BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002E05

Length=512
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010064092.1|  PREDICTED: metacaspase-4-like                      259   7e-82   Eucalyptus grandis [rose gum]
gb|ACF74337.1|  latex-abundant protein                                  249   4e-81   Arachis hypogaea [goober]
ref|XP_009628053.1|  PREDICTED: metacaspase-4-like                      258   4e-81   Nicotiana tomentosiformis
gb|AFK93071.1|  MC2                                                     257   5e-81   Petunia x hybrida [garden petunia]
ref|XP_011095833.1|  PREDICTED: metacaspase-4                           257   6e-81   Sesamum indicum [beniseed]
gb|KHN38174.1|  Metacaspase-4                                           257   8e-81   Glycine soja [wild soybean]
gb|EYU27600.1|  hypothetical protein MIMGU_mgv1a006138mg                258   8e-81   Erythranthe guttata [common monkey flower]
ref|XP_003531810.1|  PREDICTED: metacaspase-4-like                      256   2e-80   Glycine max [soybeans]
ref|NP_001237747.1|  uncharacterized protein LOC100527809               250   2e-80   
ref|XP_009791657.1|  PREDICTED: metacaspase-4-like                      256   2e-80   Nicotiana sylvestris
ref|XP_003546660.1|  PREDICTED: metacaspase-4-like                      256   2e-80   Glycine max [soybeans]
ref|NP_001266198.1|  metacaspase 1                                      256   3e-80   Solanum lycopersicum
gb|ADM52185.1|  type II metacaspase                                     256   3e-80   Hevea brasiliensis [jebe]
ref|XP_008448231.1|  PREDICTED: metacaspase-4-like                      255   5e-80   Cucumis melo [Oriental melon]
ref|XP_006366715.1|  PREDICTED: metacaspase-4-like                      254   6e-80   Solanum tuberosum [potatoes]
gb|KEH19330.1|  ICE-like protease (caspase) p20 domain protein          254   7e-80   Medicago truncatula
ref|XP_007133458.1|  hypothetical protein PHAVU_011G180300g             254   7e-80   Phaseolus vulgaris [French bean]
ref|XP_007022751.1|  Caspase, putative                                  254   7e-80   Theobroma cacao [chocolate]
gb|ACG59943.1|  metacaspase type II                                     254   8e-80   Nicotiana tabacum [American tobacco]
gb|AAD13216.1|  latex-abundant protein                                  253   2e-79   Hevea brasiliensis [jebe]
ref|XP_006389898.1|  hypothetical protein EUTSA_v10018618mg             253   2e-79   Eutrema salsugineum [saltwater cress]
ref|XP_002887781.1|  metacaspase 7                                      253   2e-79   Arabidopsis lyrata subsp. lyrata
ref|XP_011086327.1|  PREDICTED: metacaspase-5-like                      253   2e-79   Sesamum indicum [beniseed]
gb|KDP27423.1|  hypothetical protein JCGZ_20833                         253   2e-79   Jatropha curcas
ref|XP_007133456.1|  hypothetical protein PHAVU_011G180200g             253   3e-79   Phaseolus vulgaris [French bean]
gb|KFK42339.1|  hypothetical protein AALP_AA2G243500                    253   3e-79   Arabis alpina [alpine rockcress]
emb|CDP17955.1|  unnamed protein product                                253   4e-79   Coffea canephora [robusta coffee]
ref|XP_004510001.1|  PREDICTED: metacaspase-4-like                      253   4e-79   Cicer arietinum [garbanzo]
ref|XP_006584543.1|  PREDICTED: uncharacterized protein LOC100527...    253   5e-79   
ref|XP_010260805.1|  PREDICTED: metacaspase-4                           252   6e-79   Nelumbo nucifera [Indian lotus]
ref|XP_009368619.1|  PREDICTED: metacaspase-4-like                      252   7e-79   Pyrus x bretschneideri [bai li]
emb|CDX87390.1|  BnaA07g34830D                                          251   8e-79   
ref|XP_008383212.1|  PREDICTED: metacaspase-4-like                      251   1e-78   Malus domestica [apple tree]
ref|XP_010472789.1|  PREDICTED: metacaspase-4                           251   1e-78   Camelina sativa [gold-of-pleasure]
ref|XP_009106655.1|  PREDICTED: metacaspase-4                           251   1e-78   Brassica rapa
emb|CDX88530.1|  BnaC06g39740D                                          251   1e-78   
ref|XP_004154541.1|  PREDICTED: metacaspase-4-like                      251   2e-78   
ref|XP_004139955.1|  PREDICTED: metacaspase-5-like                      251   2e-78   Cucumis sativus [cucumbers]
ref|XP_009368616.1|  PREDICTED: metacaspase-4-like                      249   5e-78   Pyrus x bretschneideri [bai li]
ref|XP_010926867.1|  PREDICTED: metacaspase-5-like                      249   5e-78   Elaeis guineensis
gb|AAP84710.2|  metacaspase 7                                           249   5e-78   Arabidopsis thaliana [mouse-ear cress]
ref|NP_178052.1|  metacaspase 4                                         249   6e-78   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008798724.1|  PREDICTED: metacaspase-5-like                      249   7e-78   Phoenix dactylifera
ref|XP_011014334.1|  PREDICTED: metacaspase-4                           249   8e-78   Populus euphratica
ref|XP_010429817.1|  PREDICTED: metacaspase-4-like                      249   9e-78   Camelina sativa [gold-of-pleasure]
ref|XP_009363318.1|  PREDICTED: metacaspase-4-like                      249   1e-77   Pyrus x bretschneideri [bai li]
ref|XP_002316158.1|  latex abundant family protein                      249   1e-77   Populus trichocarpa [western balsam poplar]
ref|XP_010537828.1|  PREDICTED: metacaspase-4                           248   1e-77   Tarenaya hassleriana [spider flower]
ref|XP_007211951.1|  hypothetical protein PRUPE_ppa006400mg             249   1e-77   Prunus persica
ref|XP_010417598.1|  PREDICTED: metacaspase-4-like isoform X1           248   2e-77   Camelina sativa [gold-of-pleasure]
gb|KJB81456.1|  hypothetical protein B456_013G146600                    248   2e-77   Gossypium raimondii
ref|XP_002518827.1|  caspase, putative                                  248   2e-77   Ricinus communis
emb|CDX79312.1|  BnaC06g19910D                                          244   3e-77   
ref|XP_006302314.1|  hypothetical protein CARUB_v10020362mg             248   4e-77   Capsella rubella
ref|XP_006422307.1|  hypothetical protein CICLE_v10006644mg             246   1e-76   
ref|XP_008346071.1|  PREDICTED: metacaspase-4-like                      246   1e-76   
ref|XP_006493737.1|  PREDICTED: metacaspase-4-like                      246   1e-76   Citrus sinensis [apfelsine]
ref|XP_011013178.1|  PREDICTED: metacaspase-4-like                      246   1e-76   Populus euphratica
gb|AAM51555.1|  metacaspase 1                                           244   4e-76   Solanum lycopersicum
gb|KFK42336.1|  hypothetical protein AALP_AA2G243200                    244   7e-76   Arabis alpina [alpine rockcress]
emb|CDX67998.1|  BnaA07g20380D                                          241   1e-75   
ref|XP_002311278.1|  latex abundant family protein                      244   1e-75   
ref|XP_004488558.1|  PREDICTED: metacaspase-5-like                      243   2e-75   
gb|AES66180.2|  ICE-like protease (caspase) p20 domain protein          243   2e-75   Medicago truncatula
ref|NP_178049.2|  metacaspase 7                                         243   2e-75   Arabidopsis thaliana [mouse-ear cress]
gb|AAP84709.1|  metacaspase 4                                           243   2e-75   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006302347.1|  hypothetical protein CARUB_v10020403mg             242   3e-75   Capsella rubella
ref|XP_010092466.1|  hypothetical protein L484_019225                   243   3e-75   Morus notabilis
ref|XP_004293812.1|  PREDICTED: metacaspase-4                           243   3e-75   Fragaria vesca subsp. vesca
ref|XP_002887778.1|  predicted protein                                  241   6e-75   
ref|XP_006855871.1|  hypothetical protein AMTR_s00037p00126540          241   1e-74   Amborella trichopoda
ref|XP_009408643.1|  PREDICTED: metacaspase-5-like                      241   1e-74   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010537827.1|  PREDICTED: metacaspase-5-like                      241   1e-74   Tarenaya hassleriana [spider flower]
ref|XP_008225985.1|  PREDICTED: LOW QUALITY PROTEIN: metacaspase-4      241   1e-74   Prunus mume [ume]
ref|XP_009104536.1|  PREDICTED: metacaspase-7                           239   2e-74   Brassica rapa
emb|CDX87391.1|  BnaA07g34820D                                          239   4e-74   
ref|XP_003595929.1|  Metacaspase type II                                238   7e-74   
emb|CDX83532.1|  BnaC07g22720D                                          238   8e-74   
ref|XP_010417594.1|  PREDICTED: metacaspase-7                           238   9e-74   Camelina sativa [gold-of-pleasure]
emb|CDX88529.1|  BnaC06g39730D                                          238   1e-73   
ref|XP_008362957.1|  PREDICTED: LOW QUALITY PROTEIN: metacaspase-...    231   2e-73   
ref|XP_010472785.1|  PREDICTED: metacaspase-7                           238   2e-73   Camelina sativa [gold-of-pleasure]
gb|KFK42338.1|  hypothetical protein AALP_AA2G243400                    234   5e-73   Arabis alpina [alpine rockcress]
ref|XP_010429812.1|  PREDICTED: metacaspase-7-like                      236   1e-72   Camelina sativa [gold-of-pleasure]
ref|XP_009106654.1|  PREDICTED: metacaspase-5-like                      235   1e-72   Brassica rapa
ref|XP_009417202.1|  PREDICTED: metacaspase-5-like                      236   1e-72   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010472787.1|  PREDICTED: metacaspase-5-like                      235   2e-72   Camelina sativa [gold-of-pleasure]
emb|CDY56807.1|  BnaA02g36200D                                          235   2e-72   Brassica napus [oilseed rape]
ref|XP_010666272.1|  PREDICTED: metacaspase-5-like                      235   2e-72   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002887780.1|  type-II metacaspase                                234   3e-72   Arabidopsis lyrata subsp. lyrata
ref|XP_009128349.1|  PREDICTED: metacaspase-5                           235   3e-72   Brassica rapa
ref|NP_178050.1|  metacaspase 6                                         233   4e-72   Arabidopsis thaliana [mouse-ear cress]
emb|CDY22271.1|  BnaC02g25750D                                          234   6e-72   Brassica napus [oilseed rape]
ref|XP_010417596.1|  PREDICTED: metacaspase-5-like                      234   7e-72   Camelina sativa [gold-of-pleasure]
ref|XP_010429814.1|  PREDICTED: LOW QUALITY PROTEIN: metacaspase-...    234   7e-72   Camelina sativa [gold-of-pleasure]
ref|XP_006389899.1|  hypothetical protein EUTSA_v10018629mg             233   9e-72   Eutrema salsugineum [saltwater cress]
gb|EPS59062.1|  hypothetical protein M569_15748                         233   9e-72   Genlisea aurea
ref|XP_006389900.1|  hypothetical protein EUTSA_v10018721mg             232   1e-71   Eutrema salsugineum [saltwater cress]
gb|EYU33806.1|  hypothetical protein MIMGU_mgv1a007841mg                233   1e-71   Erythranthe guttata [common monkey flower]
ref|XP_010472786.1|  PREDICTED: metacaspase-6-like                      231   2e-71   Camelina sativa [gold-of-pleasure]
emb|CBI24133.3|  unnamed protein product                                231   4e-71   Vitis vinifera
ref|XP_006301048.1|  hypothetical protein CARUB_v10021440mg             231   5e-71   Capsella rubella
emb|CDY39817.1|  BnaA09g10690D                                          229   5e-71   Brassica napus [oilseed rape]
emb|CDY03252.1|  BnaC09g10960D                                          228   7e-71   
ref|NP_001268027.1|  metacaspase-5-like                                 231   8e-71   Vitis vinifera
ref|XP_010532015.1|  PREDICTED: metacaspase-5-like                      231   1e-70   Tarenaya hassleriana [spider flower]
ref|XP_010429813.1|  PREDICTED: metacaspase-6                           229   1e-70   Camelina sativa [gold-of-pleasure]
ref|XP_010417595.1|  PREDICTED: metacaspase-6-like                      229   1e-70   Camelina sativa [gold-of-pleasure]
emb|CDX87392.1|  BnaA07g34810D                                          229   2e-70   
ref|XP_009112709.1|  PREDICTED: metacaspase-6-like                      228   2e-70   Brassica rapa
ref|XP_010248373.1|  PREDICTED: metacaspase-5-like                      229   3e-70   Nelumbo nucifera [Indian lotus]
ref|XP_009106653.1|  PREDICTED: metacaspase-6-like                      228   3e-70   Brassica rapa
ref|XP_002887779.1|  predicted protein                                  227   6e-70   Arabidopsis lyrata subsp. lyrata
ref|XP_007149156.1|  hypothetical protein PHAVU_005G046100g             227   1e-69   Phaseolus vulgaris [French bean]
ref|NP_178051.1|  metacaspase 5                                         228   2e-69   Arabidopsis thaliana [mouse-ear cress]
gb|EAY76152.1|  hypothetical protein OsI_04084                          227   3e-69   Oryza sativa Indica Group [Indian rice]
ref|NP_001044530.1|  Os01g0799900                                       227   3e-69   
gb|EPS69363.1|  hypothetical protein M569_05402                         227   4e-69   Genlisea aurea
emb|CDX88528.1|  BnaC06g39720D                                          223   3e-68   
ref|XP_006644845.1|  PREDICTED: metacaspase-4-like                      224   5e-68   Oryza brachyantha
ref|XP_010232456.1|  PREDICTED: metacaspase-4-like                      224   7e-68   Brachypodium distachyon [annual false brome]
dbj|BAJ91232.1|  predicted protein                                      223   9e-68   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CAD59226.2|  metacaspase type II                                    222   2e-67   Picea abies
ref|XP_004970257.1|  PREDICTED: metacaspase-4-like                      223   2e-67   Setaria italica
gb|AET08881.1|  metacaspase 1                                           222   2e-67   Aegilops tauschii
gb|ACY82389.1|  type II metacaspase                                     221   3e-67   Triticum aestivum [Canadian hard winter wheat]
gb|AET08880.1|  metacaspase 1                                           221   7e-67   Aegilops speltoides
emb|CDM84568.1|  unnamed protein product                                220   1e-66   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010417593.1|  PREDICTED: metacaspase-5-like                      220   1e-66   Camelina sativa [gold-of-pleasure]
emb|CDX88526.1|  BnaC06g39700D                                          217   1e-66   
ref|XP_006302384.1|  hypothetical protein CARUB_v10020450mg             218   3e-66   Capsella rubella
ref|XP_010472784.1|  PREDICTED: metacaspase-6-like isoform X2           218   3e-66   Camelina sativa [gold-of-pleasure]
ref|XP_009106652.1|  PREDICTED: metacaspase-5-like                      219   3e-66   Brassica rapa
gb|ABK24525.1|  unknown                                                 219   3e-66   Picea sitchensis
ref|XP_010429811.1|  PREDICTED: metacaspase-5-like                      218   5e-66   Camelina sativa [gold-of-pleasure]
ref|XP_010472783.1|  PREDICTED: metacaspase-5-like isoform X1           218   5e-66   Camelina sativa [gold-of-pleasure]
ref|XP_006304434.1|  hypothetical protein CARUB_v10011040mg             217   1e-65   Capsella rubella
emb|CDX87393.1|  BnaA07g34800D                                          217   1e-65   
gb|ACB11499.1|  metacaspase type II                                     218   1e-65   Pinus sylvestris [Scotch pine]
ref|XP_002978512.1|  hypothetical protein SELMODRAFT_152567             218   2e-65   Selaginella moellendorffii
gb|AGT16256.1|  metacaspase                                             217   3e-65   Saccharum hybrid cultivar R570
tpg|DAA57249.1|  TPA: putative metacaspase family protein               216   4e-65   
ref|XP_002456486.1|  hypothetical protein SORBIDRAFT_03g037160          216   4e-65   Sorghum bicolor [broomcorn]
emb|CDX81762.1|  BnaC08g38390D                                          214   2e-64   
ref|XP_002970440.1|  hypothetical protein SELMODRAFT_270839             215   2e-64   
ref|XP_010497832.1|  PREDICTED: metacaspase-8-like isoform X1           209   2e-64   Camelina sativa [gold-of-pleasure]
ref|XP_009117766.1|  PREDICTED: metacaspase-8                           213   2e-64   Brassica rapa
gb|AAC17037.1|  Contains similarity to S. cerevisiae hypothetical...    212   8e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006416820.1|  hypothetical protein EUTSA_v10007917mg             211   2e-63   Eutrema salsugineum [saltwater cress]
gb|KFK42337.1|  hypothetical protein AALP_AA2G243300                    220   2e-63   Arabis alpina [alpine rockcress]
ref|XP_003568187.2|  PREDICTED: metacaspase-5-like                      215   8e-63   
gb|KFK44631.1|  hypothetical protein AALP_AA1G283800                    209   2e-62   Arabis alpina [alpine rockcress]
ref|NP_001055939.1|  Os05g0496500                                       208   6e-62   
ref|XP_010476753.1|  PREDICTED: metacaspase-8-like                      207   7e-62   Camelina sativa [gold-of-pleasure]
ref|XP_004961631.1|  PREDICTED: metacaspase-5-like                      207   1e-61   Setaria italica
ref|XP_010459183.1|  PREDICTED: metacaspase-8-like                      206   1e-61   Camelina sativa [gold-of-pleasure]
ref|XP_008776827.1|  PREDICTED: LOW QUALITY PROTEIN: metacaspase-...    208   1e-61   Phoenix dactylifera
ref|XP_006654594.1|  PREDICTED: metacaspase-5-like                      207   2e-61   Oryza brachyantha
dbj|BAJ89979.1|  predicted protein                                      205   6e-61   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002441316.1|  hypothetical protein SORBIDRAFT_09g024370          205   8e-61   Sorghum bicolor [broomcorn]
ref|XP_002892907.1|  hypothetical protein ARALYDRAFT_471839             203   2e-60   
gb|AET08886.1|  metacaspase 3                                           201   6e-59   Aegilops tauschii
gb|AET08885.1|  metacaspase 3                                           200   8e-59   Triticum monococcum [einkorn wheat]
ref|XP_002441314.1|  hypothetical protein SORBIDRAFT_09g024350          197   9e-58   
ref|NP_001140337.1|  uncharacterized protein LOC100272384               197   1e-57   Zea mays [maize]
gb|AET08889.1|  metacaspase 3                                           196   3e-57   Aegilops speltoides
dbj|BAD42967.1|  hypothetical protein                                   194   5e-57   Arabidopsis thaliana [mouse-ear cress]
ref|NP_173092.1|  metacaspase 8                                         194   6e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001773634.1|  predicted protein                                  193   5e-56   
emb|CDY59452.1|  BnaAnng16050D                                          191   8e-56   Brassica napus [oilseed rape]
ref|XP_004961632.1|  PREDICTED: metacaspase-4-like                      192   1e-55   Setaria italica
gb|EAY98562.1|  hypothetical protein OsI_20476                          191   2e-55   Oryza sativa Indica Group [Indian rice]
ref|NP_001055938.1|  Os05g0496400                                       191   2e-55   
ref|NP_001151968.1|  metacaspase type II                                190   3e-55   Zea mays [maize]
ref|XP_001760554.1|  predicted protein                                  189   1e-54   
gb|AJP06423.1|  MC5                                                     184   3e-53   Picea abies
ref|XP_008364242.1|  PREDICTED: metacaspase-4-like                      175   6e-52   
ref|NP_196040.1|  metacaspase 9                                         179   9e-52   Arabidopsis thaliana [mouse-ear cress]
gb|AAM63441.1|  latex-abundant protein-like                             179   9e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008455778.1|  PREDICTED: metacaspase-9                           178   2e-51   Cucumis melo [Oriental melon]
ref|XP_006430431.1|  hypothetical protein CICLE_v10012209mg             178   2e-51   Citrus clementina [clementine]
ref|XP_001760622.1|  predicted protein                                  181   2e-51   
gb|AAT07577.1|  unknown protein                                         181   3e-51   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007010765.1|  Metacaspase 9                                      177   3e-51   
ref|XP_002871080.1|  hypothetical protein ARALYDRAFT_908304             179   8e-51   
emb|CDY41391.1|  BnaCnng10270D                                          173   9e-51   Brassica napus [oilseed rape]
gb|ABD28668.1|  Peptidase C14, caspase catalytic subunit p20            176   1e-50   Medicago truncatula
ref|XP_006481975.1|  PREDICTED: metacaspase-9-like                      176   2e-50   Citrus sinensis [apfelsine]
ref|XP_011040678.1|  PREDICTED: metacaspase-9-like                      175   3e-50   Populus euphratica
ref|XP_006398876.1|  hypothetical protein EUTSA_v10014106mg             175   3e-50   Eutrema salsugineum [saltwater cress]
gb|KFK24867.1|  hypothetical protein AALP_AA8G035200                    175   4e-50   Arabis alpina [alpine rockcress]
ref|XP_010251722.1|  PREDICTED: metacaspase-9 isoform X2                175   4e-50   Nelumbo nucifera [Indian lotus]
ref|XP_010922110.1|  PREDICTED: metacaspase-9                           175   4e-50   
ref|XP_006832890.1|  hypothetical protein AMTR_s00095p00111310          174   6e-50   Amborella trichopoda
ref|XP_009395937.1|  PREDICTED: metacaspase-9                           173   2e-49   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008811948.1|  PREDICTED: metacaspase-9                           173   2e-49   Phoenix dactylifera
ref|XP_004169821.1|  PREDICTED: LOW QUALITY PROTEIN: metacaspase-...    173   2e-49   
ref|XP_004144301.1|  PREDICTED: metacaspase-9-like                      173   2e-49   Cucumis sativus [cucumbers]
ref|XP_010055397.1|  PREDICTED: metacaspase-9                           173   3e-49   Eucalyptus grandis [rose gum]
gb|AFK49292.1|  unknown                                                 172   4e-49   Medicago truncatula
gb|KHG04687.1|  Metacaspase-9 -like protein                             172   4e-49   Gossypium arboreum [tree cotton]
emb|CDX70251.1|  BnaA10g26000D                                          172   5e-49   
gb|KJB67853.1|  hypothetical protein B456_010G214900                    172   6e-49   Gossypium raimondii
ref|XP_010558138.1|  PREDICTED: metacaspase-9                           171   1e-48   Tarenaya hassleriana [spider flower]
ref|XP_002307934.1|  latex-abundant family protein                      171   1e-48   
emb|CDY35259.1|  BnaA01g07720D                                          171   1e-48   Brassica napus [oilseed rape]
ref|XP_006288211.1|  hypothetical protein CARUB_v10001449mg             171   2e-48   Capsella rubella
ref|XP_010673225.1|  PREDICTED: metacaspase-9-like isoform X1           171   2e-48   Beta vulgaris subsp. vulgaris [field beet]
emb|CDY61770.1|  BnaAnng17710D                                          171   2e-48   Brassica napus [oilseed rape]
ref|NP_001142392.1|  uncharacterized protein LOC100274565               172   2e-48   Zea mays [maize]
ref|XP_010423614.1|  PREDICTED: metacaspase-9                           171   2e-48   Camelina sativa [gold-of-pleasure]
ref|XP_009125548.1|  PREDICTED: metacaspase-9                           171   2e-48   Brassica rapa
ref|XP_004493282.1|  PREDICTED: metacaspase-9-like                      170   2e-48   Cicer arietinum [garbanzo]
ref|XP_007010767.1|  Metacaspase 9                                      170   3e-48   
ref|XP_007161829.1|  hypothetical protein PHAVU_001G101400g             170   4e-48   Phaseolus vulgaris [French bean]
ref|XP_010490925.1|  PREDICTED: metacaspase-9-like                      170   4e-48   Camelina sativa [gold-of-pleasure]
gb|EMS48949.1|  Metacaspase-4                                           172   4e-48   Triticum urartu
ref|XP_009122627.1|  PREDICTED: metacaspase-9                           169   4e-48   Brassica rapa
ref|XP_002322580.2|  latex-abundant family protein                      169   9e-48   
ref|XP_011041315.1|  PREDICTED: metacaspase-9-like                      168   1e-47   Populus euphratica
gb|AET08883.1|  metacaspase 2                                           169   1e-47   Aegilops speltoides
gb|AET08884.1|  metacaspase 2                                           169   2e-47   Aegilops tauschii
dbj|BAK00262.1|  predicted protein                                      168   2e-47   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006301624.1|  hypothetical protein CARUB_v10022065mg             168   2e-47   
gb|AET08882.1|  metacaspase 2                                           168   3e-47   Triticum monococcum [einkorn wheat]
ref|XP_010111290.1|  hypothetical protein L484_027943                   167   3e-47   Morus notabilis
ref|XP_001750356.1|  hypothetical protein                               169   4e-47   Monosiga brevicollis MX1
ref|XP_002283757.1|  PREDICTED: metacaspase-9                           167   4e-47   Vitis vinifera
ref|XP_004291543.1|  PREDICTED: metacaspase-9                           167   5e-47   Fragaria vesca subsp. vesca
gb|AGJ94053.1|  metacaspase-6                                           167   5e-47   Vitis vinifera
ref|XP_004978429.1|  PREDICTED: metacaspase-9-like                      167   6e-47   Setaria italica
emb|CBI32852.3|  unnamed protein product                                167   6e-47   Vitis vinifera
ref|XP_010251721.1|  PREDICTED: metacaspase-9 isoform X1                166   2e-46   
ref|XP_002517452.1|  caspase, putative                                  165   3e-46   Ricinus communis
ref|XP_003554078.1|  PREDICTED: metacaspase-9-like                      164   5e-46   Glycine max [soybeans]
gb|KHN34591.1|  Metacaspase-9                                           164   5e-46   Glycine soja [wild soybean]
ref|XP_010673221.1|  PREDICTED: metacaspase-9-like                      164   5e-46   Beta vulgaris subsp. vulgaris [field beet]
gb|EAY79833.1|  hypothetical protein OsI_34992                          165   5e-46   Oryza sativa Indica Group [Indian rice]
ref|NP_001065680.1|  Os11g0134700                                       164   7e-46   
emb|CBX25424.1|  hypothetical_protein                                   164   7e-46   Oryza glaberrima
ref|XP_008227368.1|  PREDICTED: metacaspase-9                           164   1e-45   Prunus mume [ume]
ref|XP_002451746.1|  hypothetical protein SORBIDRAFT_04g007090          164   1e-45   
ref|XP_011079135.1|  PREDICTED: metacaspase-9                           163   1e-45   Sesamum indicum [beniseed]
ref|XP_004977462.1|  PREDICTED: metacaspase-9-like                      163   1e-45   Setaria italica
ref|XP_006664310.1|  PREDICTED: metacaspase-9-like                      164   2e-45   
ref|XP_010232359.1|  PREDICTED: metacaspase-9                           163   2e-45   Brachypodium distachyon [annual false brome]
gb|KJB67854.1|  hypothetical protein B456_010G215000                    162   2e-45   Gossypium raimondii
ref|XP_002454039.1|  hypothetical protein SORBIDRAFT_04g023560          162   2e-45   Sorghum bicolor [broomcorn]
ref|XP_007205546.1|  hypothetical protein PRUPE_ppa008597mg             162   4e-45   Prunus persica
ref|XP_009364872.1|  PREDICTED: metacaspase-9                           162   5e-45   Pyrus x bretschneideri [bai li]
emb|CDP11653.1|  unnamed protein product                                160   1e-44   Coffea canephora [robusta coffee]
emb|CBX25236.1|  hypothetical_protein                                   161   1e-44   Oryza brachyantha
gb|KDP45463.1|  hypothetical protein JCGZ_09712                         160   1e-44   Jatropha curcas
ref|XP_008360431.1|  PREDICTED: metacaspase-9                           159   8e-44   
ref|XP_002887777.1|  predicted protein                                  155   1e-42   
gb|KHN35317.1|  Metacaspase-4                                           156   5e-42   Glycine soja [wild soybean]
ref|XP_001691826.1|  metacaspase type II                                154   3e-41   Chlamydomonas reinhardtii
gb|KJB67823.1|  hypothetical protein B456_010G213000                    154   1e-40   Gossypium raimondii
gb|KJB67827.1|  hypothetical protein B456_010G213400                    149   2e-40   Gossypium raimondii
gb|EYU20858.1|  hypothetical protein MIMGU_mgv1a010301mg                149   2e-40   Erythranthe guttata [common monkey flower]
gb|EYU20861.1|  hypothetical protein MIMGU_mgv1a010317mg                149   3e-40   Erythranthe guttata [common monkey flower]
ref|XP_008677778.1|  PREDICTED: LOC541978 isoform X1                    154   4e-40   
gb|AFW64729.1|  putative metacaspase family protein                     149   6e-40   
ref|XP_010497836.1|  PREDICTED: metacaspase-8-like isoform X2           145   6e-40   
gb|KJB67828.1|  hypothetical protein B456_010G213500                    145   1e-39   Gossypium raimondii
ref|XP_004249355.1|  PREDICTED: metacaspase-9                           146   3e-39   Solanum lycopersicum
ref|XP_006339218.1|  PREDICTED: metacaspase-9-like                      146   5e-39   Solanum tuberosum [potatoes]
gb|AGI37355.1|  metacaspase 9                                           143   6e-38   Capsicum annuum
gb|KJB67829.1|  hypothetical protein B456_010G2136001                   138   8e-38   Gossypium raimondii
ref|XP_009777730.1|  PREDICTED: metacaspase-9                           142   1e-37   Nicotiana sylvestris
ref|XP_009619339.1|  PREDICTED: metacaspase-9                           142   2e-37   Nicotiana tomentosiformis
gb|KHG09071.1|  Metacaspase-9 -like protein                             142   2e-37   Gossypium arboreum [tree cotton]
ref|XP_002946738.1|  metacaspase type II                                140   3e-36   Volvox carteri f. nagariensis
gb|KJB67834.1|  hypothetical protein B456_010G213900                    139   3e-36   Gossypium raimondii
gb|KJB67833.1|  hypothetical protein B456_010G2138002                   138   7e-36   Gossypium raimondii
ref|XP_010673226.1|  PREDICTED: metacaspase-9-like isoform X2           137   9e-36   
gb|KHG05129.1|  Metacaspase-9 -like protein                             136   3e-35   Gossypium arboreum [tree cotton]
ref|XP_002441315.1|  hypothetical protein SORBIDRAFT_09g024360          132   1e-33   
gb|AFW82397.1|  hypothetical protein ZEAMMB73_945417                    125   4e-33   
ref|XP_001783673.1|  predicted protein                                  130   1e-32   
gb|EYU20865.1|  hypothetical protein MIMGU_mgv1a021665mg                128   3e-32   
gb|EAZ17332.1|  hypothetical protein OsJ_32856                          122   5e-30   
emb|CDP10324.1|  unnamed protein product                                120   4e-29   
gb|AGI37356.1|  metacaspase 9                                           118   6e-29   
gb|EYU20875.1|  hypothetical protein MIMGU_mgv1a027045mg                119   7e-29   
gb|EYU20873.1|  hypothetical protein MIMGU_mgv1a020746mg                119   8e-29   
emb|CDP10321.1|  unnamed protein product                                119   9e-29   
gb|KIJ60130.1|  hypothetical protein HYDPIDRAFT_117596                  119   9e-29   
ref|XP_006967256.1|  predicted protein                                  118   2e-28   
gb|KIK98103.1|  hypothetical protein PAXRUDRAFT_824230                  118   2e-28   
gb|KDR84061.1|  hypothetical protein GALMADRAFT_236691                  118   3e-28   
ref|XP_002182552.1|  metacaspase                                        117   3e-28   
ref|XP_007879908.1|  hypothetical protein PFL1_04194                    117   5e-28   
ref|XP_007768988.1|  peptidase C14                                      116   6e-28   
emb|CDR46642.1|  CYFA0S24e01794g1_1                                     117   6e-28   
gb|KIJ14768.1|  Merops: C14.UPB                                         117   1e-27   
gb|EYU20864.1|  hypothetical protein MIMGU_mgv1a009602mg                116   1e-27   
gb|ETS00489.1|  hypothetical protein M419DRAFT_25669                    117   1e-27   
ref|XP_001836373.2|  metacaspase                                        116   2e-27   
ref|XP_009218517.1|  metacaspase-1                                      115   2e-27   
emb|CDR47586.1|  CYFA0S34e00144g1_1                                     115   3e-27   
gb|EHK19010.1|  hypothetical protein TRIVIDRAFT_44076                   114   3e-27   
ref|XP_009656723.1|  metacaspase-1                                      115   4e-27   
dbj|GAA97980.1|  hypothetical protein E5Q_04660                         115   4e-27   
gb|KIW61581.1|  metacaspase-1A, variant                                 114   4e-27   
emb|CEP64105.1|  LALA0S10e02388g1_1                                     115   4e-27   
ref|XP_007870116.1|  hypothetical protein GLOTRDRAFT_141026             115   4e-27   
ref|XP_005773965.1|  putative metacaspase protein                       113   4e-27   
gb|KIN97434.1|  hypothetical protein M404DRAFT_1006084                  115   5e-27   
ref|XP_007762725.1|  hypothetical protein CONPUDRAFT_78523              115   5e-27   
gb|EPE03376.1|  caspase domain-containing protein                       114   5e-27   
ref|XP_009159197.1|  metacaspase-1                                      115   5e-27   
ref|XP_007919567.1|  putative caspase domain-containing protein         114   6e-27   
emb|CCM04227.1|  predicted protein                                      115   6e-27   
gb|ENH77201.1|  caspase domain-containing protein                       114   8e-27   
emb|CEG71351.1|  Putative Metacaspase-1                                 114   8e-27   
ref|XP_002784934.1|  conserved hypothetical protein                     114   9e-27   
ref|XP_002542438.1|  hypothetical protein UREG_01954                    114   9e-27   
gb|EMD33516.1|  hypothetical protein CERSUDRAFT_118087                  114   1e-26   
gb|KIK41284.1|  hypothetical protein CY34DRAFT_85697                    114   1e-26   
ref|XP_002171430.2|  metacaspase Pca1                                   114   1e-26   
gb|KIW43233.1|  metacaspase-1A                                          114   1e-26   
ref|NP_588503.1|  metacaspase Pca1                                      114   1e-26   
gb|EPS95938.1|  hypothetical protein FOMPIDRAFT_1168066                 113   1e-26   
ref|XP_003670307.1|  hypothetical protein NDAI_0E02470                  113   1e-26   
ref|XP_007722254.1|  metacaspase-1                                      114   1e-26   
gb|KIW10968.1|  metacaspase-1A                                          114   1e-26   
gb|KIW61580.1|  metacaspase-1A                                          114   1e-26   
gb|EQB59156.1|  hypothetical protein CGLO_00504                         113   2e-26   
sp|Q0CTN3.2|MCA1A_ASPTN  RecName: Full=Metacaspase-1A; Flags: Pre...    113   2e-26   
emb|CCX33246.1|  Similar to Metacaspase-1A; acc. no. B0XPP3             113   2e-26   
ref|XP_001212129.1|  hypothetical protein ATEG_02951                    113   2e-26   
ref|XP_007376760.1|  hypothetical protein SPAPADRAFT_62586              113   2e-26   
ref|XP_663316.1|  hypothetical protein AN5712.2                         113   2e-26   
ref|XP_007601509.1|  caspase domain-containing protein                  113   2e-26   
gb|AGC74002.1|  metacaspase A                                           113   2e-26   
gb|KIV82481.1|  metacaspase-1, variant                                  113   2e-26   
ref|XP_002784789.1|  conserved hypothetical protein                     112   2e-26   
ref|XP_002341250.1|  metacaspase CasA                                   113   3e-26   
tpe|CBF81352.1|  TPA: Metacaspase-1 Precursor (EC 3.4.22.-) [Sour...    113   3e-26   
gb|KIL60176.1|  hypothetical protein M378DRAFT_953628                   113   3e-26   
gb|KIY44706.1|  peptidase C14                                           112   3e-26   
ref|XP_011120149.1|  hypothetical protein AOL_s00054g531                113   3e-26   
gb|KIV82480.1|  metacaspase-1                                           112   3e-26   
gb|EMS21988.1|  metacaspase CasA                                        113   3e-26   
gb|KGB75178.1|  metacaspase-1                                           113   3e-26   
ref|XP_002341251.1|  metacaspase CasA                                   112   3e-26   
ref|XP_007730264.1|  hypothetical protein A1O3_01931                    112   3e-26   
gb|KIR75382.1|  metacaspase-1                                           112   3e-26   
gb|EYE99429.1|  Metacaspase-1A                                          112   3e-26   
gb|KIR35949.1|  metacaspase-1                                           112   4e-26   
gb|KIR26477.1|  metacaspase-1                                           112   4e-26   
ref|XP_007299387.1|  hypothetical protein STEHIDRAFT_49989              112   4e-26   
gb|KIK21053.1|  hypothetical protein PISMIDRAFT_681765                  112   4e-26   
ref|XP_006685061.1|  hypothetical protein CANTEDRAFT_113100             112   4e-26   
ref|XP_003958376.1|  hypothetical protein KAFR_0G02070                  112   4e-26   
gb|KDN71658.1|  putative caspase domain-containing protein              112   5e-26   
gb|KII89041.1|  hypothetical protein PLICRDRAFT_124266                  112   5e-26   
gb|ERT02639.1|  metacaspase-1                                           112   6e-26   
ref|XP_003670222.1|  hypothetical protein NDAI_0E01630                  112   6e-26   
gb|EHK43709.1|  hypothetical protein TRIATDRAFT_150123                  111   6e-26   
gb|EPY26379.1|  metacaspase                                             111   6e-26   
sp|A2RB75.2|MCA1A_ASPNC  RecName: Full=Metacaspase-1A; Flags: Pre...    112   6e-26   
emb|CCF43895.1|  caspase                                                111   6e-26   
emb|CAD60748.1|  unnamed protein product                                111   6e-26   
ref|XP_007797546.1|  putative p20 subunit of caspase protein            111   7e-26   
emb|CAK97495.1|  unnamed protein product                                112   7e-26   
ref|XP_002144299.1|  metacaspase CasA                                   112   7e-26   
gb|EHN00148.1|  Mca1p                                                   111   7e-26   
gb|EJT42622.1|  MCA1-like protein                                       111   7e-26   
ref|XP_001399027.2|  metacaspase-1A                                     112   7e-26   
ref|XP_007875242.1|  hypothetical protein PNEG_03179                    111   8e-26   
ref|XP_002561316.1|  Pc16g10060                                         112   8e-26   
ref|XP_007408685.1|  hypothetical protein MELLADRAFT_43021              111   8e-26   
emb|CEG78216.1|  Putative Metacaspase-1                                 113   8e-26   
gb|EFW20090.1|  hypothetical protein CPSG_03265                         111   9e-26   
gb|EHK23273.1|  hypothetical protein TRIVIDRAFT_178714                  111   9e-26   
gb|EPS27730.1|  hypothetical protein PDE_02674                          111   9e-26   
gb|KDN46819.1|  hypothetical protein K437DRAFT_256096                   111   9e-26   
emb|CCA73585.1|  related to metacaspase 2                               112   9e-26   
ref|XP_006964913.1|  p20 subunit of caspase                             110   9e-26   
ref|XP_001244569.1|  hypothetical protein CIMG_04010                    111   9e-26   
ref|XP_003051353.1|  hypothetical protein NECHADRAFT_69680              111   9e-26   
gb|EFQ31794.1|  caspase domain-containing protein                       111   9e-26   
ref|WP_030198662.1|  Caspase-1, p20                                     110   9e-26   
ref|XP_009544626.1|  hypothetical protein HETIRDRAFT_38579              111   1e-25   
gb|EPY30100.1|  metacaspase                                             110   1e-25   
gb|EJU04567.1|  peptidase C14                                           110   1e-25   
gb|ETS02631.1|  hypothetical protein M419DRAFT_98559                    111   1e-25   
dbj|GAM39009.1|  metacaspase                                            111   1e-25   
ref|XP_003068347.1|  metacaspase, putative                              111   1e-25   
gb|KIH88961.1|  hypothetical protein SPBR_07222                         110   1e-25   
ref|XP_007672760.1|  hypothetical protein BAUCODRAFT_145553             111   1e-25   
gb|EWC45522.1|  metacaspase-1A                                          111   1e-25   
gb|EKV08035.1|  Metacaspase-1                                           110   1e-25   
gb|AFK83575.1|  metacaspase                                             109   1e-25   
ref|XP_007846304.1|  metacaspase-1                                      112   1e-25   
ref|XP_003654059.1|  caspase-like protein                               110   1e-25   
ref|XP_008865991.1|  hypothetical protein H310_03779                    110   1e-25   
ref|XP_001929768.1|  hypothetical protein                               110   1e-25   
gb|EYU20874.1|  hypothetical protein MIMGU_mgv1a026873mg                110   1e-25   
emb|CAR12434.1|  calcium-dependent metacaspase CDP II                   110   1e-25   
gb|EPQ63299.1|  cysteine protease                                       110   2e-25   
emb|CBQ70815.1|  probable MCA1-Metacaspase                              110   2e-25   
ref|XP_002294738.1|  predicted protein                                  110   2e-25   
emb|CCE29889.1|  probable caspase                                       110   2e-25   
ref|XP_003051505.1|  hypothetical protein NECHADRAFT_103977             110   2e-25   
emb|CCU75775.1|  Metacaspase                                            110   2e-25   
gb|EME39995.1|  hypothetical protein DOTSEDRAFT_74753                   110   2e-25   
dbj|GAA90035.1|  metacaspase-1a                                         110   2e-25   
dbj|GAD93321.1|  T-complex protein 1 subunit eta                        113   2e-25   
gb|KIO28346.1|  hypothetical protein M407DRAFT_243032                   109   2e-25   
ref|XP_003675531.1|  hypothetical protein NCAS_0C01750                  110   2e-25   
gb|EKF30462.1|  metacaspase, putative                                   109   2e-25   
gb|KFA67264.1|  hypothetical protein S40285_06716                       110   3e-25   
ref|XP_009221263.1|  metacaspase-1                                      110   3e-25   
gb|KIM81909.1|  hypothetical protein PILCRDRAFT_494068                  110   3e-25   
ref|XP_007362546.1|  hypothetical protein DICSQDRAFT_80416              110   3e-25   
gb|EFQ29307.1|  caspase domain-containing protein                       110   3e-25   
gb|EQB45474.1|  caspase domain-containing protein                       110   3e-25   
gb|AGC74004.1|  metacaspase A                                           110   3e-25   
gb|KEZ43577.1|  hypothetical protein SAPIO_CDS4502                      110   3e-25   
ref|XP_009837241.1|  hypothetical protein H257_11874                    109   3e-25   
ref|XP_003032105.1|  hypothetical protein SCHCODRAFT_67867              109   3e-25   
emb|CCU81343.1|  aspartic protease                                      109   3e-25   
emb|CDI52298.1|  probable MCA1-Metacaspase                              109   3e-25   
ref|XP_008714829.1|  metacaspase-1                                      109   3e-25   
emb|CDJ57918.1|  metacaspase 1 precursor, putative                      112   3e-25   
gb|AGC74009.1|  metacaspase A                                           109   4e-25   
ref|XP_001384004.1|  hypothetical protein PICST_83452                   109   4e-25   
ref|XP_772999.1|  hypothetical protein CNBJ2750                         110   4e-25   
gb|ENH83655.1|  caspase domain-containing protein                       110   4e-25   
gb|KIM80480.1|  hypothetical protein PILCRDRAFT_73139                   108   4e-25   
gb|EST06027.1|  metacaspase involved in regulation of apoptosis         109   4e-25   
ref|XP_008726946.1|  metacaspase-1                                      109   4e-25   
ref|XP_007912695.1|  putative caspase domain-containing protein         109   4e-25   
sp|A1CQZ0.2|MCA1A_ASPCL  RecName: Full=Metacaspase-1A; Flags: Pre...    109   4e-25   
ref|XP_002381967.1|  metacaspase CasA                                   109   4e-25   
gb|KJA26739.1|  hypothetical protein HYPSUDRAFT_132403                  108   4e-25   
gb|EPY43713.1|  metacaspase                                             109   4e-25   
ref|XP_002839522.1|  hypothetical protein                               109   4e-25   
ref|XP_001731255.1|  hypothetical protein MGL_1438                      108   4e-25   
ref|XP_011387285.1|  putative metacaspase                               109   4e-25   
dbj|GAC96832.1|  hypothetical protein PHSY_004416                       108   4e-25   
ref|XP_567455.1|  metacaspase                                           109   4e-25   
emb|CEJ00695.1|  Putative Metacaspase-1A (Fragment)                     109   5e-25   
ref|XP_001219642.1|  conserved hypothetical protein                     108   5e-25   
gb|KIR89079.1|  metacaspase-1                                           109   5e-25   
ref|XP_011277157.1|  Metacaspase-1A                                     109   5e-25   
ref|XP_001818986.2|  metacaspase-1A                                     109   5e-25   
gb|KIX00726.1|  metacaspase-1A                                          109   5e-25   
gb|EHK45899.1|  hypothetical protein TRIATDRAFT_219770                  109   5e-25   
sp|Q2UN81.2|MCA1A_ASPOR  RecName: Full=Metacaspase-1A; Flags: Pre...    109   5e-25   
ref|XP_007008658.1|  hypothetical protein TREMEDRAFT_36293              109   6e-25   
ref|XP_001269487.1|  metacaspase CasA                                   109   6e-25   
gb|EIF47334.1|  putative caspase                                        109   6e-25   
gb|KFG82357.1|  metacaspase CasA                                        108   6e-25   
gb|KIW69075.1|  metacaspase-1                                           109   6e-25   
gb|KID96679.1|  metacaspase CasA                                        108   6e-25   
ref|XP_007262447.1|  peptidase C14                                      108   6e-25   
ref|XP_007756517.1|  metacaspase-1A                                     109   7e-25   
emb|CCC09455.1|  putative metacaspase                                   108   7e-25   
ref|XP_007811048.1|  metacaspase CasA                                   108   7e-25   
gb|ELQ36434.1|  metacaspase                                             108   7e-25   
ref|XP_003303929.1|  hypothetical protein PTT_16331                     108   7e-25   
gb|EKG02010.1|  metacaspase, putative,cysteine peptidase, Clan CD...    107   7e-25   
gb|KIR56920.1|  metacaspase-1                                           109   7e-25   
gb|KDQ15897.1|  hypothetical protein BOTBODRAFT_107851                  108   7e-25   
emb|CEJ92012.1|  Putative Metacaspase-1                                 108   7e-25   
ref|XP_003716368.1|  metacaspase-1                                      108   7e-25   
ref|XP_003193937.1|  metacaspase                                        109   7e-25   
gb|KEF62810.1|  hypothetical protein A1O9_00783                         108   7e-25   
sp|A1D3V4.2|MCA1A_NEOFI  RecName: Full=Metacaspase-1A; Flags: Pre...    108   7e-25   
dbj|BAE56984.1|  unnamed protein product                                108   7e-25   
gb|KIR49578.1|  metacaspase-1                                           109   7e-25   
gb|KIR68829.1|  metacaspase-1                                           109   8e-25   
ref|XP_007342143.1|  peptidase C14                                      107   8e-25   
ref|XP_003881390.1|  hypothetical protein NCLIV_044210                  110   8e-25   
ref|XP_007769645.1|  hypothetical protein CONPUDRAFT_137798             109   8e-25   
ref|XP_002553128.1|  KLTH0D09614p                                       108   8e-25   
emb|CCU99654.1|  unnamed protein product                                107   8e-25   
ref|XP_004178782.1|  hypothetical protein TBLA_0B04250                  109   8e-25   
emb|CEG80846.1|  Putative Metacaspase-1A (Fragment)                     108   8e-25   
gb|KID78471.1|  metacaspase CasA                                        108   8e-25   
emb|CCF54384.1|  probable MCA1-Metacaspase                              108   8e-25   
gb|EXV06267.1|  peptidase C14 family protein                            108   9e-25   
ref|XP_001587752.1|  conserved hypothetical protein                     108   9e-25   
ref|XP_007820806.2|  caspase domain-containing protein                  108   9e-25   
ref|XP_003344347.1|  metacaspase                                        108   9e-25   
ref|XP_002627875.1|  metacaspase-1                                      108   9e-25   
gb|EEQ87880.1|  metacaspase CasA                                        108   9e-25   
sp|B0XPP3.2|MCA1A_ASPFC  RecName: Full=Metacaspase-1A; Flags: Pre...    108   9e-25   
ref|XP_504976.1|  YALI0F04059p                                          108   1e-24   
gb|KIK97762.1|  hypothetical protein PAXRUDRAFT_759934                  108   1e-24   
gb|KIY03229.1|  metacaspase-1A                                          108   1e-24   
ref|XP_003848535.1|  hypothetical protein MYCGRDRAFT_111338             108   1e-24   
ref|XP_008039651.1|  hypothetical protein TRAVEDRAFT_149939             108   1e-24   
gb|KHO01074.1|  metacaspase CasA                                        108   1e-24   
ref|XP_007766084.1|  hypothetical protein CONPUDRAFT_120204             108   1e-24   
gb|EKG10498.1|  Peptidase C14 caspase catalytic                         108   1e-24   



