Score =   163 bits (413),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 77/120 (64%), Positives = 95/120 (79%), Gaps = 1/120 (1%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            +++++LPGF   LPF L TGYIGVGE + +QLFYYFIESE+SP+ DPL+LWLTGGPGCS 
Sbjct  19   SIIKSLPGFDGNLPFVLETGYIGVGELEAVQLFYYFIESERSPKDDPLVLWLTGGPGCSA  78

Query  282  LSAFFFEIGPLTINYANST-GDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            LS   +EIGPL+ +YA S+ G  P   LNPY+WTK+ANIIFVD PVGTG+SYS T + Y 
Sbjct  79   LSGLIYEIGPLSFDYAKSSGGGKPVFALNPYSWTKLANIIFVDAPVGTGFSYSTTWEGYQ  138



>ref|XP_008236287.1| PREDICTED: serine carboxypeptidase-like 13 [Prunus mume]
Length=480

 Score =   164 bits (414),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 96/119 (81%), Gaps = 1/119 (1%)
 Frame = +3

Query  105  VVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGL  284
            +++TLPGF   LPFKL TGY+GVG   ++QLFYYF ESE SPE DPL+LWLTGGPGCS  
Sbjct  32   IIKTLPGFRGDLPFKLETGYVGVGSMDDVQLFYYFFESEGSPEYDPLVLWLTGGPGCSAF  91

Query  285  SAFFFE-IGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            SA  +E +GPL+ +YA+S G+ P L+LNPY+WTKVANIIF+D PVGTG+SY++  + Y+
Sbjct  92   SALVYENLGPLSFDYAHSIGNKPKLKLNPYSWTKVANIIFLDAPVGTGFSYAKNWEGYS  150



>ref|XP_010065879.1| PREDICTED: serine carboxypeptidase-like 13 [Eucalyptus grandis]
 gb|KCW63577.1| hypothetical protein EUGRSUZ_G01201 [Eucalyptus grandis]
Length=465

 Score =   163 bits (413),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 97/118 (82%), Gaps = 0/118 (0%)
 Frame = +3

Query  105  VVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGL  284
            V++TLPG+P +LPF L TGY+GVG+ +++Q+FYYF++SE+SP+ DPL+LW+TGGPGCS L
Sbjct  24   VIKTLPGYPGELPFYLETGYVGVGDLEDVQMFYYFVKSERSPKDDPLVLWITGGPGCSTL  83

Query  285  SAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            SA  +EIGP T NY N T   P L+++ Y+WTKVANIIFVD+PVG G+SY+   ++YN
Sbjct  84   SAILYEIGPFTFNYENLTPSRPTLKVHEYSWTKVANIIFVDEPVGAGFSYANNWESYN  141



>ref|XP_010046973.1| PREDICTED: serine carboxypeptidase-like 18 [Eucalyptus grandis]
 gb|KCW78694.1| hypothetical protein EUGRSUZ_C00146 [Eucalyptus grandis]
Length=478

 Score =   164 bits (414),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 93/118 (79%), Gaps = 0/118 (0%)
 Frame = +3

Query  105  VVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGL  284
            +++ LPG+  +LPF L  GYIGVGE++++QLFYYF+ES++SP  DP++LWLTGGPGCS L
Sbjct  35   IIKYLPGYDGELPFTLEAGYIGVGETEDVQLFYYFVESQRSPAMDPVVLWLTGGPGCSTL  94

Query  285  SAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
             AFF+E GPL+  Y+   G +P L LNPY WTK  NII++DQPVGTG+SYS T D Y+
Sbjct  95   LAFFYESGPLSFVYSGYNGSLPSLTLNPYTWTKALNIIYLDQPVGTGFSYSTTQDGYD  152



>ref|XP_004513965.1| PREDICTED: serine carboxypeptidase-like 18-like isoform X2 [Cicer 
arietinum]
Length=402

 Score =   162 bits (409),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 95/118 (81%), Gaps = 1/118 (1%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            ++V+ LPGF   LPFKL TGYIGVGE  ++Q+FYYF+ES+++P  DP+LLW  GGPGCSG
Sbjct  59   SIVKNLPGFDGDLPFKLETGYIGVGEGAKVQIFYYFVESQRNPFIDPILLWFVGGPGCSG  118

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAY  455
            LSAFFFE GPL ++  N + ++P L+LNPYAWT + N+I++D PVGTG+SYSET + Y
Sbjct  119  LSAFFFENGPLKMD-PNYSENLPKLKLNPYAWTHMLNMIYIDMPVGTGFSYSETQEGY  175



>ref|XP_008338878.1| PREDICTED: serine carboxypeptidase-like 1 [Malus domestica]
Length=475

 Score =   163 bits (412),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 92/118 (78%), Gaps = 1/118 (1%)
 Frame = +3

Query  105  VVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGL  284
            ++  LPGFP  LPFKL TGY+GVG   ++QLFYYFIESE SPE DPL+LWLTGGPGCS  
Sbjct  22   IITALPGFPGNLPFKLETGYVGVGNMDDVQLFYYFIESEGSPEYDPLVLWLTGGPGCSAF  81

Query  285  SAFFFE-IGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAY  455
            S   +E +GPL+ +YANS G+ P  +LNPY+WTKVANIIF+D PVG G+SY++T   Y
Sbjct  82   SGLIYENLGPLSFDYANSIGNKPXFKLNPYSWTKVANIIFLDAPVGXGFSYAKTWXGY  139



>ref|XP_007201001.1| hypothetical protein PRUPE_ppa005249mg [Prunus persica]
 gb|EMJ02200.1| hypothetical protein PRUPE_ppa005249mg [Prunus persica]
Length=470

 Score =   163 bits (412),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 94/119 (79%), Gaps = 1/119 (1%)
 Frame = +3

Query  105  VVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGL  284
            +V+TLPGF   LPFKL TGY+GVG   ++QLFYYF ESE SPE DPL+LWL GGPGCS  
Sbjct  22   IVKTLPGFRGDLPFKLETGYVGVGSMDDVQLFYYFFESEGSPEYDPLVLWLNGGPGCSAF  81

Query  285  SAFFFE-IGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            S   +E +GPL+ +YA+S G+ P L+LNPY+WTKVANIIF+D PVGTG+SY++  + YN
Sbjct  82   SGLVYENLGPLSFDYAHSIGNKPKLKLNPYSWTKVANIIFLDAPVGTGFSYAKNWEGYN  140



>gb|KDP35359.1| hypothetical protein JCGZ_10343 [Jatropha curcas]
Length=221

 Score =   157 bits (396),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/117 (64%), Positives = 89/117 (76%), Gaps = 0/117 (0%)
 Frame = +3

Query  105  VVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGL  284
            VV +LPGF A+LPF L TGYIGVG+  E QLFYYF+ES+ SP  DPL+LWLTGGPGCS L
Sbjct  41   VVTSLPGFDAELPFYLETGYIGVGKINESQLFYYFVESQGSPTLDPLMLWLTGGPGCSVL  100

Query  285  SAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAY  455
             A F+E GPL  +Y N  G +P L LNP+AWT+  NII+VD PVGTG+SYS T + Y
Sbjct  101  YALFYENGPLAFDYLNYNGSLPSLLLNPFAWTQRINIIYVDAPVGTGFSYSTTQENY  157



>dbj|BAF99696.1| 1-O-acylglucose:anthocyanin-O-acyltransferase- like protein [Gentiana 
triflora]
Length=481

 Score =   163 bits (412),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 93/120 (78%), Gaps = 0/120 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
             ++V+TLPGF   LPF L +GY+GVGE++E+QLFYYFIESE+ P  DPL++WLTGGPGCS
Sbjct  47   QSIVKTLPGFHGSLPFTLESGYVGVGENEELQLFYYFIESERDPANDPLVIWLTGGPGCS  106

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
              S   FEIGPLT ++ +  G +P L  NP++WTK A+IIFVD PVGTGYSYS T + Y+
Sbjct  107  AFSGLIFEIGPLTFDFESYQGGVPTLNYNPHSWTKEASIIFVDSPVGTGYSYSNTFEGYH  166



>ref|XP_011466202.1| PREDICTED: serine carboxypeptidase-like 2 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=532

 Score =   163 bits (413),  Expect = 2e-44, Method: Composition-based stats.
 Identities = 70/114 (61%), Positives = 86/114 (75%), Gaps = 0/114 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            ++V++LPGFP  LPF L TGYIGV E  ++QLFYYF+ESE++P  DPLLLWLTGGP CS 
Sbjct  38   SIVKSLPGFPGSLPFHLETGYIGVDEKDDVQLFYYFVESERNPRDDPLLLWLTGGPTCSA  97

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSET  443
            LS   FEIGP+  N     G +P   LNPY+WTKV++IIFVD PVGTG+SY  +
Sbjct  98   LSGLAFEIGPIKFNMVEYNGSLPTFVLNPYSWTKVSSIIFVDAPVGTGFSYPRS  151



>ref|XP_011458874.1| PREDICTED: serine carboxypeptidase-like 18 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=448

 Score =   162 bits (410),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 73/117 (62%), Positives = 93/117 (79%), Gaps = 0/117 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            ++V+ LPG    LPF+L TGY+GVGES+E+QLFYYF++SE++PE DPL+LWLTGGPGCS 
Sbjct  34   SLVKFLPGLQGPLPFELETGYVGVGESEELQLFYYFVKSERNPEKDPLMLWLTGGPGCSA  93

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDA  452
            +SA FFEIGPL        G +P L LNP++WTKV +IIF+D PVGTG+SY+ TS A
Sbjct  94   VSALFFEIGPLNFKVEQYNGSLPTLVLNPHSWTKVCSIIFIDSPVGTGFSYARTSFA  150



>gb|KDP35358.1| hypothetical protein JCGZ_10342 [Jatropha curcas]
Length=485

 Score =   162 bits (411),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/117 (64%), Positives = 90/117 (77%), Gaps = 0/117 (0%)
 Frame = +3

Query  105  VVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGL  284
            VV  LPGF   LPF L TGYIGVG S E QLFYYF+ES++SP  DPL+LWLTGGPGCS L
Sbjct  41   VVTNLPGFDGDLPFYLETGYIGVGASNESQLFYYFVESQRSPTLDPLMLWLTGGPGCSVL  100

Query  285  SAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAY  455
            SAFF+E GP+  +Y+N  G +P L LNP+AWT+  NII+VD P+GTG+SYS T + Y
Sbjct  101  SAFFYESGPVAFDYSNYNGSLPSLHLNPFAWTQGINIIYVDAPIGTGFSYSTTQENY  157



>ref|XP_004292764.2| PREDICTED: serine carboxypeptidase-like 7 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=476

 Score =   162 bits (410),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 73/117 (62%), Positives = 93/117 (79%), Gaps = 0/117 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            ++V+ LPG    LPF+L TGY+GVGES+E+QLFYYF++SE++PE DPL+LWLTGGPGCS 
Sbjct  34   SLVKFLPGLQGPLPFELETGYVGVGESEELQLFYYFVKSERNPEKDPLMLWLTGGPGCSA  93

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDA  452
            +SA FFEIGPL        G +P L LNP++WTKV +IIF+D PVGTG+SY+ TS A
Sbjct  94   VSALFFEIGPLNFKVEQYNGSLPTLVLNPHSWTKVCSIIFIDSPVGTGFSYARTSFA  150



>ref|XP_002522137.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF40337.1| serine carboxypeptidase, putative [Ricinus communis]
Length=479

 Score =   162 bits (411),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 73/117 (62%), Positives = 91/117 (78%), Gaps = 0/117 (0%)
 Frame = +3

Query  105  VVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGL  284
            +VE+LPG+  KLPFKL TGY+GVGE +E+QLFYYFIESE+ P  DPLLLWLTGGPGCS  
Sbjct  36   IVESLPGYKGKLPFKLETGYVGVGELEELQLFYYFIESERDPVRDPLLLWLTGGPGCSAF  95

Query  285  SAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAY  455
            S   +EIGPL  +Y    G +P L  N ++WTK+ANIIF+D PVGTG+SYS++ + Y
Sbjct  96   SGLVYEIGPLNYDYDAFNGSLPSLVANEFSWTKIANIIFLDAPVGTGFSYSKSQEGY  152



>gb|KCW55082.1| hypothetical protein EUGRSUZ_I01044 [Eucalyptus grandis]
Length=415

 Score =   161 bits (407),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 74/117 (63%), Positives = 91/117 (78%), Gaps = 0/117 (0%)
 Frame = +3

Query  105  VVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGL  284
            +VE LPG+  +LPFKL TGY+ VG+  EI+LFYYFIESE++P  DPLLLWLTGGPGCSG 
Sbjct  40   IVEYLPGYSGRLPFKLETGYVSVGDIDEIELFYYFIESERNPVKDPLLLWLTGGPGCSGF  99

Query  285  SAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAY  455
            S   FEIGPLT +YA+  G  P L  NP +WT++ANIIF+D PVGTG++YS T + Y
Sbjct  100  SGLVFEIGPLTFDYASFNGSSPTLLSNPESWTQIANIIFLDAPVGTGFAYSTTQEGY  156



>ref|XP_009614133.1| PREDICTED: serine carboxypeptidase-like 18 isoform X2 [Nicotiana 
tomentosiformis]
Length=451

 Score =   162 bits (409),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  159  GYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGLSAFFFEIGPLTINYANST  338
             Y+GVGE +++QL+YYF+ESE+ PE DPL+LWLTGGPGCSGLS+F +EIGPLT +YANS 
Sbjct  27   NYVGVGEEEKVQLYYYFVESERDPENDPLMLWLTGGPGCSGLSSFVYEIGPLTFDYANSI  86

Query  339  GDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            GD P LEL   +WTKVANIIF+DQP G+GYSY++TS+AYN
Sbjct  87   GDFPKLELKSNSWTKVANIIFIDQPAGSGYSYAKTSEAYN  126



>ref|XP_009365383.1| PREDICTED: serine carboxypeptidase-like 13 [Pyrus x bretschneideri]
Length=473

 Score =   162 bits (409),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 91/116 (78%), Gaps = 0/116 (0%)
 Frame = +3

Query  105  VVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGL  284
            +V+ LPGF   LPF+L TGY+GVGE +E+QLFYYF+++E+ PE DPL+LWLTGGPGCS L
Sbjct  43   LVKFLPGFQGPLPFELETGYVGVGEEEEVQLFYYFVKTERKPEEDPLMLWLTGGPGCSSL  102

Query  285  SAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDA  452
            +A  +EIGPL  N     G +P L LNPYAWTKV++IIFVD PVGTG+SY+  S A
Sbjct  103  TALLYEIGPLNFNIEQYNGSLPTLTLNPYAWTKVSSIIFVDSPVGTGFSYARGSFA  158



>ref|XP_003556796.2| PREDICTED: serine carboxypeptidase-like 17-like isoform X1 [Glycine 
max]
Length=373

 Score =   160 bits (404),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 73/117 (62%), Positives = 91/117 (78%), Gaps = 1/117 (1%)
 Frame = +3

Query  105  VVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGL  284
            +V+ LPGF   LPF L+TGYIGVG+ +E+QL+YYF+ES++SP  DPLLLWL GGPGCS  
Sbjct  27   IVKNLPGF-GDLPFTLNTGYIGVGQREEVQLYYYFVESQRSPLNDPLLLWLVGGPGCSAH  85

Query  285  SAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAY  455
            SAFF+E GPL  N+ +  G  P L LNP+ WTKV NI++VD PVGTGYSYS+T + Y
Sbjct  86   SAFFYENGPLMFNFHDFNGSFPQLLLNPHTWTKVLNILYVDAPVGTGYSYSKTQEGY  142



>ref|XP_004513964.1| PREDICTED: serine carboxypeptidase-like 18-like isoform X1 [Cicer 
arietinum]
Length=487

 Score =   162 bits (409),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 95/118 (81%), Gaps = 1/118 (1%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            ++V+ LPGF   LPFKL TGYIGVGE  ++Q+FYYF+ES+++P  DP+LLW  GGPGCSG
Sbjct  59   SIVKNLPGFDGDLPFKLETGYIGVGEGAKVQIFYYFVESQRNPFIDPILLWFVGGPGCSG  118

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAY  455
            LSAFFFE GPL ++  N + ++P L+LNPYAWT + N+I++D PVGTG+SYSET + Y
Sbjct  119  LSAFFFENGPLKMD-PNYSENLPKLKLNPYAWTHMLNMIYIDMPVGTGFSYSETQEGY  175