>ref|XP_010064092.1| PREDICTED: metacaspase-4-like [Eucalyptus grandis]
 gb|KCW71406.1| hypothetical protein EUGRSUZ_F04472 [Eucalyptus grandis]
Length=416

 Score =   259 bits (663),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 133/161 (83%), Positives = 147/161 (91%), Gaps = 0/161 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            MARKAVLIG NYPGTKAELKGC+NDV+RMHRCLV+RYGFSEDDIT+LID D SY QPTG+
Sbjct  1    MARKAVLIGCNYPGTKAELKGCINDVKRMHRCLVERYGFSEDDITLLIDVDDSYVQPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR AL+DLV+SA  GD+LFVHYSGHGTRLPAETGEEDDTG+DECIVP D NLITDDDFR
Sbjct  61   NIRRALADLVRSAQPGDFLFVHYSGHGTRLPAETGEEDDTGYDECIVPCDMNLITDDDFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDNAD  496
            E VD +P+GCRLTIVSDSCHSGGLI++AKEQIGEST +  D
Sbjct  121  EFVDQVPEGCRLTIVSDSCHSGGLIEQAKEQIGESTRNQED  161



>gb|ACF74337.1| latex-abundant protein [Arachis hypogaea]
Length=177

 Score =   249 bits (637),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 130/159 (82%), Positives = 145/159 (91%), Gaps = 0/159 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            MA+KAVLIG NYPGTKAELKGC+NDV RMH+CLVDRYGFSEDDITVLIDTD SYTQPTG+
Sbjct  1    MAKKAVLIGCNYPGTKAELKGCINDVWRMHKCLVDRYGFSEDDITVLIDTDDSYTQPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIRSALS LV+SA  GD LFVHYSGHGTRLPAETGE+DDTG+DECIVP D NLITDDDFR
Sbjct  61   NIRSALSRLVRSARPGDVLFVHYSGHGTRLPAETGEDDDTGYDECIVPCDMNLITDDDFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDN  490
            E VD +P+GC+LTI+SDSCHSGGL+++AKEQIG ST + 
Sbjct  121  EFVDGIPRGCKLTIISDSCHSGGLVEEAKEQIGHSTKEE  159



>ref|XP_009628053.1| PREDICTED: metacaspase-4-like [Nicotiana tomentosiformis]
Length=417

 Score =   258 bits (658),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 136/164 (83%), Positives = 149/164 (91%), Gaps = 1/164 (1%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            MA+KAVLIGINYPGTKAELKGC+NDV+RM+ CL++R+GFSEDDITVLIDTD SYTQPTGR
Sbjct  1    MAKKAVLIGINYPGTKAELKGCINDVKRMYSCLINRFGFSEDDITVLIDTDDSYTQPTGR  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            N+R ALSDLV SA  GD LFVHYSGHGTRLPAETGEEDDTG+DECIVP D NLITDDDFR
Sbjct  61   NVRKALSDLVGSAEEGDSLFVHYSGHGTRLPAETGEEDDTGYDECIVPCDMNLITDDDFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDNADADD  505
            ELVD +P+GCR+TIVSDSCHSGGLIDKAKEQIGES H   D D+
Sbjct  121  ELVDKVPEGCRITIVSDSCHSGGLIDKAKEQIGES-HKQGDDDN  163



>gb|AFK93071.1| MC2 [Petunia x hybrida]
Length=416

 Score =   257 bits (657),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 134/156 (86%), Positives = 146/156 (94%), Gaps = 0/156 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            MA+KAVLIGINYPGTKAELKGC+NDV RM+ CLV+R+GFSEDDITVLIDTD SYTQPTGR
Sbjct  1    MAKKAVLIGINYPGTKAELKGCINDVTRMYSCLVNRFGFSEDDITVLIDTDDSYTQPTGR  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            N+R ALSDLV SA  GD+LFVHYSGHGTRLPAETGE+DDTGFDECIVP D NLITDDDFR
Sbjct  61   NVRKALSDLVGSAEPGDFLFVHYSGHGTRLPAETGEQDDTGFDECIVPCDMNLITDDDFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGEST  481
            ELVD +P+GC++TIVSDSCHSGGLIDKAKEQIGEST
Sbjct  121  ELVDKVPEGCQITIVSDSCHSGGLIDKAKEQIGEST  156



>ref|XP_011095833.1| PREDICTED: metacaspase-4 [Sesamum indicum]
Length=421

 Score =   257 bits (657),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 132/156 (85%), Positives = 148/156 (95%), Gaps = 0/156 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            MAR+AVLIG NYPGTKAELKGC+NDVRRM+ CLV+RYGFSE+DITVLIDTD SYTQPTGR
Sbjct  1    MARRAVLIGCNYPGTKAELKGCINDVRRMYACLVERYGFSEEDITVLIDTDDSYTQPTGR  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR+AL+DLV SA  GD+LFVHYSGHGTRLPAETGE+DDTG+DECIVP+D NLITDDDFR
Sbjct  61   NIRAALADLVSSAQPGDFLFVHYSGHGTRLPAETGEDDDTGYDECIVPTDMNLITDDDFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGEST  481
            ELVD +P+GC++TIVSDSCHSGGLID+AKEQIGEST
Sbjct  121  ELVDKVPEGCQITIVSDSCHSGGLIDEAKEQIGEST  156



>gb|KHN38174.1| Metacaspase-4 [Glycine soja]
Length=415

 Score =   257 bits (656),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 133/156 (85%), Positives = 146/156 (94%), Gaps = 0/156 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            MA+KAVLIGINYPGTKAELKGC+NDVRRM RCL+DRYGFSEDDITVLIDTD SYT+PTG+
Sbjct  1    MAKKAVLIGINYPGTKAELKGCINDVRRMQRCLIDRYGFSEDDITVLIDTDESYTEPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIRSAL+ LV+SA  GD LFVHYSGHGTRLPAETGE+DDTGFDECIVPSD NLITDDDFR
Sbjct  61   NIRSALTRLVRSAKPGDILFVHYSGHGTRLPAETGEDDDTGFDECIVPSDMNLITDDDFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGEST  481
            E VD LP+GC +TIVSDSCHSGGL+++AKEQIGEST
Sbjct  121  EFVDGLPRGCTITIVSDSCHSGGLLEEAKEQIGEST  156



>gb|EYU27600.1| hypothetical protein MIMGU_mgv1a006138mg [Erythranthe guttata]
Length=455

 Score =   258 bits (659),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 131/156 (84%), Positives = 148/156 (95%), Gaps = 0/156 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            MA+KAV+IG NYPGTKAELKGC+NDV+RM+ CLV+RYGFSEDDITVLIDTD SYTQPTGR
Sbjct  42   MAKKAVMIGCNYPGTKAELKGCINDVKRMYTCLVERYGFSEDDITVLIDTDDSYTQPTGR  101

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            N+R+AL+DLV SA  GD+LFVHYSGHGTRLPAETGE+DDTG+DECIVPSD NLITDDDFR
Sbjct  102  NVRAALADLVNSAQPGDFLFVHYSGHGTRLPAETGEDDDTGYDECIVPSDMNLITDDDFR  161

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGEST  481
            ELVD +P+GC++TIVSDSCHSGGLID+AKEQIGEST
Sbjct  162  ELVDKVPEGCQITIVSDSCHSGGLIDEAKEQIGEST  197



>ref|XP_003531810.1| PREDICTED: metacaspase-4-like [Glycine max]
Length=415

 Score =   256 bits (654),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 132/156 (85%), Positives = 146/156 (94%), Gaps = 0/156 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            MA+KAVLIGINYPGTKAELKGC+NDVRRM RCL+DRYGFSEDDITVLIDTD SYT+PTG+
Sbjct  1    MAKKAVLIGINYPGTKAELKGCINDVRRMQRCLIDRYGFSEDDITVLIDTDESYTEPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIRSAL+ LV+SA  GD LFVHYSGHGTRLPAETGE+DDTGFDECIVPSD NLITDDDFR
Sbjct  61   NIRSALTRLVRSAKPGDILFVHYSGHGTRLPAETGEDDDTGFDECIVPSDMNLITDDDFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGEST  481
            E VD +P+GC +TIVSDSCHSGGL+++AKEQIGEST
Sbjct  121  EFVDGVPRGCTITIVSDSCHSGGLLEEAKEQIGEST  156



>ref|NP_001237747.1| uncharacterized protein LOC100527809 [Glycine max]
 gb|ACU16985.1| unknown [Glycine max]
Length=232

 Score =   250 bits (638),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 132/156 (85%), Positives = 144/156 (92%), Gaps = 0/156 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            MA+KAVLIGINYPGTKAELKGC+NDV RMHRCL+DRYGFSEDDITVLIDTD SYT+PTG+
Sbjct  1    MAKKAVLIGINYPGTKAELKGCINDVWRMHRCLIDRYGFSEDDITVLIDTDESYTEPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIRSAL+ L++SA  GD LFVHYSGHGTRLPAETGE+DDTGFDECIVPSD NLITDDDFR
Sbjct  61   NIRSALTRLIRSARPGDVLFVHYSGHGTRLPAETGEDDDTGFDECIVPSDMNLITDDDFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGEST  481
            E VD +P+ C+LTIVSDSCHSGGLID AKEQIG ST
Sbjct  121  EFVDGVPRECKLTIVSDSCHSGGLIDGAKEQIGTST  156



>ref|XP_009791657.1| PREDICTED: metacaspase-4-like [Nicotiana sylvestris]
Length=417

 Score =   256 bits (654),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 134/165 (81%), Positives = 148/165 (90%), Gaps = 0/165 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            MA+KAVLIGINYPGTKAELKGC+NDV+RM+ CL++R+GFSE+DITVLIDTD SYTQPTGR
Sbjct  1    MAKKAVLIGINYPGTKAELKGCINDVKRMYSCLINRFGFSEEDITVLIDTDDSYTQPTGR  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR ALSDLV SA  GD LFVHYSGHGTRLPAETGEEDDTG+DECIVP D NLITDDDFR
Sbjct  61   NIRKALSDLVGSAEEGDSLFVHYSGHGTRLPAETGEEDDTGYDECIVPCDMNLITDDDFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDNADADDA  508
            ELVD +P+GCR+TIVSDSCHSGGLIDKAKEQIGES     D ++ 
Sbjct  121  ELVDKVPEGCRITIVSDSCHSGGLIDKAKEQIGESHKQGDDENEG  165



>ref|XP_003546660.1| PREDICTED: metacaspase-4-like [Glycine max]
 gb|KHN35771.1| Metacaspase-4 [Glycine soja]
Length=415

 Score =   256 bits (653),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 130/156 (83%), Positives = 147/156 (94%), Gaps = 0/156 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            MA+KAVLIGINYPGTKAEL+GC+NDV RMHRCL++RYGFSEDDITVLIDTD SYT+PTG+
Sbjct  1    MAKKAVLIGINYPGTKAELRGCINDVWRMHRCLIERYGFSEDDITVLIDTDESYTEPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIRSAL+ LV+SA  GD LFVHYSGHGTRLPAETGE+DDTG+DECIVPSD NLITDDDFR
Sbjct  61   NIRSALTRLVRSAEPGDVLFVHYSGHGTRLPAETGEDDDTGYDECIVPSDMNLITDDDFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGEST  481
            E VD +P+GCR+TIVSDSCHSGGL+++AKEQIGEST
Sbjct  121  EFVDGVPRGCRITIVSDSCHSGGLLEEAKEQIGEST  156



>ref|NP_001266198.1| metacaspase 1 [Solanum lycopersicum]
 gb|AFY10520.1| metacaspase [Solanum lycopersicum]
Length=416

 Score =   256 bits (653),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 136/165 (82%), Positives = 150/165 (91%), Gaps = 1/165 (1%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            MA+KAVLIGINYPGTKAEL+GC+NDV+RM+ CL++RYGF+E+DITVLIDTD SYTQPTGR
Sbjct  1    MAKKAVLIGINYPGTKAELRGCINDVKRMYNCLLNRYGFAEEDITVLIDTDDSYTQPTGR  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR ALSDLV SA SGD LFVHYSGHGTRLPAETGEEDDTGFDECIVP D NLITDDDFR
Sbjct  61   NIRKALSDLVGSAESGDCLFVHYSGHGTRLPAETGEEDDTGFDECIVPCDMNLITDDDFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDNADADDA  508
            ELVD +P+GC++TIVSDSCHSGGLIDKAKEQIGES H   D D+ 
Sbjct  121  ELVDKVPEGCQITIVSDSCHSGGLIDKAKEQIGES-HKQGDDDEG  164



>gb|ADM52185.1| type II metacaspase [Hevea brasiliensis]
Length=417

 Score =   256 bits (653),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 131/156 (84%), Positives = 144/156 (92%), Gaps = 0/156 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            MA+KAVLIGINYPGTKAELKGC+NDV+RM+RCLVDRYGFSE+DITVLIDTD SY QPTG+
Sbjct  1    MAKKAVLIGINYPGTKAELKGCINDVKRMYRCLVDRYGFSEEDITVLIDTDESYIQPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR  L+DLV+SA  GD LFVHYSGHGTRLPAETGE+DDTGFDECIVP D NLITDDDFR
Sbjct  61   NIRRVLTDLVRSAEPGDLLFVHYSGHGTRLPAETGEDDDTGFDECIVPCDMNLITDDDFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGEST  481
            E VD +P GCR+T+VSDSCHSGGLID+AKEQIGEST
Sbjct  121  EFVDQVPHGCRITVVSDSCHSGGLIDEAKEQIGEST  156



>ref|XP_008448231.1| PREDICTED: metacaspase-4-like [Cucumis melo]
Length=421

 Score =   255 bits (651),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 128/157 (82%), Positives = 147/157 (94%), Gaps = 0/157 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            M +KA+LIG NYPGTKAEL+GC+NDV+RMH+CL++RYGFSEDDI +LIDTD SYTQPTG+
Sbjct  1    MGKKAILIGCNYPGTKAELRGCINDVKRMHQCLIERYGFSEDDIEILIDTDESYTQPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIRSAL+ LVKSA  GD+LFVHYSGHGTRLPAETGE+DDTG+DECIVP+D NLITDDDFR
Sbjct  61   NIRSALARLVKSADPGDFLFVHYSGHGTRLPAETGEDDDTGYDECIVPTDMNLITDDDFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTH  484
            ELVD +P+GCRLTIVSDSCHSGGLID A+EQIGEST+
Sbjct  121  ELVDQVPEGCRLTIVSDSCHSGGLIDDAEEQIGESTN  157



>ref|XP_006366715.1| PREDICTED: metacaspase-4-like [Solanum tuberosum]
Length=416

 Score =   254 bits (650),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 136/165 (82%), Positives = 149/165 (90%), Gaps = 1/165 (1%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            MA+KAVLIGINYPGTKAEL+GC+NDV RM+ CL++R+GF+E+DITVLIDTD SYTQPTGR
Sbjct  1    MAKKAVLIGINYPGTKAELRGCINDVNRMYNCLLNRFGFAEEDITVLIDTDDSYTQPTGR  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR ALSDLV SA SGD LFVHYSGHGTRLPAETGEEDDTGFDECIVP D NLITDDDFR
Sbjct  61   NIRKALSDLVGSAESGDCLFVHYSGHGTRLPAETGEEDDTGFDECIVPCDMNLITDDDFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDNADADDA  508
            ELVD +P+GCR+TIVSDSCHSGGLIDKAKEQIGES H   D D+ 
Sbjct  121  ELVDKVPEGCRITIVSDSCHSGGLIDKAKEQIGES-HKQGDDDEG  164



>gb|KEH19330.1| ICE-like protease (caspase) p20 domain protein [Medicago truncatula]
Length=412

 Score =   254 bits (650),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 130/156 (83%), Positives = 147/156 (94%), Gaps = 0/156 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            MARKAVLIGINYPGTKAEL+GCVNDV RMH+CL++RYGFSEDDIT+LIDTD+SYT+PTG+
Sbjct  1    MARKAVLIGINYPGTKAELRGCVNDVWRMHKCLIERYGFSEDDITILIDTDSSYTEPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR  LS+LV+S+  GD LFVHYSGHGTRLPAETGE+DDTGFDECIVPSD NLITDDDF+
Sbjct  61   NIRRVLSELVRSSEDGDVLFVHYSGHGTRLPAETGEDDDTGFDECIVPSDMNLITDDDFK  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGEST  481
            E VD +P+GCRLTIVSDSCHSGGLI++AKEQIGEST
Sbjct  121  EFVDGVPRGCRLTIVSDSCHSGGLIEEAKEQIGEST  156



>ref|XP_007133458.1| hypothetical protein PHAVU_011G180300g [Phaseolus vulgaris]
 gb|ESW05452.1| hypothetical protein PHAVU_011G180300g [Phaseolus vulgaris]
Length=415

 Score =   254 bits (650),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 130/156 (83%), Positives = 146/156 (94%), Gaps = 0/156 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            MA+KAVLIGINYPGTKAELKGC+NDV RMHRCLVDRYGFSED+ITVLIDTD SY +PTG+
Sbjct  1    MAKKAVLIGINYPGTKAELKGCINDVWRMHRCLVDRYGFSEDNITVLIDTDKSYREPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIRSAL+ LV+SA  GD LFVHYSGHGTRLPAETGE+DDTG+DECIVPSD NLITDDDF+
Sbjct  61   NIRSALTSLVRSAEDGDVLFVHYSGHGTRLPAETGEDDDTGYDECIVPSDMNLITDDDFK  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGEST  481
            E VD +P+GCR+TIVSDSCHSGGL+++AKEQIGEST
Sbjct  121  EFVDGIPRGCRITIVSDSCHSGGLLEEAKEQIGEST  156



>ref|XP_007022751.1| Caspase, putative [Theobroma cacao]
 gb|EOY14276.1| Caspase, putative [Theobroma cacao]
Length=413

 Score =   254 bits (650),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 129/156 (83%), Positives = 145/156 (93%), Gaps = 0/156 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            MA+KAVLIG NYPGTKAELKGC+NDVRRM++CL +RYGFSE+DI VLIDTD S+TQPTG+
Sbjct  1    MAKKAVLIGCNYPGTKAELKGCINDVRRMYKCLTERYGFSEEDINVLIDTDESFTQPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR ALSDLV+SA  GD+LFVHYSGHGTRLPAETGE+DDTG+DECIVP D NLITDDDFR
Sbjct  61   NIRRALSDLVRSAEPGDFLFVHYSGHGTRLPAETGEDDDTGYDECIVPCDMNLITDDDFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGEST  481
            E VD +P+GCR+TIVSDSCHSGGLID+AKEQIGEST
Sbjct  121  EFVDQVPEGCRITIVSDSCHSGGLIDEAKEQIGEST  156



>gb|ACG59943.1| metacaspase type II [Nicotiana tabacum]
Length=416

 Score =   254 bits (649),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 132/165 (80%), Positives = 147/165 (89%), Gaps = 0/165 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            MA+KAV IGINYPGTKAELKGC+NDV+RM+ CL++R+GFSE+DITVLIDTD SYTQPTGR
Sbjct  1    MAKKAVFIGINYPGTKAELKGCINDVKRMYSCLINRFGFSEEDITVLIDTDDSYTQPTGR  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR ALSDLV SA  GD LFVHYSGHGTRLPAETGE+DDTG+DECIVP D NLITDDDFR
Sbjct  61   NIRKALSDLVGSAEEGDSLFVHYSGHGTRLPAETGEDDDTGYDECIVPCDMNLITDDDFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDNADADDA  508
            ELVD +P+GCR+TIVSDSCHSGGLIDKAKEQIGES     D ++ 
Sbjct  121  ELVDKVPEGCRITIVSDSCHSGGLIDKAKEQIGESHKQGDDENEG  165



>gb|AAD13216.1| latex-abundant protein [Hevea brasiliensis]
Length=417

 Score =   253 bits (647),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 130/156 (83%), Positives = 143/156 (92%), Gaps = 0/156 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            MA+KAVLIGINYPGTKAELKGC+NDV+RM+RCLVDRYGFSE+DITVLID D SY QPTG+
Sbjct  1    MAKKAVLIGINYPGTKAELKGCINDVKRMYRCLVDRYGFSEEDITVLIDIDESYIQPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR  L+DLV+SA  GD LFVHYSGHGTRLPAETGE+DDTGFDECIVP D NLITDDDFR
Sbjct  61   NIRRVLTDLVRSAEPGDLLFVHYSGHGTRLPAETGEDDDTGFDECIVPCDMNLITDDDFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGEST  481
            E VD +P GCR+T+VSDSCHSGGLID+AKEQIGEST
Sbjct  121  EFVDQVPHGCRITVVSDSCHSGGLIDEAKEQIGEST  156



>ref|XP_006389898.1| hypothetical protein EUTSA_v10018618mg [Eutrema salsugineum]
 gb|ESQ27184.1| hypothetical protein EUTSA_v10018618mg [Eutrema salsugineum]
Length=417

 Score =   253 bits (647),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 130/157 (83%), Positives = 147/157 (94%), Gaps = 0/157 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            MA+KAVLIGINYPGTKAEL+GCVNDVRRM++CLV+RYGF+E+DITVLIDTD S TQPTG+
Sbjct  1    MAKKAVLIGINYPGTKAELRGCVNDVRRMYKCLVERYGFAEEDITVLIDTDESSTQPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR AL+DLV SA SGD+L VHYSGHGTRLPAETGE+DDTG+DECIVP D NLITDDDFR
Sbjct  61   NIRKALADLVGSADSGDFLVVHYSGHGTRLPAETGEDDDTGYDECIVPCDMNLITDDDFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTH  484
            +LVD +PQGCR+TI+SDSCHSGGLID+AKEQIGEST 
Sbjct  121  DLVDRVPQGCRMTIISDSCHSGGLIDEAKEQIGESTK  157



>ref|XP_002887781.1| metacaspase 7 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64040.1| metacaspase 7 [Arabidopsis lyrata subsp. lyrata]
Length=418

 Score =   253 bits (647),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 132/160 (83%), Positives = 147/160 (92%), Gaps = 0/160 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            MA+KAVLIGINYPGTKAEL+GCVNDVRRM++CLV+RYGFSE++ITVLIDTD S TQPTG+
Sbjct  1    MAKKAVLIGINYPGTKAELRGCVNDVRRMYKCLVERYGFSEENITVLIDTDESSTQPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR AL+DLV SA SGD L VHYSGHGTRLPAETGE+DDTGFDECIVP D NLITDDDFR
Sbjct  61   NIRRALADLVGSAESGDVLVVHYSGHGTRLPAETGEDDDTGFDECIVPCDMNLITDDDFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDNA  493
            +LVD +PQGCR+TI+SDSCHSGGLID+AKEQIGEST   A
Sbjct  121  DLVDKVPQGCRMTIISDSCHSGGLIDEAKEQIGESTKKEA  160



>ref|XP_011086327.1| PREDICTED: metacaspase-5-like [Sesamum indicum]
Length=422

 Score =   253 bits (647),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 131/161 (81%), Positives = 146/161 (91%), Gaps = 0/161 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            MA++AVLIGINYPGT AELKGC+NDVRRMH CLV+RYGF  DDITVLIDTDASYT+PTGR
Sbjct  1    MAKRAVLIGINYPGTNAELKGCINDVRRMHECLVERYGFHNDDITVLIDTDASYTEPTGR  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR+AL  LV+SA  GD+LFV YSGHGTRLPAETGE+DDTG+DECIVPSD NLITDDDFR
Sbjct  61   NIRAALDSLVRSAHPGDFLFVQYSGHGTRLPAETGEDDDTGYDECIVPSDMNLITDDDFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDNAD  496
            +LVD +P GCR+TIVSDSCHSGGLID+AKEQIGEST  N +
Sbjct  121  DLVDQVPGGCRITIVSDSCHSGGLIDEAKEQIGESTKGNEE  161



>gb|KDP27423.1| hypothetical protein JCGZ_20833 [Jatropha curcas]
Length=418

 Score =   253 bits (647),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 129/165 (78%), Positives = 147/165 (89%), Gaps = 0/165 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            MA+KAVLIGINYPGTKAELKGC+NDVRRM++CLVDRYGFSE++I +LIDTD SY QPTG+
Sbjct  1    MAKKAVLIGINYPGTKAELKGCINDVRRMYKCLVDRYGFSEENIMILIDTDESYMQPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR  LS+LV+SA  GD+LFVHYSGHGTRLPAETGE+DDTG+DECIVP D NLITDDDFR
Sbjct  61   NIRMVLSNLVRSADPGDFLFVHYSGHGTRLPAETGEDDDTGYDECIVPCDMNLITDDDFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDNADADDA  508
            E VD +P GCR+TIVSDSCHSGGLID+AKEQIGEST+      D+
Sbjct  121  EFVDQVPTGCRITIVSDSCHSGGLIDEAKEQIGESTNRQEQESDS  165



>ref|XP_007133456.1| hypothetical protein PHAVU_011G180200g [Phaseolus vulgaris]
 gb|ESW05450.1| hypothetical protein PHAVU_011G180200g [Phaseolus vulgaris]
Length=417

 Score =   253 bits (646),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 130/156 (83%), Positives = 144/156 (92%), Gaps = 0/156 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            MA+KAVLIGINYPGTKAELKGC+NDV RMHRCLVDRYGFS+DDITV+IDTD SY +PTG+
Sbjct  1    MAKKAVLIGINYPGTKAELKGCINDVWRMHRCLVDRYGFSKDDITVMIDTDKSYKEPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIRSAL+ L++SA +GD LFVHYSGHGTRLPAETGE+DDTG+DECIVPSD NLITDDDFR
Sbjct  61   NIRSALTSLIRSAEAGDVLFVHYSGHGTRLPAETGEDDDTGYDECIVPSDMNLITDDDFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGEST  481
            E VD +P GC+LTIVSDSCHSGGLID AKEQIG ST
Sbjct  121  EFVDGVPSGCKLTIVSDSCHSGGLIDGAKEQIGNST  156



>gb|KFK42339.1| hypothetical protein AALP_AA2G243500 [Arabis alpina]
Length=414

 Score =   253 bits (646),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 130/157 (83%), Positives = 147/157 (94%), Gaps = 0/157 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            MA+KAVLIGINYPGTKAEL+GCVNDV RM++CLV+RYGFSE+DITVLIDTD S TQPTG+
Sbjct  1    MAKKAVLIGINYPGTKAELRGCVNDVHRMYKCLVERYGFSEEDITVLIDTDQSCTQPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR AL+DL++SA SGD+L VHYSGHGTRLPAETGE+DDTGFDECIVP D NLITDDDFR
Sbjct  61   NIRKALADLIRSADSGDFLVVHYSGHGTRLPAETGEDDDTGFDECIVPCDMNLITDDDFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTH  484
            +LVD +PQGCR+TI+SDSCHSGGLID+AKEQIGEST 
Sbjct  121  DLVDRVPQGCRMTIISDSCHSGGLIDEAKEQIGESTK  157



>emb|CDP17955.1| unnamed protein product [Coffea canephora]
Length=415

 Score =   253 bits (645),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 129/156 (83%), Positives = 146/156 (94%), Gaps = 0/156 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            MA+KAVLIG NYPGTKAELKGC+NDVRRM+ CL+DRYGFSEDDIT+LIDTD+SY+QPTGR
Sbjct  1    MAKKAVLIGCNYPGTKAELKGCINDVRRMYACLIDRYGFSEDDITILIDTDSSYSQPTGR  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            N+R ALSDL++SA  GD LFVHYSGHGTRLPAETGE+DDTG+DECIVP D NLITDDD R
Sbjct  61   NVRRALSDLIRSASPGDILFVHYSGHGTRLPAETGEDDDTGYDECIVPCDMNLITDDDMR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGEST  481
            +LVD +P+GCR+TIVSDSCHSGGLID+AKEQIGEST
Sbjct  121  DLVDRVPEGCRITIVSDSCHSGGLIDEAKEQIGEST  156



>ref|XP_004510001.1| PREDICTED: metacaspase-4-like [Cicer arietinum]
Length=415

 Score =   253 bits (645),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 131/156 (84%), Positives = 144/156 (92%), Gaps = 0/156 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            MARKAVLIGINY GTKAEL+GCVNDV RMH+CL+DRYGFSEDDITVLIDTD SYT+PTG+
Sbjct  1    MARKAVLIGINYSGTKAELRGCVNDVWRMHKCLIDRYGFSEDDITVLIDTDESYTEPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR  L +LV+SA  GD LFVHYSGHGTRLPAETGE+DDTGFDECIVPSD NLITDDDF+
Sbjct  61   NIRRVLGELVRSAEEGDVLFVHYSGHGTRLPAETGEDDDTGFDECIVPSDMNLITDDDFK  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGEST  481
            E VD +P+GCRLTIVSDSCHSGGLI++AKEQIGEST
Sbjct  121  EFVDGVPKGCRLTIVSDSCHSGGLIEEAKEQIGEST  156



>ref|XP_006584543.1| PREDICTED: uncharacterized protein LOC100527809 isoform X1 [Glycine 
max]
 gb|KHN38172.1| Metacaspase-5 [Glycine soja]
Length=424

 Score =   253 bits (645),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 132/156 (85%), Positives = 144/156 (92%), Gaps = 0/156 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            MA+KAVLIGINYPGTKAELKGC+NDV RMHRCL+DRYGFSEDDITVLIDTD SYT+PTG+
Sbjct  1    MAKKAVLIGINYPGTKAELKGCINDVWRMHRCLIDRYGFSEDDITVLIDTDESYTEPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIRSAL+ L++SA  GD LFVHYSGHGTRLPAETGE+DDTGFDECIVPSD NLITDDDFR
Sbjct  61   NIRSALTRLIRSARPGDVLFVHYSGHGTRLPAETGEDDDTGFDECIVPSDMNLITDDDFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGEST  481
            E VD +P+ C+LTIVSDSCHSGGLID AKEQIG ST
Sbjct  121  EFVDGVPRECKLTIVSDSCHSGGLIDGAKEQIGTST  156



>ref|XP_010260805.1| PREDICTED: metacaspase-4 [Nelumbo nucifera]
Length=416

 Score =   252 bits (644),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 130/166 (78%), Positives = 148/166 (89%), Gaps = 1/166 (1%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            MA++A+LIG NYPGTKA+L GC+NDV+RM RCLVDRYGFSEDDIT+LIDTD SYTQPTG+
Sbjct  1    MAKRALLIGCNYPGTKAQLNGCINDVKRMFRCLVDRYGFSEDDITILIDTDDSYTQPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR A SDLV+SA  GD+LFVHYSGHGTRLPAETGE+DDTG+DECIVP D NLITDDDFR
Sbjct  61   NIRRAFSDLVRSAEPGDFLFVHYSGHGTRLPAETGEDDDTGYDECIVPCDMNLITDDDFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGEST-HDNADADDA  508
            E VD +P+GCR+TIVSDSCHSGGLID+AKEQIGEST H   +  D+
Sbjct  121  EYVDKVPEGCRITIVSDSCHSGGLIDEAKEQIGESTKHQEEERSDS  166



>ref|XP_009368619.1| PREDICTED: metacaspase-4-like [Pyrus x bretschneideri]
Length=415

 Score =   252 bits (643),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 129/156 (83%), Positives = 142/156 (91%), Gaps = 0/156 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            M +KAVLIG NY GTKAELKGC+NDVRRMHRCLVDRYGFSEDDI VLIDTD SYTQPTG+
Sbjct  1    MVKKAVLIGCNYQGTKAELKGCINDVRRMHRCLVDRYGFSEDDIQVLIDTDDSYTQPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR A+++L++SA   D LFVHYSGHGTRLPAETG++DDTG+DECIVP+D NLITDDDFR
Sbjct  61   NIRRAITNLIRSADPRDVLFVHYSGHGTRLPAETGDDDDTGYDECIVPTDMNLITDDDFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGEST  481
            E VD LP GCRLTIVSDSCHSGGLID+AKEQIGEST
Sbjct  121  EFVDQLPAGCRLTIVSDSCHSGGLIDEAKEQIGEST  156



>emb|CDX87390.1| BnaA07g34830D [Brassica napus]
Length=383

 Score =   251 bits (640),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 129/155 (83%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            MA+KAVLIGINYPGTKAEL+GCVNDVRRM++CLV+RYGF+E+DITVLIDTD SYT+PTG+
Sbjct  1    MAKKAVLIGINYPGTKAELRGCVNDVRRMYKCLVERYGFAEEDITVLIDTDDSYTKPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR AL+DLV SA SGD L VHYSGHGTRLPAETGE+DDTG+DECIVP D NLITDDDFR
Sbjct  61   NIRKALADLVGSADSGDVLVVHYSGHGTRLPAETGEDDDTGYDECIVPCDMNLITDDDFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGES  478
            +LVD +PQGCR+TI+SDSCHSGGLID+AKEQIGES
Sbjct  121  DLVDRVPQGCRMTIISDSCHSGGLIDEAKEQIGES  155



>ref|XP_008383212.1| PREDICTED: metacaspase-4-like [Malus domestica]
Length=415

 Score =   251 bits (642),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 128/156 (82%), Positives = 142/156 (91%), Gaps = 0/156 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            M +KAVLIG NY GTKAELKGC+NDVRRMHRCLVDRYGFSEDDI +LIDTD SYTQPTG+
Sbjct  1    MVKKAVLIGCNYQGTKAELKGCINDVRRMHRCLVDRYGFSEDDIQILIDTDDSYTQPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR A+++L++SA   D LFVHYSGHGTRLPAETG++DDTG+DECIVP+D NLITDDDFR
Sbjct  61   NIRRAITNLIRSANPRDVLFVHYSGHGTRLPAETGDDDDTGYDECIVPTDMNLITDDDFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGEST  481
            E VD LP GCRLTIVSDSCHSGGLID+AKEQIGEST
Sbjct  121  EFVDQLPAGCRLTIVSDSCHSGGLIDEAKEQIGEST  156



>ref|XP_010472789.1| PREDICTED: metacaspase-4 [Camelina sativa]
Length=416

 Score =   251 bits (642),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 131/153 (86%), Positives = 143/153 (93%), Gaps = 0/153 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            MA+KAVLIGINYPGTKAEL+GCVNDVRRM++CLV+RYGFSE+DITVLIDTD SYTQPTG+
Sbjct  1    MAKKAVLIGINYPGTKAELRGCVNDVRRMYKCLVERYGFSEEDITVLIDTDESYTQPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR AL DLV SA SGD L VHYSGHGTRLPAETGE+DDTG+DECIVP D NLITDDDFR
Sbjct  61   NIRRALKDLVGSADSGDVLVVHYSGHGTRLPAETGEDDDTGYDECIVPCDMNLITDDDFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIG  472
            +LVD +PQGCRLTIVSDSCHSGGLID+AKEQIG
Sbjct  121  DLVDQVPQGCRLTIVSDSCHSGGLIDEAKEQIG  153



>ref|XP_009106655.1| PREDICTED: metacaspase-4 [Brassica rapa]
Length=409

 Score =   251 bits (641),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 130/155 (84%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            MA+KAVLIGINYPGTKAEL+GCVNDVRRM++CLV+RYGF+E+DITVLIDTD SYT+PTG+
Sbjct  1    MAKKAVLIGINYPGTKAELRGCVNDVRRMYKCLVERYGFAEEDITVLIDTDDSYTKPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR AL+DLV SA SGD L VHYSGHGTRLPAETGE+DDTGFDECIVP D NLITDDDFR
Sbjct  61   NIRKALADLVGSADSGDVLVVHYSGHGTRLPAETGEDDDTGFDECIVPCDMNLITDDDFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGES  478
            +LVD +PQGCR+TI+SDSCHSGGLID+AKEQIGES
Sbjct  121  DLVDRVPQGCRMTIISDSCHSGGLIDEAKEQIGES  155



>emb|CDX88530.1| BnaC06g39740D [Brassica napus]
Length=409

 Score =   251 bits (641),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 129/155 (83%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            MA+KAVLIGINYPGTKAEL+GCVNDVRRM++CLV+RYGF+E+DITVLIDTD SYT+PTG+
Sbjct  1    MAKKAVLIGINYPGTKAELRGCVNDVRRMYKCLVERYGFAEEDITVLIDTDDSYTKPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR AL+DLV SA SGD L VHYSGHGTRLPAETGE+DDTG+DECIVP D NLITDDDFR
Sbjct  61   NIRKALADLVGSADSGDVLVVHYSGHGTRLPAETGEDDDTGYDECIVPCDMNLITDDDFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGES  478
            +LVD +PQGCR+TI+SDSCHSGGLID+AKEQIGES
Sbjct  121  DLVDRVPQGCRMTIISDSCHSGGLIDEAKEQIGES  155



>ref|XP_004154541.1| PREDICTED: metacaspase-4-like [Cucumis sativus]
Length=421

 Score =   251 bits (640),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 127/157 (81%), Positives = 146/157 (93%), Gaps = 0/157 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            M +KAVLIG NYPGTKAEL+GC+NDV+RM +CL++RYGFSEDDI +LIDTD SYTQPTG+
Sbjct  1    MGKKAVLIGCNYPGTKAELRGCINDVKRMRQCLIERYGFSEDDIEILIDTDESYTQPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIRSAL+ LV+SA  GD+LFVHYSGHGTRLPAETGE+DDTG+DECIVPSD NLITDDDFR
Sbjct  61   NIRSALARLVRSADPGDFLFVHYSGHGTRLPAETGEDDDTGYDECIVPSDMNLITDDDFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTH  484
            +LVD +P+GCRLTIVSDSCHSGGLID A+EQIGEST+
Sbjct  121  QLVDQVPEGCRLTIVSDSCHSGGLIDDAEEQIGESTN  157



>ref|XP_004139955.1| PREDICTED: metacaspase-5-like [Cucumis sativus]
 gb|KGN46707.1| hypothetical protein Csa_6G124220 [Cucumis sativus]
Length=421

 Score =   251 bits (640),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 127/157 (81%), Positives = 146/157 (93%), Gaps = 0/157 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            M +KAVLIG NYPGTKAEL+GC+NDV+RM +CL++RYGFSEDDI +LIDTD SYTQPTG+
Sbjct  1    MGKKAVLIGCNYPGTKAELRGCINDVKRMRQCLIERYGFSEDDIEILIDTDESYTQPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIRSAL+ LV+SA  GD+LFVHYSGHGTRLPAETGE+DDTG+DECIVPSD NLITDDDFR
Sbjct  61   NIRSALARLVRSADPGDFLFVHYSGHGTRLPAETGEDDDTGYDECIVPSDMNLITDDDFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTH  484
            +LVD +P+GCRLTIVSDSCHSGGLID A+EQIGEST+
Sbjct  121  QLVDQVPEGCRLTIVSDSCHSGGLIDDAEEQIGESTN  157



>ref|XP_009368616.1| PREDICTED: metacaspase-4-like [Pyrus x bretschneideri]
Length=415

 Score =   249 bits (637),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 128/156 (82%), Positives = 142/156 (91%), Gaps = 0/156 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            M +KAVLIG NY GTKAELKGC+NDVRRMHRCLVDRYGFS+DDI VLIDTD SYTQPTG+
Sbjct  1    MVKKAVLIGCNYQGTKAELKGCINDVRRMHRCLVDRYGFSKDDIQVLIDTDDSYTQPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR A+++L++SA   D LFVHYSGHGTRLPAETG++DDTG+DECIVP+D NLITDDDFR
Sbjct  61   NIRRAITNLIRSADPRDVLFVHYSGHGTRLPAETGDDDDTGYDECIVPTDMNLITDDDFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGEST  481
            E VD LP GCRLTIVSDSCHSGGLID+AKEQIGEST
Sbjct  121  EFVDQLPAGCRLTIVSDSCHSGGLIDEAKEQIGEST  156



>ref|XP_010926867.1| PREDICTED: metacaspase-5-like [Elaeis guineensis]
Length=409

 Score =   249 bits (637),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 124/165 (75%), Positives = 145/165 (88%), Gaps = 0/165 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            M +KA+L+G NYPGTKAELKGC+NDVRRMHRCLV+RYGF+E+DI VLIDTD SY QPTG 
Sbjct  1    MGKKALLVGCNYPGTKAELKGCINDVRRMHRCLVERYGFAEEDIAVLIDTDESYPQPTGA  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR A+++LV SA  GDYLF HYSGHGTRLPAETG++DDTG+DECIVP D NLITDDDFR
Sbjct  61   NIRRAIANLVASARPGDYLFFHYSGHGTRLPAETGDDDDTGYDECIVPCDMNLITDDDFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDNADADDA  508
            E VD +P+GCR+TIVSDSCHSGGLID++KEQIGEST    ++ D+
Sbjct  121  EFVDKVPEGCRITIVSDSCHSGGLIDESKEQIGESTRKGEESSDS  165



>gb|AAP84710.2| metacaspase 7 [Arabidopsis thaliana]
 gb|AAP44517.1| metacaspase 4 precursor [Arabidopsis thaliana]
Length=418

 Score =   249 bits (637),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 130/160 (81%), Positives = 146/160 (91%), Gaps = 0/160 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            M +KAVLIGINYPGTKAEL+GCVNDVRRM++CLV+RYGFSE++ITVLIDTD S TQPTG+
Sbjct  1    MTKKAVLIGINYPGTKAELRGCVNDVRRMYKCLVERYGFSEENITVLIDTDESSTQPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR AL+DLV+SA SGD L VHYSGHGTRLPAETGE+DDTGFDECIVP D NLITDDDFR
Sbjct  61   NIRRALADLVESADSGDVLVVHYSGHGTRLPAETGEDDDTGFDECIVPCDMNLITDDDFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDNA  493
            +LVD +P GCR+TI+SDSCHSGGLID+AKEQIGEST   A
Sbjct  121  DLVDKVPPGCRMTIISDSCHSGGLIDEAKEQIGESTKKEA  160



>ref|NP_178052.1| metacaspase 4 [Arabidopsis thaliana]
 sp|O64517.1|MCA4_ARATH RecName: Full=Metacaspase-4; Short=AtMC4; AltName: Full=Metacaspase 
2d; Short=AtMCP2d; AltName: Full=Metacaspase-7; Contains: 
RecName: Full=Metacaspase-4 subunit p20; Contains: RecName: 
Full=Metacaspase-4 subunit p10 [Arabidopsis thaliana]
 gb|AAC17081.1| Contains similarity to S. cerevisiae hypothetical protein YOR197w, 
gb|Z75105. ESTs gb|H37409, gb|AA395290, and gb|T43907 
come from this gene [Arabidopsis thaliana]
 gb|AAL85992.1| putative latex-abundant protein [Arabidopsis thaliana]
 gb|AAM91781.1| putative latex-abundant protein [Arabidopsis thaliana]
 gb|AEE36232.1| metacaspase 4 [Arabidopsis thaliana]
Length=418

 Score =   249 bits (637),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 130/160 (81%), Positives = 146/160 (91%), Gaps = 0/160 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            M +KAVLIGINYPGTKAEL+GCVNDVRRM++CLV+RYGFSE++ITVLIDTD S TQPTG+
Sbjct  1    MTKKAVLIGINYPGTKAELRGCVNDVRRMYKCLVERYGFSEENITVLIDTDESSTQPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR AL+DLV+SA SGD L VHYSGHGTRLPAETGE+DDTGFDECIVP D NLITDDDFR
Sbjct  61   NIRRALADLVESADSGDVLVVHYSGHGTRLPAETGEDDDTGFDECIVPCDMNLITDDDFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDNA  493
            +LVD +P GCR+TI+SDSCHSGGLID+AKEQIGEST   A
Sbjct  121  DLVDKVPPGCRMTIISDSCHSGGLIDEAKEQIGESTKKEA  160



>ref|XP_008798724.1| PREDICTED: metacaspase-5-like [Phoenix dactylifera]
Length=409

 Score =   249 bits (636),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 124/165 (75%), Positives = 144/165 (87%), Gaps = 0/165 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            M +KA+L+G NYPGTKAELKGC+NDVRRMHRCLVDRYGF+E+DI VLIDTD SY QPTG 
Sbjct  1    MGKKALLVGCNYPGTKAELKGCINDVRRMHRCLVDRYGFAEEDIAVLIDTDESYPQPTGA  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR A++ LV SA  GD+LF HYSGHGTRLPAETG++DDTG+DECIVP D NLITDDDFR
Sbjct  61   NIRRAVAQLVASARPGDFLFFHYSGHGTRLPAETGDDDDTGYDECIVPCDMNLITDDDFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDNADADDA  508
            E VD +P+GCR+TIVSDSCHSGGLID++KEQIGEST    ++ D+
Sbjct  121  EFVDKVPEGCRITIVSDSCHSGGLIDESKEQIGESTRKEEESSDS  165



>ref|XP_011014334.1| PREDICTED: metacaspase-4 [Populus euphratica]
Length=421

 Score =   249 bits (637),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 126/156 (81%), Positives = 143/156 (92%), Gaps = 0/156 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            M +KA+LIG NYPGTKAELKGC+NDV+RM+RCLVDRYGFSED+IT+LIDTD SYTQPTGR
Sbjct  1    MTKKALLIGCNYPGTKAELKGCINDVKRMYRCLVDRYGFSEDNITILIDTDDSYTQPTGR  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            N+R AL DLV+SA  GD LFVHYSGHGTRLPAETGE+DDTG+DECIVP D NLITDDDFR
Sbjct  61   NVRQALKDLVRSAEPGDLLFVHYSGHGTRLPAETGEDDDTGYDECIVPCDMNLITDDDFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGEST  481
            + VD +P+GCR+T+VSDSCHSGGLID+ KEQIGEST
Sbjct  121  DFVDQVPEGCRITVVSDSCHSGGLIDETKEQIGEST  156



>ref|XP_010429817.1| PREDICTED: metacaspase-4-like [Camelina sativa]
Length=415

 Score =   249 bits (636),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 130/153 (85%), Positives = 142/153 (93%), Gaps = 0/153 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            MA+KAVLIGINYPGTKAEL+GCVNDVRRM++CLV+RYGFSE+DITVLIDTD S TQPTG+
Sbjct  1    MAKKAVLIGINYPGTKAELRGCVNDVRRMYKCLVERYGFSEEDITVLIDTDESSTQPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR AL DLV SA SGD L VHYSGHGTRLPAETGE+DDTG+DECIVP D NLITDDDFR
Sbjct  61   NIRRALKDLVGSANSGDVLVVHYSGHGTRLPAETGEDDDTGYDECIVPCDMNLITDDDFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIG  472
            +LVD +PQGCRLTIVSDSCHSGGLID+AKEQIG
Sbjct  121  DLVDQVPQGCRLTIVSDSCHSGGLIDEAKEQIG  153



>ref|XP_009363318.1| PREDICTED: metacaspase-4-like [Pyrus x bretschneideri]
Length=421

 Score =   249 bits (636),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 128/156 (82%), Positives = 143/156 (92%), Gaps = 0/156 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            MARKAVLIG NYPGTKAELKGC+NDV+RM+ CLVDRYGFSEDDI VLIDTD SYTQPTG+
Sbjct  1    MARKAVLIGCNYPGTKAELKGCINDVKRMYSCLVDRYGFSEDDIQVLIDTDDSYTQPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR A+++L++SA SGD LFVHYSGHGTRLPAETG++DDTG+DEC+VP+D NLITDDDFR
Sbjct  61   NIRRAITNLIRSADSGDVLFVHYSGHGTRLPAETGDDDDTGYDECVVPTDMNLITDDDFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGEST  481
              VD LP GCRLTIVSDSCHSGGLID+A EQIGEST
Sbjct  121  GFVDQLPAGCRLTIVSDSCHSGGLIDEAIEQIGEST  156



>ref|XP_002316158.1| latex abundant family protein [Populus trichocarpa]
 gb|EEF02329.1| latex abundant family protein [Populus trichocarpa]
Length=422

 Score =   249 bits (636),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 125/156 (80%), Positives = 143/156 (92%), Gaps = 0/156 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            M +KA+LIG NYPGTKAELKGC+NDV+RM++CLVDRYGFSED++T+LIDTD SYTQPTGR
Sbjct  1    MTKKALLIGCNYPGTKAELKGCINDVKRMYQCLVDRYGFSEDNVTILIDTDDSYTQPTGR  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            N+R AL DLV+SA  GD LFVHYSGHGTRLPAETGE+DDTG+DECIVP D NLITDDDFR
Sbjct  61   NVRQALKDLVRSAEPGDMLFVHYSGHGTRLPAETGEDDDTGYDECIVPCDMNLITDDDFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGEST  481
            + VD +PQGCR+T+VSDSCHSGGLID+ KEQIGEST
Sbjct  121  DFVDQIPQGCRITVVSDSCHSGGLIDETKEQIGEST  156



>ref|XP_010537828.1| PREDICTED: metacaspase-4 [Tarenaya hassleriana]
Length=405

 Score =   248 bits (634),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 127/156 (81%), Positives = 147/156 (94%), Gaps = 0/156 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            MA+KAVLIGINYPGTKAEL+GCVNDVRRM++CLV+RYGF+E+DITVLIDTD SYT+PTG+
Sbjct  1    MAKKAVLIGINYPGTKAELRGCVNDVRRMYKCLVERYGFAEEDITVLIDTDDSYTKPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR ALSDLV SA SGD L VHYSGHGTRLPAETGE+DDTG+DECIVP D NLITDDDFR
Sbjct  61   NIRRALSDLVGSADSGDILLVHYSGHGTRLPAETGEDDDTGYDECIVPCDMNLITDDDFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGEST  481
            +LVD +P+GC++T++SDSCHSGGLID+AKEQIG+ST
Sbjct  121  DLVDKVPEGCQMTLISDSCHSGGLIDEAKEQIGDST  156



>ref|XP_007211951.1| hypothetical protein PRUPE_ppa006400mg [Prunus persica]
 gb|EMJ13150.1| hypothetical protein PRUPE_ppa006400mg [Prunus persica]
Length=413

 Score =   249 bits (635),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 127/156 (81%), Positives = 143/156 (92%), Gaps = 0/156 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            MA+KAVLIG NY GTKAELKGC+NDV+RMH CLVD YGF EDDI VLID+D+SYTQPTGR
Sbjct  1    MAKKAVLIGCNYQGTKAELKGCINDVKRMHSCLVDIYGFREDDIQVLIDSDSSYTQPTGR  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR A+++L++SA SGD LFVHYSGHGTRLPAETG++DDTG+DECIVP+D NLITDDDFR
Sbjct  61   NIRRAITNLIRSADSGDVLFVHYSGHGTRLPAETGDDDDTGYDECIVPTDMNLITDDDFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGEST  481
            E VD LP GCRLT+VSDSCHSGGLID+AKEQIGEST
Sbjct  121  EFVDQLPAGCRLTMVSDSCHSGGLIDEAKEQIGEST  156



>ref|XP_010417598.1| PREDICTED: metacaspase-4-like isoform X1 [Camelina sativa]
 ref|XP_010417599.1| PREDICTED: metacaspase-4-like isoform X2 [Camelina sativa]
Length=415

 Score =   248 bits (634),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 130/153 (85%), Positives = 142/153 (93%), Gaps = 0/153 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            MA+KAVLIGINYPGTKAEL+GCVNDVRRM++CLV+RYGFSE+DITVLIDTD S TQPTG+
Sbjct  1    MAKKAVLIGINYPGTKAELRGCVNDVRRMYKCLVERYGFSEEDITVLIDTDESSTQPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR AL DLV SA SGD L VHYSGHGTRLPAETGE+DDTG+DECIVP D NLITDDDFR
Sbjct  61   NIRRALKDLVGSADSGDVLVVHYSGHGTRLPAETGEDDDTGYDECIVPCDMNLITDDDFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIG  472
            +LVD +PQGCRLTIVSDSCHSGGLID+AKEQIG
Sbjct  121  DLVDQVPQGCRLTIVSDSCHSGGLIDEAKEQIG  153



>gb|KJB81456.1| hypothetical protein B456_013G146600 [Gossypium raimondii]
Length=421