>emb|CBI19380.3| unnamed protein product [Vitis vinifera]
Length=503

 Score =   162 bits (410),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 93/118 (79%), Gaps = 0/118 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
            H+ V+ LPGF   LPF+L TGY+GVGES+E+QLFYYF++SE +P  DPLLLWLTGGPGCS
Sbjct  62   HSPVKFLPGFEGPLPFELETGYVGVGESEEVQLFYYFVKSENNPTEDPLLLWLTGGPGCS  121

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDA  452
              SA F+EIGPL        G +P LELNP++WT+V+NIIF+D PVGTG+SY+ TS A
Sbjct  122  AFSALFYEIGPLYFESVPYHGSLPTLELNPHSWTQVSNIIFLDAPVGTGFSYATTSRA  179



>ref|XP_002283413.1| PREDICTED: serine carboxypeptidase-like 2 [Vitis vinifera]
Length=469

 Score =   161 bits (408),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 93/118 (79%), Gaps = 0/118 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
            H+ V+ LPGF   LPF+L TGY+GVGES+E+QLFYYF++SE +P  DPLLLWLTGGPGCS
Sbjct  28   HSPVKFLPGFEGPLPFELETGYVGVGESEEVQLFYYFVKSENNPTEDPLLLWLTGGPGCS  87

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDA  452
              SA F+EIGPL        G +P LELNP++WT+V+NIIF+D PVGTG+SY+ TS A
Sbjct  88   AFSALFYEIGPLYFESVPYHGSLPTLELNPHSWTQVSNIIFLDAPVGTGFSYATTSRA  145



>ref|XP_010028338.1| PREDICTED: serine carboxypeptidase-like 13 [Eucalyptus grandis]
 gb|KCW55061.1| hypothetical protein EUGRSUZ_I01037 [Eucalyptus grandis]
Length=473

 Score =   161 bits (408),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 88/115 (77%), Gaps = 0/115 (0%)
 Frame = +3

Query  105  VVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGL  284
            ++ETLPGFP KLPF L TGYIGV E  ++QLFYYFIES++ P  DPL+ W+TGGPGCSG 
Sbjct  28   IIETLPGFPGKLPFTLETGYIGVNEIDDVQLFYYFIESQRDPANDPLVFWMTGGPGCSGF  87

Query  285  SAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSD  449
            SA  FEIGPLT +Y    G +P L +N Y+WT+ ANIIF+D PVG G+SY+ T +
Sbjct  88   SALAFEIGPLTFDYGTYNGTLPSLLINKYSWTQAANIIFIDAPVGAGFSYATTEE  142



>gb|KDO81469.1| hypothetical protein CISIN_1g012276mg [Citrus sinensis]
Length=348

 Score =   159 bits (402),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 90/118 (76%), Gaps = 0/118 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
            H+ V+ LPGF   LPF+L TGY+GVGES+E QLFYYF++S+K+P+ DPLLLWLTGGPGCS
Sbjct  24   HSTVKFLPGFQGPLPFELETGYVGVGESEEAQLFYYFVKSDKNPKEDPLLLWLTGGPGCS  83

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDA  452
              S   +EIGP+  N     G +P L LNPY+WTK A+I+FVD PVGTG+SY+ T  A
Sbjct  84   AFSGLAYEIGPVNFNTVEYNGSLPTLRLNPYSWTKEASILFVDSPVGTGFSYARTPHA  141



>gb|KDP44530.1| hypothetical protein JCGZ_16363 [Jatropha curcas]
Length=467

 Score =   161 bits (408),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 71/120 (59%), Positives = 92/120 (77%), Gaps = 0/120 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
             ++++ LPGF   LPF L TGY+GVG ++E+QLFYYF+ESE++P+ DPL+LW T GPGCS
Sbjct  24   QSIIKNLPGFDGDLPFNLETGYVGVGYNEEVQLFYYFVESERNPKDDPLVLWFTAGPGCS  83

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
             LSA  ++ GPL  NYAN T   P L LNP++WTKVANII++D PVGTG+SY+ T   YN
Sbjct  84   SLSAILYQHGPLHFNYANPTSSKPTLVLNPHSWTKVANIIYLDAPVGTGFSYATTWRGYN  143



>ref|XP_008236347.1| PREDICTED: serine carboxypeptidase-like 13 [Prunus mume]
Length=536

 Score =   162 bits (410),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 96/119 (81%), Gaps = 1/119 (1%)
 Frame = +3

Query  105  VVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGL  284
            +++TLPGF   LPFKL TGY+GVG   ++QLFYYF ESE SPE DPL+LWLTGGPGCSG 
Sbjct  32   IIKTLPGFRGDLPFKLETGYVGVGGMDDVQLFYYFFESEGSPEYDPLVLWLTGGPGCSGF  91

Query  285  SAFFFE-IGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            S   +E +GPL+ +YA+S G+ P L+LNPY+WTKVAN+IF+D PVGTG+SY++  + Y+
Sbjct  92   SGIVYENLGPLSFDYAHSIGNKPKLKLNPYSWTKVANVIFLDAPVGTGFSYAKNWEGYS  150



>ref|XP_006422770.1| hypothetical protein CICLE_v10028371mg [Citrus clementina]
 gb|ESR36010.1| hypothetical protein CICLE_v10028371mg [Citrus clementina]
Length=468

 Score =   161 bits (407),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 89/112 (79%), Gaps = 0/112 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
              ++ TLPGF   LPFKL TGYIGVGE+  +QLFYYFIESE+SPE DPL+LWL+GGPGCS
Sbjct  21   RQIITTLPGFDGDLPFKLETGYIGVGENDNVQLFYYFIESERSPEDDPLVLWLSGGPGCS  80

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSY  434
            G  A  +++GPL+ +Y NS  + P L LNPY+WTKVA+IIF+D P GTG+SY
Sbjct  81   GFWALAYQLGPLSFDYENSRENSPKLLLNPYSWTKVASIIFIDAPAGTGFSY  132



>ref|XP_008236280.1| PREDICTED: serine carboxypeptidase-like 17 isoform X1 [Prunus 
mume]
Length=476

 Score =   161 bits (407),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 89/120 (74%), Gaps = 0/120 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
              V++ LPGF   LPF+L TGY+GVG   E+QLFYYF ESE+SPE DPLLLW+TGGP CS
Sbjct  35   QTVIKNLPGFSGDLPFELETGYVGVGNKDELQLFYYFTESERSPENDPLLLWITGGPRCS  94

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
              S   +EIGP+  ++   T D  +L LNPY+WTK+ANIIF+D P GTG+SYS T+D YN
Sbjct  95   AFSGLVYEIGPIAFSFTRITKDPVELVLNPYSWTKLANIIFLDAPAGTGFSYSTTTDGYN  154



>ref|XP_008236275.1| PREDICTED: serine carboxypeptidase-like 17 isoform X1 [Prunus 
mume]
Length=461

 Score =   161 bits (407),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 91/120 (76%), Gaps = 0/120 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
              +++ LPGF   LPFKL TGY+GVG   E+QLFYYFIESE+SPE DPLLLW+TGGP CS
Sbjct  35   QTIIKNLPGFSGDLPFKLETGYVGVGNKDELQLFYYFIESERSPENDPLLLWITGGPRCS  94

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            G S   +E GP++ ++ + T    +L LNPY+WTK+ANIIF+D P GTG+SYS T+D YN
Sbjct  95   GFSGLVYENGPISFSFTSITKHPVELVLNPYSWTKLANIIFLDAPAGTGFSYSTTTDGYN  154



>ref|XP_008236281.1| PREDICTED: serine carboxypeptidase-like 17 isoform X2 [Prunus 
mume]
Length=472

 Score =   161 bits (407),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 89/120 (74%), Gaps = 0/120 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
              V++ LPGF   LPF+L TGY+GVG   E+QLFYYF ESE+SPE DPLLLW+TGGP CS
Sbjct  35   QTVIKNLPGFSGDLPFELETGYVGVGNKDELQLFYYFTESERSPENDPLLLWITGGPRCS  94

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
              S   +EIGP+  ++   T D  +L LNPY+WTK+ANIIF+D P GTG+SYS T+D YN
Sbjct  95   AFSGLVYEIGPIAFSFTRITKDPVELVLNPYSWTKLANIIFLDAPAGTGFSYSTTTDGYN  154



>ref|XP_004296446.1| PREDICTED: serine carboxypeptidase-like 18 [Fragaria vesca subsp. 
vesca]
Length=475

 Score =   161 bits (407),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 89/119 (75%), Gaps = 0/119 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
              +V +LPGF   LPF L TGY+GVG+S   QLFYYF+ES++SP  DPL+LW TGGPGCS
Sbjct  34   QTIVTSLPGFEGDLPFTLETGYVGVGDSNTSQLFYYFVESQRSPAEDPLMLWFTGGPGCS  93

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAY  455
             LSAFF+E GPL+  Y +  G +P L LNPYAWT+  NII+VD PVGTG+SYS T + Y
Sbjct  94   VLSAFFYESGPLSFTYVDYNGSLPSLHLNPYAWTQGLNIIYVDSPVGTGFSYSTTQEGY  152



>ref|XP_010028347.1| PREDICTED: serine carboxypeptidase-like 18 [Eucalyptus grandis]
 gb|KCW55081.1| hypothetical protein EUGRSUZ_I01044 [Eucalyptus grandis]
Length=487

 Score =   161 bits (407),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 74/117 (63%), Positives = 91/117 (78%), Gaps = 0/117 (0%)
 Frame = +3

Query  105  VVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGL  284
            +VE LPG+  +LPFKL TGY+ VG+  EI+LFYYFIESE++P  DPLLLWLTGGPGCSG 
Sbjct  40   IVEYLPGYSGRLPFKLETGYVSVGDIDEIELFYYFIESERNPVKDPLLLWLTGGPGCSGF  99

Query  285  SAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAY  455
            S   FEIGPLT +YA+  G  P L  NP +WT++ANIIF+D PVGTG++YS T + Y
Sbjct  100  SGLVFEIGPLTFDYASFNGSSPTLLSNPESWTQIANIIFLDAPVGTGFAYSTTQEGY  156



>ref|XP_007199818.1| hypothetical protein PRUPE_ppa005264mg [Prunus persica]
 gb|EMJ01017.1| hypothetical protein PRUPE_ppa005264mg [Prunus persica]
Length=451

 Score =   160 bits (405),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 73/118 (62%), Positives = 93/118 (79%), Gaps = 1/118 (1%)
 Frame = +3

Query  105  VVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGL  284
            +++TLPGF   LPFKL TGY+GVG   ++QLFYYF ESE SPE DPL+LWL GGPGCS  
Sbjct  22   IIKTLPGFRGDLPFKLETGYVGVGSMDDVQLFYYFFESEGSPEYDPLVLWLNGGPGCSAF  81

Query  285  SAFFFE-IGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAY  455
            S   +E +GPL+ +YA+S G+ P L+LNPY+WTKVANIIF+D PVGTG+SY++  + Y
Sbjct  82   SGLVYENLGPLSFDYAHSIGNKPKLKLNPYSWTKVANIIFLDAPVGTGFSYAKNWEGY  139



>ref|XP_007199854.1| hypothetical protein PRUPE_ppa005665mg [Prunus persica]
 gb|EMJ01053.1| hypothetical protein PRUPE_ppa005665mg [Prunus persica]
Length=449

 Score =   160 bits (405),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 75/117 (64%), Positives = 94/117 (80%), Gaps = 1/117 (1%)
 Frame = +3

Query  108  VETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGLS  287
            ++TLPGF   LPFKL TGY+GVG   ++QLFYYF ESE SPE DPL+LWLTGGPGCS  S
Sbjct  23   IKTLPGFGGDLPFKLETGYVGVGGMDDVQLFYYFFESEGSPEYDPLVLWLTGGPGCSAFS  82

Query  288  AFFFE-IGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAY  455
            A  +E +GPL+ +YA+S G+ P L+LNPY+WTKVANIIF+D PVGTG+SY++  + Y
Sbjct  83   AIVYENLGPLSFDYAHSIGNKPKLKLNPYSWTKVANIIFLDAPVGTGFSYAKNWEGY  139



>ref|XP_007199819.1| hypothetical protein PRUPE_ppa005264mg [Prunus persica]
 gb|EMJ01018.1| hypothetical protein PRUPE_ppa005264mg [Prunus persica]
Length=470

 Score =   160 bits (405),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 94/119 (79%), Gaps = 1/119 (1%)
 Frame = +3

Query  105  VVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGL  284
            +++TLPGF   LPFKL TGY+GVG   ++QLFYYF ESE SPE DPL+LWL GGPGCS  
Sbjct  22   IIKTLPGFRGDLPFKLETGYVGVGSMDDVQLFYYFFESEGSPEYDPLVLWLNGGPGCSAF  81

Query  285  SAFFFE-IGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            S   +E +GPL+ +YA+S G+ P L+LNPY+WTKVANIIF+D PVGTG+SY++  + Y+
Sbjct  82   SGLVYENLGPLSFDYAHSIGNKPKLKLNPYSWTKVANIIFLDAPVGTGFSYAKNWEGYS  140



>ref|XP_006472320.1| PREDICTED: serine carboxypeptidase-like 18-like isoform X1 [Citrus 
sinensis]
 ref|XP_006472321.1| PREDICTED: serine carboxypeptidase-like 18-like isoform X2 [Citrus 
sinensis]
Length=467

 Score =   160 bits (404),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/118 (62%), Positives = 90/118 (76%), Gaps = 0/118 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
            H+ V+ LPGF   LPF+L TGY+GVGES+E QLFYYF++SEK+P+ DPLLLWLTGGPGCS
Sbjct  24   HSTVKFLPGFQGPLPFELETGYVGVGESEEAQLFYYFVKSEKNPKEDPLLLWLTGGPGCS  83

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDA  452
              S   +EIGP+  N     G +P L LNPY+WTK A+I+FVD PVGTG+SY+ T  A
Sbjct  84   AFSGLAYEIGPVNFNTVEYNGSLPTLRLNPYSWTKEASILFVDSPVGTGFSYARTPHA  141



>ref|XP_011069855.1| PREDICTED: serine carboxypeptidase-like 18 isoform X1 [Sesamum 
indicum]
Length=481

 Score =   160 bits (405),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 89/113 (79%), Gaps = 0/113 (0%)
 Frame = +3

Query  105  VVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGL  284
            +VE+LPG P KLP K  TGYIGVGE++E QLFY+F+ESE +PE DP + WLTGGPGC+GL
Sbjct  27   LVESLPGLPDKLPNKFETGYIGVGENEEAQLFYFFLESESNPEKDPFVFWLTGGPGCAGL  86

Query  285  SAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSET  443
            S    E+G   ++YAN  GD   L+LN YAWTK ANI+F+DQPVGTG+SY++T
Sbjct  87   STILLEMGTFMLDYANCKGDSVALKLNEYAWTKAANILFIDQPVGTGFSYAKT  139



>ref|XP_011069856.1| PREDICTED: serine carboxypeptidase-like 18 isoform X2 [Sesamum 
indicum]
Length=477

 Score =   160 bits (404),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 89/113 (79%), Gaps = 0/113 (0%)
 Frame = +3

Query  105  VVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGL  284
            +VE+LPG P KLP K  TGYIGVGE++E QLFY+F+ESE +PE DP + WLTGGPGC+GL
Sbjct  27   LVESLPGLPDKLPNKFETGYIGVGENEEAQLFYFFLESESNPEKDPFVFWLTGGPGCAGL  86

Query  285  SAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSET  443
            S    E+G   ++YAN  GD   L+LN YAWTK ANI+F+DQPVGTG+SY++T
Sbjct  87   STILLEMGTFMLDYANCKGDSVALKLNEYAWTKAANILFIDQPVGTGFSYAKT  139



>ref|XP_008236285.1| PREDICTED: serine carboxypeptidase-like 2 isoform X1 [Prunus 
mume]
Length=472

 Score =   159 bits (402),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 94/118 (80%), Gaps = 1/118 (1%)
 Frame = +3

Query  105  VVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGL  284
            +++TLPGF   LPFKL TGY+GVG   ++QLFYYF ESE SPE DPL+LWLTGGPGCS  
Sbjct  23   IIKTLPGFRGDLPFKLETGYVGVGGMDDVQLFYYFFESEGSPEYDPLVLWLTGGPGCSAF  82

Query  285  SAFFFE-IGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAY  455
            SA  +E +GPL+ + A+S G+ P L+LNPY+WTKVANIIF+D PVGTG+SY++  + Y
Sbjct  83   SAIVYENLGPLSFDSAHSIGNKPKLKLNPYSWTKVANIIFLDAPVGTGFSYAKNWEGY  140



>gb|KJB73513.1| hypothetical protein B456_011G236800 [Gossypium raimondii]
Length=347

 Score =   157 bits (396),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 85/112 (76%), Gaps = 3/112 (3%)
 Frame = +3