 Score =   248 bits (634),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 125/156 (80%), Positives = 146/156 (94%), Gaps = 0/156 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            M +KAVLIGINYPGTKAELKGC+NDV+RM++CL++RYGFSE+DITVLIDTD SY QPTG+
Sbjct  1    MGKKAVLIGINYPGTKAELKGCINDVKRMYKCLIERYGFSEEDITVLIDTDNSYDQPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR AL+DLV+SA  GD+LFVHYSGHGTRLPAETG++DDTG+DECIVP D NLITDDDFR
Sbjct  61   NIRRALNDLVRSAEPGDFLFVHYSGHGTRLPAETGDDDDTGYDECIVPCDMNLITDDDFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGEST  481
            ELVD +P+G R+TIVSDSCHSGGLID+AKEQIG+S+
Sbjct  121  ELVDKVPKGSRITIVSDSCHSGGLIDEAKEQIGDSS  156



>ref|XP_002518827.1| caspase, putative [Ricinus communis]
 gb|EEF43545.1| caspase, putative [Ricinus communis]
Length=419

 Score =   248 bits (634),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 126/155 (81%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            M +KAVLIG NYPGTKAELKGC+NDVRRM++CLVDRYGFSE++ITVLIDTD SYTQPTG+
Sbjct  1    MTKKAVLIGCNYPGTKAELKGCINDVRRMYKCLVDRYGFSEENITVLIDTDESYTQPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR A+ DLV+SA  GD LFVHYSGHGTRLPAETGE+DDTG+DECIVP D NLITDDDFR
Sbjct  61   NIRKAVGDLVRSAEPGDVLFVHYSGHGTRLPAETGEDDDTGYDECIVPCDMNLITDDDFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGES  478
            + VD +P+GCR+T+VSDSCHSGGLID+AKEQIGES
Sbjct  121  DFVDQIPEGCRITVVSDSCHSGGLIDEAKEQIGES  155



>emb|CDX79312.1| BnaC06g19910D [Brassica napus]
Length=315

 Score =   244 bits (624),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 127/163 (78%), Positives = 142/163 (87%), Gaps = 0/163 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            MA+KAVLIGINYPGTK ELKGCVNDV RMH+CLVDRYGFSE+DITVLIDTD SYTQPTG+
Sbjct  1    MAKKAVLIGINYPGTKIELKGCVNDVHRMHKCLVDRYGFSEEDITVLIDTDDSYTQPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR+ALS+L+  A SGD LFVHYSGHGTR+P E GEED+TGFDECIVP D N I DDDFR
Sbjct  61   NIRNALSELITPAKSGDVLFVHYSGHGTRVPLEEGEEDETGFDECIVPCDMNPIPDDDFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDNADAD  502
            ELVD +P GC++T VSDSCHSGGLID AKE IGEST+ N + +
Sbjct  121  ELVDQVPPGCKITFVSDSCHSGGLIDGAKEHIGESTNKNRNQE  163



>ref|XP_006302314.1| hypothetical protein CARUB_v10020362mg [Capsella rubella]
 gb|EOA35212.1| hypothetical protein CARUB_v10020362mg [Capsella rubella]
Length=419

 Score =   248 bits (632),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 128/153 (84%), Positives = 142/153 (93%), Gaps = 0/153 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            M +KAVLIGINYPGTKAEL+GCVNDVRRMH+CLV+RYGFSE+DITVLIDTD S TQPTG+
Sbjct  1    MTKKAVLIGINYPGTKAELRGCVNDVRRMHKCLVERYGFSEEDITVLIDTDESSTQPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR AL+DLV SA SGD L VHYSGHGTRLPAETGE+DDTG+DECIVP D NLITDDDFR
Sbjct  61   NIRRALADLVGSADSGDVLVVHYSGHGTRLPAETGEDDDTGYDECIVPCDMNLITDDDFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIG  472
            +LVD +PQGCR+TI+SDSCHSGGLID+AKEQIG
Sbjct  121  DLVDRVPQGCRMTIISDSCHSGGLIDEAKEQIG  153



>ref|XP_006422307.1| hypothetical protein CICLE_v10006644mg [Citrus clementina]
 gb|ESR35547.1| hypothetical protein CICLE_v10006644mg [Citrus clementina]
Length=408

 Score =   246 bits (628),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 128/163 (79%), Positives = 144/163 (88%), Gaps = 0/163 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            M +KAVLIGINYPGTKAELKGCVNDV+RM+ CLVDRYGFSE++ITVLIDTD   TQPTGR
Sbjct  1    MTKKAVLIGINYPGTKAELKGCVNDVKRMYACLVDRYGFSEENITVLIDTDDRSTQPTGR  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR AL +LV+SA  GD LFVHYSGHGTRLPAETGE+DDTG+DECIVPSD NLITDDDFR
Sbjct  61   NIRRALGNLVRSAEPGDVLFVHYSGHGTRLPAETGEDDDTGYDECIVPSDMNLITDDDFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDNADAD  502
            E VD +P GC +T+VSDSCHSGGLID+AKEQIGEST  + + +
Sbjct  121  EFVDQIPPGCEITVVSDSCHSGGLIDEAKEQIGESTRRDEEEE  163



>ref|XP_008346071.1| PREDICTED: metacaspase-4-like [Malus domestica]
Length=424

 Score =   246 bits (629),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 128/156 (82%), Positives = 142/156 (91%), Gaps = 0/156 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            MARKAVLIG NY GTKAELKGC+NDV+RM+ CLVDRYGFSEDDI VLIDTD SYTQPTG+
Sbjct  1    MARKAVLIGCNYAGTKAELKGCINDVKRMYSCLVDRYGFSEDDIQVLIDTDDSYTQPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR A+++L++SA SGD LFVHYSGHGTRLPAETG++DDTG+DECIVP+D NLITDDDFR
Sbjct  61   NIRRAITNLIRSADSGDVLFVHYSGHGTRLPAETGDDDDTGYDECIVPTDMNLITDDDFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGEST  481
              VD LP GCRLTIVSDSCHSGGLID+A EQIGEST
Sbjct  121  GFVDQLPAGCRLTIVSDSCHSGGLIDEAIEQIGEST  156



>ref|XP_006493737.1| PREDICTED: metacaspase-4-like [Citrus sinensis]
 gb|KDO61516.1| hypothetical protein CISIN_1g041177mg [Citrus sinensis]
Length=417

 Score =   246 bits (628),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 128/156 (82%), Positives = 141/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            M +KAVLIGINYPGTKAELKGCVNDV+RM+ CLVDRYGFSE++ITVLIDTD   TQPTGR
Sbjct  1    MTKKAVLIGINYPGTKAELKGCVNDVKRMYACLVDRYGFSEENITVLIDTDDRSTQPTGR  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR AL +LV+SA  GD LFVHYSGHGTRLPAETGE+DDTG+DECIVPSD NLITDDDFR
Sbjct  61   NIRRALGNLVRSAEPGDVLFVHYSGHGTRLPAETGEDDDTGYDECIVPSDMNLITDDDFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGEST  481
            E VD +P GC +T+VSDSCHSGGLID+AKEQIGEST
Sbjct  121  EFVDQIPPGCEITVVSDSCHSGGLIDEAKEQIGEST  156



>ref|XP_011013178.1| PREDICTED: metacaspase-4-like [Populus euphratica]
Length=415

 Score =   246 bits (628),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 128/165 (78%), Positives = 146/165 (88%), Gaps = 0/165 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            M +KAVLIG NYPGTKAELKGC+NDV+RM RCLVDRYGF ED+IT+LIDTD SYT PTG+
Sbjct  1    MTKKAVLIGCNYPGTKAELKGCINDVKRMCRCLVDRYGFYEDNITILIDTDDSYTLPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            N+R AL+DLV S+  GD+LFVHYSGHGTRLPAETGEEDDTG+DECIVP D NLITDDDFR
Sbjct  61   NVRKALNDLVLSSEPGDFLFVHYSGHGTRLPAETGEEDDTGYDECIVPCDMNLITDDDFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDNADADDA  508
            +LVD +PQGCR+TIVSDSCHSGGLID+ KEQIGEST    + +D+
Sbjct  121  DLVDQVPQGCRITIVSDSCHSGGLIDETKEQIGESTKRQDEEEDS  165



>gb|AAM51555.1| metacaspase 1 [Solanum lycopersicum]
Length=409

 Score =   244 bits (624),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 143/158 (91%), Gaps = 1/158 (1%)
 Frame = +2

Query  35   IGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGRNIRSALS  214
            IGINYPGTKAEL+GC+NDVRRM+ CL++RYGF+E+DITVLIDTD SYTQPTGRNIR ALS
Sbjct  1    IGINYPGTKAELRGCINDVRRMYNCLLNRYGFAEEDITVLIDTDDSYTQPTGRNIRKALS  60

Query  215  DLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFRELVDSLP  394
            DLV SA SGD LFVHYSGHGTRLPAETGEEDDTGFDECIVP D NLITDDDFRELVD +P
Sbjct  61   DLVGSAESGDCLFVHYSGHGTRLPAETGEEDDTGFDECIVPCDMNLITDDDFRELVDKVP  120

Query  395  QGCRLTIVSDSCHSGGLIDKAKEQIGESTHDNADADDA  508
            +GC++TIVSDSCHSGGLIDKAKEQIGES H   D D+ 
Sbjct  121  EGCQITIVSDSCHSGGLIDKAKEQIGES-HKQGDDDEG  157



>gb|KFK42336.1| hypothetical protein AALP_AA2G243200 [Arabis alpina]
Length=398

 Score =   244 bits (622),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 126/156 (81%), Positives = 140/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            MA+KAVLIGINYPGTK ELKGCVNDV RMH+CLVDRYGF E+DI VLIDTD SYTQPTG+
Sbjct  1    MAKKAVLIGINYPGTKVELKGCVNDVHRMHKCLVDRYGFVEEDIKVLIDTDKSYTQPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR ALS+LVK A SGD LFVH+SGHGTR+P ETGEEDDTGFDECIVP D N I DDDFR
Sbjct  61   NIRRALSELVKPAKSGDVLFVHFSGHGTRVPPETGEEDDTGFDECIVPCDINPIPDDDFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGEST  481
            ELV+ +P+GC++TI+ DSCHSGGLID+AKEQIGEST
Sbjct  121  ELVERVPEGCKITIIPDSCHSGGLIDEAKEQIGEST  156



>emb|CDX67998.1| BnaA07g20380D [Brassica napus]
Length=315

 Score =   241 bits (614),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 127/163 (78%), Positives = 140/163 (86%), Gaps = 0/163 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            MA+KAVLIGINYPGTK ELKGCVNDV RMH+CLVDRYGFSE DITVLIDTD SYTQPTG+
Sbjct  1    MAKKAVLIGINYPGTKIELKGCVNDVHRMHKCLVDRYGFSEKDITVLIDTDDSYTQPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR+ALS+L+  A  GD LFVHYSGHGTR+P E GEEDDTGFDECIVP D N I DDDFR
Sbjct  61   NIRNALSELITPAKPGDVLFVHYSGHGTRVPLEEGEEDDTGFDECIVPCDMNPIPDDDFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDNADAD  502
            +LVD +P GC+LT VSDSCHSGGLID AKE IGEST+ N + +
Sbjct  121  DLVDQVPSGCKLTFVSDSCHSGGLIDGAKEHIGESTNKNRNQE  163



>ref|XP_002311278.1| latex abundant family protein [Populus trichocarpa]
 gb|ABK95507.1| unknown [Populus trichocarpa]
 gb|EEE88645.1| latex abundant family protein [Populus trichocarpa]
Length=416

 Score =   244 bits (622),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 127/156 (81%), Positives = 142/156 (91%), Gaps = 0/156 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            M +KAVLIG NYPGTKAELKGCVNDV+RM RCLVDRYGF ED+IT+LIDTD SYT PTG+
Sbjct  1    MTKKAVLIGCNYPGTKAELKGCVNDVKRMCRCLVDRYGFYEDNITILIDTDDSYTLPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            N+R AL+DLV S+  GD+LFVHYSGHGTRLPAETGEEDDTG+DECIVP D NLITDDDFR
Sbjct  61   NVRKALNDLVLSSEPGDFLFVHYSGHGTRLPAETGEEDDTGYDECIVPCDMNLITDDDFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGEST  481
            +LVD +P+GCR+TIVSDSCHSGGLID+ KEQIGEST
Sbjct  121  DLVDQVPEGCRITIVSDSCHSGGLIDETKEQIGEST  156



>ref|XP_004488558.1| PREDICTED: metacaspase-5-like [Cicer arietinum]
Length=392

 Score =   243 bits (619),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 124/160 (78%), Positives = 143/160 (89%), Gaps = 0/160 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            MA+KAVLIG NYPGTKAEL GC+NDV RMH CL+ +YGF E+DITVLIDTD SYTQPTG+
Sbjct  1    MAKKAVLIGCNYPGTKAELNGCINDVWRMHTCLIHKYGFLENDITVLIDTDHSYTQPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIRSA+S LV+SA  GD LFVHYSGHGTRLPAETGE+DDTG+DECIVP+D NLITD+DFR
Sbjct  61   NIRSAMSRLVRSARPGDVLFVHYSGHGTRLPAETGEDDDTGYDECIVPTDMNLITDEDFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDNA  493
            E V+ LP+GCR+T+VSDSCHSGGLI+ AKEQIGEST + +
Sbjct  121  EFVEKLPKGCRITMVSDSCHSGGLIEAAKEQIGESTKEGS  160



>gb|AES66180.2| ICE-like protease (caspase) p20 domain protein [Medicago truncatula]
Length=401

 Score =   243 bits (619),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 123/160 (77%), Positives = 144/160 (90%), Gaps = 0/160 (0%)
 Frame = +2

Query  8    REMARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPT  187
            REMA+KAVLIG NYPGTKAELKGC+NDV RMH+CL+ +YGFS+ DITVLIDTD SYTQPT
Sbjct  2    REMAKKAVLIGCNYPGTKAELKGCINDVWRMHKCLIHKYGFSDKDITVLIDTDHSYTQPT  61

Query  188  GRNIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDD  367
            G+NIRSA+S LV+SA  GD  FVHYSGHGTRLPAETGE+DDTG+DECIVP+D NLITD+D
Sbjct  62   GKNIRSAMSRLVRSAQPGDVFFVHYSGHGTRLPAETGEDDDTGYDECIVPTDMNLITDED  121

Query  368  FRELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHD  487
            FR+ V+ +P+ CR+TIVSDSCHSGGLI+ AKEQIG+ST +
Sbjct  122  FRDFVEKVPKSCRITIVSDSCHSGGLIESAKEQIGDSTKE  161



>ref|NP_178049.2| metacaspase 7 [Arabidopsis thaliana]
 sp|Q6XPT5.1|MCA7_ARATH RecName: Full=Metacaspase-7; Short=AtMC7; AltName: Full=Metacaspase 
2a; Short=AtMCP2a; AltName: Full=Metacaspase-4 [Arabidopsis 
thaliana]
 gb|AAP44520.1| metacaspase 7 precursor [Arabidopsis thaliana]
 gb|AEE36229.1| metacaspase 7 [Arabidopsis thaliana]
Length=403

 Score =   243 bits (619),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 124/156 (79%), Positives = 143/156 (92%), Gaps = 0/156 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            MA++A+LIGINYPGT  EL+GCVNDV RMH+CLVDR+GF+E+DITVLIDTD SYTQPTG+
Sbjct  1    MAKRALLIGINYPGTTEELQGCVNDVHRMHKCLVDRFGFAEEDITVLIDTDESYTQPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR ALS+L+K A SGD LFVHYSGHGTR+P ETGEEDDTGFDECIVPSD N I DDDFR
Sbjct  61   NIRQALSELIKPAKSGDVLFVHYSGHGTRVPPETGEEDDTGFDECIVPSDLNPIPDDDFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGEST  481
            +LV+ +P+GC++TIVSDSCHSGGLID+AKEQIGEST
Sbjct  121  DLVEQVPEGCQITIVSDSCHSGGLIDEAKEQIGEST  156



>gb|AAP84709.1| metacaspase 4 [Arabidopsis thaliana]
Length=403

 Score =   243 bits (619),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 124/156 (79%), Positives = 143/156 (92%), Gaps = 0/156 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            MA++A+LIGINYPGT  EL+GCVNDV RMH+CLVDR+GF+E+DITVLIDTD SYTQPTG+
Sbjct  1    MAKRALLIGINYPGTTEELQGCVNDVHRMHKCLVDRFGFAEEDITVLIDTDESYTQPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR ALS+L+K A SGD LFVHYSGHGTR+P ETGEEDDTGFDECIVPSD N I DDDFR
Sbjct  61   NIRQALSELIKPAKSGDVLFVHYSGHGTRVPPETGEEDDTGFDECIVPSDLNPIPDDDFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGEST  481
            +LV+ +P+GC++TIVSDSCHSGGLID+AKEQIGEST
Sbjct  121  DLVEQVPEGCQITIVSDSCHSGGLIDEAKEQIGEST  156



>ref|XP_006302347.1| hypothetical protein CARUB_v10020403mg [Capsella rubella]
 gb|EOA35245.1| hypothetical protein CARUB_v10020403mg [Capsella rubella]
Length=402

 Score =   242 bits (618),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 123/163 (75%), Positives = 146/163 (90%), Gaps = 0/163 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            MA++A+LIGINYPGT  EL+GCVNDVRRMH+CL++R+GF+E+DITVLIDTD SYTQPTG+
Sbjct  1    MAKRALLIGINYPGTTEELQGCVNDVRRMHKCLLERFGFAEEDITVLIDTDESYTQPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR ALS+L++ A SGD LFVHYSGHGTR+P ETGEEDDTGFDECIVPSD N I DDDFR
Sbjct  61   NIRQALSELIRPAKSGDVLFVHYSGHGTRVPPETGEEDDTGFDECIVPSDLNPIPDDDFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDNADAD  502
            +LV+ +P+GC++TIVSDSCHSGGLID+AKEQIGEST    D +
Sbjct  121  DLVEQVPEGCQITIVSDSCHSGGLIDEAKEQIGESTTAKPDRE  163



>ref|XP_010092466.1| hypothetical protein L484_019225 [Morus notabilis]
 gb|EXB51232.1| hypothetical protein L484_019225 [Morus notabilis]
Length=432

 Score =   243 bits (620),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 146/165 (88%), Gaps = 0/165 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            M +KAVLIG NYPGTKAEL+GC+NDV+RM+ CL++R+GFSEDDITVLID+D SYTQPTG+
Sbjct  1    MGKKAVLIGCNYPGTKAELRGCINDVKRMYNCLIERFGFSEDDITVLIDSDDSYTQPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            N R AL+ L++SA  GD+LFVHYSGHGTRLPAETGE+DDTG+DECIVP D NLITDDDFR
Sbjct  61   NTRQALAALIQSAEPGDFLFVHYSGHGTRLPAETGEDDDTGYDECIVPCDMNLITDDDFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDNADADDA  508
              VD +P+GCR+TIVSDSCHSGGLID+AKEQIGEST  + D  ++
Sbjct  121  GFVDQIPEGCRITIVSDSCHSGGLIDEAKEQIGESTKRDDDESES  165



>ref|XP_004293812.1| PREDICTED: metacaspase-4 [Fragaria vesca subsp. vesca]
Length=413

 Score =   243 bits (619),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 124/159 (78%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            M +KAVLIG NY GTKAELKGC+NDV RM+RCL+DRYGF+E+DI VLIDTD SYTQPTG+
Sbjct  1    MVKKAVLIGCNYQGTKAELKGCINDVNRMYRCLIDRYGFAEEDINVLIDTDDSYTQPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR A++DL++SA SGD LFVHYSGHGTRLPAETG++DDTG+DECIVP+D NLITDDDFR
Sbjct  61   NIRRAITDLIRSARSGDVLFVHYSGHGTRLPAETGDDDDTGYDECIVPTDMNLITDDDFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDN  490
            E VD L +GCRLTIVSDSCHSGGLID++ EQIGES   N
Sbjct  121  EFVDQLKKGCRLTIVSDSCHSGGLIDESVEQIGESHKGN  159



>ref|XP_002887778.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64037.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=399

 Score =   241 bits (615),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 121/157 (77%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            MA++A+LIGINYPG+  EL+GCVNDVRRMH+CLVDR+GF+E DITVLIDTD SYTQPTG+
Sbjct  1    MAKRALLIGINYPGSTDELQGCVNDVRRMHKCLVDRFGFAEKDITVLIDTDKSYTQPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR ALS+L+K A  GD LFVHYSGHGTR+P ET EEDD GFDECIVPSD N I DDDFR
Sbjct  61   NIRQALSELIKPAKPGDVLFVHYSGHGTRVPPETEEEDDAGFDECIVPSDLNPIPDDDFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTH  484
            +LV+ +P+GC++TIVSDSCHSGGLID+AKEQIGEST+
Sbjct  121  DLVEQVPEGCQITIVSDSCHSGGLIDEAKEQIGESTN  157



>ref|XP_006855871.1| hypothetical protein AMTR_s00037p00126540 [Amborella trichopoda]
 gb|ERN17338.1| hypothetical protein AMTR_s00037p00126540 [Amborella trichopoda]
Length=422

 Score =   241 bits (615),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 124/166 (75%), Positives = 141/166 (85%), Gaps = 0/166 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            M +KAVL+G NYPGTKAELKGCVNDVRRM  CL++R+GF EDDIT+LIDTD SY QPTG 
Sbjct  1    MGKKAVLVGCNYPGTKAELKGCVNDVRRMRECLINRFGFHEDDITILIDTDDSYDQPTGA  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR AL  L++ A  GD LF HYSGHGTRLPAETG++DDTG+DECIVP D NLITDDDFR
Sbjct  61   NIRRALGRLLEEAEDGDILFFHYSGHGTRLPAETGDDDDTGYDECIVPCDMNLITDDDFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDNADADDAD  511
            E VD +P+GC++TIVSDSCHSGGLID+AKEQIGEST D A  +D D
Sbjct  121  EFVDKVPEGCQITIVSDSCHSGGLIDEAKEQIGESTKDGAVEEDTD  166



>ref|XP_009408643.1| PREDICTED: metacaspase-5-like [Musa acuminata subsp. malaccensis]
Length=414

 Score =   241 bits (615),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = +2

Query  20   RKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGRNI  199
            ++AVL+G NYPGTKAELKGC+NDV RM + LV+R+GF+E+DITVLIDTD SYTQPTG NI
Sbjct  4    KRAVLVGCNYPGTKAELKGCINDVNRMRQSLVERFGFAEEDITVLIDTDRSYTQPTGANI  63

Query  200  RSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFREL  379
            R A+SDLV SA  GDYLF HYSGHGTRLPAETGE+DDTG+DECIVP D NLITDDDFRE 
Sbjct  64   RRAISDLVASAHPGDYLFFHYSGHGTRLPAETGEDDDTGYDECIVPCDMNLITDDDFREF  123

Query  380  VDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGEST  481
            V+ +PQGCRLTIVSDSCHSGGLIDKAKEQIGEST
Sbjct  124  VNKVPQGCRLTIVSDSCHSGGLIDKAKEQIGEST  157



>ref|XP_010537827.1| PREDICTED: metacaspase-5-like [Tarenaya hassleriana]
Length=415

 Score =   241 bits (615),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 126/156 (81%), Positives = 143/156 (92%), Gaps = 0/156 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            MA+KAVLIGINYPGTKAEL+GCVNDV RMH+CLVD YGF E++ITVLIDTD SYT+PTGR
Sbjct  1    MAKKAVLIGINYPGTKAELQGCVNDVHRMHKCLVDLYGFPEENITVLIDTDDSYTKPTGR  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            N+R ALSDLV SA +GD L VHYSGHGTR+PAETGE+DDTG+DECIVP D NLITDDDFR
Sbjct  61   NVRRALSDLVGSAEAGDILVVHYSGHGTRVPAETGEDDDTGYDECIVPCDMNLITDDDFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGEST  481
            +LV+ +P+G R+TIVSDSCHSGGLID+AKEQIGEST
Sbjct  121  DLVERVPKGARITIVSDSCHSGGLIDEAKEQIGEST  156



>ref|XP_008225985.1| PREDICTED: LOW QUALITY PROTEIN: metacaspase-4 [Prunus mume]
Length=413

 Score =   241 bits (614),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 123/156 (79%), Positives = 140/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            MA+KAVLIG NY GTKAELKGC+NDV+RMH CLVDRYGF EDDI VLID+D+SYTQPTGR
Sbjct  1    MAKKAVLIGCNYQGTKAELKGCINDVKRMHSCLVDRYGFREDDIQVLIDSDSSYTQPTGR  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR A+++L++SA SGD LF HY+G G R PAETG++DDTG+DECIVP+D NLITDDDFR
Sbjct  61   NIRRAITNLIRSADSGDVLFFHYAGLGPRXPAETGDDDDTGYDECIVPTDMNLITDDDFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGEST  481
            E VD LP GCRLT+VSDSCHSGGLID+AKEQIGEST
Sbjct  121  EFVDQLPAGCRLTMVSDSCHSGGLIDEAKEQIGEST  156



>ref|XP_009104536.1| PREDICTED: metacaspase-7 [Brassica rapa]
Length=370

 Score =   239 bits (609),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 126/163 (77%), Positives = 138/163 (85%), Gaps = 0/163 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            MA+KAVLIGINYPGTK EL GCVNDV RMH+CLVDRYGFSE DITVLIDTD SYTQPTG+
Sbjct  1    MAKKAVLIGINYPGTKIELNGCVNDVHRMHKCLVDRYGFSEKDITVLIDTDDSYTQPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR+ALS L+  A  GD LFVHYSGHGTR+P E GEEDDTGFDECIVP D N I DDDFR
Sbjct  61   NIRNALSKLITPAKPGDVLFVHYSGHGTRVPLEEGEEDDTGFDECIVPCDMNPIPDDDFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDNADAD  502
            +LVD +P GC+LT VSDSCHSGGLID AKE IGEST+ N + +
Sbjct  121  DLVDQVPSGCKLTFVSDSCHSGGLIDGAKEHIGESTNKNRNQE  163



>emb|CDX87391.1| BnaA07g34820D [Brassica napus]
Length=392

 Score =   239 bits (610),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 125/156 (80%), Positives = 142/156 (91%), Gaps = 0/156 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            MA+KAVLIGINYPGTKAEL+GCVNDVRRMH+CLVDR+GF E +IT LIDTD SYT+PTG+
Sbjct  1    MAKKAVLIGINYPGTKAELRGCVNDVRRMHKCLVDRFGFLERNITELIDTDDSYTKPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR AL +LV+SA SGD L VHYSGHGTRLPAETGE+DDTG+DECIVP D NLITDD+FR
Sbjct  61   NIRRALLNLVESAKSGDVLVVHYSGHGTRLPAETGEDDDTGYDECIVPCDMNLITDDEFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGEST  481
            ELVD +P+  R+TI+SDSCHSGGLID+AKEQIGEST
Sbjct  121  ELVDKVPKDARITIISDSCHSGGLIDEAKEQIGEST  156



>ref|XP_003595929.1| Metacaspase type II [Medicago truncatula]
 ref|XP_003595933.1| Metacaspase type II [Medicago truncatula]
Length=398

 Score =   238 bits (608),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            MA+KAVLIG NYPGTKAELKGC+NDV RMH+CL+ +YGFS+ DITVLIDTD SYTQPTG+
Sbjct  1    MAKKAVLIGCNYPGTKAELKGCINDVWRMHKCLIHKYGFSDKDITVLIDTDHSYTQPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIRSA+S LV+SA  GD  FVHYSGHGTRLPAETGE+DDTG+DECIVP+D NLITD+DFR
Sbjct  61   NIRSAMSRLVRSAQPGDVFFVHYSGHGTRLPAETGEDDDTGYDECIVPTDMNLITDEDFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHD  487
            + V+ +P+ CR+TIVSDSCHSGGLI+ AKEQIG+ST +
Sbjct  121  DFVEKVPKSCRITIVSDSCHSGGLIESAKEQIGDSTKE  158



>emb|CDX83532.1| BnaC07g22720D [Brassica napus]
Length=374

 Score =   238 bits (606),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 125/156 (80%), Positives = 142/156 (91%), Gaps = 0/156 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            MA+KAVLIGINYPGTKAEL+GCVNDVRRMH+CLVDR+GF E +IT LIDTD SYT+PTG+
Sbjct  1    MAKKAVLIGINYPGTKAELRGCVNDVRRMHKCLVDRFGFLERNITELIDTDDSYTKPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR AL +LV+SA SGD L VHYSGHGTRLPAETGE+DDTG+DECIVP D NLITDD+FR
Sbjct  61   NIRRALLNLVESAISGDVLVVHYSGHGTRLPAETGEDDDTGYDECIVPCDMNLITDDEFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGEST  481
            ELVD +P+  R+TI+SDSCHSGGLID+AKEQIGEST
Sbjct  121  ELVDKVPKDARITIISDSCHSGGLIDEAKEQIGEST  156



>ref|XP_010417594.1| PREDICTED: metacaspase-7 [Camelina sativa]
Length=403

 Score =   238 bits (608),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 122/163 (75%), Positives = 142/163 (87%), Gaps = 0/163 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            M ++AVLIGINYPGT  EL+GCVND RRMH+CLVDR+GF+E+DIT+LID+D SYTQPTG+
Sbjct  1    MVKRAVLIGINYPGTAEELQGCVNDARRMHKCLVDRFGFAEEDITLLIDSDKSYTQPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR ALS+LV  A +GD LFVHYSGHGTR+P ETGEEDDTGFDECIVPSD N I DDDFR
Sbjct  61   NIRQALSELVTPAKAGDVLFVHYSGHGTRVPPETGEEDDTGFDECIVPSDLNPIPDDDFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDNADAD  502
             LV+ +P+GC++TIVSDSCHSGGLID+AKEQIGEST    D +
Sbjct  121  SLVEQVPEGCQITIVSDSCHSGGLIDEAKEQIGESTTTKPDPE  163



>emb|CDX88529.1| BnaC06g39730D [Brassica napus]
Length=374

 Score =   238 bits (606),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 125/156 (80%), Positives = 142/156 (91%), Gaps = 0/156 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            MA+KAVLIGINYPGTKAEL+GCVNDVRRMH+CLVDR+GF E +IT LIDTD SYT+PTG+
Sbjct  1    MAKKAVLIGINYPGTKAELRGCVNDVRRMHKCLVDRFGFLERNITELIDTDDSYTKPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR AL +LV+SA SGD L VHYSGHGTRLPAETGE+DDTG+DECIVP D NLITDD+FR
Sbjct  61   NIRRALLNLVESAISGDVLVVHYSGHGTRLPAETGEDDDTGYDECIVPCDMNLITDDEFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGEST  481
            ELVD +P+  R+TI+SDSCHSGGLID+AKEQIGEST
Sbjct  121  ELVDKVPKDARITIISDSCHSGGLIDEAKEQIGEST  156



>ref|XP_008362957.1| PREDICTED: LOW QUALITY PROTEIN: metacaspase-4-like [Malus domestica]
Length=196

 Score =   231 bits (589),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 123/157 (78%), Positives = 137/157 (87%), Gaps = 1/157 (1%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            MARKAVLIG NY GTKAELKGC+NDV+RM+ CLVDRYGFSEDDI VLIDTD SYTQPTG+
Sbjct  1    MARKAVLIGCNYAGTKAELKGCINDVKRMYSCLVDRYGFSEDDIQVLIDTDDSYTQPTGK  60

Query  194  -NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDF  370
             NIR A+++L++SA SGD LFVHY GHGT LPAETG++DDTG+DECIVP+  NLITDDDF
Sbjct  61   KNIRRAITNLIRSADSGDVLFVHYCGHGTHLPAETGDDDDTGYDECIVPTAMNLITDDDF  120

Query  371  RELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGEST  481
            R  VD LP GCRLTI SDSCHS GLID+A EQIGEST
Sbjct  121  RGFVDQLPAGCRLTIASDSCHSSGLIDEAIEQIGEST  157



>ref|XP_010472785.1| PREDICTED: metacaspase-7 [Camelina sativa]
Length=434

 Score =   238 bits (608),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 122/163 (75%), Positives = 142/163 (87%), Gaps = 0/163 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            M ++AV+IGINYPGT  EL+GCVND RRMH+CL+DR+GF+E+DIT+LIDTD SYTQPTG+
Sbjct  31   MVKRAVVIGINYPGTAEELQGCVNDARRMHKCLLDRFGFAEEDITMLIDTDKSYTQPTGK  90

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR ALS+LV  A SGD LFVHYSGHGTR+P ETGEEDDTGFDECIVPSD N I DDDFR
Sbjct  91   NIRQALSELVTPAKSGDVLFVHYSGHGTRVPPETGEEDDTGFDECIVPSDLNPIPDDDFR  150

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDNADAD  502
             LV+ +P+GC++TIVSDSCHSGGLID+AKEQIGEST    D +
Sbjct  151  SLVEQVPEGCQITIVSDSCHSGGLIDEAKEQIGESTTTKPDPE  193



>gb|KFK42338.1| hypothetical protein AALP_AA2G243400 [Arabis alpina]
Length=334

 Score =   234 bits (597),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 138/155 (89%), Gaps = 0/155 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            MA+KAVLIGINYPGTKAEL+GCVNDVRR+H+CLVDR+GF E +IT LIDTD S TQPTG+
Sbjct  1    MAKKAVLIGINYPGTKAELRGCVNDVRRVHKCLVDRFGFLERNITELIDTDKSKTQPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR ALSDLV SA SGD L VHYSGHGTRLPAETGE+DDTG+DECIVP D NLITDD+FR
Sbjct  61   NIRQALSDLVGSAKSGDVLVVHYSGHGTRLPAETGEDDDTGYDECIVPCDMNLITDDEFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGES  478
            E V+ +P+   +TI+SDSCHSGGLID+AKEQIGES
Sbjct  121  EFVEKVPKDAHITIISDSCHSGGLIDEAKEQIGES  155



>ref|XP_010429812.1| PREDICTED: metacaspase-7-like [Camelina sativa]
Length=398

 Score =   236 bits (601),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 122/163 (75%), Positives = 141/163 (87%), Gaps = 0/163 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            M ++AVLIGINYPGT  EL+GCVND RRMH+CL+DR+GF+ +DIT+LIDTD SYTQPTG+
Sbjct  1    MVKRAVLIGINYPGTAEELQGCVNDARRMHKCLLDRFGFAVEDITMLIDTDKSYTQPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR AL +LV SA SGD LFVHYSGHGTR+P ETGEEDDTGFDECIVPSD N I DDDFR
Sbjct  61   NIRQALLELVSSAKSGDVLFVHYSGHGTRVPPETGEEDDTGFDECIVPSDLNPIPDDDFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDNADAD  502
             LV+ +P+GC++TIVSDSCHSGGLID+AKEQIGEST    D +
Sbjct  121  SLVEQVPEGCQITIVSDSCHSGGLIDEAKEQIGESTTTKPDRE  163



>ref|XP_009106654.1| PREDICTED: metacaspase-5-like [Brassica rapa]
Length=392

 Score =   235 bits (600),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 123/156 (79%), Positives = 141/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            MA+KAVLIGINYPGTKAEL+GCVND RRMH+CLVDR+GF E +IT LIDTD SYT+PTG+
Sbjct  1    MAKKAVLIGINYPGTKAELRGCVNDARRMHKCLVDRFGFLERNITELIDTDDSYTKPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR AL +LV++A SGD L VHYSGHGTRLPAETGE+DDTG+DECIVP D NLITDD+FR
Sbjct  61   NIRRALLNLVETARSGDVLVVHYSGHGTRLPAETGEDDDTGYDECIVPCDMNLITDDEFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGEST  481
            ELVD +P+  R+TI+SDSCHSGGLID+AKEQIGEST
Sbjct  121  ELVDKVPKDARITIISDSCHSGGLIDEAKEQIGEST  156



>ref|XP_009417202.1| PREDICTED: metacaspase-5-like [Musa acuminata subsp. malaccensis]
Length=410

 Score =   236 bits (601),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 119/165 (72%), Positives = 143/165 (87%), Gaps = 0/165 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            M +KAVL+G NYPGTKAEL+GC+NDV+RM RCLV R+GF++DDI VLIDTD +Y +PTG 
Sbjct  1    MGKKAVLVGCNYPGTKAELRGCINDVKRMRRCLVKRFGFADDDIAVLIDTDDAYPRPTGA  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR AL+ LV SA  GD+LFVHYSGHGTRLPAETG++DDTG+DECIVP D NLITDDDFR
Sbjct  61   NIRRALTRLVSSAEPGDFLFVHYSGHGTRLPAETGDDDDTGYDECIVPCDMNLITDDDFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDNADADDA  508
            + V+ +P+GCR+TIVSDSCHSGGLID++KEQIGEST    D+ D+
Sbjct  121  DFVNKVPKGCRITIVSDSCHSGGLIDESKEQIGESTKHQDDSSDS  165



>ref|XP_010472787.1| PREDICTED: metacaspase-5-like [Camelina sativa]
Length=410

 Score =   235 bits (600),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 121/163 (74%), Positives = 144/163 (88%), Gaps = 0/163 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            MA+KAVLIGINYPGTKAEL+GCVNDVRR+H+CLVDR+GFSE +IT LIDTD S+T+PTG+
Sbjct  1    MAKKAVLIGINYPGTKAELRGCVNDVRRVHKCLVDRFGFSEGNITQLIDTDESFTKPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR AL +LV+SA SGD L VHYSGHGTRLPAETGE+DDTG+DECIVP D NLITDD+FR
Sbjct  61   NIRQALLNLVESAKSGDVLVVHYSGHGTRLPAETGEDDDTGYDECIVPCDMNLITDDEFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDNADAD  502
            +LV+ +P+   +TI+SDSCHSGGLID+AKEQIG+ST  N   +
Sbjct  121  DLVEKVPKDAHMTIISDSCHSGGLIDEAKEQIGDSTKKNPKKE  163



>emb|CDY56807.1| BnaA02g36200D [Brassica napus]
Length=416

 Score =   235 bits (599),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 122/156 (78%), Positives = 142/156 (91%), Gaps = 0/156 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            MA+KAVLIGINYPGTKAEL+GCVNDV+RMH+CLVDR+GFSE +IT LIDTD S T+PTG+
Sbjct  1    MAKKAVLIGINYPGTKAELRGCVNDVKRMHKCLVDRFGFSERNITELIDTDNSSTKPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR AL +LV+SA SGD L VHYSGHGTRLPAETGE+DDTG+DECIVP D NLITDD+FR
Sbjct  61   NIRRALLNLVESARSGDVLVVHYSGHGTRLPAETGEDDDTGYDECIVPCDMNLITDDEFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGEST  481
            ELV+ +P+  ++TI+SDSCHSGGLID+AKEQIGEST
Sbjct  121  ELVEKVPKDAQITIISDSCHSGGLIDEAKEQIGEST  156



>ref|XP_010666272.1| PREDICTED: metacaspase-5-like [Beta vulgaris subsp. vulgaris]
Length=419

 Score =   235 bits (600),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 120/157 (76%), Positives = 138/157 (88%), Gaps = 0/157 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            M +KAVLIG NYPGTKAELKGC+NDV +MH CL++RYGF E DIT+LIDTD S+T+PTG+
Sbjct  1    MGKKAVLIGCNYPGTKAELKGCINDVHKMHACLLERYGFDEQDITILIDTDRSFTEPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR AL +LV+SA  GD+LFVHYSGHGTRLPAETGE+DDTG+DECIVP D NLITD+DF+
Sbjct  61   NIRRALQNLVRSAEPGDFLFVHYSGHGTRLPAETGEQDDTGYDECIVPCDMNLITDEDFK  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTH  484
            ELV  +P GCR+TIVSDSCHSGGLI  AKEQIGEST 
Sbjct  121  ELVCQVPDGCRITIVSDSCHSGGLISGAKEQIGESTQ  157



>ref|XP_002887780.1| type-II metacaspase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64039.1| type-II metacaspase [Arabidopsis lyrata subsp. lyrata]
Length=379

 Score =   234 bits (596),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 122/156 (78%), Positives = 141/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            MA+KAVLIGINYPGTKAEL+GCVNDVRR+H+CLVDR+GFSE +IT LIDTD S T+PTG+
Sbjct  1    MAKKAVLIGINYPGTKAELRGCVNDVRRVHKCLVDRFGFSERNITELIDTDDSSTKPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR AL +LV+SA SGD L VHYSGHGTRLPAETGE+DDTG+DECIVP D NLITDD+FR
Sbjct  61   NIRRALLNLVESAKSGDVLVVHYSGHGTRLPAETGEDDDTGYDECIVPCDMNLITDDEFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGEST  481
            +LVD +P+   +TI+SDSCHSGGLID+AKEQIGEST
Sbjct  121  DLVDKVPKEAHITIISDSCHSGGLIDEAKEQIGEST  156



>ref|XP_009128349.1| PREDICTED: metacaspase-5 [Brassica rapa]
Length=428

 Score =   235 bits (599),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 122/156 (78%), Positives = 142/156 (91%), Gaps = 0/156 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            MA+KAVLIGINYPGTKAEL+GCVNDV+RMH+CLVDR+GFSE +IT LIDTD S T+PTG+
Sbjct  1    MAKKAVLIGINYPGTKAELRGCVNDVKRMHKCLVDRFGFSERNITELIDTDNSSTKPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR AL +LV+SA SGD L VHYSGHGTRLPAETGE+DDTG+DECIVP D NLITDD+FR
Sbjct  61   NIRRALLNLVESARSGDVLVVHYSGHGTRLPAETGEDDDTGYDECIVPCDMNLITDDEFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGEST  481
            ELV+ +P+  ++TI+SDSCHSGGLID+AKEQIGEST
Sbjct  121  ELVEKVPKDAQITIISDSCHSGGLIDEAKEQIGEST  156



>ref|NP_178050.1| metacaspase 6 [Arabidopsis thaliana]
 sp|O64519.1|MCA6_ARATH RecName: Full=Metacaspase-6; Short=AtMC6; AltName: Full=Metacaspase 
2c; Short=AtMCP2c; AltName: Full=Metacaspase-5 [Arabidopsis 
thaliana]
 gb|AAC17078.1| Contains similarity to S. cerevisiae hypothetical protein YOR197w, 
gb|Z75105 [Arabidopsis thaliana]
 gb|AAP84713.1| metacaspase 5 [Arabidopsis thaliana]
 gb|AAP44519.1| metacaspase 6 precursor [Arabidopsis thaliana]
 gb|ABJ98564.1| At1g79320 [Arabidopsis thaliana]
 gb|AEE36230.1| metacaspase 6 [Arabidopsis thaliana]
Length=368

 Score =   233 bits (594),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 144/165 (87%), Gaps = 0/165 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            MA+KA+LIGINY GTKAEL+GCVNDVRRM   LV+RYGFSE++I +LIDTD+S  +PTG+
Sbjct  1    MAKKALLIGINYVGTKAELRGCVNDVRRMRISLVERYGFSEENIKMLIDTDSSSIKPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR AL DLV+ A SGD LFVHYSGHGTRLPAETGE+DDTG+DECIVPSD NLITDDDFR
Sbjct  61   NIRQALLDLVEPAKSGDVLFVHYSGHGTRLPAETGEDDDTGYDECIVPSDMNLITDDDFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDNADADDA  508
            +LVD +P+ C +TI+SDSCHSGGLID+AKEQIGEST    D+ D+
Sbjct  121  DLVDMVPKDCPITIISDSCHSGGLIDEAKEQIGESTKKKKDSGDS  165



>emb|CDY22271.1| BnaC02g25750D [Brassica napus]
Length=428

 Score =   234 bits (597),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 122/156 (78%), Positives = 141/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            MA+KAVLIGINYPGTKAEL+GCVNDV+RMH+CLVDR+GFSE +IT LIDTD S T+PTG+
Sbjct  1    MAKKAVLIGINYPGTKAELRGCVNDVKRMHKCLVDRFGFSERNITELIDTDNSSTKPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR AL +LV+SA SGD L VHYSGHGTRLPAETGE+DDTG+DECIVP D NLITDD+FR
Sbjct  61   NIRRALLNLVESARSGDVLVVHYSGHGTRLPAETGEDDDTGYDECIVPCDMNLITDDEFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGEST  481
            ELV  +P+  ++TI+SDSCHSGGLID+AKEQIGEST
Sbjct  121  ELVKKVPKDAQITIISDSCHSGGLIDEAKEQIGEST  156



>ref|XP_010417596.1| PREDICTED: metacaspase-5-like [Camelina sativa]
Length=406

 Score =   234 bits (596),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 120/163 (74%), Positives = 143/163 (88%), Gaps = 0/163 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            M +KAVLIGINYPGTKAEL+GCVNDVRR+H+CLVDR+GFSE +IT LIDTD S+T+PTG+
Sbjct  1    MTKKAVLIGINYPGTKAELRGCVNDVRRVHKCLVDRFGFSERNITQLIDTDESFTKPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR AL +LV+SA SGD L VHYSGHGTRLPAETGE+DDTG+DECIVP D NLITDD+FR
Sbjct  61   NIRQALLNLVESAKSGDVLVVHYSGHGTRLPAETGEDDDTGYDECIVPCDMNLITDDEFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDNADAD  502
            +LV+ +P+   +TI+SDSCHSGGLID+AKEQIG+ST  N   +
Sbjct  121  DLVEKVPKDAHMTIISDSCHSGGLIDEAKEQIGDSTKKNPKKE  163



>ref|XP_010429814.1| PREDICTED: LOW QUALITY PROTEIN: metacaspase-5-like [Camelina 
sativa]
Length=410

 Score =   234 bits (596),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 120/163 (74%), Positives = 143/163 (88%), Gaps = 0/163 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            M +KAVLIGINYPGTKAEL+GCVNDVRR+H+CLVDR+GFSE +IT LIDTD S+T+PTG+
Sbjct  1    MTKKAVLIGINYPGTKAELRGCVNDVRRVHKCLVDRFGFSERNITQLIDTDESFTKPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR AL +LV+SA SGD L VHYSGHGTRLPAETGE+DDTG+DECIVP D NLITDD+FR
Sbjct  61   NIRKALLNLVESAKSGDVLVVHYSGHGTRLPAETGEDDDTGYDECIVPCDMNLITDDEFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDNADAD  502
            +LV+ +P+   +TI+SDSCHSGGLID+AKEQIG+ST  N   +
Sbjct  121  DLVEKVPKDAHMTIISDSCHSGGLIDEAKEQIGDSTKKNPKKE  163



>ref|XP_006389899.1| hypothetical protein EUTSA_v10018629mg [Eutrema salsugineum]
 gb|ESQ27185.1| hypothetical protein EUTSA_v10018629mg [Eutrema salsugineum]
Length=413

 Score =   233 bits (595),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 123/163 (75%), Positives = 140/163 (86%), Gaps = 0/163 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            MA+KAVLIGINYPGTKAEL GCVNDVRRMH+CLVDR+GFSE +IT LIDTD S T+PTG+
Sbjct  1    MAKKAVLIGINYPGTKAELHGCVNDVRRMHKCLVDRFGFSERNITELIDTDDSSTKPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR AL +LV+SA SGD L VHYSGHGTRLPAETGE+DDTG+DECIVP D NLITDD+FR
Sbjct  61   NIRRALLNLVESAESGDVLVVHYSGHGTRLPAETGEDDDTGYDECIVPCDMNLITDDEFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDNADAD  502
            E V+ +P+  R+T +SDSCHSGGLID+AKEQIGEST      D
Sbjct  121  EFVEKVPKDARITFISDSCHSGGLIDEAKEQIGESTKKKPKKD  163



>gb|EPS59062.1| hypothetical protein M569_15748 [Genlisea aurea]
Length=386

 Score =   233 bits (593),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 124/159 (78%), Positives = 136/159 (86%), Gaps = 0/159 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            MA+KAVLIG NYPGT+ ELKGCVNDV RMHRCLV+ +GF  +DITVL+DTD SY QPTGR
Sbjct  1    MAKKAVLIGCNYPGTQVELKGCVNDVWRMHRCLVELFGFHAEDITVLVDTDRSYAQPTGR  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR AL DLV+SA  GD LFVHYSGHGTRLPAE GEEDDTGFDECIVP+D NLITDDDFR
Sbjct  61   NIRRALVDLVRSASRGDVLFVHYSGHGTRLPAEAGEEDDTGFDECIVPTDMNLITDDDFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDN  490
            E+VD LP GC +TIVSDSCHSGGLI + KEQIG S  D+
Sbjct  121  EVVDELPPGCSITIVSDSCHSGGLIHEEKEQIGVSKTDS  159



>ref|XP_006389900.1| hypothetical protein EUTSA_v10018721mg [Eutrema salsugineum]
 gb|ESQ27186.1| hypothetical protein EUTSA_v10018721mg [Eutrema salsugineum]
Length=376

 Score =   232 bits (591),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 122/157 (78%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            MA+KAVLIGINY GTKAEL+GCVNDVRRMH  LV+RYGFSE +I +LIDTD+S  +PTG+
Sbjct  1    MAKKAVLIGINYVGTKAELRGCVNDVRRMHISLVERYGFSEKNIKLLIDTDSSTIKPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR AL DLV+ A  GD LFVHYSGHGTRLPAETGE+DDTG+DECIVPSD NLITDDDFR
Sbjct  61   NIRQALLDLVEPAKPGDVLFVHYSGHGTRLPAETGEDDDTGYDECIVPSDMNLITDDDFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTH  484
            +LVD +P+ C +TI+SDSCHSGGLID+AKEQIGEST 
Sbjct  121  DLVDMVPKDCPITIISDSCHSGGLIDEAKEQIGESTR  157



>gb|EYU33806.1| hypothetical protein MIMGU_mgv1a007841mg [Erythranthe guttata]
Length=393

 Score =   233 bits (593),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 119/156 (76%), Positives = 134/156 (86%), Gaps = 1/156 (1%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            MA+KAVLIG NYPGT+ EL+GCVNDV RM+ CLV+RYGF+E DI VLIDTD SYTQPTGR
Sbjct  1    MAKKAVLIGCNYPGTQGELRGCVNDVLRMYVCLVERYGFAEQDIAVLIDTDESYTQPTGR  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR+AL DLV SA  GD LFVHYSGHG RLP+    +D+TG+DECIVP+D NLITDDDFR
Sbjct  61   NIRAALVDLVCSAAPGDSLFVHYSGHGVRLPS-DNPDDETGYDECIVPTDINLITDDDFR  119

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGEST  481
             LVD +P+GCR+TIVSDSCHSGGLI  AKEQIGEST
Sbjct  120  ALVDQVPKGCRITIVSDSCHSGGLISAAKEQIGEST  155



>ref|XP_010472786.1| PREDICTED: metacaspase-6-like [Camelina sativa]
Length=369

 Score =   231 bits (590),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 125/166 (75%), Positives = 142/166 (86%), Gaps = 1/166 (1%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            MA+KA+LIGINY GTKAEL+GCVNDVRRMH  LV+RYGFSE +I +LIDTD+S  +PTG+
Sbjct  1    MAKKALLIGINYVGTKAELRGCVNDVRRMHISLVERYGFSEKNIKMLIDTDSSSIKPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR AL DLV+ A  GD LFVHYSGHGTRLPAETGEEDDTG+DECIVPSD NLITDDDFR
Sbjct  61   NIRQALLDLVEPAKPGDVLFVHYSGHGTRLPAETGEEDDTGYDECIVPSDMNLITDDDFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDNADADDAD  511
            +LVD +P+ C +TI+SDSCHSGGLID+AKEQIGEST    D D  D
Sbjct  121  DLVDMVPKDCPITIISDSCHSGGLIDEAKEQIGESTK-KKDKDSGD  165



>emb|CBI24133.3| unnamed protein product [Vitis vinifera]
Length=371

 Score =   231 bits (588),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 120/157 (76%), Positives = 137/157 (87%), Gaps = 0/157 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            M +KAVLIG NY GTKAELKGC+NDV RM+  LV+R+GFS+DDITVLIDTD    QPTG+
Sbjct  1    MGKKAVLIGCNYQGTKAELKGCINDVNRMYNSLVNRFGFSQDDITVLIDTDPDGVQPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR AL +L++SA  GD LFVHYSGHGTRLPAETGE+DDTG+DECIVP+D NLITDDDFR
Sbjct  61   NIRRALLNLIRSAQPGDILFVHYSGHGTRLPAETGEDDDTGYDECIVPTDMNLITDDDFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTH  484
              VD +P+GCR+TIVSDSCHSGGLID+AKEQIGEST 
Sbjct  121  SFVDKVPEGCRITIVSDSCHSGGLIDEAKEQIGESTR  157



>ref|XP_006301048.1| hypothetical protein CARUB_v10021440mg [Capsella rubella]
 gb|EOA33946.1| hypothetical protein CARUB_v10021440mg [Capsella rubella]
Length=409

 Score =   231 bits (590),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 120/156 (77%), Positives = 140/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            M +KAVLIGINYPGTKAEL+GCVNDVRR+H+CLVDR+GFSE +IT LIDTD S T+PTG+
Sbjct  1    MTKKAVLIGINYPGTKAELRGCVNDVRRVHKCLVDRFGFSERNITELIDTDKSSTKPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR AL +LV+SA SGD L VHYSGHGTRLPAETGE+DDTG+DECIVP D NLITDD+FR
Sbjct  61   NIRKALLNLVESAKSGDVLVVHYSGHGTRLPAETGEDDDTGYDECIVPCDMNLITDDEFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGEST  481
            +LV+ +P+   +TI+SDSCHSGGLID+AKEQIGEST
Sbjct  121  DLVEKVPKDAHITIISDSCHSGGLIDEAKEQIGEST  156



>emb|CDY39817.1| BnaA09g10690D [Brassica napus]
Length=323

 Score =   229 bits (583),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 120/162 (74%), Positives = 135/162 (83%), Gaps = 0/162 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            M +KAVLIGINYPGT+ EL+GCVNDV+RMHRCLVDR+GFSE++IT LIDTD S  QPTG+
Sbjct  1    MVKKAVLIGINYPGTEGELRGCVNDVKRMHRCLVDRFGFSEENITELIDTDKSKIQPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR ALS+LV SA  GD LFVHYSGHG RLP ETGE+DDTGFDECIVP D N ITDD+ R
Sbjct  61   NIRQALSELVGSANPGDVLFVHYSGHGVRLPPETGEDDDTGFDECIVPCDMNNITDDEIR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDNADA  499
            E+VD +P+ C +TIVSDSCHSGGLID  KEQIGEST     A
Sbjct  121  EIVDKVPEDCSITIVSDSCHSGGLIDATKEQIGESTKKAGKA  162



>emb|CDY03252.1| BnaC09g10960D [Brassica napus]
Length=323

 Score =   228 bits (582),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 120/162 (74%), Positives = 135/162 (83%), Gaps = 0/162 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            M +KAVLIGINYPGT+ EL+GCVNDV+RMHRCLVDR+GFSE++IT LIDTD S  QPTG+
Sbjct  1    MVKKAVLIGINYPGTEGELRGCVNDVKRMHRCLVDRFGFSEENITELIDTDKSKIQPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR ALS+LV SA  GD LFVHYSGHG RLP ETGE+DDTGFDECIVP D N ITDD+ R
Sbjct  61   NIRQALSELVGSANPGDVLFVHYSGHGVRLPPETGEDDDTGFDECIVPCDMNNITDDEIR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDNADA  499
            E+VD +P+ C +TIVSDSCHSGGLID  KEQIGEST     A
Sbjct  121  EIVDKVPEDCSITIVSDSCHSGGLIDATKEQIGESTKKAGKA  162



>ref|NP_001268027.1| metacaspase-5-like [Vitis vinifera]
 gb|AGJ94052.1| metacaspase-5 [Vitis vinifera]
Length=424

 Score =   231 bits (590),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 120/157 (76%), Positives = 137/157 (87%), Gaps = 0/157 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            M +KAVLIG NY GTKAELKGC+NDV RM+  LV+R+GFS+DDITVLIDTD    QPTG+
Sbjct  1    MGKKAVLIGCNYQGTKAELKGCINDVNRMYNSLVNRFGFSQDDITVLIDTDPDGVQPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR AL +L++SA  GD LFVHYSGHGTRLPAETGE+DDTG+DECIVP+D NLITDDDFR
Sbjct  61   NIRRALLNLIRSAQPGDILFVHYSGHGTRLPAETGEDDDTGYDECIVPTDMNLITDDDFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTH  484
              VD +P+GCR+TIVSDSCHSGGLID+AKEQIGEST 
Sbjct  121  SFVDKVPEGCRITIVSDSCHSGGLIDEAKEQIGESTR  157



>ref|XP_010532015.1| PREDICTED: metacaspase-5-like [Tarenaya hassleriana]
Length=418

 Score =   231 bits (589),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 137/154 (89%), Gaps = 0/154 (0%)
 Frame = +2

Query  20   RKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGRNI  199
            +KA LIGINYPGT+ EL+GCVNDV RMH+CLVD+YGF+E+DITVLIDTD SYT+PTG+NI
Sbjct  4    KKAALIGINYPGTEVELRGCVNDVWRMHKCLVDQYGFAEEDITVLIDTDDSYTKPTGKNI  63

Query  200  RSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFREL  379
            R ALSDLV +A  GD L VHYSGHGTR+PAETGE+DDTG+DECIVP D NLI DDDFR+L
Sbjct  64   RRALSDLVGAAKPGDILVVHYSGHGTRVPAETGEDDDTGYDECIVPCDMNLIYDDDFRDL  123

Query  380  VDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGEST  481
            V+ +P  CR+TI+SDSCHSGGLID AKEQIGEST
Sbjct  124  VEKVPDSCRMTIISDSCHSGGLIDSAKEQIGEST  157



>ref|XP_010429813.1| PREDICTED: metacaspase-6 [Camelina sativa]
Length=369

 Score =   229 bits (584),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 121/157 (77%), Positives = 138/157 (88%), Gaps = 0/157 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            MA+KA+LIGINY GTKAEL+GCVNDVRRMH  LV+RYGF E +I +LIDTD+S  +PTG+
Sbjct  1    MAKKALLIGINYVGTKAELRGCVNDVRRMHISLVERYGFPEKNIKMLIDTDSSSIKPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR AL DLV+ A  GD LFVHYSGHGTRLPAETGEEDDTG+DECIVPSD NLITDDDFR
Sbjct  61   NIRQALLDLVEPAKPGDVLFVHYSGHGTRLPAETGEEDDTGYDECIVPSDMNLITDDDFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTH  484
            +LVD +P+ C +TI+SDSCHSGGLID+AKEQIGEST 
Sbjct  121  DLVDMVPKDCPITIISDSCHSGGLIDEAKEQIGESTK  157



>ref|XP_010417595.1| PREDICTED: metacaspase-6-like [Camelina sativa]
Length=369

 Score =   229 bits (584),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 121/157 (77%), Positives = 138/157 (88%), Gaps = 0/157 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            MA+KA+LIGINY GTKAEL+GCVNDVRRMH  LV+RYGF E +I +LIDTD+S  +PTG+
Sbjct  1    MAKKALLIGINYVGTKAELRGCVNDVRRMHISLVERYGFPEKNIKMLIDTDSSSIKPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR AL DLV+ A  GD LFVHYSGHGTRLPAETGEEDDTG+DECIVPSD NLITDDDFR
Sbjct  61   NIRQALLDLVEPAKPGDVLFVHYSGHGTRLPAETGEEDDTGYDECIVPSDMNLITDDDFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTH  484
            +LVD +P+ C +TI+SDSCHSGGLID+AKEQIGEST 
Sbjct  121  DLVDMVPKDCPITIISDSCHSGGLIDEAKEQIGESTK  157



>emb|CDX87392.1| BnaA07g34810D [Brassica napus]
Length=374

 Score =   229 bits (584),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 121/157 (77%), Positives = 138/157 (88%), Gaps = 0/157 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            MA++AVLIGINY GTKAEL+GCVNDVRRMH  LV+RYGFS+ +I +LIDTD+S  +PTG+
Sbjct  1    MAKRAVLIGINYVGTKAELRGCVNDVRRMHVSLVERYGFSDKNIKLLIDTDSSTMKPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR AL DLV+ A  GD LFVHYSGHGTRLPAETGE+DDTG+DECIVPSD NLITDDDFR
Sbjct  61   NIRQALLDLVQPAQPGDVLFVHYSGHGTRLPAETGEDDDTGYDECIVPSDMNLITDDDFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTH  484
            +LVD  P+ C +TIVSDSCHSGGLID+AKEQIGEST 
Sbjct  121  DLVDMAPKDCPITIVSDSCHSGGLIDEAKEQIGESTK  157



>ref|XP_009112709.1| PREDICTED: metacaspase-6-like [Brassica rapa]
Length=336

 Score =   228 bits (580),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 119/162 (73%), Positives = 135/162 (83%), Gaps = 0/162 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            M +KAVLIGINYPGT+ EL+GCVNDV+RMH+CLVDR+GFSE++IT LIDTD S  QPTG+
Sbjct  15   MVKKAVLIGINYPGTEGELRGCVNDVKRMHKCLVDRFGFSEENITELIDTDKSKIQPTGK  74

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR ALS+LV SA  GD LFVHYSGHG RLP ETGE+DDTGFDECIVP D N ITDD+ R
Sbjct  75   NIRQALSELVGSANPGDVLFVHYSGHGVRLPLETGEDDDTGFDECIVPCDMNNITDDEIR  134

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDNADA  499
            E+VD +P+ C +TIVSDSCHSGGLID  KEQIGEST     A
Sbjct  135  EIVDKVPEDCSITIVSDSCHSGGLIDATKEQIGESTKKTGKA  176



>ref|XP_010248373.1| PREDICTED: metacaspase-5-like [Nelumbo nucifera]
Length=416

 Score =   229 bits (585),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 143/167 (86%), Gaps = 1/167 (1%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            MA++A+L+G NYPG + EL GCVNDV+RMH+ L+DRYGFSE DITVLIDTD SYTQPTG+
Sbjct  1    MAKRALLVGCNYPGMEIELGGCVNDVKRMHKSLIDRYGFSEQDITVLIDTDNSYTQPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR+ALSDLV+SA  G +LF HYSGHG RLP ETGEEDDTG+DECIVP D NLITDD+ R
Sbjct  61   NIRAALSDLVRSAEPGGFLFFHYSGHGNRLPPETGEEDDTGYDECIVPCDINLITDDEIR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDNAD-ADDAD  511
            + V+ +P+GCR+TIVSDSCHSGGLID+AKEQIGES+  + +   DAD
Sbjct  121  DFVELVPEGCRITIVSDSCHSGGLIDEAKEQIGESSKRHRELVSDAD  167



>ref|XP_009106653.1| PREDICTED: metacaspase-6-like [Brassica rapa]
Length=375

 Score =   228 bits (582),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 121/156 (78%), Positives = 138/156 (88%), Gaps = 0/156 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            MA++AVLIGINY GTKAEL+GCVNDVRRMH  LV+RYGFS+ +I +LIDTD+S  +PTG+
Sbjct  1    MAKRAVLIGINYVGTKAELRGCVNDVRRMHVSLVERYGFSDKNIKLLIDTDSSTIKPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR AL DLV+ A  GD LFVHYSGHGTRLPAETGE+DDTG+DECIVPSD NLITDDDFR
Sbjct  61   NIRQALLDLVQPAQPGDVLFVHYSGHGTRLPAETGEDDDTGYDECIVPSDMNLITDDDFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGEST  481
            +LVD  P+ C +TIVSDSCHSGGLID+AKEQIGEST
Sbjct  121  DLVDMAPKDCPITIVSDSCHSGGLIDEAKEQIGEST  156



>ref|XP_002887779.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64038.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=357

 Score =   227 bits (579),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 120/165 (73%), Positives = 141/165 (85%), Gaps = 0/165 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            MA+KA+LIGINY GTKAEL+GCVNDVRRM   LV+RYGFSE +I +LIDTD++  +PTG+
Sbjct  1    MAKKALLIGINYVGTKAELRGCVNDVRRMRITLVERYGFSETNIKMLIDTDSTSIKPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR AL DLV+ A  GD LFVHYSGHGTRLPAETGE+DDTG+DECIVPSD NLITDDDFR
Sbjct  61   NIRQALLDLVEPAKPGDVLFVHYSGHGTRLPAETGEDDDTGYDECIVPSDMNLITDDDFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDNADADDA  508
            +LV+ +P+ C +TI+SDSCHSGGLID+AKEQIGEST    D  D+
Sbjct  121  DLVEMVPKDCPITIISDSCHSGGLIDEAKEQIGESTKKKKDYGDS  165



>ref|XP_007149156.1| hypothetical protein PHAVU_005G046100g [Phaseolus vulgaris]
 gb|ESW21150.1| hypothetical protein PHAVU_005G046100g [Phaseolus vulgaris]
Length=380

 Score =   227 bits (578),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 115/157 (73%), Positives = 135/157 (86%), Gaps = 0/157 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            M +KAVLIG NYPGTKAEL+GC+NDV  M +CL++ YGFSE DI VLIDT  SYTQPTG+
Sbjct  1    MGKKAVLIGCNYPGTKAELRGCINDVWSMKKCLINIYGFSEKDIVVLIDTHHSYTQPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR ALS LV+SA SGD LFVHYSGHGTRLPAE+ ++D+TG+DECIVP+D NLI DDDFR
Sbjct  61   NIRFALSKLVRSAKSGDVLFVHYSGHGTRLPAESDDQDNTGYDECIVPTDMNLIADDDFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTH  484
             LVD +P+GC +TIVSD CHSGGLI+ AKEQIG+ST+
Sbjct  121  LLVDKVPRGCNITIVSDCCHSGGLIEAAKEQIGDSTN  157



>ref|NP_178051.1| metacaspase 5 [Arabidopsis thaliana]
 sp|O64518.1|MCA5_ARATH RecName: Full=Metacaspase-5; Short=AtMC5; AltName: Full=Metacaspase 
2b; Short=AtMCP2b; AltName: Full=Metacaspase-6 [Arabidopsis 
thaliana]
 gb|AAC17038.1| Contains similarity to S. cerevisiae hypothetical protein YOR197w, 
gb|Z75105. EST gb|T76227 comes from this gene [Arabidopsis 
thaliana]
 gb|AAP84714.1| metacaspase 6 [Arabidopsis thaliana]
 gb|AAP44518.1| metacaspase 5 precursor [Arabidopsis thaliana]
 gb|ABJ98568.1| At1g79330 [Arabidopsis thaliana]
 gb|AEE36231.1| metacaspase 5 [Arabidopsis thaliana]
Length=410

 Score =   228 bits (580),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 119/156 (76%), Positives = 139/156 (89%), Gaps = 0/156 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            MA+KAVLIGINYPGTKAEL+GCVNDVRR+H+ LVDR+GFSE +IT LIDTD S T+PTG+
Sbjct  1    MAKKAVLIGINYPGTKAELRGCVNDVRRVHKSLVDRFGFSERNITELIDTDESSTKPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR AL +LV+SA  GD L VHYSGHGTRLPAETGE+DDTG+DECIVP D NLITDD+FR
Sbjct  61   NIRRALLNLVESAKPGDVLVVHYSGHGTRLPAETGEDDDTGYDECIVPCDMNLITDDEFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGEST  481
            +LV+ +P+   +TI+SDSCHSGGLID+AKEQIGEST
Sbjct  121  DLVEKVPKEAHITIISDSCHSGGLIDEAKEQIGEST  156