Query  108  VETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGLS  287
            + +LPGF A LPFKL TGYIGVG+   ++ FYYFI+SE+ P  DPL+LWLTGGPGCS LS
Sbjct  30   IRSLPGFSASLPFKLETGYIGVGD---VEFFYYFIQSERDPSKDPLILWLTGGPGCSALS  86

Query  288  AFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSET  443
              FFEIGPL  N     G +P   LNPY+WTKVANIIF+D PVGTG+SYS T
Sbjct  87   GLFFEIGPLQFNMVEYNGSLPTFVLNPYSWTKVANIIFLDAPVGTGFSYSTT  138



>ref|XP_008236286.1| PREDICTED: serine carboxypeptidase-like 2 isoform X2 [Prunus 
mume]
Length=470

 Score =   159 bits (402),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 94/118 (80%), Gaps = 1/118 (1%)
 Frame = +3

Query  105  VVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGL  284
            +++TLPGF   LPFKL TGY+GVG   ++QLFYYF ESE SPE DPL+LWLTGGPGCS  
Sbjct  23   IIKTLPGFRGDLPFKLETGYVGVGGMDDVQLFYYFFESEGSPEYDPLVLWLTGGPGCSAF  82

Query  285  SAFFFE-IGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAY  455
            SA  +E +GPL+ + A+S G+ P L+LNPY+WTKVANIIF+D PVGTG+SY++  + Y
Sbjct  83   SAIVYENLGPLSFDSAHSIGNKPKLKLNPYSWTKVANIIFLDAPVGTGFSYAKNWEGY  140



>ref|XP_002525293.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF37121.1| serine carboxypeptidase, putative [Ricinus communis]
Length=596

 Score =   160 bits (405),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 70/114 (61%), Positives = 89/114 (78%), Gaps = 0/114 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            +++ TLPGF   +PFKL TGYIGV E +++QLFYYFIESE++   DPL+LWLTGGPGCS 
Sbjct  40   SIIRTLPGFSGSVPFKLETGYIGVDEKEDVQLFYYFIESERNAREDPLVLWLTGGPGCSA  99

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSET  443
            LS   FEIGPL  N     G +P L+LNPY+WTKV+++IF+D PVGTG+SYS +
Sbjct  100  LSGLAFEIGPLLFNMVEYNGSLPTLKLNPYSWTKVSSVIFLDAPVGTGFSYSRS  153



>ref|XP_006433655.1| hypothetical protein CICLE_v10001060mg [Citrus clementina]
 gb|ESR46895.1| hypothetical protein CICLE_v10001060mg [Citrus clementina]
Length=467

 Score =   159 bits (401),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 90/118 (76%), Gaps = 0/118 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
            H+ V+ LPGF   LPF+L TGY+GVGES+E QLFYYF++S+K+P+ DPLLLWLTGGPGCS
Sbjct  24   HSTVKFLPGFQGPLPFELETGYVGVGESEEAQLFYYFVKSDKNPKEDPLLLWLTGGPGCS  83

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDA  452
              S   +EIGP+  N     G +P L LNPY+WTK A+I+FVD PVGTG+SY+ T  A
Sbjct  84   AFSGLAYEIGPVNFNTVEYNGSLPTLRLNPYSWTKEASILFVDSPVGTGFSYARTPHA  141



>ref|XP_009761854.1| PREDICTED: serine carboxypeptidase-like 18 [Nicotiana sylvestris]
Length=429

 Score =   158 bits (399),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 92/115 (80%), Gaps = 0/115 (0%)
 Frame = +3

Query  108  VETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGLS  287
            V+ LPGF   LPF+L TGYIGVG+S+++QLFYYFI+SE +PE+DPLLLW+TGGPGCS LS
Sbjct  29   VKLLPGFKGPLPFELETGYIGVGDSEDVQLFYYFIKSESNPESDPLLLWITGGPGCSALS  88

Query  288  AFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDA  452
               ++IGP+T       G +P ++LNPY+WTKVA+IIF+D PVGTG+SY+ T  A
Sbjct  89   GLIYDIGPITFEPVEYNGSVPTMKLNPYSWTKVASIIFLDLPVGTGFSYARTPAA  143



>gb|KDO81468.1| hypothetical protein CISIN_1g012276mg [Citrus sinensis]
Length=467

 Score =   159 bits (401),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 90/118 (76%), Gaps = 0/118 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
            H+ V+ LPGF   LPF+L TGY+GVGES+E QLFYYF++S+K+P+ DPLLLWLTGGPGCS
Sbjct  24   HSTVKFLPGFQGPLPFELETGYVGVGESEEAQLFYYFVKSDKNPKEDPLLLWLTGGPGCS  83

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDA  452
              S   +EIGP+  N     G +P L LNPY+WTK A+I+FVD PVGTG+SY+ T  A
Sbjct  84   AFSGLAYEIGPVNFNTVEYNGSLPTLRLNPYSWTKEASILFVDSPVGTGFSYARTPHA  141



>ref|XP_007201023.1| hypothetical protein PRUPE_ppa005420mg [Prunus persica]
 gb|EMJ02222.1| hypothetical protein PRUPE_ppa005420mg [Prunus persica]
Length=462

 Score =   159 bits (401),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 71/120 (59%), Positives = 90/120 (75%), Gaps = 0/120 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
              +++ LPGF   LPFKL TGY+GVG   E+QLFYYFIESE+SPE DPLLLW+TGGP CS
Sbjct  35   QTIIKNLPGFSGDLPFKLETGYVGVGNKDELQLFYYFIESERSPENDPLLLWITGGPRCS  94

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
              S   +E GP++ ++ + T    +L LNPY+WTK+ANIIF+D P GTG+SYS T+D YN
Sbjct  95   SFSGLVYENGPISFSFTSITKHPVELVLNPYSWTKLANIIFLDAPAGTGFSYSTTTDGYN  154



>gb|KFK27798.1| hypothetical protein AALP_AA8G430800 [Arabis alpina]
Length=1250

 Score =   163 bits (412),  Expect = 5e-43, Method: Composition-based stats.
 Identities = 69/114 (61%), Positives = 90/114 (79%), Gaps = 0/114 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            ++V+ LPGF   LPF+L TGYIGVGE +E+QLFYYFI+SE +P+ DPLL+W+TGGPGCS 
Sbjct  22   SIVKFLPGFEGPLPFELETGYIGVGEEEELQLFYYFIKSENNPQEDPLLIWMTGGPGCSS  81

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSET  443
            ++ F +EIGPLTI      G+IP L    Y+WTK+ANI+F+DQPVG+G+SY  T
Sbjct  82   VNGFLYEIGPLTIKIEAYDGNIPSLVPTTYSWTKLANILFLDQPVGSGFSYKRT  135



>gb|KFK27800.1| hypothetical protein AALP_AA8G430800 [Arabis alpina]
Length=1257

 Score =   163 bits (412),  Expect = 6e-43, Method: Composition-based stats.
 Identities = 69/114 (61%), Positives = 90/114 (79%), Gaps = 0/114 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            ++V+ LPGF   LPF+L TGYIGVGE +E+QLFYYFI+SE +P+ DPLL+W+TGGPGCS 
Sbjct  22   SIVKFLPGFEGPLPFELETGYIGVGEEEELQLFYYFIKSENNPQEDPLLIWMTGGPGCSS  81

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSET  443
            ++ F +EIGPLTI      G+IP L    Y+WTK+ANI+F+DQPVG+G+SY  T
Sbjct  82   VNGFLYEIGPLTIKIEAYDGNIPSLVPTTYSWTKLANILFLDQPVGSGFSYKRT  135



>ref|XP_007200276.1| hypothetical protein PRUPE_ppa014806mg [Prunus persica]
 gb|EMJ01475.1| hypothetical protein PRUPE_ppa014806mg [Prunus persica]
Length=392

 Score =   157 bits (397),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 92/118 (78%), Gaps = 1/118 (1%)
 Frame = +3

Query  105  VVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGL  284
            +++TLPGF   LPFKL TGY+GVG   ++QLFYYF ESE SPE DPL+LWL GG GCS  
Sbjct  11   IIKTLPGFGGDLPFKLETGYVGVGAMDDVQLFYYFFESEGSPEYDPLVLWLNGGSGCSTF  70

Query  285  SAFFFE-IGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAY  455
            S F +E +GPL+ +Y NS G+ P L+LNPY+WTKVANIIFVD+PVGTG+SY+ +   Y
Sbjct  71   SDFVYENLGPLSFDYLNSIGNKPKLKLNPYSWTKVANIIFVDEPVGTGFSYANSWVGY  128



>ref|XP_011069858.1| PREDICTED: serine carboxypeptidase-like 18 [Sesamum indicum]
Length=481

 Score =   159 bits (401),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 71/117 (61%), Positives = 91/117 (78%), Gaps = 0/117 (0%)
 Frame = +3

Query  105  VVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGL  284
            +VE+LPG P KLP K  TGYIGVG ++E+QLFY+F ESE +PE DPLLLW+TGGPGC+GL
Sbjct  27   LVESLPGLPDKLPNKFETGYIGVGVNEEVQLFYFFFESESNPEKDPLLLWMTGGPGCTGL  86

Query  285  SAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAY  455
            S    E+G   ++YANS G    L+LN YAWTK ANI+F+DQP GTG+SY++T + +
Sbjct  87   STILLEMGTFMLDYANSKGGSVALKLNEYAWTKAANILFIDQPAGTGFSYAKTLEGF  143



>gb|KFK27799.1| hypothetical protein AALP_AA8G430800 [Arabis alpina]
Length=1234

 Score =   163 bits (412),  Expect = 6e-43, Method: Composition-based stats.
 Identities = 69/114 (61%), Positives = 90/114 (79%), Gaps = 0/114 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            ++V+ LPGF   LPF+L TGYIGVGE +E+QLFYYFI+SE +P+ DPLL+W+TGGPGCS 
Sbjct  22   SIVKFLPGFEGPLPFELETGYIGVGEEEELQLFYYFIKSENNPQEDPLLIWMTGGPGCSS  81

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSET  443
            ++ F +EIGPLTI      G+IP L    Y+WTK+ANI+F+DQPVG+G+SY  T
Sbjct  82   VNGFLYEIGPLTIKIEAYDGNIPSLVPTTYSWTKLANILFLDQPVGSGFSYKRT  135



>emb|CDY52618.1| BnaCnng22970D [Brassica napus]
Length=439

 Score =   158 bits (399),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 88/115 (77%), Gaps = 0/115 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
             + V  LPGF   LPF+L TGYIGVGE++E QLFYYFI+SE++PE DPLL+WL+GGPGCS
Sbjct  25   RSTVRYLPGFQGPLPFELETGYIGVGEAEEDQLFYYFIKSERNPEEDPLLIWLSGGPGCS  84

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSET  443
             LS   FE GPL+ N  +  GDIP L    Y+WTKVANII++DQPVGTG+SYS  
Sbjct  85   SLSGLLFENGPLSFNIESDNGDIPSLVSTTYSWTKVANIIYLDQPVGTGFSYSRN  139



>ref|XP_011466208.1| PREDICTED: serine carboxypeptidase-like 18 isoform X3 [Fragaria 
vesca subsp. vesca]
Length=445

 Score =   158 bits (399),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 70/114 (61%), Positives = 86/114 (75%), Gaps = 0/114 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            ++V++LPGFP  LPF L TGYIGV E  ++QLFYYF+ESE++P  DPLLLWLTGGP CS 
Sbjct  38   SIVKSLPGFPGSLPFHLETGYIGVDEKDDVQLFYYFVESERNPRDDPLLLWLTGGPTCSA  97

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSET  443
            LS   FEIGP+  N     G +P   LNPY+WTKV++IIFVD PVGTG+SY  +
Sbjct  98   LSGLAFEIGPIKFNMVEYNGSLPTFVLNPYSWTKVSSIIFVDAPVGTGFSYPRS  151



>ref|XP_008236344.1| PREDICTED: serine carboxypeptidase-like 13 [Prunus mume]
Length=509

 Score =   159 bits (401),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 73/118 (62%), Positives = 93/118 (79%), Gaps = 1/118 (1%)
 Frame = +3

Query  105  VVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGL  284
            +++TLPGF   LPFKL TGY+GVG   ++QLFYYF ESE SPE DPL+LWLTGGPGCS  
Sbjct  23   IIKTLPGFRGDLPFKLETGYVGVGGMDDVQLFYYFFESEGSPEYDPLVLWLTGGPGCSAF  82

Query  285  SAFFFE-IGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAY  455
            SA  +E +GP + + A+S G+ P L+LNPY+WTKVANIIF+D PVGTG+SY++  + Y
Sbjct  83   SALVYENLGPFSFDSAHSIGNKPKLKLNPYSWTKVANIIFLDAPVGTGFSYTKNWEGY  140



>gb|KCW80986.1| hypothetical protein EUGRSUZ_C02352 [Eucalyptus grandis]
Length=496

 Score =   158 bits (400),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 73/117 (62%), Positives = 88/117 (75%), Gaps = 0/117 (0%)
 Frame = +3

Query  105  VVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGL  284
            VV+ LPG+   LPF L TGYIGVGES E QLFYYF+ES+++P  DPL+LWLTGGPGCS L
Sbjct  53   VVKNLPGYDGDLPFYLETGYIGVGESNESQLFYYFVESQRTPSQDPLMLWLTGGPGCSVL  112

Query  285  SAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAY  455
            SAF +E GPL   Y    G IP L  NPYAWT+  N++FVD P+GTG+SYS T++ Y
Sbjct  113  SAFLYEGGPLAFTYEGYNGSIPSLHQNPYAWTQGLNMLFVDAPIGTGFSYSTTAENY  169



>gb|KEH33547.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=454

 Score =   157 bits (398),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 94/118 (80%), Gaps = 1/118 (1%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            ++V+ LPGF  +LPFKL TGYIGVGE  ++Q+FYYF+ES+++P  DP+LLW  GGPGCS 
Sbjct  25   SIVKNLPGFDGELPFKLETGYIGVGEGAKVQMFYYFVESQRNPFVDPILLWFVGGPGCSA  84

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAY  455
            LSAFFFE GPLT+   + +G +P L+LNPY WT + N++++D PVGTG+SYSET + Y
Sbjct  85   LSAFFFENGPLTME-DDYSGILPKLKLNPYGWTHMLNMMYIDIPVGTGFSYSETQEGY  141



>gb|KHG24307.1| Serine carboxypeptidase-like 18 [Gossypium arboreum]
Length=446

 Score =   157 bits (398),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 85/112 (76%), Gaps = 3/112 (3%)
 Frame = +3

Query  108  VETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGLS  287
            + +LPGF A LPFKL TGYIGVG+   ++ FYYFI+SE+ P  DPL+LWLTGGPGCS LS
Sbjct  12   IRSLPGFSASLPFKLETGYIGVGD---LEFFYYFIQSERDPSKDPLILWLTGGPGCSALS  68

Query  288  AFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSET  443
              FFEIGPL  N     G +P   LNPY+WTKVANIIF+D PVGTG+SYS T
Sbjct  69   GLFFEIGPLQFNMVEHNGSLPTFALNPYSWTKVANIIFLDAPVGTGFSYSTT  120



>ref|XP_006401829.1| hypothetical protein EUTSA_v10013495mg [Eutrema salsugineum]
 gb|ESQ43282.1| hypothetical protein EUTSA_v10013495mg [Eutrema salsugineum]
Length=457

 Score =   157 bits (398),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 72/114 (63%), Positives = 90/114 (79%), Gaps = 0/114 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
             ++ +LPGF   LPF+L TGYIGVGE +EIQLFYYFI+SE++PE DPL+LWLTGGPGCS 
Sbjct  46   TIIRSLPGFEGPLPFELETGYIGVGEVEEIQLFYYFIKSERNPEEDPLVLWLTGGPGCSS  105

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSET  443
            L+A  FE GPLTI      G IP L    Y+WTK+AN+I++DQPVG+G+SYS+T
Sbjct  106  LNALLFENGPLTIKMDGYNGGIPSLVSTTYSWTKIANMIYLDQPVGSGFSYSKT  159



>ref|XP_010486652.1| PREDICTED: serine carboxypeptidase-like 7 isoform X2 [Camelina 
sativa]
Length=440

 Score =   157 bits (397),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 91/115 (79%), Gaps = 0/115 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            ++VE LPGF  +LPF+L TGYIGVGE +E+QLFYYFI+SE+ PE DP+LLWL+GGPGCS 
Sbjct  27   SIVEFLPGFDGRLPFELETGYIGVGEEEEVQLFYYFIKSERIPEEDPILLWLSGGPGCSS  86

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETS  446
            +S  F+E GP+T+      G IP L   PY+WTKV++II++DQPVGTG+SYS T 
Sbjct  87   ISGLFYENGPVTVKLEVYNGTIPSLVSTPYSWTKVSSIIYLDQPVGTGFSYSRTQ  141



>gb|KDP41601.1| hypothetical protein JCGZ_16008 [Jatropha curcas]
Length=478

 Score =   157 bits (398),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 93/120 (78%), Gaps = 0/120 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
            ++ VE LPGF  +LPF+L TGY+GV E++E+QLFYYFI+SE + + DPLLLWLTGGPGCS
Sbjct  26   YSTVEYLPGFEGELPFQLETGYVGVDEAEEVQLFYYFIKSEGNVKEDPLLLWLTGGPGCS  85

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
             LS   +EIGPLT       G +P L LNP++WTK A+IIFVD PVGTG+SY++T  AY+
Sbjct  86   ALSGLLYEIGPLTFEVVEYNGSLPKLILNPHSWTKAASIIFVDMPVGTGFSYAKTQPAYH  145



>ref|XP_010048652.1| PREDICTED: serine carboxypeptidase-like 18 [Eucalyptus grandis]
 gb|KCW80985.1| hypothetical protein EUGRSUZ_C02352 [Eucalyptus grandis]
Length=495

 Score =   158 bits (399),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 73/117 (62%), Positives = 88/117 (75%), Gaps = 0/117 (0%)
 Frame = +3

Query  105  VVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGL  284
            VV+ LPG+   LPF L TGYIGVGES E QLFYYF+ES+++P  DPL+LWLTGGPGCS L
Sbjct  53   VVKNLPGYDGDLPFYLETGYIGVGESNESQLFYYFVESQRTPSQDPLMLWLTGGPGCSVL  112

Query  285  SAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAY  455
            SAF +E GPL   Y    G IP L  NPYAWT+  N++FVD P+GTG+SYS T++ Y
Sbjct  113  SAFLYEGGPLAFTYEGYNGSIPSLHQNPYAWTQGLNMLFVDAPIGTGFSYSTTAENY  169



>gb|KJB73514.1| hypothetical protein B456_011G236800 [Gossypium raimondii]
Length=424

 Score =   157 bits (396),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 85/112 (76%), Gaps = 3/112 (3%)
 Frame = +3

Query  108  VETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGLS  287
            + +LPGF A LPFKL TGYIGVG+   ++ FYYFI+SE+ P  DPL+LWLTGGPGCS LS
Sbjct  30   IRSLPGFSASLPFKLETGYIGVGD---VEFFYYFIQSERDPSKDPLILWLTGGPGCSALS  86

Query  288  AFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSET  443
              FFEIGPL  N     G +P   LNPY+WTKVANIIF+D PVGTG+SYS T
Sbjct  87   GLFFEIGPLQFNMVEYNGSLPTFVLNPYSWTKVANIIFLDAPVGTGFSYSTT  138



>ref|XP_006401830.1| hypothetical protein EUTSA_v10015511mg [Eutrema salsugineum]
 gb|ESQ43283.1| hypothetical protein EUTSA_v10015511mg [Eutrema salsugineum]
Length=405

 Score =   156 bits (394),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 92/114 (81%), Gaps = 0/114 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            +++ +LPGF   LPF+L TGYIGVGE++E+QLFYYFI+SE++PE DPLLLWL+GGPGCS 
Sbjct  23   SIIRSLPGFEGPLPFELETGYIGVGEAEEVQLFYYFIKSERNPEEDPLLLWLSGGPGCSS  82

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSET  443
            LS   +E GP+TI     +G IP L    Y+WTK+AN+I++DQPVG+G+SYS+T
Sbjct  83   LSGLLYENGPVTIKMDGYSGGIPSLVSTTYSWTKIANMIYLDQPVGSGFSYSKT  136



>ref|XP_004288266.1| PREDICTED: serine carboxypeptidase-like 2 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=485

 Score =   157 bits (397),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 70/114 (61%), Positives = 86/114 (75%), Gaps = 0/114 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            ++V++LPGFP  LPF L TGYIGV E  ++QLFYYF+ESE++P  DPLLLWLTGGP CS 
Sbjct  38   SIVKSLPGFPGSLPFHLETGYIGVDEKDDVQLFYYFVESERNPRDDPLLLWLTGGPTCSA  97

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSET  443
            LS   FEIGP+  N     G +P   LNPY+WTKV++IIFVD PVGTG+SY  +
Sbjct  98   LSGLAFEIGPIKFNMVEYNGSLPTFVLNPYSWTKVSSIIFVDAPVGTGFSYPRS  151



>ref|XP_007018461.1| Serine carboxypeptidase-like 7, putative [Theobroma cacao]
 gb|EOY15686.1| Serine carboxypeptidase-like 7, putative [Theobroma cacao]
Length=473

 Score =   157 bits (397),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 91/119 (76%), Gaps = 1/119 (1%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
            H+ V+ LPGF   LPF+L TGY+GVG+S+++QLFYYF++SE++PE DPLLLWLTGGPGCS
Sbjct  27   HSAVKFLPGFEGPLPFELETGYVGVGDSEDVQLFYYFVKSERNPEEDPLLLWLTGGPGCS  86

Query  279  GLSAFFFEIGPLTINY-ANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDA  452
              S   FEIGPL         G +P L LNPY+WTKV+NIIFVD PVGTG+SY+  + A
Sbjct  87   AFSGLVFEIGPLNFKADVEYNGSLPTLVLNPYSWTKVSNIIFVDSPVGTGFSYARNNLA  145



>ref|XP_010484511.1| PREDICTED: serine carboxypeptidase-like 7 [Camelina sativa]
Length=237

 Score =   152 bits (383),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 92/115 (80%), Gaps = 0/115 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            ++V+ LPGF   LPF+L TGYIGVGE +E+QLFYYFI+SE++P+ DPLLLWLTGGPGCS 
Sbjct  27   SIVKFLPGFDGHLPFELETGYIGVGEEEELQLFYYFIKSERNPKEDPLLLWLTGGPGCSS  86

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETS  446
            +SA  +E GP+T+ +    G +P L    ++WTKV++II++DQPVGTG+SYS+T 
Sbjct  87   ISALLYENGPVTVKHEVYNGSLPSLVSTTHSWTKVSSIIYLDQPVGTGFSYSKTQ  141



>ref|XP_011070163.1| PREDICTED: serine carboxypeptidase-like 18 [Sesamum indicum]
Length=485

 Score =   157 bits (397),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 86/119 (72%), Gaps = 0/119 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
              V++TLPG P KLP KL TGYIGVGE +E+QLFY+F ESE  PE DP + W+TGGPGCS
Sbjct  28   QRVIQTLPGLPDKLPNKLETGYIGVGEDEEVQLFYFFFESEGDPEKDPFIFWITGGPGCS  87

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAY  455
            GLS    EIG   I++ N TG    L+LN YAWTK A+I+F+DQP GTGYSYS T   Y
Sbjct  88   GLSVILMEIGTFVIDFPNCTGGPTALKLNEYAWTKSASILFIDQPAGTGYSYSNTLKGY  146



>gb|KDO81473.1| hypothetical protein CISIN_1g012205mg [Citrus sinensis]
Length=388

 Score =   155 bits (393),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 88/115 (77%), Gaps = 0/115 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
            ++ V+ LPGF   LPF+L TGY+GVGES + QLFYYF++SEK+P  DPLLLWLTGGPGCS
Sbjct  25   YSTVKFLPGFQGPLPFELETGYVGVGESGDAQLFYYFVKSEKNPREDPLLLWLTGGPGCS  84

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSET  443
              S   +EIGP+  N     G +P L LNPY+WTK A+I+FVD PVGTGYSY++T
Sbjct  85   AFSGLAYEIGPINFNVVEYNGSLPTLHLNPYSWTKEASILFVDSPVGTGYSYAKT  139



>emb|CDP20368.1| unnamed protein product [Coffea canephora]
Length=445

 Score =   157 bits (396),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 89/120 (74%), Gaps = 0/120 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
             ++V+TLPG+   LPFKL TGYI  G   E+Q F+YFIESE+ P+ DPL+LWLTGGPGCS
Sbjct  23   RSIVDTLPGYSGTLPFKLETGYISAGRDDEVQFFHYFIESEREPDRDPLMLWLTGGPGCS  82

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
              S   +EIGPL  ++    G +P   LNPY+WTK+A+IIF+D PVGTG++Y+ TS+ Y+
Sbjct  83   AFSGLVYEIGPLNFDFETFDGSLPAFVLNPYSWTKIASIIFLDAPVGTGFTYATTSEGYH  142



>gb|KJB73511.1| hypothetical protein B456_011G236800 [Gossypium raimondii]
Length=470

 Score =   157 bits (396),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 85/112 (76%), Gaps = 3/112 (3%)
 Frame = +3

Query  108  VETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGLS  287
            + +LPGF A LPFKL TGYIGVG+   ++ FYYFI+SE+ P  DPL+LWLTGGPGCS LS
Sbjct  30   IRSLPGFSASLPFKLETGYIGVGD---VEFFYYFIQSERDPSKDPLILWLTGGPGCSALS  86

Query  288  AFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSET  443
              FFEIGPL  N     G +P   LNPY+WTKVANIIF+D PVGTG+SYS T
Sbjct  87   GLFFEIGPLQFNMVEYNGSLPTFVLNPYSWTKVANIIFLDAPVGTGFSYSTT  138



>gb|KJB73512.1| hypothetical protein B456_011G236800 [Gossypium raimondii]
Length=466

 Score =   157 bits (396),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 85/112 (76%), Gaps = 3/112 (3%)
 Frame = +3

Query  108  VETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGLS  287
            + +LPGF A LPFKL TGYIGVG+   ++ FYYFI+SE+ P  DPL+LWLTGGPGCS LS
Sbjct  30   IRSLPGFSASLPFKLETGYIGVGD---VEFFYYFIQSERDPSKDPLILWLTGGPGCSALS  86

Query  288  AFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSET  443
              FFEIGPL  N     G +P   LNPY+WTKVANIIF+D PVGTG+SYS T
Sbjct  87   GLFFEIGPLQFNMVEYNGSLPTFVLNPYSWTKVANIIFLDAPVGTGFSYSTT  138



>gb|KDP32094.1| hypothetical protein JCGZ_12555 [Jatropha curcas]
Length=472

 Score =   157 bits (396),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 70/114 (61%), Positives = 88/114 (77%), Gaps = 0/114 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            + ++ LPGF   LPFKL TGY+ VG+  ++QLFYYFIESE++P  DPLLLWLTGGPGCS 
Sbjct  32   STIKNLPGFSGPLPFKLETGYVEVGKKGDVQLFYYFIESERNPREDPLLLWLTGGPGCSS  91

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSET  443
            LS   FEIGPL  N     G +P L+LNP++WTKV++IIF+D PVGTG+SYS +
Sbjct  92   LSGLIFEIGPLQFNIVEYNGSLPTLKLNPHSWTKVSSIIFLDAPVGTGFSYSRS  145



>ref|XP_009120828.1| PREDICTED: serine carboxypeptidase-like 15 isoform X2 [Brassica 
rapa]
Length=407

 Score =   155 bits (393),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/115 (63%), Positives = 87/115 (76%), Gaps = 0/115 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
             + V  LPGF   LPF+L TGYIGVGE++E QLFYYFI+SE++PE DPLL+WL+GGPGCS
Sbjct  25   RSTVRYLPGFQGPLPFELETGYIGVGEAEEDQLFYYFIKSERNPEEDPLLIWLSGGPGCS  84

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSET  443
             LS   FE GPL+ N  +  GDIP L    Y+WTKVANII++DQP GTG+SYS  
Sbjct  85   SLSGLLFENGPLSFNIESDNGDIPSLVSTTYSWTKVANIIYLDQPAGTGFSYSRN  139



>ref|XP_003633199.2| PREDICTED: serine carboxypeptidase-like 13 isoform X2 [Vitis 
vinifera]
Length=461

 Score =   157 bits (396),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 93/119 (78%), Gaps = 0/119 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
             +V++TLPGF  +LPF L TGY+GVGE++E+QLFYYF++S+++P  DPL+LWL+GGPGCS
Sbjct  28   RSVIKTLPGFSGELPFYLETGYVGVGENEEVQLFYYFVKSQRNPVFDPLMLWLSGGPGCS  87

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAY  455
             L+AFF+E GPLT N     G +P+L L    WTK  NIIFVD PVG+G+SYS+T + Y
Sbjct  88   TLTAFFYENGPLTFNIQEYEGGLPNLYLKENTWTKTLNIIFVDAPVGSGFSYSKTQEGY  146



>ref|XP_007018464.1| Serine carboxypeptidase-like 2, putative [Theobroma cacao]
 gb|EOY15689.1| Serine carboxypeptidase-like 2, putative [Theobroma cacao]
Length=406

 Score =   155 bits (392),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 89/118 (75%), Gaps = 0/118 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
            H++V+ LPGF   LPF+L TGY+GVGES ++QLFYYFI+SE++P  DPLLLWLTGGPGCS
Sbjct  26   HSLVKFLPGFEGPLPFELETGYVGVGESDDVQLFYYFIKSERNPGEDPLLLWLTGGPGCS  85

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDA  452
            GLS   +EIGPL        G +P L LNPY+WTK+++IIFVD  VGTG+ Y+    A
Sbjct  86   GLSGLVYEIGPLNFKVVEYNGSLPTLVLNPYSWTKISSIIFVDSSVGTGFFYATNQHA  143



>ref|XP_010048542.1| PREDICTED: serine carboxypeptidase-like 13 [Eucalyptus grandis]
 gb|KCW80817.1| hypothetical protein EUGRSUZ_C02185 [Eucalyptus grandis]
Length=471

 Score =   156 bits (395),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 88/119 (74%), Gaps = 0/119 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
             +V+ LPG+   LPF L TGY+GVGE + +QLFYYF+ES++SP  DPLLLW+ GGPGCS 
Sbjct  27   VIVKNLPGYSGDLPFTLETGYVGVGEDEVVQLFYYFVESDRSPSQDPLLLWIDGGPGCSS  86

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            L+ FFF+ GPL    +   G +P L  NPY+WT+  NIIF+D PVGTG+SYS T+D YN
Sbjct  87   LAGFFFQNGPLNFQTSGYNGSLPSLHPNPYSWTQGMNIIFLDAPVGTGFSYSTTTDGYN  145



>ref|XP_009120822.1| PREDICTED: serine carboxypeptidase-like 15 isoform X1 [Brassica 
rapa]
Length=441

 Score =   156 bits (394),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 72/115 (63%), Positives = 87/115 (76%), Gaps = 0/115 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
             + V  LPGF   LPF+L TGYIGVGE++E QLFYYFI+SE++PE DPLL+WL+GGPGCS
Sbjct  25   RSTVRYLPGFQGPLPFELETGYIGVGEAEEDQLFYYFIKSERNPEEDPLLIWLSGGPGCS  84

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSET  443
             LS   FE GPL+ N  +  GDIP L    Y+WTKVANII++DQP GTG+SYS  
Sbjct  85   SLSGLLFENGPLSFNIESDNGDIPSLVSTTYSWTKVANIIYLDQPAGTGFSYSRN  139



>gb|KDO81472.1| hypothetical protein CISIN_1g012205mg [Citrus sinensis]
Length=414

 Score =   155 bits (393),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 88/115 (77%), Gaps = 0/115 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
            ++ V+ LPGF   LPF+L TGY+GVGES + QLFYYF++SEK+P  DPLLLWLTGGPGCS
Sbjct  25   YSTVKFLPGFQGPLPFELETGYVGVGESGDAQLFYYFVKSEKNPREDPLLLWLTGGPGCS  84

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSET  443
              S   +EIGP+  N     G +P L LNPY+WTK A+I+FVD PVGTGYSY++T
Sbjct  85   AFSGLAYEIGPINFNVVEYNGSLPTLHLNPYSWTKEASILFVDSPVGTGYSYAKT  139



>dbj|BAF56655.1| serine carboxypeptitase-like protein 1 [Diospyros kaki]
Length=452

 Score =   156 bits (394),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 90/120 (75%), Gaps = 1/120 (1%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            ++V+ LPGF  +LPFKL TGYIGVGE  E+QLFYYF+ES+  P  DPL+LWLTGGPGCSG
Sbjct  8    SIVKFLPGFDGELPFKLETGYIGVGEIDEVQLFYYFVESQGDPSNDPLILWLTGGPGCSG  67