>gb|EAY76152.1| hypothetical protein OsI_04084 [Oryza sativa Indica Group]
Length=417

 Score =   227 bits (579),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 121/160 (76%), Positives = 132/160 (83%), Gaps = 1/160 (1%)
 Frame = +2

Query  14   MARK-AVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTG  190
            M RK A+L+GINYPGTKAELKGC NDV RMHRCLVDR+GF EDDI VL+D D+S TQPTG
Sbjct  1    MGRKRALLVGINYPGTKAELKGCHNDVDRMHRCLVDRFGFDEDDIRVLLDRDSSGTQPTG  60

Query  191  RNIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDF  370
             NIR AL+ LV  A  GD+LF HYSGHGTRLPAETG+ DDTG+DECIVPSD NLITD DF
Sbjct  61   ANIRRALAQLVGDARPGDFLFFHYSGHGTRLPAETGQNDDTGYDECIVPSDMNLITDQDF  120

Query  371  RELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDN  490
            RELV  +P GC  TIVSDSCHSGGL+D AKEQIG ST  N
Sbjct  121  RELVQKVPNGCLFTIVSDSCHSGGLLDSAKEQIGNSTRQN  160



>ref|NP_001044530.1| Os01g0799900 [Oryza sativa Japonica Group]
 dbj|BAB92418.1| putative latex-abundant protein [Oryza sativa Japonica Group]
 dbj|BAF06444.1| Os01g0799900 [Oryza sativa Japonica Group]
 gb|EAZ13839.1| hypothetical protein OsJ_03763 [Oryza sativa Japonica Group]
 dbj|BAG93160.1| unnamed protein product [Oryza sativa Japonica Group]
Length=417

 Score =   227 bits (579),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 121/160 (76%), Positives = 132/160 (83%), Gaps = 1/160 (1%)
 Frame = +2

Query  14   MARK-AVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTG  190
            M RK A+L+GINYPGTKAELKGC NDV RMHRCLVDR+GF EDDI VL+D D+S TQPTG
Sbjct  1    MGRKRALLVGINYPGTKAELKGCHNDVDRMHRCLVDRFGFDEDDIRVLLDRDSSGTQPTG  60

Query  191  RNIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDF  370
             NIR AL+ LV  A  GD+LF HYSGHGTRLPAETG+ DDTG+DECIVPSD NLITD DF
Sbjct  61   ANIRRALAQLVGDARPGDFLFFHYSGHGTRLPAETGQNDDTGYDECIVPSDMNLITDQDF  120

Query  371  RELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDN  490
            RELV  +P GC  TIVSDSCHSGGL+D AKEQIG ST  N
Sbjct  121  RELVQKVPNGCLFTIVSDSCHSGGLLDSAKEQIGNSTRQN  160



>gb|EPS69363.1| hypothetical protein M569_05402, partial [Genlisea aurea]
Length=436

 Score =   227 bits (579),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 121/168 (72%), Positives = 140/168 (83%), Gaps = 0/168 (0%)
 Frame = +2

Query  8    REMARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPT  187
            + MARKAVLIG NY GTKAEL+GC+NDVRRM+ CLVD YGFS+DDITVL D   S  QPT
Sbjct  3    KTMARKAVLIGCNYGGTKAELRGCINDVRRMYACLVDLYGFSKDDITVLTDAADSDLQPT  62

Query  188  GRNIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDD  367
            GRNIR A++DL+ SA  GD LFVHYSGHGTRLPAETGE+DDTG+DECIVP+D NLITDDD
Sbjct  63   GRNIRQAITDLIGSASPGDILFVHYSGHGTRLPAETGEDDDTGYDECIVPTDMNLITDDD  122

Query  368  FRELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDNADADDAD  511
            FR  V+ +P+GC++TIVSDSCHSGGLID+AKEQIG ST  + +    D
Sbjct  123  FRGFVNQVPEGCQITIVSDSCHSGGLIDEAKEQIGNSTKQSNEEHGGD  170



>emb|CDX88528.1| BnaC06g39720D [Brassica napus]
Length=374

 Score =   223 bits (569),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            MA++AVLIGINY GTKAEL+GCVNDVRRMH  LV+RYGFS+ +I +LIDTD+S T+PTG+
Sbjct  1    MAKRAVLIGINYVGTKAELRGCVNDVRRMHVSLVERYGFSDKNIKLLIDTDSSTTKPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR AL DLV+ A  GD LFVHYSGHGTRLPAETGE+DDTG+DECIVPSD NLITDDDFR
Sbjct  61   NIRQALLDLVQPAKPGDVLFVHYSGHGTRLPAETGEDDDTGYDECIVPSDMNLITDDDFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQI  469
            +LVD  P+ C +TIVSDSCHSGGLID+AKEQI
Sbjct  121  DLVDMAPKDCPITIVSDSCHSGGLIDEAKEQI  152



>ref|XP_006644845.1| PREDICTED: metacaspase-4-like [Oryza brachyantha]
Length=417

 Score =   224 bits (570),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 118/160 (74%), Positives = 132/160 (83%), Gaps = 1/160 (1%)
 Frame = +2

Query  14   MARK-AVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTG  190
            M RK A+L+GINYPGTKAEL+GC NDV RMHRCLVDR+ F EDDI VL+D D+S TQPTG
Sbjct  1    MGRKRALLVGINYPGTKAELRGCHNDVDRMHRCLVDRFDFDEDDIRVLVDRDSSGTQPTG  60

Query  191  RNIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDF  370
             NIR A++ LV  A  GD+LF HYSGHGTRLPAE G++DDTG+DECIVPSD NLITD DF
Sbjct  61   ANIRRAMARLVGDARPGDFLFFHYSGHGTRLPAEKGQDDDTGYDECIVPSDMNLITDQDF  120

Query  371  RELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDN  490
            RELV  +P GC  TIVSDSCHSGGL+DKAKEQIG ST  N
Sbjct  121  RELVQKVPNGCLFTIVSDSCHSGGLLDKAKEQIGNSTKQN  160



>ref|XP_010232456.1| PREDICTED: metacaspase-4-like [Brachypodium distachyon]
Length=428

 Score =   224 bits (570),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 120/160 (75%), Positives = 132/160 (83%), Gaps = 1/160 (1%)
 Frame = +2

Query  14   MARK-AVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTG  190
            M RK A+L+GINYPGTKAELKGC NDV RMHRCLVDR+GF EDDI VL+D  +S  QPTG
Sbjct  1    MGRKLALLVGINYPGTKAELKGCHNDVDRMHRCLVDRFGFDEDDIRVLVDRGSSGPQPTG  60

Query  191  RNIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDF  370
             NIR AL+ LV  A  GD+LF HYSGHGTRLPAETG++DDTG+DECIVPSD NLITD DF
Sbjct  61   ANIRRALARLVGDARPGDFLFFHYSGHGTRLPAETGQDDDTGYDECIVPSDMNLITDQDF  120

Query  371  RELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDN  490
            RELV  +P GC  TIVSDSCHSGGL+DKAKEQIG ST  N
Sbjct  121  RELVQKVPDGCIFTIVSDSCHSGGLLDKAKEQIGNSTRQN  160



>dbj|BAJ91232.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=404

 Score =   223 bits (568),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 119/160 (74%), Positives = 133/160 (83%), Gaps = 1/160 (1%)
 Frame = +2

Query  14   MARK-AVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTG  190
            M RK A+L+GINYPGTKAELKGC NDV RMHRCLVDR+GF E+DITVL+D  +S  QPTG
Sbjct  1    MGRKLALLVGINYPGTKAELKGCHNDVDRMHRCLVDRFGFDEEDITVLLDRGSSGPQPTG  60

Query  191  RNIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDF  370
             NIR AL+ LV  A  GD+LF HYSGHGTRLPAETG++DDTG+DECIVPSD NLITD DF
Sbjct  61   ANIRHALAKLVGDARPGDFLFFHYSGHGTRLPAETGQDDDTGYDECIVPSDMNLITDQDF  120

Query  371  RELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDN  490
            R+LV  +P GC  TIVSDSCHSGGL+DKAKEQIG ST  N
Sbjct  121  RDLVQKVPDGCIFTIVSDSCHSGGLLDKAKEQIGNSTRQN  160



>emb|CAD59226.2| metacaspase type II [Picea abies]
Length=418

 Score =   222 bits (566),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 134/158 (85%), Gaps = 0/158 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            M +KAVL+G NYPGTKAELKGCVNDV RM++CLV+RYGF E++I VLIDTD SY QPTG 
Sbjct  1    MTKKAVLVGCNYPGTKAELKGCVNDVNRMYKCLVERYGFEEENIRVLIDTDDSYPQPTGA  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            N+R AL  LV+ + +GD +F HYSGHG RLPAETG++DDTG+DECIVP D NLITDDDFR
Sbjct  61   NVRRALKTLVEGSRAGDIIFFHYSGHGVRLPAETGDKDDTGYDECIVPCDMNLITDDDFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHD  487
            E +D +P+ C  TIVSDSCHSGGLI++AKEQIGEST D
Sbjct  121  EFIDKVPRDCFCTIVSDSCHSGGLIERAKEQIGESTKD  158



>ref|XP_004970257.1| PREDICTED: metacaspase-4-like [Setaria italica]
Length=423

 Score =   223 bits (567),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 120/163 (74%), Positives = 131/163 (80%), Gaps = 3/163 (2%)
 Frame = +2

Query  2    GGREMARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQ  181
            GGR   ++A+L+GINYPGTKAELKGC NDV RMHRCLVDR+GF EDDI VL D D S  Q
Sbjct  2    GGR---KRALLVGINYPGTKAELKGCHNDVDRMHRCLVDRFGFDEDDIRVLSDKDRSGPQ  58

Query  182  PTGRNIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITD  361
            PTG NIR AL+ LV  A  GD+LF HYSGHGTRLPAETG+ DDTG+DECIVPSD NLITD
Sbjct  59   PTGANIRRALARLVGDARPGDFLFFHYSGHGTRLPAETGQHDDTGYDECIVPSDMNLITD  118

Query  362  DDFRELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDN  490
             DFRELV  +P GC  TIVSDSCHSGGL+D AKEQIG ST  N
Sbjct  119  QDFRELVQKVPDGCLFTIVSDSCHSGGLLDSAKEQIGNSTRQN  161



>gb|AET08881.1| metacaspase 1 [Aegilops tauschii]
 gb|AET34448.1| metacaspase 4 [Triticum aestivum]
 gb|EMT32086.1| Metacaspase-4 [Aegilops tauschii]
 emb|CCC14977.1| MC1D protein [Aegilops tauschii]
Length=405

 Score =   222 bits (565),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 118/160 (74%), Positives = 133/160 (83%), Gaps = 1/160 (1%)
 Frame = +2

Query  14   MARK-AVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTG  190
            M RK A+L+GINYPGTKAELKGC NDV RMH+CLVDR+GF ED+ITVL+D  +S  QPTG
Sbjct  1    MGRKLALLVGINYPGTKAELKGCHNDVDRMHKCLVDRFGFDEDNITVLLDRGSSGPQPTG  60

Query  191  RNIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDF  370
             NIR AL+ LV  A  GD+LF HYSGHGTRLPAETG++DDTG+DECIVPSD NLITD DF
Sbjct  61   ANIRHALAKLVGEARRGDFLFFHYSGHGTRLPAETGQDDDTGYDECIVPSDMNLITDQDF  120

Query  371  RELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDN  490
            R+LV  +P GC  TIVSDSCHSGGL+DKAKEQIG ST  N
Sbjct  121  RDLVQKVPDGCIFTIVSDSCHSGGLLDKAKEQIGNSTKQN  160



>gb|ACY82389.1| type II metacaspase [Triticum aestivum]
Length=405

 Score =   221 bits (564),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 118/160 (74%), Positives = 133/160 (83%), Gaps = 1/160 (1%)
 Frame = +2

Query  14   MARK-AVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTG  190
            M RK A+L+GINYPGTKAELKGC NDV RMH+CLVDR+GF ED+ITVL+D  +S  QPTG
Sbjct  1    MGRKLALLVGINYPGTKAELKGCHNDVDRMHKCLVDRFGFDEDNITVLLDRGSSGPQPTG  60

Query  191  RNIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDF  370
             NIR AL+ LV  A  GD+LF HYSGHGTRLPAETG++DDTG+DECIVPSD NLITD DF
Sbjct  61   ANIRHALAKLVGDARRGDFLFFHYSGHGTRLPAETGQDDDTGYDECIVPSDMNLITDQDF  120

Query  371  RELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDN  490
            R+LV  +P GC  TIVSDSCHSGGL+DKAKEQIG ST  N
Sbjct  121  RDLVQKVPDGCIFTIVSDSCHSGGLLDKAKEQIGNSTRQN  160



>gb|AET08880.1| metacaspase 1 [Aegilops speltoides]
 emb|CCC14966.1| MC1B protein [Aegilops speltoides]
Length=405

 Score =   221 bits (562),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 117/160 (73%), Positives = 133/160 (83%), Gaps = 1/160 (1%)
 Frame = +2

Query  14   MARK-AVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTG  190
            M RK A+L+GINYPGTKAELKGC NDV RMH+CLVDR+GF E++ITVL+D  +S  QPTG
Sbjct  1    MGRKLALLVGINYPGTKAELKGCHNDVDRMHKCLVDRFGFDEENITVLLDRGSSGPQPTG  60

Query  191  RNIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDF  370
             NIR AL+ LV  A  GD+LF HYSGHGTRLPAETG++DDTG+DECIVPSD NLITD DF
Sbjct  61   ANIRHALAKLVGEARRGDFLFFHYSGHGTRLPAETGQDDDTGYDECIVPSDMNLITDQDF  120

Query  371  RELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDN  490
            R+LV  +P GC  TIVSDSCHSGGL+DKAKEQIG ST  N
Sbjct  121  RDLVQKVPDGCIFTIVSDSCHSGGLLDKAKEQIGNSTKQN  160



>emb|CDM84568.1| unnamed protein product [Triticum aestivum]
Length=405

 Score =   220 bits (561),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 117/160 (73%), Positives = 133/160 (83%), Gaps = 1/160 (1%)
 Frame = +2

Query  14   MARK-AVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTG  190
            M RK A+L+GINYPGTKAELKGC NDV RMH+CLVDR+GF E++ITVL+D  +S  QPTG
Sbjct  1    MGRKLALLVGINYPGTKAELKGCHNDVDRMHKCLVDRFGFDEENITVLLDRGSSGPQPTG  60

Query  191  RNIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDF  370
             NIR AL+ LV  A  GD+LF HYSGHGTRLPAETG++DDTG+DECIVPSD NLITD DF
Sbjct  61   ANIRHALAKLVGDARRGDFLFFHYSGHGTRLPAETGQDDDTGYDECIVPSDMNLITDQDF  120

Query  371  RELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDN  490
            R+LV  +P GC  TIVSDSCHSGGL+DKAKEQIG ST  N
Sbjct  121  RDLVQKVPDGCIFTIVSDSCHSGGLLDKAKEQIGNSTRQN  160



>ref|XP_010417593.1| PREDICTED: metacaspase-5-like [Camelina sativa]
Length=388

 Score =   220 bits (560),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 130/155 (84%), Gaps = 0/155 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            M +KA+LIGINYPGT+ EL GC+NDV R H+ LV+ +GFSE++IT LIDTD S  QPTG+
Sbjct  1    MVKKAILIGINYPGTEGELLGCINDVTRTHKSLVELFGFSEENITELIDTDKSKIQPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR A SDLV++A SGD LFVHYSGHGTRLP ETGE+DDT FDECIVPSD N ITDDD R
Sbjct  61   NIRQAFSDLVETAKSGDVLFVHYSGHGTRLPPETGEDDDTEFDECIVPSDHNYITDDDIR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGES  478
            E+VD +P+GC  T VSDSCHSGGLID AKEQIGES
Sbjct  121  EIVDKVPKGCSFTFVSDSCHSGGLIDSAKEQIGES  155



>emb|CDX88526.1| BnaC06g39700D [Brassica napus]
Length=318

 Score =   217 bits (553),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 113/155 (73%), Positives = 129/155 (83%), Gaps = 0/155 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            M +KAVLIGINYPGT+ EL GC+NDV+RMH+ LV+ YGFSE++I  LIDTD S TQPTG+
Sbjct  1    MVKKAVLIGINYPGTEEELVGCINDVKRMHKSLVELYGFSEENIVELIDTDESKTQPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR A  DLV SA  GD LFVHYSGHGTRLP +TGE+DDTG+DECIVPSD N ITDDD +
Sbjct  61   NIRQAFWDLVGSAQPGDVLFVHYSGHGTRLPPKTGEDDDTGYDECIVPSDINYITDDDIK  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGES  478
            E+V  +P+GC  T VSDSCHSGGLID AKEQIGES
Sbjct  121  EIVGHVPKGCSFTFVSDSCHSGGLIDSAKEQIGES  155



>ref|XP_006302384.1| hypothetical protein CARUB_v10020450mg [Capsella rubella]
 gb|EOA35282.1| hypothetical protein CARUB_v10020450mg [Capsella rubella]
Length=385

 Score =   218 bits (556),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 128/155 (83%), Gaps = 0/155 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            M +KA+LIGINYPGT+ EL+GC+NDV R H+ LV  +GFSE++IT LIDTD S  QPTG+
Sbjct  1    MVKKAILIGINYPGTEGELRGCINDVTRTHKSLVQLFGFSEENITELIDTDKSKIQPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR A SDLV SA SGD LFVHYSGHGTRLP ETGE+DDT FDECIVPSD N ITDDD R
Sbjct  61   NIRRAFSDLVDSAKSGDVLFVHYSGHGTRLPPETGEDDDTEFDECIVPSDHNYITDDDIR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGES  478
            E+VD +P+GC  T VSDSCHSGGLID  KEQIGES
Sbjct  121  EIVDKVPKGCSFTFVSDSCHSGGLIDSTKEQIGES  155



>ref|XP_010472784.1| PREDICTED: metacaspase-6-like isoform X2 [Camelina sativa]
Length=362

 Score =   218 bits (555),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 130/155 (84%), Gaps = 0/155 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            M +KA+LIGINYPGT+ EL GC+NDV R H+ LV+ +GF E++IT LIDT+ S  QPTG+
Sbjct  1    MVKKAILIGINYPGTEGELLGCINDVTRTHKSLVELFGFLEENITELIDTEKSKIQPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR A SDLV+SA SGD+LFVHYSGHGTRLP ETGE+DDT FDECIVPSD N ITDDD R
Sbjct  61   NIRQAFSDLVESAKSGDFLFVHYSGHGTRLPPETGEDDDTEFDECIVPSDHNYITDDDIR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGES  478
            E+VD +P+GC  T VSDSCH+GGLID AKEQIGES
Sbjct  121  EIVDKVPKGCSFTFVSDSCHTGGLIDSAKEQIGES  155



>ref|XP_009106652.1| PREDICTED: metacaspase-5-like [Brassica rapa]
Length=389

 Score =   219 bits (557),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 114/161 (71%), Positives = 131/161 (81%), Gaps = 0/161 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            M +KAVLIGINYPGT+ EL GC+NDV+RMH+ LV+ YGFSE++I  LIDTD S TQPTG+
Sbjct  1    MVKKAVLIGINYPGTEGELLGCINDVKRMHKSLVELYGFSEENIVELIDTDESQTQPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR A  DLV SA  GD LFVHYSGHGTRLP ETGE+DDTG+DECIVPSD N ITDDD +
Sbjct  61   NIRQAFWDLVGSAQPGDVLFVHYSGHGTRLPPETGEDDDTGYDECIVPSDINYITDDDIK  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDNAD  496
            E+V  +P+GC  T VSDSCHSGGLID AKEQIGES    ++
Sbjct  121  EIVSHVPKGCSFTFVSDSCHSGGLIDSAKEQIGESFKKKSN  161



>gb|ABK24525.1| unknown [Picea sitchensis]
Length=418

 Score =   219 bits (559),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 113/158 (72%), Positives = 133/158 (84%), Gaps = 0/158 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            M +KAVL+G NYPGTKAELKGCVNDV RM++CLV+RY F E++I VLIDTD SY QPTG 
Sbjct  1    MTKKAVLVGCNYPGTKAELKGCVNDVNRMYKCLVERYCFEEENIRVLIDTDDSYPQPTGA  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            N+R AL  LV+ + +GD +F HYSGHG RLPAETG++DDTG+DECIVP D NLITDDDFR
Sbjct  61   NVRRALKTLVEGSRAGDIIFFHYSGHGVRLPAETGDKDDTGYDECIVPCDMNLITDDDFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHD  487
            E +D +P+ C  TIVSDSCHSGGLI++AKEQIGEST D
Sbjct  121  EFIDKVPRDCFCTIVSDSCHSGGLIERAKEQIGESTKD  158



>ref|XP_010429811.1| PREDICTED: metacaspase-5-like [Camelina sativa]
Length=387

 Score =   218 bits (555),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 113/155 (73%), Positives = 129/155 (83%), Gaps = 0/155 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            M +KA+LIGINYPGT+ EL GC+NDV R H+ LV+ +GF E++IT LIDTD S  QPTG+
Sbjct  1    MVKKAILIGINYPGTEGELLGCINDVTRTHKSLVELFGFPEENITELIDTDKSKIQPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR A SDLV++A SGD LFVHYSGHGTRLP ETGE+DDT FDECIVPSD N ITDDD R
Sbjct  61   NIRQAFSDLVETAKSGDVLFVHYSGHGTRLPPETGEDDDTEFDECIVPSDHNYITDDDIR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGES  478
            E+VD +P+GC  T VSDSCHSGGLID AKEQIGES
Sbjct  121  EIVDKVPKGCSFTFVSDSCHSGGLIDSAKEQIGES  155



>ref|XP_010472783.1| PREDICTED: metacaspase-5-like isoform X1 [Camelina sativa]
Length=388

 Score =   218 bits (555),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 130/155 (84%), Gaps = 0/155 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            M +KA+LIGINYPGT+ EL GC+NDV R H+ LV+ +GF E++IT LIDT+ S  QPTG+
Sbjct  1    MVKKAILIGINYPGTEGELLGCINDVTRTHKSLVELFGFLEENITELIDTEKSKIQPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR A SDLV+SA SGD+LFVHYSGHGTRLP ETGE+DDT FDECIVPSD N ITDDD R
Sbjct  61   NIRQAFSDLVESAKSGDFLFVHYSGHGTRLPPETGEDDDTEFDECIVPSDHNYITDDDIR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGES  478
            E+VD +P+GC  T VSDSCH+GGLID AKEQIGES
Sbjct  121  EIVDKVPKGCSFTFVSDSCHTGGLIDSAKEQIGES  155



>ref|XP_006304434.1| hypothetical protein CARUB_v10011040mg [Capsella rubella]
 gb|EOA37332.1| hypothetical protein CARUB_v10011040mg [Capsella rubella]
Length=371

 Score =   217 bits (552),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 106/156 (68%), Positives = 125/156 (80%), Gaps = 1/156 (1%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            MA+KA+LIGINYPGT  EL+GCVNDVRRM +CL++RYGFS  DIT+LIDTD SY QPTG+
Sbjct  1    MAKKALLIGINYPGTAVELRGCVNDVRRMQKCLIERYGFSNGDITILIDTDKSYIQPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeed-dtgfdeCIVPSDFNLITDDDF  370
            NIR  L DL+K+  SGD L  HYSGHGTRLP    E    TG+DECI P D NLI DDDF
Sbjct  61   NIRDKLEDLIKAGKSGDILVFHYSGHGTRLPPVNEESGDSTGYDECITPCDMNLIKDDDF  120

Query  371  RELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGES  478
            R++V  + +GC+LTI+SDSCHSGGLI++ KEQIGES
Sbjct  121  RQMVAKVEKGCQLTIISDSCHSGGLIEEVKEQIGES  156



>emb|CDX87393.1| BnaA07g34800D [Brassica napus]
Length=389

 Score =   217 bits (552),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 113/154 (73%), Positives = 128/154 (83%), Gaps = 0/154 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            M +KAVLIGINYPGT+ EL GC+NDV+RMH+ LV+ YGFSE++I  LIDTD S TQPTG+
Sbjct  1    MVKKAVLIGINYPGTEGELVGCINDVKRMHKSLVELYGFSEENIVELIDTDESKTQPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR A  DLV SA  GD LFVHYSGHGTRLP ETGE+DDTG+DECIVPSD N ITDDD +
Sbjct  61   NIRQAFWDLVGSAQPGDVLFVHYSGHGTRLPPETGEDDDTGYDECIVPSDINYITDDDIK  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGE  475
            E+V  +P+GC  T VSDSCHSGGLID AKEQIGE
Sbjct  121  EIVSHVPKGCSFTFVSDSCHSGGLIDSAKEQIGE  154



>gb|ACB11499.1| metacaspase type II [Pinus sylvestris]
Length=418

 Score =   218 bits (554),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 112/158 (71%), Positives = 131/158 (83%), Gaps = 0/158 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            M RKAVL+G NYPGTKAELKGCVNDV RM++CLV+R+GF E++I VLIDTD SY QPTG 
Sbjct  1    MTRKAVLVGCNYPGTKAELKGCVNDVNRMYKCLVERFGFKEENIRVLIDTDDSYPQPTGA  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR A   L + A  GD +F HYSGHG RLPAETG++DDTG+DECIVP D N+ITDDDFR
Sbjct  61   NIRRAWKTLAEGARPGDIIFFHYSGHGVRLPAETGDQDDTGYDECIVPCDMNIITDDDFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHD  487
            + +D +P+ C  TIVSDSCHSGGLI++AKEQIGEST D
Sbjct  121  DFIDKVPRDCLCTIVSDSCHSGGLIERAKEQIGESTKD  158



>ref|XP_002978512.1| hypothetical protein SELMODRAFT_152567 [Selaginella moellendorffii]
 gb|EFJ20498.1| hypothetical protein SELMODRAFT_152567 [Selaginella moellendorffii]
Length=431

 Score =   218 bits (555),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 108/156 (69%), Positives = 135/156 (87%), Gaps = 0/156 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            M ++A+L+G NYPGTKAEL GCVNDV+RM+R LV+++GF+ED+I VLIDTD+  TQPTG 
Sbjct  1    MGKRALLVGCNYPGTKAELHGCVNDVKRMYRSLVEKFGFAEDEIVVLIDTDSEGTQPTGA  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR AL++L++    GD LF HYSGHG R+PAE+GE DDTG+DECIVP D NLITDDDFR
Sbjct  61   NIRKALANLIEGTEDGDILFFHYSGHGVRVPAESGEPDDTGYDECIVPCDMNLITDDDFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGEST  481
            +LVD LP+GCR+T+VSDSCHSGGLI+ AKEQ+G+S+
Sbjct  121  DLVDKLPEGCRITLVSDSCHSGGLIENAKEQVGDSS  156



>gb|AGT16256.1| metacaspase [Saccharum hybrid cultivar R570]
Length=419

 Score =   217 bits (552),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 117/163 (72%), Positives = 129/163 (79%), Gaps = 3/163 (2%)
 Frame = +2

Query  2    GGREMARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQ  181
            GGR++A   +L+GINYPGTKAELKGC NDV RM RCLVDR+GF E DI VL D D S  Q
Sbjct  2    GGRKLA---LLVGINYPGTKAELKGCYNDVDRMRRCLVDRFGFDEADIRVLTDADRSAPQ  58

Query  182  PTGRNIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITD  361
            PTG NIR AL+ LV  A  GD+LF HYSGHGTRLPAETG+ DDTG+DECIVP D NLITD
Sbjct  59   PTGANIRRALARLVGDARPGDFLFFHYSGHGTRLPAETGQHDDTGYDECIVPCDMNLITD  118

Query  362  DDFRELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDN  490
             DFRELV  +P+GC  TIVSDSCHSGGL+D AKEQIG ST  N
Sbjct  119  QDFRELVQKVPEGCLFTIVSDSCHSGGLLDSAKEQIGNSTRQN  161



>tpg|DAA57249.1| TPA: putative metacaspase family protein [Zea mays]
Length=421

 Score =   216 bits (551),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 117/163 (72%), Positives = 129/163 (79%), Gaps = 3/163 (2%)
 Frame = +2

Query  2    GGREMARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQ  181
            GGR++A   +L+GINYPGTKAELKGC NDV RM RCLVDR+GF E DI VL D D S  Q
Sbjct  2    GGRKIA---LLVGINYPGTKAELKGCYNDVDRMRRCLVDRFGFDEADIRVLTDADRSAPQ  58

Query  182  PTGRNIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITD  361
            PTG NIR AL+ LV  A  GD+LF HYSGHGTRLPAETG+ DDTG+DECIVP D NLITD
Sbjct  59   PTGANIRRALARLVGDARPGDFLFFHYSGHGTRLPAETGQHDDTGYDECIVPCDMNLITD  118

Query  362  DDFRELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDN  490
             DFRELV  +P+GC  TIVSDSCHSGGL+D AKEQIG ST  N
Sbjct  119  QDFRELVQKVPEGCLFTIVSDSCHSGGLLDSAKEQIGNSTKQN  161



>ref|XP_002456486.1| hypothetical protein SORBIDRAFT_03g037160 [Sorghum bicolor]
 gb|EES01606.1| hypothetical protein SORBIDRAFT_03g037160 [Sorghum bicolor]
Length=419

 Score =   216 bits (551),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 116/163 (71%), Positives = 129/163 (79%), Gaps = 3/163 (2%)
 Frame = +2

Query  2    GGREMARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQ  181
            GGR++A   +L+GINYPGTKAELKGC NDV RM RCL+DR+GF E DI VL D D S  Q
Sbjct  2    GGRKLA---LLVGINYPGTKAELKGCYNDVDRMRRCLIDRFGFDEADIRVLTDADRSAPQ  58

Query  182  PTGRNIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITD  361
            PTG NIR AL+ LV  A  GD+LF HYSGHGTRLPAETG+ DDTG+DECIVP D NLITD
Sbjct  59   PTGANIRRALARLVGDARPGDFLFFHYSGHGTRLPAETGQNDDTGYDECIVPCDMNLITD  118

Query  362  DDFRELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDN  490
             DFRELV  +P+GC  TIVSDSCHSGGL+D AKEQIG ST  N
Sbjct  119  QDFRELVQKVPEGCLFTIVSDSCHSGGLLDSAKEQIGNSTRQN  161



>emb|CDX81762.1| BnaC08g38390D [Brassica napus]
Length=375

 Score =   214 bits (544),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 106/155 (68%), Positives = 123/155 (79%), Gaps = 0/155 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            MA+KA+LIGINYPGT  EL+GCVNDVRRM +CL+DRYGFS  DITVLIDTD S  QPTG+
Sbjct  1    MAKKALLIGINYPGTAVELRGCVNDVRRMQKCLIDRYGFSNKDITVLIDTDKSSIQPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR AL  L+     GD L  HYSGHGTRLP E G  D T +DECI P D NLITD++FR
Sbjct  61   NIREALKKLIAEGEPGDVLVFHYSGHGTRLPTEEGLFDATDYDECITPCDMNLITDNEFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGES  478
            ++V  + +GC LTI+SDSCHSGGLI++AKEQIGES
Sbjct  121  DMVAEVKKGCLLTIISDSCHSGGLIEEAKEQIGES  155



>ref|XP_002970440.1| hypothetical protein SELMODRAFT_270839 [Selaginella moellendorffii]
 ref|XP_002994502.1| hypothetical protein SELMODRAFT_229801 [Selaginella moellendorffii]
 gb|EFJ04429.1| hypothetical protein SELMODRAFT_229801 [Selaginella moellendorffii]
 gb|EFJ28570.1| hypothetical protein SELMODRAFT_270839 [Selaginella moellendorffii]
Length=431

 Score =   215 bits (548),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 107/156 (69%), Positives = 134/156 (86%), Gaps = 0/156 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            M ++A+L+G NYPGTKAEL GCVNDV+RM+R LV+++GF+ED+I VLIDTD+  TQPTG 
Sbjct  1    MGKRALLVGCNYPGTKAELHGCVNDVKRMYRSLVEKFGFAEDEIVVLIDTDSEGTQPTGA  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR AL++L++    G  LF HYSGHG R+PAE+GE DDTG+DECIVP D NLITDDDFR
Sbjct  61   NIRKALANLIEGTEDGGILFFHYSGHGVRVPAESGEPDDTGYDECIVPCDMNLITDDDFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGEST  481
            +LVD LP+GCR+T+VSDSCHSGGLI+ AKEQ+G+S+
Sbjct  121  DLVDKLPEGCRITLVSDSCHSGGLIENAKEQVGDSS  156



>ref|XP_010497832.1| PREDICTED: metacaspase-8-like isoform X1 [Camelina sativa]
Length=249

 Score =   209 bits (533),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 128/167 (77%), Gaps = 1/167 (1%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            MA+KA+LIGINYPGT  EL+GCVNDVRRM +CL++RYGFS+ DIT+LIDTD S  QPTG+
Sbjct  1    MAKKALLIGINYPGTAVELRGCVNDVRRMQKCLIERYGFSKKDITILIDTDKSCIQPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAe-tgeeddtgfdeCIVPSDFNLITDDDF  370
            NIR  L +L+    SGD+L  HYSGHGTRLP       D TG+DECI PSD NLI DD+F
Sbjct  61   NIRHHLEELIDFGKSGDFLVFHYSGHGTRLPPPDDESGDSTGYDECITPSDMNLIMDDEF  120

Query  371  RELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDNADADDAD  511
            R +V  + +GC+LTI+SDSCHSGGLI++ KEQIGES     + + AD
Sbjct  121  RSMVSKVKKGCQLTIISDSCHSGGLIEEVKEQIGESHVKPIEENHAD  167



>ref|XP_009117766.1| PREDICTED: metacaspase-8 [Brassica rapa]
 emb|CDY51004.1| BnaA09g56330D [Brassica napus]
Length=375