Query  282  LSAFFFEIGPLTINYAN-STGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
             SA  +EIGPL     +   G +P L  +  +WTKVANIIF+DQPVGTG+SY  T+ AYN
Sbjct  68   FSALVYEIGPLLFKVQSWKPGTLPSLRASKNSWTKVANIIFIDQPVGTGFSYGTTAAAYN  127



>emb|CDY00759.1| BnaC03g37430D [Brassica napus]
Length=202

 Score =   150 bits (379),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 87/114 (76%), Gaps = 0/114 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            + V  LPG+   LPF+L TGYIGVGE++E Q FYYFI+SE++P  DPLL+WLTGGPGCS 
Sbjct  21   STVRYLPGYQGPLPFELETGYIGVGEAEESQFFYYFIKSERTPAEDPLLIWLTGGPGCSS  80

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSET  443
            +SAF  E GPL  N  + +G+IP L    Y+W+KVANII++DQPVGTG+SYS  
Sbjct  81   ISAFLLENGPLAFNTESDSGNIPSLVSTTYSWSKVANIIYLDQPVGTGFSYSRN  134



>gb|KCW63486.1| hypothetical protein EUGRSUZ_G01118 [Eucalyptus grandis]
Length=418

 Score =   155 bits (392),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 73/118 (62%), Positives = 90/118 (76%), Gaps = 3/118 (3%)
 Frame = +3

Query  105  VVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGL  284
            +VETLPGFP +LPFKL TGYI VGE   I+ FYYF++S  +PE DPLLL++ GGPGCSGL
Sbjct  20   IVETLPGFPGRLPFKLETGYISVGE---IEFFYYFVQSTGNPEADPLLLFMNGGPGCSGL  76

Query  285  SAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            +AF F+IGPL  N  + TG +P L   P AWTK ANIIF+D P+G G+SY+ T+ AYN
Sbjct  77   NAFLFQIGPLKFNTTDYTGGLPSLLYEPDAWTKTANIIFIDAPIGAGFSYAMTASAYN  134



>ref|XP_008452662.1| PREDICTED: serine carboxypeptidase-like 13 [Cucumis melo]
Length=464

 Score =   156 bits (394),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 72/140 (51%), Positives = 101/140 (72%), Gaps = 9/140 (6%)
 Frame = +3

Query  24   FVVMASTFKIlastflllflaptflHAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFY  203
            ++++ S F+I+++            H  VE LPGFP +LPF+L TGY+GVG+ +E+QLFY
Sbjct  9    YILLVSVFQIISAAAS---------HWTVEFLPGFPGRLPFELETGYVGVGDLEEVQLFY  59

Query  204  YFIESEKSPETDPLLLWLTGGPGCSGLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTK  383
            YF++SE +P+TDPLL WLTGGPGCS L+A  FE+GP+        G +P++ LNPY+WTK
Sbjct  60   YFVKSEGNPKTDPLLFWLTGGPGCSALTALAFEVGPINFKIKEYDGSLPEVILNPYSWTK  119

Query  384  VANIIFVDQPVGTGYSYSET  443
             ++I+FVD PVGTG+SY  T
Sbjct  120  KSSILFVDLPVGTGFSYGTT  139



>ref|XP_010068327.1| PREDICTED: serine carboxypeptidase-like 18 [Eucalyptus grandis]
Length=482

 Score =   156 bits (394),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 73/118 (62%), Positives = 90/118 (76%), Gaps = 3/118 (3%)
 Frame = +3

Query  105  VVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGL  284
            +VETLPGFP +LPFKL TGYI VGE   I+ FYYF++S  +PE DPLLL++ GGPGCSGL
Sbjct  37   IVETLPGFPGRLPFKLETGYISVGE---IEFFYYFVQSTGNPEADPLLLFMNGGPGCSGL  93

Query  285  SAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            +AF F+IGPL  N  + TG +P L   P AWTK ANIIF+D P+G G+SY+ T+ AYN
Sbjct  94   NAFLFQIGPLKFNTTDYTGGLPSLLYEPDAWTKTANIIFIDAPIGAGFSYAMTASAYN  151



>ref|XP_004306039.2| PREDICTED: serine carboxypeptidase-like 16 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=274

 Score =   152 bits (383),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 83/117 (71%), Gaps = 0/117 (0%)
 Frame = +3

Query  105  VVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGL  284
            +  TLPG P  LPF L TGY+ VG+  ++Q FYYFIES++ P  DPLLLWLTGGPGCSG 
Sbjct  39   ITTTLPGHPGTLPFSLETGYVSVGDLDQLQFFYYFIESQRDPVKDPLLLWLTGGPGCSGF  98

Query  285  SAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAY  455
            S   +EIGPLT +Y    G  P    NP++WT+VANIIF+D PVGTG+SYS   + Y
Sbjct  99   SGLVYEIGPLTFDYIAFNGSFPTFVDNPFSWTQVANIIFIDAPVGTGFSYSTAQEGY  155



>ref|XP_004163543.1| PREDICTED: LOW QUALITY PROTEIN: serine carboxypeptidase-like 
18-like [Cucumis sativus]
Length=466

 Score =   155 bits (393),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 99/145 (68%), Gaps = 9/145 (6%)
 Frame = +3

Query  24   FVVMASTFKIlastflllflaptflHAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFY  203
            F+++ S F+I+              H  V+ LPGFP +LPF+L TGY+GVG+ +E+QLFY
Sbjct  9    FILLVSVFQIIFGAAS---------HWTVDFLPGFPGRLPFELETGYVGVGDMEEVQLFY  59

Query  204  YFIESEKSPETDPLLLWLTGGPGCSGLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTK  383
            YF++SE +P+TDPLL WLTGGPGCS L+   FE+GP+        G +P + LNPY+WTK
Sbjct  60   YFVKSEGNPKTDPLLFWLTGGPGCSALTGLAFELGPINFKIEEYNGSLPQIILNPYSWTK  119

Query  384  VANIIFVDQPVGTGYSYSETSDAYN  458
             ++I+FVD PVGTG+SY  T  + N
Sbjct  120  KSSILFVDLPVGTGFSYGTTPQSLN  144



>emb|CBI17848.3| unnamed protein product [Vitis vinifera]
Length=563

 Score =   157 bits (396),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 93/119 (78%), Gaps = 0/119 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
             +V++TLPGF  +LPF L TGY+GVGE++E+QLFYYF++S+++P  DPL+LWL+GGPGCS
Sbjct  130  RSVIKTLPGFSGELPFYLETGYVGVGENEEVQLFYYFVKSQRNPVFDPLMLWLSGGPGCS  189

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAY  455
             L+AFF+E GPLT N     G +P+L L    WTK  NIIFVD PVG+G+SYS+T + Y
Sbjct  190  TLTAFFYENGPLTFNIQEYEGGLPNLYLKENTWTKTLNIIFVDAPVGSGFSYSKTQEGY  248


 Score = 79.7 bits (195),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 50/73 (68%), Gaps = 4/73 (5%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTG----YIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGP  269
            ++V TL GFP +L F L TG    Y+GVG+++E+QL Y F   E++P  +PL+ WLTGGP
Sbjct  15   SIVTTLLGFPEELSFYLETGFVCRYVGVGKNEEVQLLYLFFRLERNPSVNPLMFWLTGGP  74

Query  270  GCSGLSAFFFEIG  308
             CS  S+FF+  G
Sbjct  75   SCSTFSSFFYSNG  87



>ref|XP_008385684.1| PREDICTED: uncharacterized protein LOC103448207 [Malus domestica]
Length=466

 Score =   155 bits (393),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 77/145 (53%), Positives = 93/145 (64%), Gaps = 28/145 (19%)
 Frame = +3

Query  105  VVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGL  284
            ++  LPGFP  LPFKL TGY+GVG   ++QLFYYFIESE SPE DPL+LWLTGGPGCS  
Sbjct  22   IITALPGFPGNLPFKLETGYVGVGNMDDVQLFYYFIESEGSPEYDPLVLWLTGGPGCSAF  81

Query  285  SA----------------------------FFFEIGPLTINYANSTGDIPDLELNPYAWT  380
            S                             F+F  GPL+ +YANS G+ P  +LNPY+WT
Sbjct  82   SGLIYENLGTCLIINSLSASFQRITLFCNRFYFVXGPLSFDYANSIGNKPKFKLNPYSWT  141

Query  381  KVANIIFVDQPVGTGYSYSETSDAY  455
            KVANIIF+D PVGTG+SY++T   Y
Sbjct  142  KVANIIFLDAPVGTGFSYAKTWRGY  166



>emb|CDY11114.1| BnaC06g23660D [Brassica napus]
Length=439

 Score =   155 bits (392),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 72/115 (63%), Positives = 89/115 (77%), Gaps = 0/115 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            + V+ LPGF   LPF+L TGYIGVGE +E+QLFYYFI+SE++PE DPLLLWL+GGPGCS 
Sbjct  30   STVKFLPGFDGPLPFELETGYIGVGEEEEVQLFYYFIKSERNPEEDPLLLWLSGGPGCSS  89

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETS  446
            +S   FE GPLT+      G +P L    Y+WTK++NIIF+DQPVGTG+SYS TS
Sbjct  90   ISGLLFENGPLTMKLDAYNGSLPSLVSTTYSWTKLSNIIFLDQPVGTGFSYSRTS  144



>emb|CDY50564.1| BnaA01g30780D [Brassica napus]
Length=439

 Score =   155 bits (392),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 87/115 (76%), Gaps = 0/115 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
             + V  LPGF   LPF+L TGYIGVGE++E QLFYYFI+SE++PE DPLL+WL+GGPGC+
Sbjct  25   RSTVRYLPGFQGPLPFELETGYIGVGEAEEDQLFYYFIKSERNPEEDPLLIWLSGGPGCT  84

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSET  443
             LS   FE GPL+ N  +  GDIP L    Y+WTKVANII++DQP GTG+SYS  
Sbjct  85   SLSGLLFENGPLSFNIESDNGDIPSLVSTTYSWTKVANIIYLDQPAGTGFSYSRN  139



>ref|XP_008452663.1| PREDICTED: serine carboxypeptidase-like 13 [Cucumis melo]
Length=464

 Score =   155 bits (393),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 69/115 (60%), Positives = 89/115 (77%), Gaps = 0/115 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
            H  VE LPGFP +LPF+L TGY+GVG+ +E+QLFYYF++SE +P+TDPLL WLTGGPGCS
Sbjct  25   HWTVEFLPGFPGRLPFELETGYVGVGDLEEVQLFYYFVKSEGNPKTDPLLFWLTGGPGCS  84

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSET  443
             L+A  FE+GP+        G +P + LNPY+WTK ++I+FVD PVGTG+SY  T
Sbjct  85   ALTALAFEVGPINFKIEEYNGSLPQIILNPYSWTKKSSILFVDLPVGTGFSYGTT  139



>ref|XP_006433654.1| hypothetical protein CICLE_v10001055mg [Citrus clementina]
 gb|ESR46894.1| hypothetical protein CICLE_v10001055mg [Citrus clementina]
Length=468

 Score =   155 bits (393),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 88/115 (77%), Gaps = 0/115 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
            ++ V+ LPGF   LPF+L TGY+GVGES + QLFYYF++SEK+P  DPLLLWLTGGPGCS
Sbjct  25   YSTVKFLPGFQGPLPFELETGYVGVGESGDAQLFYYFVKSEKNPREDPLLLWLTGGPGCS  84

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSET  443
              S   +EIGP+  N     G +P L LNPY+WTK A+I+FVD PVGTGYSY++T
Sbjct  85   AFSGLAYEIGPINFNVVEYNGSLPTLHLNPYSWTKEASILFVDSPVGTGYSYAKT  139



>ref|XP_010046975.1| PREDICTED: serine carboxypeptidase-like 17 [Eucalyptus grandis]
 gb|KCW78695.1| hypothetical protein EUGRSUZ_C00147 [Eucalyptus grandis]
Length=504

 Score =   156 bits (394),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 91/119 (76%), Gaps = 0/119 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
              VV TLPG+  +LPF L TGY+GVGE +E QLFYYF+ES++SP  DPL+LWLTGGPGCS
Sbjct  60   QKVVTTLPGYDGELPFYLETGYVGVGELEESQLFYYFVESQRSPALDPLMLWLTGGPGCS  119

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAY  455
             LSAFF+E GP+  +Y    G +P + +NP+ WT+  NII+VD P+GTG+SYS T++ Y
Sbjct  120  VLSAFFYESGPVEFSYVGYNGSLPSMHVNPHTWTQGLNIIYVDAPIGTGFSYSTTAENY  178



>gb|KDO81471.1| hypothetical protein CISIN_1g012205mg [Citrus sinensis]
Length=468

 Score =   155 bits (393),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 88/115 (77%), Gaps = 0/115 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
            ++ V+ LPGF   LPF+L TGY+GVGES + QLFYYF++SEK+P  DPLLLWLTGGPGCS
Sbjct  25   YSTVKFLPGFQGPLPFELETGYVGVGESGDAQLFYYFVKSEKNPREDPLLLWLTGGPGCS  84

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSET  443
              S   +EIGP+  N     G +P L LNPY+WTK A+I+FVD PVGTGYSY++T
Sbjct  85   AFSGLAYEIGPINFNVVEYNGSLPTLHLNPYSWTKEASILFVDSPVGTGYSYAKT  139



>ref|XP_006415268.1| hypothetical protein EUTSA_v10007570mg [Eutrema salsugineum]
 gb|ESQ33621.1| hypothetical protein EUTSA_v10007570mg [Eutrema salsugineum]
Length=464

 Score =   155 bits (392),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 87/119 (73%), Gaps = 0/119 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            +V+  LPGF   LPF L TGYIGVGE +++QLFYYFI+SE +PE DPLL+WLTGGP C+ 
Sbjct  28   SVISHLPGFEGPLPFHLETGYIGVGEEEKVQLFYYFIKSENNPEEDPLLIWLTGGPACTA  87

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            LSA  FEIGPLT       G +P L    Y+WTKVANIIF+DQPVGTG+SYS T   Y 
Sbjct  88   LSALAFEIGPLTFKTEGYNGSLPSLISTSYSWTKVANIIFLDQPVGTGFSYSTTRLTYK  146



>ref|XP_010321497.1| PREDICTED: serine carboxypeptidase-like 12 [Solanum lycopersicum]
Length=459

 Score =   155 bits (392),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 72/115 (63%), Positives = 90/115 (78%), Gaps = 0/115 (0%)
 Frame = +3

Query  108  VETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGLS  287
            V+ LPGF  +L F+L TGYIGVGE+ E+Q+FYYFI+SE +P+ DPL+ W TGGPGCS LS
Sbjct  27   VKYLPGFEGQLAFQLETGYIGVGEADEVQVFYYFIKSESNPKVDPLIYWFTGGPGCSALS  86

Query  288  AFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDA  452
            A FFE GP+T++     G +P L LNPYA+TKVA+IIFVD PVGTG+SY+ T  A
Sbjct  87   AIFFEFGPITLDTRAYNGSLPTLSLNPYAYTKVASIIFVDLPVGTGFSYATTQKA  141



>ref|NP_001031402.1| serine carboxypeptidase-like 13 [Arabidopsis thaliana]
 gb|AEC07386.1| serine carboxypeptidase-like 13 [Arabidopsis thaliana]
Length=411

 Score =   154 bits (390),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 89/114 (78%), Gaps = 0/114 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            ++V+ LPGF   LPF+L TGYIG+GE +E+QLFYYFI+SEK+PE DPLLLWL+GGPGCS 
Sbjct  24   SIVKFLPGFEGPLPFELETGYIGIGEEEEVQLFYYFIKSEKNPEEDPLLLWLSGGPGCSS  83

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSET  443
            L+   FE GP+ + +    G +P L    Y+WTK+ANIIF+DQPVG+G+SYS T
Sbjct  84   LTGLLFENGPVALKFEVYNGSVPSLVSTTYSWTKMANIIFLDQPVGSGFSYSRT  137



>ref|XP_007208562.1| hypothetical protein PRUPE_ppa024102mg [Prunus persica]
 gb|EMJ09761.1| hypothetical protein PRUPE_ppa024102mg [Prunus persica]
Length=360

 Score =   153 bits (387),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 84/108 (78%), Gaps = 0/108 (0%)
 Frame = +3

Query  105  VVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGL  284
            ++++LPGFP  LPFKL TGYIG  E +++QLFYYF+ESE++P  DPL+LWLTGGP CSGL
Sbjct  45   IIKSLPGFPGSLPFKLETGYIGADEKEDVQLFYYFVESERNPRDDPLMLWLTGGPTCSGL  104

Query  285  SAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGY  428
            S   FEIGP+  N     G +P   +NPY+WTKV++IIFVD P+GTG+
Sbjct  105  SGVAFEIGPMKFNMVEYNGSLPTFVINPYSWTKVSSIIFVDAPIGTGF  152



>ref|XP_006594522.1| PREDICTED: serine carboxypeptidase-like 12-like [Glycine max]
Length=469

 Score =   155 bits (392),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 71/117 (61%), Positives = 90/117 (77%), Gaps = 0/117 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            ++V+ LPGF   LPF L TGY+GVGES+++Q FYYFIESE +P+ DPL+LWLTGGPGCS 
Sbjct  32   SIVKFLPGFKGPLPFVLETGYVGVGESEDVQAFYYFIESENNPKKDPLMLWLTGGPGCSA  91

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDA  452
            LS   FEIGPLT  Y    G +P+L L P++WTKV++IIFVD PV TG++Y+ T  A
Sbjct  92   LSGLVFEIGPLTFKYEEYNGSLPNLVLRPHSWTKVSSIIFVDLPVSTGFTYATTEFA  148



>gb|KJB48751.1| hypothetical protein B456_008G084400 [Gossypium raimondii]
Length=158

 Score =   147 bits (372),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 86/119 (72%), Gaps = 3/119 (3%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            +VV++LPGF A LPFKL TG+    E  +++ FYYFIESE++P  DPLLLWLTGGPGCS 
Sbjct  26   SVVDSLPGFTAPLPFKLETGHT---EVDDLEFFYYFIESERNPAKDPLLLWLTGGPGCSS  82

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            LS FF EIGPL  N     G +P   LN YAW KV++IIF+D PVGTG+SYS T+  + 
Sbjct  83   LSGFFLEIGPLRFNMVEYNGSLPTFFLNQYAWAKVSSIIFLDAPVGTGFSYSRTAQGFK  141



>ref|NP_001077947.1| serine carboxypeptidase-like 13 [Arabidopsis thaliana]
 gb|AEC07388.1| serine carboxypeptidase-like 13 [Arabidopsis thaliana]
Length=433

 Score =   154 bits (390),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 89/114 (78%), Gaps = 0/114 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            ++V+ LPGF   LPF+L TGYIG+GE +E+QLFYYFI+SEK+PE DPLLLWL+GGPGCS 
Sbjct  24   SIVKFLPGFEGPLPFELETGYIGIGEEEEVQLFYYFIKSEKNPEEDPLLLWLSGGPGCSS  83

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSET  443
            L+   FE GP+ + +    G +P L    Y+WTK+ANIIF+DQPVG+G+SYS T
Sbjct  84   LTGLLFENGPVALKFEVYNGSVPSLVSTTYSWTKMANIIFLDQPVGSGFSYSRT  137



>gb|KFK44962.1| hypothetical protein AALP_AA1G326200 [Arabis alpina]
Length=463

 Score =   155 bits (391),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 73/114 (64%), Positives = 87/114 (76%), Gaps = 0/114 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            +V+  LPGF   LPF L TGYIGVGE + ++LFYYFI+SE +PE DPLL+WLTGGPGCS 
Sbjct  28   SVISYLPGFEGPLPFHLETGYIGVGEGERVKLFYYFIKSENNPEKDPLLIWLTGGPGCSS  87

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSET  443
            LSA  FEIGPL++      G +P L   PY+WTK ANIIF+DQPVGTG+SYS T
Sbjct  88   LSALAFEIGPLSLKNEGYNGGLPSLISTPYSWTKEANIIFLDQPVGTGFSYSTT  141



>ref|XP_002878649.1| hypothetical protein ARALYDRAFT_481165 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54908.1| hypothetical protein ARALYDRAFT_481165 [Arabidopsis lyrata subsp. 
lyrata]
Length=411

 Score =   154 bits (388),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 88/114 (77%), Gaps = 0/114 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            ++V+ LPGF   LPF+L TGYIG+GE +E+QLFYYFI+SEK+P+ DPLLLWLTGGPGCS 
Sbjct  24   SIVKFLPGFEGPLPFELETGYIGIGEEEEVQLFYYFIKSEKNPKEDPLLLWLTGGPGCSS  83

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSET  443
            L+   FE GP+ + +    G +P L    Y+WTK+ANIIF+DQPVG G+SYS T
Sbjct  84   LTGLLFENGPVALKFEVYNGSVPSLVSTTYSWTKMANIIFLDQPVGAGFSYSRT  137



>ref|NP_179881.3| serine carboxypeptidase-like 13 [Arabidopsis thaliana]
 sp|Q8H780.2|SCP13_ARATH RecName: Full=Serine carboxypeptidase-like 13; AltName: Full=Sinapoylglucose--sinapoylglucose 
O-sinapoyltransferase; AltName: 
Full=Sinapoylglucose--sinapoylglucose acyltransferase; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAC17815.1| putative serine carboxypeptidase I [Arabidopsis thaliana]
 gb|AAM15008.1| putative serine carboxypeptidase I [Arabidopsis thaliana]
 gb|AEC07385.1| serine carboxypeptidase-like 13 [Arabidopsis thaliana]
Length=430

 Score =   154 bits (389),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 89/114 (78%), Gaps = 0/114 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            ++V+ LPGF   LPF+L TGYIG+GE +E+QLFYYFI+SEK+PE DPLLLWL+GGPGCS 
Sbjct  24   SIVKFLPGFEGPLPFELETGYIGIGEEEEVQLFYYFIKSEKNPEEDPLLLWLSGGPGCSS  83

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSET  443
            L+   FE GP+ + +    G +P L    Y+WTK+ANIIF+DQPVG+G+SYS T
Sbjct  84   LTGLLFENGPVALKFEVYNGSVPSLVSTTYSWTKMANIIFLDQPVGSGFSYSRT  137



>gb|KDP41600.1| hypothetical protein JCGZ_16007 [Jatropha curcas]
Length=472

 Score =   155 bits (391),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 87/115 (76%), Gaps = 0/115 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
            H+ VE LPGF   LPF+L TGYIGVGES+++QLFYYF+ S+ + E DPLLLWLTGGPGCS
Sbjct  29   HSKVEFLPGFNGPLPFELETGYIGVGESEDVQLFYYFVRSQGNAEKDPLLLWLTGGPGCS  88

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSET  443
             LS F +EIGPL        G +P L LNP +WTKVA+IIF+D PVGTG+SY  T
Sbjct  89   ALSGFIYEIGPLYFEVVEYNGSLPTLFLNPNSWTKVASIIFIDSPVGTGFSYPRT  143



>ref|XP_007047573.1| Serine carboxypeptidase-like 2, putative isoform 1 [Theobroma 
cacao]
 ref|XP_007047574.1| Serine carboxypeptidase-like 18, putative isoform 1 [Theobroma 
cacao]
 gb|EOX91730.1| Serine carboxypeptidase-like 2, putative isoform 1 [Theobroma 
cacao]
 gb|EOX91731.1| Serine carboxypeptidase-like 18, putative isoform 1 [Theobroma 
cacao]
Length=476

 Score =   155 bits (391),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 72/114 (63%), Positives = 85/114 (75%), Gaps = 3/114 (3%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            + +  LPGF A LPFKL TGYIGVG+   ++ F+YFIESE++P  DPL LWLTGGPGCS 
Sbjct  39   STIRALPGFSASLPFKLETGYIGVGD---VEFFFYFIESERNPAEDPLFLWLTGGPGCSA  95

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSET  443
            LS  FFEIGPL  N     G +P   LNPY+WTKVA+IIF+D PVGTG+SYS T
Sbjct  96   LSGLFFEIGPLQFNMVEYNGSLPTFALNPYSWTKVASIIFLDAPVGTGFSYSRT  149



>ref|XP_006415270.1| hypothetical protein EUTSA_v10009366mg [Eutrema salsugineum]
 gb|ESQ33623.1| hypothetical protein EUTSA_v10009366mg [Eutrema salsugineum]
Length=440

 Score =   154 bits (389),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 74/114 (65%), Positives = 86/114 (75%), Gaps = 0/114 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            +V+  LPGF   LPF L TGYIGVGE +++QLFYYFI+SEK+PE DPLLLWLTGGP C+ 
Sbjct  28   SVISYLPGFEGPLPFHLETGYIGVGEEEKVQLFYYFIKSEKNPEEDPLLLWLTGGPACTA  87

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSET  443
            LSA  FE GPLT       G +P L    Y+WTKVANIIF+DQPVGTG+SYS T
Sbjct  88   LSALAFENGPLTFKTEGYNGSLPSLISTSYSWTKVANIIFLDQPVGTGFSYSTT  141



>ref|XP_010464718.1| PREDICTED: serine carboxypeptidase-like 7 isoform X2 [Camelina 
sativa]
Length=406

 Score =   154 bits (388),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/114 (61%), Positives = 91/114 (80%), Gaps = 0/114 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            ++VE LPGF   LPF+L TGYIGVGE +E+QLFYYFI+SE++P+  PLLLWL+GGPGCS 
Sbjct  27   SIVEFLPGFDGPLPFELETGYIGVGEEEEVQLFYYFIKSERNPKEVPLLLWLSGGPGCSS  86

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSET  443
            +S  F+E GP+T+    + G IP L   PY+WTKV++II++DQPVGTG+SYS T
Sbjct  87   ISGLFYENGPVTVKLEVNNGTIPSLVSTPYSWTKVSSIIYLDQPVGTGFSYSRT  140



>ref|XP_010656845.1| PREDICTED: serine carboxypeptidase-like 13 [Vitis vinifera]
Length=480

 Score =   154 bits (390),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 94/119 (79%), Gaps = 1/119 (1%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
             ++++TLPGFP +LPF L TGY+GVGE++ +QLFYYF++S+++P  DPL+LWLTGGPGCS
Sbjct  33   RSIIKTLPGFPGELPFYLETGYVGVGENESVQLFYYFVKSQRNPVLDPLVLWLTGGPGCS  92

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAY  455
             LSAFF+E GP++ N   + G +P LEL  Y WT+  NII++D PVGTG+SYS T + Y
Sbjct  93   TLSAFFYESGPVSFNLTYN-GGLPTLELKEYTWTETLNIIYLDAPVGTGFSYSTTQEGY  150



>ref|NP_198467.2| serine carboxypeptidase-like 1 [Arabidopsis thaliana]
 sp|Q8RWJ6.1|SCP1_ARATH RecName: Full=Serine carboxypeptidase-like 1; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAM13043.1| serine carboxypeptidase [Arabidopsis thaliana]
 gb|AAM91325.1| serine carboxypeptidase [Arabidopsis thaliana]
 gb|AED94054.1| serine carboxypeptidase-like 1 [Arabidopsis thaliana]
Length=441

 Score =   154 bits (389),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 69/116 (59%), Positives = 90/116 (78%), Gaps = 0/116 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            ++V++LPGF  +LPF+L TGYIGVGE +E+QLFYYFI+SE++P+ DPL+LWLTGGPGCS 
Sbjct  31   SIVKSLPGFEGQLPFELETGYIGVGEEEEVQLFYYFIKSERNPKEDPLILWLTGGPGCSA  90

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSD  449
            +S   FE GPLT+      G +P L    Y+WTK ++IIF+DQPVGTG+SYS T  
Sbjct  91   ISGLLFENGPLTMKLDVYNGTLPSLVSTTYSWTKTSSIIFLDQPVGTGFSYSRTQQ  146



>ref|XP_011457835.1| PREDICTED: serine carboxypeptidase-like 7 [Fragaria vesca subsp. 
vesca]
Length=467

 Score =   154 bits (390),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 91/119 (76%), Gaps = 1/119 (1%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
              +VETLPG+   LPFKL TGYI V +  E+ LFYYF+ES+++P  DPL+LWLTGGPGCS
Sbjct  23   RTIVETLPGWNGTLPFKLETGYISVDDLDEVNLFYYFVESDRNPIEDPLVLWLTGGPGCS  82

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAY  455
            G SAF +EIGP T +  +  G IP + +NPY+WTKVANIIF+D PVG G+SYS +S+ +
Sbjct  83   GFSAFAYEIGPFTFD-LHYNGSIPTIVMNPYSWTKVANIIFIDAPVGAGFSYSTSSEGW  140



>ref|XP_006345611.1| PREDICTED: serine carboxypeptidase-like 19-like [Solanum tuberosum]
Length=388

 Score =   153 bits (386),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 89/115 (77%), Gaps = 0/115 (0%)
 Frame = +3

Query  108  VETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGLS  287
            V+ LPGF   LPF+L TGYIGVGE+ E+QLFYYFI+S+ + + DPL+ W TGGPGCS LS
Sbjct  33   VKYLPGFEGPLPFQLETGYIGVGEANEVQLFYYFIKSQSNSKIDPLIYWFTGGPGCSPLS  92

Query  288  AFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDA  452
            A  FE+GP+T++     G +P L LNPYA+TKVAN+IFVD PVG+GYSY+ T  A
Sbjct  93   AILFELGPITMDIRAYNGSLPTLSLNPYAYTKVANMIFVDLPVGSGYSYATTQKA  147



>ref|XP_006433653.1| hypothetical protein CICLE_v10001059mg [Citrus clementina]
 gb|ESR46893.1| hypothetical protein CICLE_v10001059mg [Citrus clementina]
Length=467

 Score =   154 bits (389),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 87/115 (76%), Gaps = 0/115 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
             +  + LPGF   LPF+L TGY+GVGES++ QLFYYF++SEK+P+ DPLLLWLTGGPGCS
Sbjct  24   RSTAKFLPGFQGPLPFELETGYVGVGESEDAQLFYYFVKSEKNPKEDPLLLWLTGGPGCS  83

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSET  443
              SA  +EIGP+  N     G +P L LNPY+WTK A+I+FVD PVGTG+SY  T
Sbjct  84   AFSALVYEIGPINFNILEYNGSLPTLHLNPYSWTKEASILFVDSPVGTGFSYVRT  138



>emb|CBI17847.3| unnamed protein product [Vitis vinifera]
Length=530

 Score =   155 bits (391),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 94/119 (79%), Gaps = 1/119 (1%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
             ++++TLPGFP +LPF L TGY+GVGE++ +QLFYYF++S+++P  DPL+LWLTGGPGCS
Sbjct  83   RSIIKTLPGFPGELPFYLETGYVGVGENESVQLFYYFVKSQRNPVLDPLVLWLTGGPGCS  142

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAY  455
             LSAFF+E GP++ N   + G +P LEL  Y WT+  NII++D PVGTG+SYS T + Y
Sbjct  143  TLSAFFYESGPVSFNLTYN-GGLPTLELKEYTWTETLNIIYLDAPVGTGFSYSTTQEGY  200



>dbj|BAA96893.1| serine carboxypeptidase [Arabidopsis thaliana]
Length=512

 Score =   154 bits (390),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 69/116 (59%), Positives = 90/116 (78%), Gaps = 0/116 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            ++V++LPGF  +LPF+L TGYIGVGE +E+QLFYYFI+SE++P+ DPL+LWLTGGPGCS 
Sbjct  31   SIVKSLPGFEGQLPFELETGYIGVGEEEEVQLFYYFIKSERNPKEDPLILWLTGGPGCSA  90

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSD  449
            +S   FE GPLT+      G +P L    Y+WTK ++IIF+DQPVGTG+SYS T  
Sbjct  91   ISGLLFENGPLTMKLDVYNGTLPSLVSTTYSWTKTSSIIFLDQPVGTGFSYSRTQQ  146



>ref|XP_010464717.1| PREDICTED: serine carboxypeptidase-like 7 isoform X1 [Camelina 
sativa]
Length=440

 Score =   153 bits (387),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 91/115 (79%), Gaps = 0/115 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            ++VE LPGF   LPF+L TGYIGVGE +E+QLFYYFI+SE++P+  PLLLWL+GGPGCS 
Sbjct  27   SIVEFLPGFDGPLPFELETGYIGVGEEEEVQLFYYFIKSERNPKEVPLLLWLSGGPGCSS  86

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETS  446
            +S  F+E GP+T+    + G IP L   PY+WTKV++II++DQPVGTG+SYS T 
Sbjct  87   ISGLFYENGPVTVKLEVNNGTIPSLVSTPYSWTKVSSIIYLDQPVGTGFSYSRTQ  141



>ref|XP_006472315.1| PREDICTED: serine carboxypeptidase-like 18-like isoform X1 [Citrus 
sinensis]
Length=487

 Score =   154 bits (388),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 87/115 (76%), Gaps = 0/115 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
             + V+ LPGF   L F+L TGY+GVGES++ QLFYYF++SEK+P+ DPLLLWLTGGPGCS
Sbjct  24   RSTVKFLPGFQGPLSFELETGYVGVGESEDAQLFYYFVKSEKNPKEDPLLLWLTGGPGCS  83