 Score =   213 bits (543),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 105/155 (68%), Positives = 123/155 (79%), Gaps = 0/155 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            MA+KA+LIGINYPGT  EL+GCVNDVRRM +CL+DRYGFS  DITVLIDTD +  QPTG+
Sbjct  1    MAKKALLIGINYPGTAVELRGCVNDVRRMQKCLIDRYGFSNKDITVLIDTDKTSIQPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR AL  L+     GD L  HYSGHGTRLP E G  D T +DECI P D NLITD++FR
Sbjct  61   NIREALKKLIAEGEPGDVLVFHYSGHGTRLPTEEGLFDATDYDECITPCDMNLITDNEFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGES  478
            ++V  + +GC LTI+SDSCHSGGLI++AKEQIGES
Sbjct  121  DMVAEVKKGCLLTIISDSCHSGGLIEEAKEQIGES  155



>gb|AAC17037.1| Contains similarity to S. cerevisiae hypothetical protein YOR197w, 
gb|Z75105 [Arabidopsis thaliana]
Length=388

 Score =   212 bits (540),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 112/156 (72%), Positives = 131/156 (84%), Gaps = 15/156 (10%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            MA++A+LIGINYPGT  EL+GCVNDV RMH+CLVDR+GF+E+DITVLIDTD SYTQPTG+
Sbjct  1    MAKRALLIGINYPGTTEELQGCVNDVHRMHKCLVDRFGFAEEDITVLIDTDESYTQPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR ALS+L+K A SGD LFVHYSGHGTR+P ETGEEDD               TDDDFR
Sbjct  61   NIRQALSELIKPAKSGDVLFVHYSGHGTRVPPETGEEDD---------------TDDDFR  105

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGEST  481
            +LV+ +P+GC++TIVSDSCHSGGLID+AKEQIGEST
Sbjct  106  DLVEQVPEGCQITIVSDSCHSGGLIDEAKEQIGEST  141



>ref|XP_006416820.1| hypothetical protein EUTSA_v10007917mg [Eutrema salsugineum]
 gb|ESQ35173.1| hypothetical protein EUTSA_v10007917mg [Eutrema salsugineum]
Length=382

 Score =   211 bits (537),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 108/156 (69%), Positives = 127/156 (81%), Gaps = 1/156 (1%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            MA+KA+LIGINYPGT  EL+GCVNDVRRM +CL+DRYGF+E+DITVLIDTD S TQPTG+
Sbjct  1    MAKKALLIGINYPGTAVELRGCVNDVRRMRKCLIDRYGFTEEDITVLIDTDNSGTQPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeed-dtgfdeCIVPSDFNLITDDDF  370
            NIR AL+ L+ S  SGD L  HYSGHGTRLP E G     TGFDECI PSD NLI D +F
Sbjct  61   NIRDALTKLIGSGKSGDILVFHYSGHGTRLPPEKGILGDATGFDECITPSDMNLIMDHEF  120

Query  371  RELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGES  478
            R++V  + +GCRLTI+SDSCHSGGLI++  EQIG+S
Sbjct  121  RDMVAEVKEGCRLTIISDSCHSGGLIEELDEQIGDS  156



>gb|KFK42337.1| hypothetical protein AALP_AA2G243300 [Arabis alpina]
Length=961

 Score =   220 bits (560),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 119/156 (76%), Positives = 134/156 (86%), Gaps = 0/156 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            MAR+AVLIGINY GTKAEL+GCVNDVRRMH  LV++YGFS  +I +LIDTD+S  +PTG+
Sbjct  1    MARRAVLIGINYVGTKAELRGCVNDVRRMHVSLVEQYGFSAKNIKLLIDTDSSTIKPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR AL DLV  A  GD LFVHYSGHGTRLPAETGE+DDTG+DECIVPSD NLITDDD R
Sbjct  61   NIRQALLDLVTPAQPGDVLFVHYSGHGTRLPAETGEDDDTGYDECIVPSDMNLITDDDIR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGEST  481
            +LVD  P+ C +T VSDSCHSGGLID+AKEQIGEST
Sbjct  121  DLVDMAPKDCPITFVSDSCHSGGLIDEAKEQIGEST  156



>ref|XP_003568187.2| PREDICTED: metacaspase-5-like [Brachypodium distachyon]
Length=644

 Score =   215 bits (548),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 127/157 (81%), Gaps = 1/157 (1%)
 Frame = +2

Query  14   MARK-AVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTG  190
            M RK AVL+GINYPGTKAELKGC+NDV RM R LVDR+GF+E DI VL D D +  QPTG
Sbjct  1    MGRKRAVLVGINYPGTKAELKGCLNDVARMRRSLVDRFGFAEADIRVLADADPAAPQPTG  60

Query  191  RNIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDF  370
             NIR  L+ LV  A  GDYLF HYSGHGTRLPAETG++DDTG+DECIVPSD NLITD DF
Sbjct  61   ANIRRELARLVSDARPGDYLFFHYSGHGTRLPAETGQDDDTGYDECIVPSDMNLITDQDF  120

Query  371  RELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGEST  481
             ELV  +P GC  TIVSDSCHSGGL+DKAKEQIG ST
Sbjct  121  TELVQKVPNGCLFTIVSDSCHSGGLLDKAKEQIGHST  157



>gb|KFK44631.1| hypothetical protein AALP_AA1G283800 [Arabis alpina]
Length=406

 Score =   209 bits (532),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 129/155 (83%), Gaps = 0/155 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            M +KAVLIGINYPGT+ EL GCVNDV+R H+ LV+ +GF E++IT LIDTD S TQPTG+
Sbjct  1    MVKKAVLIGINYPGTEGELLGCVNDVKRTHKSLVELFGFLEENITELIDTDMSKTQPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NI  ALS+LV SA  GD LFVHYSGHGTR+P+ETGE DDTGFDECIVP D N ITDDD R
Sbjct  61   NILDALSELVGSAKPGDVLFVHYSGHGTRVPSETGENDDTGFDECIVPFDSNYITDDDIR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGES  478
            E+V  +P+ C +TIVSDSCHSGGLID +KEQIG+S
Sbjct  121  EIVSKVPKSCSITIVSDSCHSGGLIDSSKEQIGDS  155



>ref|NP_001055939.1| Os05g0496500 [Oryza sativa Japonica Group]
 gb|AAO72653.1| latex-abundant protein-like protein [Oryza sativa Japonica Group]
 gb|AAT07578.1| putative latex-abundant protein [Oryza sativa Japonica Group]
 dbj|BAF17853.1| Os05g0496500 [Oryza sativa Japonica Group]
 gb|EAY98563.1| hypothetical protein OsI_20477 [Oryza sativa Indica Group]
 gb|EEE64235.1| hypothetical protein OsJ_19068 [Oryza sativa Japonica Group]
Length=420

 Score =   208 bits (530),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 114/163 (70%), Positives = 126/163 (77%), Gaps = 3/163 (2%)
 Frame = +2

Query  2    GGREMARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQ  181
            GGR   ++A+L+GINYPGTKAELKGC NDV RM R LVDR+GF E DI VL D D S  Q
Sbjct  2    GGR---KRALLVGINYPGTKAELKGCHNDVARMRRALVDRFGFDEADIRVLADADRSAPQ  58

Query  182  PTGRNIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITD  361
            PTG NIR  L+ LV  A  GD+LF HYSGHGTRLPAETG++DDTG+DECIVPSD NLITD
Sbjct  59   PTGANIRRELARLVGDARPGDFLFFHYSGHGTRLPAETGQDDDTGYDECIVPSDMNLITD  118

Query  362  DDFRELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDN  490
             DF ELV  +P  C  TIVSDSCHSGGL+DK KEQIG ST  N
Sbjct  119  QDFTELVQKVPDDCLFTIVSDSCHSGGLLDKTKEQIGHSTKQN  161



>ref|XP_010476753.1| PREDICTED: metacaspase-8-like [Camelina sativa]
Length=376

 Score =   207 bits (526),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 104/156 (67%), Positives = 123/156 (79%), Gaps = 1/156 (1%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            MA+KA+LIGINYPGT  EL+GCVNDVRRM +CL++RYGF+  DITVLIDTD S  QPTG+
Sbjct  1    MAKKALLIGINYPGTAVELRGCVNDVRRMKKCLIERYGFANKDITVLIDTDKSCIQPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAe-tgeeddtgfdeCIVPSDFNLITDDDF  370
            NIR  L +L+    SGD+L  HYSGHGTRLP       D TGFDECI PSD NLI DD+F
Sbjct  61   NIRHHLEELIDFGKSGDFLVFHYSGHGTRLPPPDIESGDSTGFDECITPSDMNLIRDDEF  120

Query  371  RELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGES  478
            R +V  + +GC+LTI+SDSCHSGGLI++ KEQIGES
Sbjct  121  RSMVAKVKKGCQLTIISDSCHSGGLIEEVKEQIGES  156



>ref|XP_004961631.1| PREDICTED: metacaspase-5-like [Setaria italica]
Length=413

 Score =   207 bits (528),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 124/157 (79%), Gaps = 0/157 (0%)
 Frame = +2

Query  20   RKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGRNI  199
            ++AVL+GINYPGTKAELKGC NDV RM RCLVDR+GF E  I VL+D  +   QPTG NI
Sbjct  4    KRAVLVGINYPGTKAELKGCHNDVARMRRCLVDRFGFDESGIRVLVDDGSGGPQPTGANI  63

Query  200  RSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFREL  379
            R  L+ LV  A  GD LF HYSGHGTRLPAETG++DDTG+DECIVP D NLITD DF EL
Sbjct  64   RRELARLVGDARPGDLLFFHYSGHGTRLPAETGQDDDTGYDECIVPCDMNLITDQDFTEL  123

Query  380  VDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDN  490
            V  +P+GC LTIVSDSCHSGGL+DK KEQIG ST  N
Sbjct  124  VQKVPEGCLLTIVSDSCHSGGLLDKTKEQIGHSTKQN  160



>ref|XP_010459183.1| PREDICTED: metacaspase-8-like [Camelina sativa]
Length=379

 Score =   206 bits (524),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 106/167 (63%), Positives = 125/167 (75%), Gaps = 1/167 (1%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            MA+KA+LIGINYPGT  EL+GCVNDVRRM +CL++RYGFS  DIT+LIDTD S  QPTG+
Sbjct  1    MAKKALLIGINYPGTAVELRGCVNDVRRMQKCLIERYGFSNKDITILIDTDKSCIQPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAe-tgeeddtgfdeCIVPSDFNLITDDDF  370
            NIR  L  L+    SGD+L  HYSGHGTRLP       D TGFDECI P D NLI DD+F
Sbjct  61   NIRHHLEKLIDLGKSGDFLVFHYSGHGTRLPPPDIESGDSTGFDECITPCDMNLIRDDEF  120

Query  371  RELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDNADADDAD  511
            R +V ++ +GC+LTI+SDSCHSGGLI+  KEQIGES     + D AD
Sbjct  121  RSMVANVKKGCQLTIISDSCHSGGLIEGVKEQIGESHVKPIEEDHAD  167



>ref|XP_008776827.1| PREDICTED: LOW QUALITY PROTEIN: metacaspase-1-like [Phoenix dactylifera]
Length=442

 Score =   208 bits (529),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 104/148 (70%), Positives = 124/148 (84%), Gaps = 0/148 (0%)
 Frame = +2

Query  29   VLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGRNIRSA  208
            VL+G NYPGTKAELKGC+N++RRMHRCLV+RYGF+E  I VL+DTD SY QP G NI  A
Sbjct  78   VLVGCNYPGTKAELKGCINEMRRMHRCLVERYGFAEQHIAVLVDTDESYPQPMGANIHCA  137

Query  209  LSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFRELVDS  388
            ++ L+ SA  GDY+F HYSGHG RLPAETGE+DDTG+DECIV  D  LITDDDFRE VD 
Sbjct  138  VAKLITSARPGDYIFFHYSGHGXRLPAETGEDDDTGYDECIVSCDMKLITDDDFREFVDK  197

Query  389  LPQGCRLTIVSDSCHSGGLIDKAKEQIG  472
            +P+GCR+TI+SDSC SGGLID+++EQI 
Sbjct  198  VPEGCRITIMSDSCQSGGLIDESREQIA  225



>ref|XP_006654594.1| PREDICTED: metacaspase-5-like [Oryza brachyantha]
Length=419

 Score =   207 bits (526),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 114/160 (71%), Positives = 124/160 (78%), Gaps = 1/160 (1%)
 Frame = +2

Query  14   MARK-AVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTG  190
            M RK A+L+GINYPGTKAELKGC NDV RM R LVDR+GF E DI VL D D S  QPTG
Sbjct  1    MGRKRALLVGINYPGTKAELKGCHNDVARMRRSLVDRFGFDEADIRVLADADRSAPQPTG  60

Query  191  RNIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDF  370
             NIR  L+ LV  A  GD+LF HYSGHGTRLPAETG++DDTG+DECIVPSD NLITD DF
Sbjct  61   ANIRRELARLVGDARRGDFLFFHYSGHGTRLPAETGQDDDTGYDECIVPSDMNLITDQDF  120

Query  371  RELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDN  490
             ELV  +P  C  TIVSDSCHSGGL+DK KEQIG ST  N
Sbjct  121  TELVQKVPGDCLFTIVSDSCHSGGLLDKTKEQIGHSTKQN  160



>dbj|BAJ89979.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=414

 Score =   205 bits (522),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 113/160 (71%), Positives = 124/160 (78%), Gaps = 1/160 (1%)
 Frame = +2

Query  14   MARK-AVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTG  190
            M RK AVL+GINY GTKAELKGC NDV RM RCLVDR+GF +  + VL D D +  QPTG
Sbjct  1    MGRKRAVLVGINYAGTKAELKGCHNDVARMRRCLVDRFGFDDAAVRVLSDADPAAPQPTG  60

Query  191  RNIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDF  370
             NIR  L+ LV  A  GD LF HYSGHGTRLPAETG++DDTG+DECIVPSD NLITD DF
Sbjct  61   ANIRRELARLVADARPGDSLFFHYSGHGTRLPAETGQDDDTGYDECIVPSDMNLITDQDF  120

Query  371  RELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDN  490
             ELV  +P GC  TIVSDSCHSGGL+DKAKEQIG ST  N
Sbjct  121  TELVQKVPDGCLFTIVSDSCHSGGLLDKAKEQIGHSTKQN  160



>ref|XP_002441316.1| hypothetical protein SORBIDRAFT_09g024370 [Sorghum bicolor]
 gb|EES19746.1| hypothetical protein SORBIDRAFT_09g024370 [Sorghum bicolor]
Length=414

 Score =   205 bits (522),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 113/158 (72%), Positives = 124/158 (78%), Gaps = 1/158 (1%)
 Frame = +2

Query  17   ARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGRN  196
            A++AVL+GINYPGTKAELKGC NDV RM RCLVDR+GF E  I VLID D S  +PTG N
Sbjct  3    AKRAVLVGINYPGTKAELKGCHNDVARMRRCLVDRFGFDESGIRVLID-DGSALKPTGAN  61

Query  197  IRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFRE  376
            IR  L+ LV  A  GD LF HYSGHGTRLPAETG++DDTG+DECIVP D NLITD DF E
Sbjct  62   IRRELARLVGDARPGDLLFFHYSGHGTRLPAETGQDDDTGYDECIVPCDMNLITDQDFTE  121

Query  377  LVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDN  490
            LV  +P GC  TIVSDSCHSGGL+DK KEQIG ST  N
Sbjct  122  LVQKIPSGCLFTIVSDSCHSGGLLDKTKEQIGHSTKLN  159



>ref|XP_002892907.1| hypothetical protein ARALYDRAFT_471839 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69166.1| hypothetical protein ARALYDRAFT_471839 [Arabidopsis lyrata subsp. 
lyrata]
Length=379

 Score =   203 bits (517),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 102/156 (65%), Positives = 121/156 (78%), Gaps = 1/156 (1%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            MA+KAVLIGINYPGT  EL+GCVNDVRRM +CL++ YGF+  DIT+LIDTD S  QPTG+
Sbjct  1    MAKKAVLIGINYPGTAVELRGCVNDVRRMQKCLIELYGFANKDITILIDTDKSCIQPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRL-PAetgeeddtgfdeCIVPSDFNLITDDDF  370
            NI   L+ L+ S  SGD+L  HYSGHGTR+ P      D TGFDECI P D NLI D DF
Sbjct  61   NIHDELTRLIASGQSGDFLVFHYSGHGTRIPPGIGELGDSTGFDECITPCDMNLIKDHDF  120

Query  371  RELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGES  478
            RE+V  + +GC+LTI+SDSCHSGGLI++ KEQIGES
Sbjct  121  REMVSHVKEGCQLTIISDSCHSGGLIEEVKEQIGES  156



>gb|AET08886.1| metacaspase 3 [Aegilops tauschii]
 emb|CCC14979.1| MC3D protein [Aegilops tauschii]
Length=419

 Score =   201 bits (510),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 116/163 (71%), Positives = 126/163 (77%), Gaps = 4/163 (2%)
 Frame = +2

Query  14   MARK-AVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDD--ITVLIDTD-ASYTQ  181
            M RK AVL+GINY GTKAELKGC NDV RM RCLVDR+GF +D   I VL D D A+  Q
Sbjct  1    MGRKRAVLVGINYAGTKAELKGCHNDVARMRRCLVDRFGFDDDGAGIRVLSDADPAAPLQ  60

Query  182  PTGRNIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITD  361
            PTG NIR  L+ LV  A  GD LF HYSGHGTRLPAETG++DDTG+DECIVPSD NLITD
Sbjct  61   PTGANIRRELARLVADARPGDSLFFHYSGHGTRLPAETGQDDDTGYDECIVPSDMNLITD  120

Query  362  DDFRELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDN  490
             DF ELV  +P GC  TIVSDSCHSGGL+DKAKEQIG ST  N
Sbjct  121  QDFTELVQKVPDGCLFTIVSDSCHSGGLLDKAKEQIGHSTKQN  163



>gb|AET08885.1| metacaspase 3 [Triticum monococcum]
 emb|CCC14973.1| MC3A protein [Triticum urartu]
Length=421

 Score =   200 bits (509),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 116/164 (71%), Positives = 125/164 (76%), Gaps = 5/164 (3%)
 Frame = +2

Query  14   MARK-AVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDD--ITVLIDTD--ASYT  178
            M RK AVL+GINY GTKAELKGC NDV RM RCLVDR+GF +D   I VL D D  A   
Sbjct  1    MGRKRAVLVGINYAGTKAELKGCHNDVARMRRCLVDRFGFDDDADAIRVLSDADRTAPQQ  60

Query  179  QPTGRNIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLIT  358
            QPTG NIR  L+ LV  A  GD LF HYSGHGTRLPAETG++DDTG+DECIVPSD NLIT
Sbjct  61   QPTGANIRRELARLVADARPGDSLFFHYSGHGTRLPAETGQDDDTGYDECIVPSDMNLIT  120

Query  359  DDDFRELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDN  490
            D DF ELV  +P GC  TIVSDSCHSGGL+DKAKEQIG ST  N
Sbjct  121  DQDFTELVQKVPDGCLFTIVSDSCHSGGLLDKAKEQIGHSTKQN  164



>ref|XP_002441314.1| hypothetical protein SORBIDRAFT_09g024350 [Sorghum bicolor]
 gb|EES19744.1| hypothetical protein SORBIDRAFT_09g024350 [Sorghum bicolor]
Length=414

 Score =   197 bits (501),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 107/157 (68%), Positives = 118/157 (75%), Gaps = 0/157 (0%)
 Frame = +2

Query  20   RKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGRNI  199
            ++AVL+GINYPGT  ELKGC+NDV RM RCLV+R+GF E  I VL D D S   PTG NI
Sbjct  4    KRAVLVGINYPGTDGELKGCLNDVARMRRCLVERFGFDEAGIRVLADADPSTPPPTGANI  63

Query  200  RSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFREL  379
            R  L  LV  A  GD LF HYSGHG +LPAETGE+DDTG+DECIVP D NLI D DF EL
Sbjct  64   RLELERLVAGARPGDALFFHYSGHGLQLPAETGEDDDTGYDECIVPCDLNLIKDQDFTEL  123

Query  380  VDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDN  490
            V  +P GCR T+VSDSCHSGGLIDK KEQIG ST  N
Sbjct  124  VAKVPDGCRFTMVSDSCHSGGLIDKTKEQIGNSTKQN  160



>ref|NP_001140337.1| uncharacterized protein LOC100272384 [Zea mays]
 gb|ACF83610.1| unknown [Zea mays]
 gb|ACG42470.1| latex-abundant protein [Zea mays]
 gb|AFW82399.1| putative metacaspase family protein [Zea mays]
Length=422

 Score =   197 bits (501),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 109/154 (71%), Positives = 119/154 (77%), Gaps = 1/154 (1%)
 Frame = +2

Query  17   ARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGRN  196
            A++AVL+GINY GTKAELKGC NDV RM RCLVDR+GF E  I VLID D S  QPTG N
Sbjct  3    AKRAVLVGINYQGTKAELKGCHNDVARMRRCLVDRFGFDESGIRVLID-DGSAPQPTGAN  61

Query  197  IRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFRE  376
            IR  L+ LV  A  GD LF HYSGHG RLPAETG++DDTG+DECIVP D NLITD DF E
Sbjct  62   IRRELARLVGDARPGDLLFFHYSGHGIRLPAETGKDDDTGYDECIVPCDMNLITDQDFTE  121

Query  377  LVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGES  478
            L   +P GC  TIVSDSCHSGGL+DK KEQIG S
Sbjct  122  LAQKVPSGCLFTIVSDSCHSGGLLDKTKEQIGHS  155



>gb|AET08889.1| metacaspase 3 [Aegilops speltoides]
 emb|CCC14968.1| MC3B protein [Aegilops speltoides]
Length=418

 Score =   196 bits (498),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 115/164 (70%), Positives = 124/164 (76%), Gaps = 5/164 (3%)
 Frame = +2

Query  14   MARK-AVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDD--ITVLIDTD--ASYT  178
            M RK AVL+GINY GTKAELKGC NDV RM RCLVDR+GF +D   I VL D D  A   
Sbjct  1    MGRKRAVLVGINYAGTKAELKGCHNDVARMRRCLVDRFGFDDDGAAIRVLSDADRAAPQQ  60

Query  179  QPTGRNIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLIT  358
            QPTG NIR  L+ LV  A  GD L  HYSGHGTRLPAETG++DDTG+DECIVPSD NLIT
Sbjct  61   QPTGANIRRELARLVADACPGDSLSFHYSGHGTRLPAETGQDDDTGYDECIVPSDMNLIT  120

Query  359  DDDFRELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDN  490
            D DF ELV  +P GC  TIVSDSCHSGGL+DKAKEQIG ST  N
Sbjct  121  DQDFTELVQKVPDGCLFTIVSDSCHSGGLLDKAKEQIGHSTKQN  164



>dbj|BAD42967.1| hypothetical protein [Arabidopsis thaliana]
Length=381

 Score =   194 bits (494),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 98/162 (60%), Positives = 118/162 (73%), Gaps = 1/162 (1%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            MA+KA+LIGINYPGT  EL+GCVNDV RM +CL++ YGF+  DI ++IDTD S  QPTG+
Sbjct  1    MAKKALLIGINYPGTAVELRGCVNDVHRMQKCLIELYGFANKDIVIMIDTDKSCIQPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRL-PAetgeeddtgfdeCIVPSDFNLITDDDF  370
            NI   L +L+ S  SGD+L  HYSGHGTR+ P     E  TGFDECI P D NLI D  F
Sbjct  61   NICDELDNLIASGQSGDFLVFHYSGHGTRIPPGIEDSEGPTGFDECITPCDMNLIKDQQF  120

Query  371  RELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDNAD  496
            RE+V  + +GC+LTI+SDSCHSGGLI + KEQIGES     D
Sbjct  121  REMVSRVKEGCQLTIISDSCHSGGLIQEVKEQIGESHMKPVD  162



>ref|NP_173092.1| metacaspase 8 [Arabidopsis thaliana]
 sp|Q9SA41.1|MCA8_ARATH RecName: Full=Metacaspase-8; Short=AtMC8; AltName: Full=Metacaspase 
2e; Short=AtMCP2e [Arabidopsis thaliana]
 gb|AAD34694.1|AC006341_22 Similar to gb|AF098458 latex-abundant protein (LAR) from Hevea 
brasiliensis [Arabidopsis thaliana]
 gb|AAP84711.1| metacaspase 8 [Arabidopsis thaliana]
 gb|AAP44521.1| metacaspase 8 precursor [Arabidopsis thaliana]
 gb|AEE29449.1| metacaspase 8 [Arabidopsis thaliana]
Length=381

 Score =   194 bits (493),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 99/162 (61%), Positives = 119/162 (73%), Gaps = 1/162 (1%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            MA+KA+LIGINYPGT  EL+GCVNDV RM +CL++ YGF+  DI ++IDTD S  QPTG+
Sbjct  1    MAKKALLIGINYPGTAVELRGCVNDVHRMQKCLIELYGFANKDIVIMIDTDKSCIQPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRL-PAetgeeddtgfdeCIVPSDFNLITDDDF  370
            NI   L +L+ S  SGD+L  HYSGHGTR+ P     ED TGFDECI P D NLI D  F
Sbjct  61   NICDELDNLIASGQSGDFLVFHYSGHGTRIPPGIEDSEDPTGFDECITPCDMNLIKDQQF  120

Query  371  RELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDNAD  496
            RE+V  + +GC+LTI+SDSCHSGGLI + KEQIGES     D
Sbjct  121  REMVSRVKEGCQLTIISDSCHSGGLIQEVKEQIGESHMKPVD  162



>ref|XP_001773634.1| predicted protein [Physcomitrella patens]
 gb|EDQ61522.1| predicted protein [Physcomitrella patens]
Length=423

 Score =   193 bits (490),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 98/155 (63%), Positives = 123/155 (79%), Gaps = 0/155 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            M+++A+L+G NYPGTK EL GC NDVRRM   L++R+GF E DI V++DTD S  QPTG 
Sbjct  1    MSKRALLVGCNYPGTKCELHGCANDVRRMKELLMNRFGFDEIDILVMLDTDPSLPQPTGA  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR +L+ L++S  +GD L  HYSGHGT++PAE+GE+DDTG DE IVP+D NL+TDDDFR
Sbjct  61   NIRKSLAQLIQSTEAGDCLVFHYSGHGTQVPAESGEQDDTGADEAIVPTDMNLLTDDDFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGES  478
            ELV+ +P G   T +SDSCHSGGLID AKEQIG +
Sbjct  121  ELVNQIPVGVTFTFLSDSCHSGGLIDSAKEQIGNT  155



>emb|CDY59452.1| BnaAnng16050D [Brassica napus]
Length=362

 Score =   191 bits (484),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 99/155 (64%), Positives = 115/155 (74%), Gaps = 3/155 (2%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            MA+KA+LIGIN+PGT  EL GCVNDVRRM +CL+DRYGFS  DI VLIDTD S  QPTG+
Sbjct  1    MAKKALLIGINHPGTAVELCGCVNDVRRMKKCLIDRYGFSNKDIRVLIDTDKSSIQPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NI  AL  L+    SGD L  HYSGHGTRLP E G  D T +DECI P D NLI    FR
Sbjct  61   NIHEALKKLIAEEESGDVLVFHYSGHGTRLPTEQGLFDATNYDECITPCDMNLIM---FR  117

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGES  478
            ++V  + +GC LTI+S SCHSGGLI++ KEQ+GES
Sbjct  118  DMVAEVKEGCLLTIISASCHSGGLIEETKEQMGES  152



>ref|XP_004961632.1| PREDICTED: metacaspase-4-like [Setaria italica]
Length=414

 Score =   192 bits (487),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 105/157 (67%), Positives = 118/157 (75%), Gaps = 0/157 (0%)
 Frame = +2

Query  20   RKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGRNI  199
            ++AVL+GINYPGT  ELKGC+NDV RM RCLV+R+GF E  I VL D D S   PTG NI
Sbjct  4    KRAVLVGINYPGTDGELKGCLNDVSRMRRCLVERFGFDEAGIRVLADADPSTPPPTGANI  63

Query  200  RSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFREL  379
            R  L  LV  A +GD LF HYSGHG +LPAETGE+DDTG+DECIVP D NLI D DF EL
Sbjct  64   RLELERLVAGARAGDTLFFHYSGHGLQLPAETGEDDDTGYDECIVPCDLNLIKDQDFTEL  123

Query  380  VDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDN  490
            V  +P GC  T+VSDSCHSGGLIDK KEQIG ST  +
Sbjct  124  VAKVPDGCLFTMVSDSCHSGGLIDKTKEQIGNSTKQS  160



>gb|EAY98562.1| hypothetical protein OsI_20476 [Oryza sativa Indica Group]
Length=409

 Score =   191 bits (485),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 105/161 (65%), Positives = 116/161 (72%), Gaps = 2/161 (1%)
 Frame = +2

Query  14   MARK-AVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTG  190
            M RK AVL+GINY GT+ ELKGC+NDV RM RCLVDR+GF E DI VL D D S  QPTG
Sbjct  1    MGRKRAVLVGINYAGTEGELKGCLNDVARMRRCLVDRFGFDEADIRVLADADPSTPQPTG  60

Query  191  RNIRSALSDLVKSAGSGDYLFVHYSGHGTRLP-AetgeeddtgfdeCIVPSDFNLITDDD  367
             NIR  L  LV  A  GD LF HYSGHG +LP    G++DD G+DECIVP D NLI D D
Sbjct  61   ANIRLELERLVGDARPGDTLFFHYSGHGLQLPIETGGDDDDIGYDECIVPCDMNLIKDQD  120

Query  368  FRELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDN  490
            F ELV  +P GC  T+VSDSCHSGGLIDK KEQIG ST  +
Sbjct  121  FTELVQKVPDGCLFTMVSDSCHSGGLIDKTKEQIGSSTKQS  161



>ref|NP_001055938.1| Os05g0496400 [Oryza sativa Japonica Group]
 dbj|BAF17852.1| Os05g0496400 [Oryza sativa Japonica Group]
 gb|EEE64234.1| hypothetical protein OsJ_19067 [Oryza sativa Japonica Group]
Length=409

 Score =   191 bits (484),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 106/161 (66%), Positives = 117/161 (73%), Gaps = 2/161 (1%)
 Frame = +2

Query  14   MARK-AVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTG  190
            M RK AVL+GINY GT+ ELKGC+NDV RM RCLVDR+GF E DI VL D D S  QPTG
Sbjct  1    MGRKRAVLVGINYAGTEGELKGCLNDVARMRRCLVDRFGFDEADIRVLADADPSTPQPTG  60

Query  191  RNIRSALSDLVKSAGSGDYLFVHYSGHGTRLP-AetgeeddtgfdeCIVPSDFNLITDDD  367
             NIR  L  LV  A  GD LF HYSGHG +LP    G++DDTG+DECIVP D NLI D D
Sbjct  61   ANIRLELERLVGDARPGDTLFFHYSGHGLQLPIETGGDDDDTGYDECIVPCDMNLIKDQD  120

Query  368  FRELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDN  490
            F ELV  +P GC  T+VSDSCHSGGLIDK KEQIG ST  +
Sbjct  121  FTELVQKVPDGCLFTMVSDSCHSGGLIDKTKEQIGSSTKQS  161



>ref|NP_001151968.1| metacaspase type II [Zea mays]
 gb|ACG45179.1| metacaspase type II [Zea mays]
 gb|AFW82398.1| metacaspase type II [Zea mays]
Length=408

 Score =   190 bits (483),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 105/157 (67%), Positives = 117/157 (75%), Gaps = 0/157 (0%)
 Frame = +2

Query  20   RKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGRNI  199
            ++A+L+GINY GT  ELKGC+NDV RM RCLV R+GF E DI VL D D S   PTG NI
Sbjct  4    KRALLVGINYLGTDGELKGCLNDVARMRRCLVGRFGFDEADIRVLADADPSTPPPTGANI  63

Query  200  RSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFREL  379
            R  L  LV  A  GD LF HYSGHG +LPAETGE+DDTG+DECIVP D NLI D DF +L
Sbjct  64   RLELERLVAGARPGDALFFHYSGHGLQLPAETGEDDDTGYDECIVPCDLNLIKDQDFTDL  123

Query  380  VDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDN  490
            V  +P GCR T+VSDSCHSGGLIDK KEQIG ST  N
Sbjct  124  VAKVPDGCRFTMVSDSCHSGGLIDKTKEQIGNSTKQN  160



>ref|XP_001760554.1| predicted protein [Physcomitrella patens]
 gb|EDQ74629.1| predicted protein [Physcomitrella patens]
Length=415

 Score =   189 bits (481),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 95/164 (58%), Positives = 123/164 (75%), Gaps = 0/164 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            M+++A+L+G NYPGTK +L GC NDVRRM   L+DR+GF E DI V++DTD +  QPTG 
Sbjct  1    MSKRALLVGCNYPGTKVQLHGCANDVRRMKALLIDRFGFDERDILVMLDTDPALPQPTGA  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR  L  L+++   GD L  HYSGHGT++PAE+G+EDDTG +E IVP+D NL+TDDDFR
Sbjct  61   NIRKCLDKLIENTQPGDCLVFHYSGHGTQVPAESGQEDDTGAEEAIVPTDMNLLTDDDFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDNADADD  505
            ELV+ +P G   T +SDSCHSGGLID  KEQIG +  D  + ++
Sbjct  121  ELVNKIPVGVTFTFLSDSCHSGGLIDSTKEQIGHTVKDVEEGEE  164



>gb|AJP06423.1| MC5 [Picea abies]
Length=340

 Score =   184 bits (466),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 90/170 (53%), Positives = 114/170 (67%), Gaps = 5/170 (3%)
 Frame = +2