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSET  443
              SA  +EIGP+  N     G +P L LNPY+WTK A+I+FVD PVGTG+SY  T
Sbjct  84   AFSALVYEIGPINFNILEYNGSLPTLHLNPYSWTKEASILFVDSPVGTGFSYVRT  138



>ref|XP_006472317.1| PREDICTED: serine carboxypeptidase-like 18-like isoform X3 [Citrus 
sinensis]
Length=463

 Score =   153 bits (387),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 87/115 (76%), Gaps = 0/115 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
             + V+ LPGF   L F+L TGY+GVGES++ QLFYYF++SEK+P+ DPLLLWLTGGPGCS
Sbjct  24   RSTVKFLPGFQGPLSFELETGYVGVGESEDAQLFYYFVKSEKNPKEDPLLLWLTGGPGCS  83

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSET  443
              SA  +EIGP+  N     G +P L LNPY+WTK A+I+FVD PVGTG+SY  T
Sbjct  84   AFSALVYEIGPINFNILEYNGSLPTLHLNPYSWTKEASILFVDSPVGTGFSYVRT  138



>ref|XP_002510077.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF52264.1| serine carboxypeptidase, putative [Ricinus communis]
Length=468

 Score =   153 bits (387),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 69/118 (58%), Positives = 92/118 (78%), Gaps = 0/118 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
            ++ ++ LPGF   LPF L TGYIGV ES+++QLFYYF++S+++ + DPLLLWLTGGPGCS
Sbjct  27   YSTIKYLPGFQGPLPFSLETGYIGVDESEDVQLFYYFVKSQRNAKEDPLLLWLTGGPGCS  86

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDA  452
            GLS   +EIGPLT       G +P L LNP++WT+VA+IIF+D PVGTG+SY++T  A
Sbjct  87   GLSGLLYEIGPLTFEVVEYNGSLPTLILNPHSWTQVASIIFIDIPVGTGFSYAQTQLA  144



>ref|XP_008237699.1| PREDICTED: serine carboxypeptidase-like 2 [Prunus mume]
Length=449

 Score =   153 bits (386),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 66/109 (61%), Positives = 84/109 (77%), Gaps = 0/109 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
             V+++LPGFP  LPFKL TGYIGV E +++QLFYYF+E E++P  DPL+LWLTGGP CSG
Sbjct  17   TVIKSLPGFPGFLPFKLETGYIGVDEKEDVQLFYYFVECERNPRDDPLMLWLTGGPTCSG  76

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGY  428
            LS   FEIGP+  N     G +P   +NPY+WTKV++IIFVD P+GTG+
Sbjct  77   LSGLAFEIGPMKFNMVEYNGSLPTFVINPYSWTKVSSIIFVDAPIGTGF  125



>gb|KJB58678.1| hypothetical protein B456_009G221000 [Gossypium raimondii]
Length=398

 Score =   152 bits (384),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 71/117 (61%), Positives = 85/117 (73%), Gaps = 0/117 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            + V+ LPGF   LPF+L TGY+GVG+S+E QLFYYF++SE  PE DPLL WLTGGPGCS 
Sbjct  19   SAVKFLPGFEGPLPFELETGYVGVGDSEEAQLFYYFVKSEGKPEDDPLLFWLTGGPGCSA  78

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDA  452
             S   FEIGPL        G +P L  NPYAWTKV+NIIF+D PVGTG+SY+  + A
Sbjct  79   FSGLVFEIGPLKFKVDVYNGSLPTLVYNPYAWTKVSNIIFIDSPVGTGFSYATNNRA  135



>ref|XP_010515304.1| PREDICTED: serine carboxypeptidase-like 7 [Camelina sativa]
Length=442

 Score =   153 bits (386),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 90/114 (79%), Gaps = 0/114 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            ++V++LPGF   LPF+L TGYIGVGE +E+QLFYYFI+SE++PE DPLLLWL+GGPGCS 
Sbjct  32   SIVKSLPGFDGLLPFELETGYIGVGEEEEVQLFYYFIKSERNPEEDPLLLWLSGGPGCSS  91

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSET  443
            +S   +E GPLT+      G +P L    Y+WTKV++II++DQPVGTG+SYS T
Sbjct  92   ISGLLYENGPLTVKREVYNGTLPSLVSTTYSWTKVSSIIYLDQPVGTGFSYSRT  145



>ref|XP_002268517.1| PREDICTED: serine carboxypeptidase-like 17 [Vitis vinifera]
 emb|CBI17849.3| unnamed protein product [Vitis vinifera]
Length=472

 Score =   153 bits (387),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 91/118 (77%), Gaps = 0/118 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            ++++TLPG+  +LPF L TGY+GVGE++E+QLFY F++S+++P  DPL++WLTGGPGCS 
Sbjct  28   SIIKTLPGYSGELPFYLETGYVGVGENEEVQLFYMFVKSQRNPVLDPLVMWLTGGPGCST  87

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAY  455
             SAFF+  GPL+ +Y N TG +P L LN Y WT   NII+VD PVG G+SYS T + Y
Sbjct  88   FSAFFYGNGPLSFDYKNYTGGLPSLLLNEYTWTSGLNIIYVDTPVGAGFSYSRTQEGY  145



>ref|XP_010694002.1| PREDICTED: serine carboxypeptidase-like 10 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=374

 Score =   151 bits (382),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 92/119 (77%), Gaps = 2/119 (2%)
 Frame = +3

Query  105  VVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGL  284
            V++++PG+P  LPF L TGY+GVG+++ +QLFYYFI+SE++P+TDPL+LWLTGGPGCS L
Sbjct  38   VIKSVPGYPDNLPFYLETGYVGVGDNEGVQLFYYFIKSERNPQTDPLILWLTGGPGCSAL  97

Query  285  SAFFFEIGPLTINYA--NSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAY  455
            S    EIGPL  N +  N     P  +LNP++WTKVA+IIF+D PVGTG+SY+   + Y
Sbjct  98   SGLVLEIGPLIFNTSAFNWHSKAPTFQLNPFSWTKVASIIFLDSPVGTGFSYATDPEHY  156



>emb|CDP17658.1| unnamed protein product [Coffea canephora]
Length=457

 Score =   153 bits (386),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 91/117 (78%), Gaps = 0/117 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            +VV+ LPGF + LPF L TGYIGVGES+++QLFYYF++SE +P+ DPLL+WLTGGPGCS 
Sbjct  33   SVVKFLPGFESPLPFVLETGYIGVGESEDVQLFYYFVKSESNPQIDPLLIWLTGGPGCSS  92

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDA  452
            +S   +EIGP+        G +P L  NPY+WTK+A+IIF+D PVGTG+SY+ T+ A
Sbjct  93   ISGLAYEIGPVKFQRVLYDGTLPKLMTNPYSWTKLASIIFLDSPVGTGFSYARTAKA  149



>ref|XP_006404766.1| hypothetical protein EUTSA_v10000651mg [Eutrema salsugineum]
 gb|ESQ46219.1| hypothetical protein EUTSA_v10000651mg [Eutrema salsugineum]
Length=435

 Score =   152 bits (385),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 71/114 (62%), Positives = 89/114 (78%), Gaps = 0/114 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            +VV+ LPGF   LPF+L TGYIG+GE +E+QLFYYFI+SEK+P+ DPLL+WLTGGPGCS 
Sbjct  24   SVVKFLPGFEGPLPFELETGYIGLGEEEEVQLFYYFIKSEKNPQEDPLLIWLTGGPGCSS  83

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSET  443
            L A  FE GPL + +    G +P L    Y+WTK+ANIIF+DQPVG G+SYS+T
Sbjct  84   LFALLFENGPLALKFEVYNGSLPSLVSTSYSWTKMANIIFLDQPVGGGFSYSKT  137



>ref|XP_006472316.1| PREDICTED: serine carboxypeptidase-like 18-like isoform X2 [Citrus 
sinensis]
Length=467

 Score =   153 bits (386),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 87/115 (76%), Gaps = 0/115 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
             + V+ LPGF   L F+L TGY+GVGES++ QLFYYF++SEK+P+ DPLLLWLTGGPGCS
Sbjct  24   RSTVKFLPGFQGPLSFELETGYVGVGESEDAQLFYYFVKSEKNPKEDPLLLWLTGGPGCS  83

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSET  443
              SA  +EIGP+  N     G +P L LNPY+WTK A+I+FVD PVGTG+SY  T
Sbjct  84   AFSALVYEIGPINFNILEYNGSLPTLHLNPYSWTKEASILFVDSPVGTGFSYVRT  138



>gb|KDO81474.1| hypothetical protein CISIN_1g012236mg [Citrus sinensis]
Length=467

 Score =   153 bits (386),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 87/115 (76%), Gaps = 0/115 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
             + V+ LPGF   L F+L TGY+GVGES++ QLFYYF++SEK+P+ DPLLLWLTGGPGCS
Sbjct  24   RSTVKFLPGFQGPLSFELETGYVGVGESEDAQLFYYFVKSEKNPKEDPLLLWLTGGPGCS  83

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSET  443
              SA  +EIGP+  N     G +P L LNPY+WTK A+I+FVD PVGTG+SY  T
Sbjct  84   AFSALVYEIGPINFNILEYNGSLPTLHLNPYSWTKEASILFVDSPVGTGFSYVRT  138



>ref|XP_010464720.1| PREDICTED: serine carboxypeptidase-like 7 [Camelina sativa]
Length=443

 Score =   152 bits (385),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 69/115 (60%), Positives = 90/115 (78%), Gaps = 0/115 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            ++VE+LPGF   LPF+L TGYIGVGE +E+QLFYYFI+SE++P+ DPLLLWL+GGPGCS 
Sbjct  30   SIVESLPGFDGPLPFELETGYIGVGEEEEVQLFYYFIKSERNPKEDPLLLWLSGGPGCSS  89

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETS  446
            +S   +E GPLT+      G +P L    Y+WTKV++II++DQPVGTG+SYS T 
Sbjct  90   ISGLLYENGPLTVKLEVYNGTLPSLVSTTYSWTKVSSIIYLDQPVGTGFSYSRTQ  144



>emb|CDY09545.1| BnaC05g23740D [Brassica napus]
Length=436

 Score =   152 bits (384),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 70/114 (61%), Positives = 88/114 (77%), Gaps = 0/114 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            +V++ LPGF   LPF+L TGYIGVGE++E Q+FYYFI+SE++PE DPLL+WL+GGPGCS 
Sbjct  26   SVIKYLPGFEGPLPFELETGYIGVGEAEEDQMFYYFIKSERNPEEDPLLVWLSGGPGCSS  85

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSET  443
            L+  F+E GPL  N     G IP L    Y+WTKVANII++DQPVGTG+SYS  
Sbjct  86   LTGLFYENGPLAFNVEPYNGSIPSLVSTTYSWTKVANIIYLDQPVGTGFSYSRN  139



>gb|EPS73196.1| hypothetical protein M569_01551 [Genlisea aurea]
Length=444

 Score =   152 bits (384),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 89/119 (75%), Gaps = 8/119 (7%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            ++VE LPGF   LPFKL TGY+GVGE++   LFYYFIESE+ P TDPL++W+TGGPGCS 
Sbjct  22   SIVENLPGFSGALPFKLETGYVGVGENE---LFYYFIESERDPVTDPLIIWITGGPGCSA  78

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            LS   +EIGP+T N     G  P L+LNPY+WTK A+I+FVD PVGTG+SYS T   Y 
Sbjct  79   LSGLVYEIGPMTFN-----GSSPVLKLNPYSWTKAASIVFVDSPVGTGFSYSTTPQGYQ  132



>ref|XP_010277008.1| PREDICTED: serine carboxypeptidase-like 18 isoform X2 [Nelumbo 
nucifera]
Length=448

 Score =   152 bits (384),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 66/112 (59%), Positives = 86/112 (77%), Gaps = 0/112 (0%)
 Frame = +3

Query  108  VETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGLS  287
            +++LPGF   LPF+L TGY+ V ES+++ LFYYFI+SE+ P+ DPL+LWLTGGPGCS LS
Sbjct  30   IQSLPGFQGPLPFELETGYVSVDESEDVHLFYYFIKSERDPKHDPLMLWLTGGPGCSALS  89

Query  288  AFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSET  443
               FEIGPL I      G +P L LNPY+WTK ++IIF+D P+GTG+SYS +
Sbjct  90   GLLFEIGPLRIETMKYNGSLPSLALNPYSWTKASSIIFLDSPIGTGFSYSSS  141



>sp|Q9C7Z9.2|SCP18_ARATH RecName: Full=Serine carboxypeptidase-like 18; Flags: Precursor 
[Arabidopsis thaliana]
Length=464

 Score =   152 bits (385),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 88/119 (74%), Gaps = 0/119 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            +V+  LPGF   LPF L TGYIGVGE +++QLFYYFI+SE +PE DPL++WLTGGP C+ 
Sbjct  27   SVISYLPGFEGLLPFHLETGYIGVGEGEKVQLFYYFIKSENNPEEDPLIIWLTGGPACTA  86

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            LSA  FEIGPLT       G +P L    Y+WTKVA+IIF+DQPVGTGYSYS T  +Y 
Sbjct  87   LSALAFEIGPLTFKTEGYNGGLPSLVSTSYSWTKVASIIFLDQPVGTGYSYSTTPLSYK  145



>ref|NP_174619.1| serine carboxypeptidase-like 18 [Arabidopsis thaliana]
 gb|AAG51208.1|AC051630_5 serine carboxypeptidase, putative; 88458-86107 [Arabidopsis thaliana]
 gb|AEE31604.1| serine carboxypeptidase-like 18 [Arabidopsis thaliana]
Length=446

 Score =   152 bits (384),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 88/119 (74%), Gaps = 0/119 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            +V+  LPGF   LPF L TGYIGVGE +++QLFYYFI+SE +PE DPL++WLTGGP C+ 
Sbjct  27   SVISYLPGFEGLLPFHLETGYIGVGEGEKVQLFYYFIKSENNPEEDPLIIWLTGGPACTA  86

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            LSA  FEIGPLT       G +P L    Y+WTKVA+IIF+DQPVGTGYSYS T  +Y 
Sbjct  87   LSALAFEIGPLTFKTEGYNGGLPSLVSTSYSWTKVASIIFLDQPVGTGYSYSTTPLSYK  145



>ref|XP_006345532.1| PREDICTED: serine carboxypeptidase-like 18-like isoform X2 [Solanum 
tuberosum]
Length=338

 Score =   150 bits (379),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 89/115 (77%), Gaps = 0/115 (0%)
 Frame = +3

Query  108  VETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGLS  287
            V+ LPGF   LPF+L TGYIGVGE+ E+QLFYYFI+S+ +P+ DPL+ W TGGPGCS LS
Sbjct  27   VKYLPGFERPLPFQLETGYIGVGEADEVQLFYYFIKSQSNPKVDPLIYWFTGGPGCSPLS  86

Query  288  AFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDA  452
              FFE GP+T++     G +P L LNP+A+TKVA++IFVD PVGTG+SY+ T  A
Sbjct  87   GIFFEFGPITLDTRAYNGSLPTLSLNPHAYTKVASMIFVDLPVGTGFSYATTQKA  141



>gb|KFK38432.1| hypothetical protein AALP_AA3G112600 [Arabis alpina]
Length=441

 Score =   152 bits (384),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 69/115 (60%), Positives = 89/115 (77%), Gaps = 0/115 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            ++V+ LPGF   LPF+L TGYIG+GE +E+QLFYYFI+SE++PE DPLLLWL+GGPGCS 
Sbjct  31   SIVKFLPGFDGPLPFELETGYIGIGEKEEVQLFYYFIKSERNPEQDPLLLWLSGGPGCSC  90

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETS  446
            +S   FE GPLT+      G +P L    Y+WTKV++II++DQPVGTG+SYS T 
Sbjct  91   ISGLLFENGPLTVKLDAYNGTLPSLVSTTYSWTKVSSIIYLDQPVGTGFSYSRTQ  145



>ref|XP_009600999.1| PREDICTED: serine carboxypeptidase-like 7 isoform X1 [Nicotiana 
tomentosiformis]
Length=465

 Score =   152 bits (385),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 89/115 (77%), Gaps = 0/115 (0%)
 Frame = +3

Query  108  VETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGLS  287
            V+ LPGF   LPF+L TGYIGV +S++ QLFYYFI+SE +PE+DP+LLW+TGGPGCS LS
Sbjct  29   VKLLPGFKGPLPFELETGYIGVDDSEDTQLFYYFIKSESNPESDPILLWITGGPGCSALS  88

Query  288  AFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDA  452
               +EIGP+T       G +P + LNPY+WTKVA+IIF+D PVGTG+SY+ T  A
Sbjct  89   GLIYEIGPITFEPVEYNGSLPTMILNPYSWTKVASIIFLDLPVGTGFSYARTPAA  143



>ref|XP_009601001.1| PREDICTED: serine carboxypeptidase-like 7 isoform X2 [Nicotiana 
tomentosiformis]
Length=464

 Score =   152 bits (385),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 89/115 (77%), Gaps = 0/115 (0%)
 Frame = +3

Query  108  VETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGLS  287
            V+ LPGF   LPF+L TGYIGV +S++ QLFYYFI+SE +PE+DP+LLW+TGGPGCS LS
Sbjct  29   VKLLPGFKGPLPFELETGYIGVDDSEDTQLFYYFIKSESNPESDPILLWITGGPGCSALS  88

Query  288  AFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDA  452
               +EIGP+T       G +P + LNPY+WTKVA+IIF+D PVGTG+SY+ T  A
Sbjct  89   GLIYEIGPITFEPVEYNGSLPTMILNPYSWTKVASIIFLDLPVGTGFSYARTPAA  143



>ref|XP_009135216.1| PREDICTED: serine carboxypeptidase-like 15 [Brassica rapa]
Length=453

 Score =   152 bits (384),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 72/115 (63%), Positives = 86/115 (75%), Gaps = 0/115 (0%)
 Frame = +3

Query  108  VETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGLS  287
            V  LPGF   LPF+L TGYIGVGE++E QLFYYFI+SE++P  DPLL+WLTGGPGCS LS
Sbjct  41   VRYLPGFQGPLPFELETGYIGVGEAEEDQLFYYFIKSERNPSEDPLLIWLTGGPGCSSLS  100

Query  288  AFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDA  452
                E GPL  N  + +G+IP L    Y+WTKVANII++DQPVGTG+SYS    A
Sbjct  101  GLILENGPLAFNIESDSGNIPSLVSTTYSWTKVANIIYLDQPVGTGFSYSRNRLA  155



>gb|AAN60354.1| unknown [Arabidopsis thaliana]
Length=411

 Score =   151 bits (382),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 87/114 (76%), Gaps = 0/114 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            ++V+ LPGF   L F+L TGYIG+GE +E+QLFYYFI+SEK+PE DPLLLWL+GGPGCS 
Sbjct  24   SIVKFLPGFEGPLSFELETGYIGIGEEEEVQLFYYFIKSEKNPEEDPLLLWLSGGPGCSS  83

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSET  443
            L+   FE GP+ + +    G +P L    Y+WTK+ANIIF+DQPVG G+SYS T
Sbjct  84   LTGLLFENGPVALKFEVYNGSVPSLVSTAYSWTKMANIIFLDQPVGAGFSYSRT  137



>ref|XP_009771130.1| PREDICTED: serine carboxypeptidase-like 13 isoform X3 [Nicotiana 
sylvestris]
Length=411

 Score =   151 bits (382),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 69/120 (58%), Positives = 87/120 (73%), Gaps = 0/120 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
            H+ VE LPGF   LPF L TGYIGVGE +E+QLFYYF++SE  P  DP+L+WL+GGPGCS
Sbjct  32   HSTVEFLPGFEGPLPFHLETGYIGVGEYEEVQLFYYFLKSESEPTKDPILIWLSGGPGCS  91

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
              +A  ++IGPL        G +P L LNP +WTKVANIIF+DQPV +G+SY+ TS  + 
Sbjct  92   SFTALVYQIGPLYFEPNEYNGSLPKLTLNPNSWTKVANIIFLDQPVNSGFSYATTSTTFK  151



>ref|XP_009114926.1| PREDICTED: LOW QUALITY PROTEIN: serine carboxypeptidase-like 
18 [Brassica rapa]
Length=468

 Score =   152 bits (385),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 72/114 (63%), Positives = 85/114 (75%), Gaps = 0/114 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            +V+  LPGF   LPF L TGYIGVGE +++QLFYYFI+SE  PE DPLL+WLTGGP C+ 
Sbjct  31   SVISHLPGFEGPLPFHLETGYIGVGEEEKVQLFYYFIKSENKPEEDPLLIWLTGGPACTA  90

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSET  443
            LSA  FEIGPLT       G +P L    Y+WTKVA+IIF+DQPVGTG+SYS T
Sbjct  91   LSALAFEIGPLTFKTEGYNGGLPSLVSTSYSWTKVASIIFLDQPVGTGFSYSTT  144



>ref|XP_010277006.1| PREDICTED: serine carboxypeptidase-like 1 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010277007.1| PREDICTED: serine carboxypeptidase-like 1 isoform X1 [Nelumbo 
nucifera]
Length=467

 Score =   152 bits (384),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 66/112 (59%), Positives = 86/112 (77%), Gaps = 0/112 (0%)
 Frame = +3

Query  108  VETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGLS  287
            +++LPGF   LPF+L TGY+ V ES+++ LFYYFI+SE+ P+ DPL+LWLTGGPGCS LS
Sbjct  30   IQSLPGFQGPLPFELETGYVSVDESEDVHLFYYFIKSERDPKHDPLMLWLTGGPGCSALS  89

Query  288  AFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSET  443
               FEIGPL I      G +P L LNPY+WTK ++IIF+D P+GTG+SYS +
Sbjct  90   GLLFEIGPLRIETMKYNGSLPSLALNPYSWTKASSIIFLDSPIGTGFSYSSS  141



>ref|XP_008452659.1| PREDICTED: serine carboxypeptidase-like 18 isoform X5 [Cucumis 
melo]
Length=348

 Score =   150 bits (379),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 88/112 (79%), Gaps = 0/112 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
            ++ V  LPGFP  LPF+L TGY+GVG+S E Q+F+YF++S+++P+TDPLLLWLTGGPGCS
Sbjct  21   YSTVNHLPGFPGPLPFQLETGYVGVGDSDEFQIFHYFVKSDQNPKTDPLLLWLTGGPGCS  80

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSY  434
             LS   FEIGP++     +   IP L LNPY+WTK ++I+FVD PVGTG+SY
Sbjct  81   ALSGLVFEIGPISFKEEEAKESIPQLILNPYSWTKNSSILFVDLPVGTGFSY  132



>ref|XP_008236290.1| PREDICTED: serine carboxypeptidase-like 17 isoform X2 [Prunus 
mume]
Length=473

 Score =   152 bits (385),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 69/115 (60%), Positives = 84/115 (73%), Gaps = 0/115 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
              +V+ LPGF   LPFKL TGY+GVG S+E+Q+FYYF ESE SPE DPLLLW+TGGP CS
Sbjct  32   QTIVKNLPGFSGDLPFKLETGYVGVGNSEELQMFYYFTESESSPENDPLLLWMTGGPRCS  91

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSET  443
                  +EIGP++  + + + D   L LNPY+WTKVANIIF+D P  TGYSYS T
Sbjct  92   SFYGLIYEIGPISFQFNDLSKDPLKLVLNPYSWTKVANIIFLDAPAATGYSYSTT  146



>gb|KFK41348.1| hypothetical protein AALP_AA2G118800 [Arabis alpina]
Length=445

 Score =   152 bits (383),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 89/114 (78%), Gaps = 0/114 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            ++V+ LPGF   LPF+L TGYIGVGE +E+QLFYYFI+SE +P+ DPLL+W+ GGPGCS 
Sbjct  23   SIVKFLPGFEGPLPFELETGYIGVGEEEELQLFYYFIKSENNPQEDPLLIWMNGGPGCSS  82

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSET  443
            +  F +EIGPLTI      G+IP L  + Y+WTK+ANI+F+DQPVG+G+SY  T
Sbjct  83   VYGFLYEIGPLTIKIEAYDGNIPSLVPSTYSWTKMANILFLDQPVGSGFSYKRT  136



>ref|XP_004289672.1| PREDICTED: serine carboxypeptidase-like 13 [Fragaria vesca subsp. 
vesca]
Length=474

 Score =   152 bits (384),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 69/116 (59%), Positives = 85/116 (73%), Gaps = 0/116 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
             ++++ LP F   LPFKL TGY+GVG+S+E+QLFYY +ESE+SPE DPLL+WLTGGP CS
Sbjct  31   QSIIKNLPAFHGDLPFKLETGYVGVGDSEEVQLFYYLVESERSPENDPLLIWLTGGPRCS  90

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETS  446
                  +EIGP++    N + D   L LNP +W KVANIIFVD P GTGYSYS TS
Sbjct  91   SFYGLIYEIGPMSFELTNLSTDPLTLVLNPNSWNKVANIIFVDAPAGTGYSYSTTS  146



>gb|KJB58677.1| hypothetical protein B456_009G221000 [Gossypium raimondii]
Length=455

 Score =   152 bits (384),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 71/117 (61%), Positives = 85/117 (73%), Gaps = 0/117 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            + V+ LPGF   LPF+L TGY+GVG+S+E QLFYYF++SE  PE DPLL WLTGGPGCS 
Sbjct  19   SAVKFLPGFEGPLPFELETGYVGVGDSEEAQLFYYFVKSEGKPEDDPLLFWLTGGPGCSA  78

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDA  452
             S   FEIGPL        G +P L  NPYAWTKV+NIIF+D PVGTG+SY+  + A
Sbjct  79   FSGLVFEIGPLKFKVDVYNGSLPTLVYNPYAWTKVSNIIFIDSPVGTGFSYATNNRA  135



>gb|KFK41349.1| hypothetical protein AALP_AA2G118800 [Arabis alpina]
Length=440

 Score =   152 bits (383),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 89/114 (78%), Gaps = 0/114 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            ++V+ LPGF   LPF+L TGYIGVGE +E+QLFYYFI+SE +P+ DPLL+W+ GGPGCS 
Sbjct  23   SIVKFLPGFEGPLPFELETGYIGVGEEEELQLFYYFIKSENNPQEDPLLIWMNGGPGCSS  82

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSET  443
            +  F +EIGPLTI      G+IP L  + Y+WTK+ANI+F+DQPVG+G+SY  T
Sbjct  83   VYGFLYEIGPLTIKIEAYDGNIPSLVPSTYSWTKMANILFLDQPVGSGFSYKRT  136



>ref|XP_004289772.1| PREDICTED: serine carboxypeptidase-like 18 [Fragaria vesca subsp. 
vesca]
Length=484

 Score =   152 bits (385),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 85/118 (72%), Gaps = 0/118 (0%)
 Frame = +3

Query  105  VVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGL  284
            +  TLPG+   LPF L TGY+ VG+  ++Q FYYFIES++ P  DPLLLWLTGGPGCSG 
Sbjct  39   ITTTLPGYNGTLPFSLETGYVSVGDLDQLQFFYYFIESQRDPVKDPLLLWLTGGPGCSGF  98

Query  285  SAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            S   +EIGPLT +Y    G  P    NP++WT++ANIIF+D PVGTG+SYS T + YN
Sbjct  99   SGLVYEIGPLTFDYIAFNGSFPTFVDNPFSWTQIANIIFIDAPVGTGFSYSTTQEGYN  156



>emb|CDP06920.1| unnamed protein product [Coffea canephora]
Length=298

 Score =   149 bits (375),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 91/117 (78%), Gaps = 0/117 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            ++V+ LPGF   LPF+L TGYIGVGES+++QLFY FI+SE +PE+DPL+LWL GGPGCS 
Sbjct  34   SIVKFLPGFQGPLPFELETGYIGVGESEDVQLFYAFIKSESNPESDPLILWLDGGPGCSS  93

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDA  452
              A FF  GP+ +   +  G +P+L LNPY WTKV +II++D PVGTG+SY++T+ A
Sbjct  94   FIALFFGTGPVIVEPLSFDGTLPNLILNPYTWTKVVSIIYLDSPVGTGFSYAKTAKA  150



>ref|XP_006472322.1| PREDICTED: serine carboxypeptidase-like 18-like [Citrus sinensis]
Length=468

 Score =   152 bits (383),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 69/115 (60%), Positives = 87/115 (76%), Gaps = 0/115 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
            ++ V+ LPGF   LPF+L TGY+GVGES + QLFY+F++SEK+P  DPLLLWLTGGPGCS
Sbjct  25   YSTVKFLPGFQGPLPFELETGYVGVGESGDAQLFYFFVKSEKNPREDPLLLWLTGGPGCS  84

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSET  443
              S   +EIGP+        G +P L LNPY+WTK A+I+FVD PVGTGYSY++T
Sbjct  85   AFSGLAYEIGPINFKVVEYNGSLPTLHLNPYSWTKEASILFVDSPVGTGYSYAKT  139



>gb|KCW63482.1| hypothetical protein EUGRSUZ_G01114 [Eucalyptus grandis]
Length=437

 Score =   151 bits (382),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 88/118 (75%), Gaps = 3/118 (3%)
 Frame = +3

Query  105  VVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGL  284
            +VETLPGFP +LPFKL TGYI VGE   ++ FYYF++S  +P  DPLL ++ GGPGCSGL
Sbjct  37   IVETLPGFPGRLPFKLETGYISVGE---VEFFYYFVQSTGNPGADPLLFFMNGGPGCSGL  93

Query  285  SAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            +AF F+IGPL  N  + TG +P L   P AWTK ANIIF+D PVG G+SY+ T+ AYN
Sbjct  94   NAFLFQIGPLKFNITDYTGGLPSLIYEPDAWTKTANIIFIDAPVGAGFSYATTASAYN  151



>gb|EPS64042.1| hypothetical protein M569_10739, partial [Genlisea aurea]
Length=183

 Score =   145 bits (366),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 85/111 (77%), Gaps = 0/111 (0%)
 Frame = +3

Query  105  VVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGL  284
            +VETLPGF  +LPFKL TGYIGVGE + IQ+FYYFIESE+ P +DPL++WLTGGPGCSG 
Sbjct  17   IVETLPGFTGRLPFKLETGYIGVGEKEAIQMFYYFIESERDPVSDPLVIWLTGGPGCSGF  76

Query  285  SAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYS  437
            S   +EIG   + +      +P L L  ++WTKVA+IIF+D PVGTG+SYS
Sbjct  77   SGLAYEIGESNLFHLYIFFGMPFLVLRSHSWTKVASIIFIDSPVGTGFSYS  127



>ref|XP_006345531.1| PREDICTED: serine carboxypeptidase-like 18-like isoform X1 [Solanum 
tuberosum]
Length=389

 Score =   150 bits (380),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 89/115 (77%), Gaps = 0/115 (0%)
 Frame = +3

Query  108  VETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGLS  287
            V+ LPGF   LPF+L TGYIGVGE+ E+QLFYYFI+S+ +P+ DPL+ W TGGPGCS LS
Sbjct  27   VKYLPGFERPLPFQLETGYIGVGEADEVQLFYYFIKSQSNPKVDPLIYWFTGGPGCSPLS  86

Query  288  AFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDA  452
              FFE GP+T++     G +P L LNP+A+TKVA++IFVD PVGTG+SY+ T  A
Sbjct  87   GIFFEFGPITLDTRAYNGSLPTLSLNPHAYTKVASMIFVDLPVGTGFSYATTQKA  141



>ref|XP_008452658.1| PREDICTED: serine carboxypeptidase-like 18 isoform X4 [Cucumis 
melo]
Length=399

 Score =   150 bits (380),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 88/112 (79%), Gaps = 0/112 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
            ++ V  LPGFP  LPF+L TGY+GVG+S E Q+F+YF++S+++P+TDPLLLWLTGGPGCS
Sbjct  21   YSTVNHLPGFPGPLPFQLETGYVGVGDSDEFQIFHYFVKSDQNPKTDPLLLWLTGGPGCS  80

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSY  434
             LS   FEIGP++     +   IP L LNPY+WTK ++I+FVD PVGTG+SY
Sbjct  81   ALSGLVFEIGPISFKEEEAKESIPQLILNPYSWTKNSSILFVDLPVGTGFSY  132



>ref|XP_006415266.1| hypothetical protein EUTSA_v10007559mg [Eutrema salsugineum]
 gb|ESQ33619.1| hypothetical protein EUTSA_v10007559mg [Eutrema salsugineum]
Length=465

 Score =   152 bits (383),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 88/112 (79%), Gaps = 0/112 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            +V+  LPGF   LPF L TGYIGVGE +++QLFYYF++SE +PE DPLL+WL+GGP CS 
Sbjct  28   SVISHLPGFEGPLPFHLETGYIGVGEGEKVQLFYYFVKSENNPEEDPLLIWLSGGPACSS  87

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYS  437
            +SA  FEIGPLT N   ++G +P L    Y+WTK+A+IIF+DQPVGTG+SYS
Sbjct  88   ISALAFEIGPLTFNTEGNSGGLPSLVSTSYSWTKIASIIFLDQPVGTGFSYS  139



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 563956788320