Query  2    GGREMARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQ  181
            G  +  + AVL+G +YP T+ EL GCVNDV RM   L+ R+GF++++I +LIDTD SYT+
Sbjct  2    GNNDNKKYAVLVGCSYPNTENELHGCVNDVMRMQGILIHRFGFAKENINLLIDTDKSYTK  61

Query  182  PTGRNIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITD  361
            PTG NIR AL  ++K A  GD LF HYSGHGT +P        +   ECIVP DFNL+TD
Sbjct  62   PTGENIRKALVKMIKQAKPGDVLFFHYSGHGTLVP-----LHHSAGYECIVPCDFNLLTD  116

Query  362  DDFRELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDNADADDAD  511
            +DFR +V+  P G   T++SDSCHSGGLIDK KEQIG     N    D +
Sbjct  117  EDFRLMVNMCPLGTSFTMISDSCHSGGLIDKEKEQIGPHATANRSLTDPE  166



>ref|XP_008364242.1| PREDICTED: metacaspase-4-like [Malus domestica]
Length=175

 Score =   175 bits (444),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 93/115 (81%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            MARKAVLIG NY GTKAELKGC+NDV+RM+ CLVDRYGFSEDDI VLIDTD SYTQPTG+
Sbjct  1    MARKAVLIGCNYAGTKAELKGCINDVKRMYSCLVDRYGFSEDDIQVLIDTDDSYTQPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLIT  358
            NIR A+++L++SA SGD LFVHYSGHGTRLPAETG++DDTG+DECIVP+D NLIT
Sbjct  61   NIRRAITNLIRSADSGDVLFVHYSGHGTRLPAETGDDDDTGYDECIVPTDMNLIT  115



>ref|NP_196040.1| metacaspase 9 [Arabidopsis thaliana]
 sp|Q9FYE1.1|MCA9_ARATH RecName: Full=Metacaspase-9; Short=AtMC9; Contains: RecName: 
Full=Metacaspase-9 subunit p20; Contains: RecName: Full=Metacaspase-9 
subunit p10; AltName: Full=Metacaspase 2f; Short=AtMCP2f 
[Arabidopsis thaliana]
 emb|CAC05502.1| latex-abundant protein-like [Arabidopsis thaliana]
 gb|AAL36186.1| putative latex-abundant protein [Arabidopsis thaliana]
 gb|AAM14247.1| putative latex-abundant protein [Arabidopsis thaliana]
 gb|AAP84712.1| metacaspase 9 [Arabidopsis thaliana]
 gb|AAP44522.1| metacaspase 9 precurser [Arabidopsis thaliana]
 gb|AED90710.1| metacaspase 9 [Arabidopsis thaliana]
Length=325

 Score =   179 bits (454),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 90/161 (56%), Positives = 109/161 (68%), Gaps = 3/161 (2%)
 Frame = +2

Query  5    GREMARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQP  184
            G    R AVL+G NYP T+ EL GC+NDV  M   ++ R+GF +DDI VL D   S  +P
Sbjct  5    GMVKKRLAVLVGCNYPNTRNELHGCINDVLAMKETILSRFGFKQDDIEVLTDEPESKVKP  64

Query  185  TGRNIRSALSDLV--KSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLIT  358
            TG NI++AL  +V    AGSGD LF HYSGHGTR+P+          +  IVP DFNLIT
Sbjct  65   TGANIKAALRRMVDKAQAGSGDILFFHYSGHGTRIPSVKSAHPFKQDE-AIVPCDFNLIT  123

Query  359  DDDFRELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGEST  481
            D DFRELV+ LP+G   T++SDSCHSGGLIDK KEQIG S+
Sbjct  124  DVDFRELVNQLPKGTSFTMISDSCHSGGLIDKEKEQIGPSS  164



>gb|AAM63441.1| latex-abundant protein-like [Arabidopsis thaliana]
Length=320

 Score =   179 bits (454),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 89/156 (57%), Positives = 108/156 (69%), Gaps = 3/156 (2%)
 Frame = +2

Query  20   RKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGRNI  199
            R AVL+G NYP T+ EL GC+NDV  M   ++ R+GF +DDI VL D   S  +PTG NI
Sbjct  5    RLAVLVGCNYPNTRNELHGCINDVLAMKETILSRFGFKQDDIEVLTDEPESKVKPTGANI  64

Query  200  RSALSDLV--KSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            ++AL  +V    AGSGD LF HYSGHGTR+P+          +  IVP DFNLITD DFR
Sbjct  65   KAALRRMVDKAQAGSGDILFFHYSGHGTRIPSVKSAHPFKQDE-AIVPCDFNLITDVDFR  123

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGEST  481
            ELV+ LP+G   T++SDSCHSGGLIDK KEQIG S+
Sbjct  124  ELVNQLPKGTSFTMISDSCHSGGLIDKEKEQIGPSS  159



>ref|XP_008455778.1| PREDICTED: metacaspase-9 [Cucumis melo]
Length=317

 Score =   178 bits (452),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 91/159 (57%), Positives = 107/159 (67%), Gaps = 1/159 (1%)
 Frame = +2

Query  20   RKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGRNI  199
            R AVL+G NYP TK EL GC+NDV  M   L+ R+GF E +I VL D   S   PTG NI
Sbjct  6    RMAVLVGCNYPNTKYELHGCINDVMAMREKLMSRFGFEESNIQVLTDEPGSLLMPTGSNI  65

Query  200  RSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFREL  379
            + AL  +V  A SGD LF HYSGHGTR+P+     +    DE IVP DFNLITD DFR L
Sbjct  66   KRALGRMVSKAESGDVLFFHYSGHGTRVPS-MKHGNFLRQDEAIVPCDFNLITDIDFRHL  124

Query  380  VDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDNAD  496
            V+ +P+G   T++SDSCHSGGLIDK KEQIG ST  N +
Sbjct  125  VNRMPKGASFTMISDSCHSGGLIDKEKEQIGPSTIVNGE  163



>ref|XP_006430431.1| hypothetical protein CICLE_v10012209mg [Citrus clementina]
 gb|ESR43671.1| hypothetical protein CICLE_v10012209mg [Citrus clementina]
Length=321

 Score =   178 bits (452),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 87/155 (56%), Positives = 107/155 (69%), Gaps = 0/155 (0%)
 Frame = +2

Query  20   RKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGRNI  199
            R AVL+G NYP TK EL GC+NDV  M   +++R+GF  + I +L D   S   PTG NI
Sbjct  8    RIAVLVGCNYPNTKNELHGCINDVLAMRDVIINRFGFDPNHIELLTDAPGSSVMPTGANI  67

Query  200  RSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFREL  379
            ++AL  +V  A +GD LF HYSGHGTR+P+          DE IVP DFNLITD DFR+L
Sbjct  68   KAALDRMVSKAEAGDVLFFHYSGHGTRIPSLRPIWPFRQQDEAIVPCDFNLITDLDFRQL  127

Query  380  VDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTH  484
            V+ LP+G   T+ SDSCHSGGLIDKAKEQIG S++
Sbjct  128  VNRLPKGASFTVFSDSCHSGGLIDKAKEQIGPSSN  162



>ref|XP_001760622.1| predicted protein [Physcomitrella patens]
 gb|EDQ74697.1| predicted protein [Physcomitrella patens]
Length=426

 Score =   181 bits (459),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 111/154 (72%), Gaps = 0/154 (0%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            M R+A+L+G NYPG   ELKG  NDV RMH  L  ++GF   +I VL+D D    QPTG 
Sbjct  1    MVRRALLVGCNYPGEPCELKGSANDVDRMHVLLTKKFGFKPTEILVLVDIDPRSRQPTGA  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR +L  LV  A  GD LF H+SGHGT++P + G  D+TG++ECIVPSD NL+TDDDFR
Sbjct  61   NIRKSLRKLVDGAEPGDVLFFHFSGHGTQVPPDRGRRDETGYEECIVPSDMNLLTDDDFR  120

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGE  475
            ELVD +P GC  T ++D+CHSGGLID  KEQIG+
Sbjct  121  ELVDRIPPGCNFTFIADACHSGGLIDNEKEQIGD  154



>gb|AAT07577.1| unknown protein [Oryza sativa Japonica Group]
Length=424

 Score =   181 bits (458),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 106/176 (60%), Positives = 117/176 (66%), Gaps = 17/176 (10%)
 Frame = +2

Query  14   MARK-AVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTG  190
            M RK AVL+GINY GT+ ELKGC+NDV RM RCLVDR+GF E DI VL D D S  QPTG
Sbjct  1    MGRKRAVLVGINYAGTEGELKGCLNDVARMRRCLVDRFGFDEADIRVLADADPSTPQPTG  60

Query  191  RNIRSALSDLVKSAGSGDYLFVHYSGHGTRLP-AetgeeddtgfdeCIVPSDFNLI----  355
             NIR  L  LV  A  GD LF HYSGHG +LP    G++DDTG+DECIVP D NLI    
Sbjct  61   ANIRLELERLVGDARPGDTLFFHYSGHGLQLPIETGGDDDDTGYDECIVPCDMNLIKVYM  120

Query  356  -----------TDDDFRELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDN  490
                        D DF ELV  +P GC  T+VSDSCHSGGLIDK KEQIG ST  +
Sbjct  121  AITHLTRELDDADQDFTELVQKVPDGCLFTMVSDSCHSGGLIDKTKEQIGSSTKQS  176



>ref|XP_007010765.1| Metacaspase 9 [Theobroma cacao]
 gb|EOY19575.1| Metacaspase 9 [Theobroma cacao]
Length=312

 Score =   177 bits (450),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 89/157 (57%), Positives = 110/157 (70%), Gaps = 1/157 (1%)
 Frame = +2

Query  20   RKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGRNI  199
            R AVL+G NYP TK EL GC+NDV  M   LV+R+GF    + +L D   S   PTG N+
Sbjct  7    RLAVLVGCNYPNTKHELHGCINDVVAMREVLVERFGFDPSHVKLLTDAPGSLVMPTGANM  66

Query  200  RSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFREL  379
            ++AL+++V  A +GD LF HYSGHGTR+P+    ++    DE IVP DFNLITD DFR+L
Sbjct  67   KAALNEMVNKAEAGDVLFFHYSGHGTRIPS-LKPDNHFRQDEAIVPCDFNLITDVDFRQL  125

Query  380  VDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDN  490
            V+ LP+G   TI+SDSCHSGGLIDK KEQIG ST  N
Sbjct  126  VNRLPKGATFTILSDSCHSGGLIDKEKEQIGPSTIKN  162



>ref|XP_002871080.1| hypothetical protein ARALYDRAFT_908304 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47339.1| hypothetical protein ARALYDRAFT_908304 [Arabidopsis lyrata subsp. 
lyrata]
Length=393

 Score =   179 bits (453),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 89/158 (56%), Positives = 107/158 (68%), Gaps = 3/158 (2%)
 Frame = +2

Query  5    GREMARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQP  184
            G    R AVL+G NYP T+ EL GC+NDV  M   ++ R+GF EDDI VL D   S  +P
Sbjct  8    GMAKKRLAVLVGCNYPNTRNELHGCINDVLAMKETIMSRFGFKEDDIEVLTDEPESKVKP  67

Query  185  TGRNIRSALSDLV--KSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLIT  358
            TG NI+++L  +V    AGSGD LF HYSGHGTR+P+          +  IVP DFNLIT
Sbjct  68   TGANIKASLRRMVGKAQAGSGDILFFHYSGHGTRIPSVKSSHPFKQDE-AIVPCDFNLIT  126

Query  359  DDDFRELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIG  472
            D DFRELV+ LP+G   T++SDSCHSGGLIDK KEQIG
Sbjct  127  DVDFRELVNQLPKGTSFTMISDSCHSGGLIDKEKEQIG  164



>emb|CDY41391.1| BnaCnng10270D [Brassica napus]
Length=200

 Score =   173 bits (438),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 107/160 (67%), Gaps = 4/160 (3%)
 Frame = +2

Query  20   RKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGRNI  199
            R AVL+G NYP T+ EL GCVNDV  M   L  R+GF +DD+ VL D   S  +PTG NI
Sbjct  10   RLAVLVGCNYPNTRNELHGCVNDVLAMKETLSTRFGFKQDDMEVLTDEPESKVKPTGANI  69

Query  200  RSALSDLVKSAGSG---DYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDF  370
            ++AL  +V+ A +G   D LF HYSGHGTR+P+          +  IVP DFNLITD DF
Sbjct  70   KAALRRMVEKAQNGSGGDVLFFHYSGHGTRIPSVKPAHPFRQDE-AIVPCDFNLITDVDF  128

Query  371  RELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDN  490
            RELV+ LP+G   T++SDSCHSGGLIDK KEQIG  +  N
Sbjct  129  RELVNQLPKGTSFTMISDSCHSGGLIDKEKEQIGPFSSSN  168



>gb|ABD28668.1| Peptidase C14, caspase catalytic subunit p20 [Medicago truncatula]
 gb|KEH23557.1| ICE-like protease (caspase) p20 domain protein [Medicago truncatula]
Length=319

 Score =   176 bits (446),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 91/167 (54%), Positives = 115/167 (69%), Gaps = 4/167 (2%)
 Frame = +2

Query  8    REMARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTD---ASYT  178
            R+  R AVL+G NYP T  EL+GC+NDV  M   LV R+GF   +I +L D D   +S T
Sbjct  3    RKNKRLAVLVGCNYPNTPNELRGCINDVLAMKDTLVKRFGFDHANIQLLTDDDPKNSSST  62

Query  179  QPTGRNIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLIT  358
             PTG NI+ ALS +V  A +GD L+ HYSGHGTR+P++         +  IVP DFNLIT
Sbjct  63   MPTGANIKQALSSMVDKAEAGDVLYFHYSGHGTRIPSKIHGHPFRHEE-AIVPCDFNLIT  121

Query  359  DDDFRELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDNADA  499
            D DFR+LV+ +P+G  LTI+SDSCHSGGLIDK KEQIG S+ D+ +A
Sbjct  122  DLDFRQLVNRIPKGASLTILSDSCHSGGLIDKEKEQIGPSSFDDKNA  168



>ref|XP_006481975.1| PREDICTED: metacaspase-9-like [Citrus sinensis]
 gb|KDO57353.1| hypothetical protein CISIN_1g020767mg [Citrus sinensis]
Length=321

 Score =   176 bits (446),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/155 (55%), Positives = 106/155 (68%), Gaps = 0/155 (0%)
 Frame = +2

Query  20   RKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGRNI  199
            R AVL+G NYP TK EL GC+NDV  M   +++R+GF  + I +L D   S   PTG NI
Sbjct  8    RIAVLVGCNYPNTKNELHGCINDVLAMRDVIINRFGFDPNHIELLTDAPGSSVMPTGANI  67

Query  200  RSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFREL  379
            ++AL  +V  A +GD L  HYSGHGTR+P+          DE IVP DFNLITD DFR+L
Sbjct  68   KAALDRMVSKAEAGDVLLFHYSGHGTRIPSLRPIWPFRQQDEAIVPCDFNLITDLDFRQL  127

Query  380  VDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTH  484
            V+ LP+G   T+ SDSCHSGGLIDKAKEQIG S++
Sbjct  128  VNRLPKGASFTVFSDSCHSGGLIDKAKEQIGPSSN  162



>ref|XP_011040678.1| PREDICTED: metacaspase-9-like [Populus euphratica]
Length=315

 Score =   175 bits (444),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 88/151 (58%), Positives = 105/151 (70%), Gaps = 1/151 (1%)
 Frame = +2

Query  20   RKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGRNI  199
            R AVL+G NYP T+ EL GC+NDV  M   LV R+GF   ++ +L D   S   PTG NI
Sbjct  7    RMAVLVGCNYPNTRNELHGCINDVLTMKELLVKRFGFDLRNVQLLTDAPGSVVLPTGANI  66

Query  200  RSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFREL  379
            + ALS ++  A +GD LF HYSGHGTR+P+          DE IVPSDFNLITD DFR+L
Sbjct  67   KKALSHMIDQAEAGDVLFFHYSGHGTRIPS-VKSGHPFRQDEAIVPSDFNLITDVDFRQL  125

Query  380  VDSLPQGCRLTIVSDSCHSGGLIDKAKEQIG  472
            V+ LP+G  LTI+SDSCHSGGLIDK KEQIG
Sbjct  126  VNRLPKGASLTILSDSCHSGGLIDKEKEQIG  156



>ref|XP_006398876.1| hypothetical protein EUTSA_v10014106mg [Eutrema salsugineum]
 gb|ESQ40329.1| hypothetical protein EUTSA_v10014106mg [Eutrema salsugineum]
Length=324

 Score =   175 bits (444),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 91/158 (58%), Positives = 108/158 (68%), Gaps = 6/158 (4%)
 Frame = +2

Query  5    GREMARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQP  184
            G +  R AVL+G NYP T+ EL GCVNDV  M   L+ R+GF +DD+ VL D   S  +P
Sbjct  5    GMDKRRLAVLVGCNYPNTRNELHGCVNDVLAMKETLLTRFGFKQDDMEVLTDEPESKVKP  64

Query  185  TGRNIRSALSDLV--KSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLIT  358
            TG NI++AL  +V    AGSGD LF HYSGHGTR+P+          DE IVP DFNLIT
Sbjct  65   TGANIKAALRRMVDKAQAGSGDVLFFHYSGHGTRIPS----GHPFKKDEAIVPCDFNLIT  120

Query  359  DDDFRELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIG  472
            D DFRELV+ LP+G   T++SDSCHSGGLID  KEQIG
Sbjct  121  DIDFRELVNQLPKGTSFTMISDSCHSGGLIDNEKEQIG  158



>gb|KFK24867.1| hypothetical protein AALP_AA8G035200 [Arabis alpina]
Length=324

 Score =   175 bits (443),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 89/153 (58%), Positives = 105/153 (69%), Gaps = 3/153 (2%)
 Frame = +2

Query  20   RKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGRNI  199
            R AVL+G NYP TK EL GCVNDV  M   L+ R+GF + D+ VL D   S  +PTG NI
Sbjct  10   RLAVLVGCNYPNTKNELHGCVNDVLAMKETLLTRFGFKQSDMEVLTDEPESKVKPTGANI  69

Query  200  RSALSDLVKSA--GSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            ++AL  +V  A  GSGD LF HYSGHGTR+P+          +  IVP DFNLITD DFR
Sbjct  70   KAALRRMVDKAQTGSGDVLFFHYSGHGTRIPSVKPAHPFKQDE-AIVPCDFNLITDIDFR  128

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIG  472
            ELV+ LP+G   T++SDSCHSGGLIDK KEQIG
Sbjct  129  ELVNQLPKGTSFTMLSDSCHSGGLIDKEKEQIG  161



>ref|XP_010251722.1| PREDICTED: metacaspase-9 isoform X2 [Nelumbo nucifera]
Length=325

 Score =   175 bits (443),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 90/158 (57%), Positives = 105/158 (66%), Gaps = 1/158 (1%)
 Frame = +2

Query  20   RKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGRNI  199
            R A L+G NYP T  EL GC+NDV  M   LV+R+GF   DI +L D  +S   PTG NI
Sbjct  10   RLATLVGCNYPNTPNELHGCINDVHAMRDALVNRFGFDPSDIVLLTDAPSSLVMPTGANI  69

Query  200  RSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFREL  379
            RSAL+ ++  A +GD LF HYSGHGTR+P+          DE IVP DFNLITD DFR L
Sbjct  70   RSALNRMIDQAEAGDVLFFHYSGHGTRIPS-ARPGHGFRHDEAIVPCDFNLITDVDFRHL  128

Query  380  VDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDNA  493
            V+ LP+G   TI+SDSCHSGGLIDK KEQIG S    A
Sbjct  129  VNRLPKGASFTIISDSCHSGGLIDKEKEQIGPSVASGA  166



>ref|XP_010922110.1| PREDICTED: metacaspase-9 [Elaeis guineensis]
 ref|XP_010922111.1| PREDICTED: metacaspase-9 [Elaeis guineensis]
Length=318

 Score =   175 bits (443),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 89/154 (58%), Positives = 103/154 (67%), Gaps = 0/154 (0%)
 Frame = +2

Query  20   RKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGRNI  199
            R A L+G NYP T+ EL GC+NDV  M   LV R+GF   DI +L D   S + PTG NI
Sbjct  7    RLATLVGCNYPNTQHELHGCINDVHAMSDVLVARFGFDRSDILILTDASGSPSLPTGANI  66

Query  200  RSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFREL  379
            + AL+ ++  A  GD LF HYSGHGT +PA        G DE IVP DFNLITD DFR+L
Sbjct  67   KRALAAMIARAEPGDVLFFHYSGHGTLIPAVKPHHSWHGHDEAIVPCDFNLITDIDFRQL  126

Query  380  VDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGEST  481
            VD LP G   T++SDSCHSGGLIDK KEQIG ST
Sbjct  127  VDRLPAGVTFTMISDSCHSGGLIDKEKEQIGPST  160



>ref|XP_006832890.1| hypothetical protein AMTR_s00095p00111310 [Amborella trichopoda]
 gb|ERM98168.1| hypothetical protein AMTR_s00095p00111310 [Amborella trichopoda]
Length=313

 Score =   174 bits (441),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 87/151 (58%), Positives = 107/151 (71%), Gaps = 1/151 (1%)
 Frame = +2

Query  20   RKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGRNI  199
            R A L+G NYPGT  EL GC+NDV  M   LV R+GF+ +DIT L D++ S  +PTG NI
Sbjct  7    RLATLVGCNYPGTPNELHGCINDVLTMRSVLVKRFGFNPNDITTLTDSEDSKVKPTGENI  66

Query  200  RSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFREL  379
            R AL+++V  A +GD LF HYSGHGT +PA +      G+ E IVP+D+NL+TD DFR L
Sbjct  67   REALNEMVSKAEAGDVLFFHYSGHGTLIPA-SMLGHKHGYYEAIVPTDYNLMTDLDFRWL  125

Query  380  VDSLPQGCRLTIVSDSCHSGGLIDKAKEQIG  472
            V+ LP G   T +SDSCHSGGLIDK KEQIG
Sbjct  126  VNQLPTGTSFTFLSDSCHSGGLIDKEKEQIG  156



>ref|XP_009395937.1| PREDICTED: metacaspase-9 [Musa acuminata subsp. malaccensis]
Length=320

 Score =   173 bits (439),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 88/154 (57%), Positives = 102/154 (66%), Gaps = 0/154 (0%)
 Frame = +2

Query  20   RKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGRNI  199
            R A L+G NY  T+ EL GC+NDV  M   LV R+GF+ DD+ +L D   S   PTG NI
Sbjct  7    RLATLVGCNYAHTRHELSGCINDVHAMRDVLVSRFGFAPDDVVLLTDAPGSVVLPTGANI  66

Query  200  RSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFREL  379
            R AL+ ++  A  GD LF HYSGHGT +P           DE IVP DFNLITD DFR+L
Sbjct  67   RGALAAMIGRAELGDVLFFHYSGHGTLIPPVRPHHGWHKPDEAIVPCDFNLITDVDFRQL  126

Query  380  VDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGEST  481
            VD +P+G   TIVSDSCHSGGLIDK KEQIG ST
Sbjct  127  VDRVPRGASFTIVSDSCHSGGLIDKEKEQIGPST  160



>ref|XP_008811948.1| PREDICTED: metacaspase-9 [Phoenix dactylifera]
Length=317

 Score =   173 bits (439),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 86/154 (56%), Positives = 102/154 (66%), Gaps = 0/154 (0%)
 Frame = +2

Query  20   RKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGRNI  199
            R A L+G NYP T+ EL GC+NDV  M   LV R+GF  +DI +L D   S   PTG NI
Sbjct  7    RLATLVGCNYPNTQHELHGCINDVHAMSDVLVARFGFHRNDILILTDASGSPLLPTGANI  66

Query  200  RSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFREL  379
            +SA++ ++  A  GD LF HYSGHGT +P           DE IVP DFNLITD DFR+L
Sbjct  67   KSAVAAMIARAEPGDVLFFHYSGHGTLIPPVKPHHSRHAHDEAIVPCDFNLITDVDFRQL  126

Query  380  VDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGEST  481
            +D LP G   T++SDSCHSGGLIDK KEQIG ST
Sbjct  127  IDRLPAGASFTMISDSCHSGGLIDKEKEQIGPST  160



>ref|XP_004169821.1| PREDICTED: LOW QUALITY PROTEIN: metacaspase-9-like [Cucumis sativus]
Length=316

 Score =   173 bits (438),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 91/159 (57%), Positives = 107/159 (67%), Gaps = 1/159 (1%)
 Frame = +2

Query  20   RKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGRNI  199
            R AVL+G NY  TK EL GC+NDV  M   L+ R+GF E +I VL D   S   PTG NI
Sbjct  6    RMAVLVGCNYRNTKYELHGCINDVMAMREKLMSRFGFKESNIQVLTDEPGSLLMPTGANI  65

Query  200  RSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFREL  379
            + AL  +V  A SGD LF HYSGHGTR+P+     +  G DE IVP DFNLITD DFR L
Sbjct  66   KRALGRMVGKAESGDVLFFHYSGHGTRVPS-MKHGNFLGQDEAIVPCDFNLITDIDFRHL  124

Query  380  VDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDNAD  496
            V+ +P+G   T++SDSCHSGGLIDK KEQIG ST  N +
Sbjct  125  VNRIPKGASFTMISDSCHSGGLIDKEKEQIGPSTIVNGE  163



>ref|XP_004144301.1| PREDICTED: metacaspase-9-like [Cucumis sativus]
 gb|KGN54647.1| hypothetical protein Csa_4G416430 [Cucumis sativus]
Length=317

 Score =   173 bits (438),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 91/159 (57%), Positives = 107/159 (67%), Gaps = 1/159 (1%)
 Frame = +2

Query  20   RKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGRNI  199
            R AVL+G NY  TK EL GC+NDV  M   L+ R+GF E +I VL D   S   PTG NI
Sbjct  6    RMAVLVGCNYRNTKYELHGCINDVMAMREKLMSRFGFKESNIQVLTDEPGSLLMPTGANI  65

Query  200  RSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFREL  379
            + AL  +V  A SGD LF HYSGHGTR+P+     +  G DE IVP DFNLITD DFR L
Sbjct  66   KRALGRMVGKAESGDVLFFHYSGHGTRVPS-MKHGNFLGQDEAIVPCDFNLITDIDFRHL  124

Query  380  VDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDNAD  496
            V+ +P+G   T++SDSCHSGGLIDK KEQIG ST  N +
Sbjct  125  VNRIPKGASFTMISDSCHSGGLIDKEKEQIGPSTIVNGE  163



>ref|XP_010055397.1| PREDICTED: metacaspase-9 [Eucalyptus grandis]
 gb|KCW89969.1| hypothetical protein EUGRSUZ_A02174 [Eucalyptus grandis]
Length=328

 Score =   173 bits (438),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 103/154 (67%), Gaps = 1/154 (1%)
 Frame = +2

Query  20   RKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGRNI  199
            R AVL+G NY GT+ EL GC+NDVR M   LV R+GF E  + VL D   S   PTG NI
Sbjct  7    RSAVLVGCNYQGTQYELHGCINDVRAMRETLVGRFGFEEGRVEVLTDEPGSPVMPTGANI  66

Query  200  RSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFREL  379
             +AL  +V  A  GD LF HYSGHGTR+P+          DE IVP DFNLITD DFR L
Sbjct  67   MAALGRMVDRAEPGDVLFFHYSGHGTRIPS-PRPVFPFKKDEAIVPCDFNLITDVDFRHL  125

Query  380  VDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGEST  481
            V+ LP+G  LTI+SDSCHSGGLIDK KEQ+G S 
Sbjct  126  VNRLPKGATLTILSDSCHSGGLIDKEKEQVGPSA  159



>gb|AFK49292.1| unknown [Medicago truncatula]
Length=319

 Score =   172 bits (437),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 90/167 (54%), Positives = 114/167 (68%), Gaps = 4/167 (2%)
 Frame = +2

Query  8    REMARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTD---ASYT  178
            R+  R AVL+G NYP T  EL+GC+NDV  M   LV R+GF   +I +L D D   +S T
Sbjct  3    RKNKRLAVLVGCNYPNTPNELRGCINDVLAMKDTLVKRFGFDHANIQLLTDDDPKNSSST  62

Query  179  QPTGRNIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLIT  358
             PTG NI+ ALS +V  A +GD L+ HYSGHGTR+P++         +  IV  DFNLIT
Sbjct  63   MPTGANIKQALSSMVDKAEAGDVLYFHYSGHGTRIPSKIHGHPFRHEE-AIVSCDFNLIT  121

Query  359  DDDFRELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDNADA  499
            D DFR+LV+ +P+G  LTI+SDSCHSGGLIDK KEQIG S+ D+ +A
Sbjct  122  DLDFRQLVNRIPKGASLTILSDSCHSGGLIDKEKEQIGPSSFDDKNA  168



>gb|KHG04687.1| Metacaspase-9 -like protein [Gossypium arboreum]
Length=319

 Score =   172 bits (436),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 92/167 (55%), Positives = 111/167 (66%), Gaps = 10/167 (6%)
 Frame = +2

Query  20   RKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDA-------SYT  178
            R AVL+G NYP T+ EL GC+NDV  M   LV R+GF   +I +L D  A       S  
Sbjct  7    RLAVLVGCNYPNTQYELHGCINDVVAMKDVLVKRFGFDPTNIELLTDASAATGEGSSSVV  66

Query  179  QPTGRNIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLIT  358
             PTG NI++ALS +V+ A +GD L+ HYSGHGTR+P         G DE IVP DFNLIT
Sbjct  67   LPTGENIKAALSKMVRQAEAGDVLYFHYSGHGTRIP---KPAHLFGHDEAIVPCDFNLIT  123

Query  359  DDDFRELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDNADA  499
            D DFR+LV+ LP+G   TI+SDSCHSGGLIDK KEQIG ST+  A +
Sbjct  124  DVDFRQLVNQLPKGASFTILSDSCHSGGLIDKEKEQIGPSTYRAASS  170



>emb|CDX70251.1| BnaA10g26000D [Brassica napus]
Length=323

 Score =   172 bits (436),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 87/160 (54%), Positives = 107/160 (67%), Gaps = 4/160 (3%)
 Frame = +2

Query  20   RKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGRNI  199
            R AVL+G NYP T+ EL GCVNDV  M   L  R+GF ++D+ VL D   S  +PTG NI
Sbjct  10   RLAVLVGCNYPNTRNELHGCVNDVLAMKETLTTRFGFKQEDMEVLTDEPESKVKPTGANI  69

Query  200  RSALSDLVKSAGSG---DYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDF  370
            ++AL  +V+ A +G   D LF HYSGHGTR+P+          +  IVP DFNLITD DF
Sbjct  70   KAALRRMVEKAQNGSGGDVLFFHYSGHGTRIPSVKPAHPFRQDE-AIVPCDFNLITDVDF  128

Query  371  RELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDN  490
            RELV+ LP+G   T++SDSCHSGGLIDK KEQIG  +  N
Sbjct  129  RELVNQLPKGTSFTMISDSCHSGGLIDKEKEQIGPFSSSN  168



>gb|KJB67853.1| hypothetical protein B456_010G214900 [Gossypium raimondii]
Length=319

 Score =   172 bits (435),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 92/167 (55%), Positives = 110/167 (66%), Gaps = 10/167 (6%)
 Frame = +2

Query  20   RKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDA-------SYT  178
            R AVL+G NYP T+ EL GC+NDV  M   LV R+GF   +I +L D  A       S  
Sbjct  7    RLAVLVGCNYPNTQYELHGCINDVVAMKDVLVKRFGFDPTNIELLTDASAVTGEGSSSVV  66

Query  179  QPTGRNIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLIT  358
             PTG NI++ALS +V  A +GD L+ HYSGHGTR+P         G DE IVP DFNLIT
Sbjct  67   LPTGENIKAALSKMVSQAEAGDVLYFHYSGHGTRIP---KSAHIFGHDEAIVPCDFNLIT  123

Query  359  DDDFRELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDNADA  499
            D DFR+LV+ LP+G   TI+SDSCHSGGLIDK KEQIG ST+  A +
Sbjct  124  DVDFRQLVNQLPKGASFTILSDSCHSGGLIDKEKEQIGPSTYRAASS  170



>ref|XP_010558138.1| PREDICTED: metacaspase-9 [Tarenaya hassleriana]
Length=316

 Score =   171 bits (433),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 90/164 (55%), Positives = 107/164 (65%), Gaps = 1/164 (1%)
 Frame = +2

Query  20   RKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGRNI  199
            R AVL+G NYP TK EL GCVNDV  M   L+ ++GF    + VL D   S  +PTG N+
Sbjct  8    RYAVLVGCNYPNTKNELHGCVNDVLAMKEVLLRQFGFETGHVEVLTDEPGSSVKPTGANV  67

Query  200  RSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFREL  379
            ++AL  +V  A  GD LF HYSGHGTR+P+          DE IVP DFNLITD DFREL
Sbjct  68   KAALGRMVDKAEPGDVLFFHYSGHGTRIPS-VKPGHPFRHDEAIVPCDFNLITDVDFREL  126

Query  380  VDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDNADADDAD  511
            V+ LP+G   T+VSDSCHSGGLIDK KEQIG S+       +AD
Sbjct  127  VNRLPKGTSFTMVSDSCHSGGLIDKEKEQIGPSSTITTLTANAD  170



>ref|XP_002307934.1| latex-abundant family protein [Populus trichocarpa]
 gb|EEE91457.1| latex-abundant family protein [Populus trichocarpa]
Length=315

 Score =   171 bits (433),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 86/151 (57%), Positives = 103/151 (68%), Gaps = 1/151 (1%)
 Frame = +2

Query  20   RKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGRNI  199
            R AVL+G NYP T+ EL GC+NDV  M   LV R+GF    + +L D   S   PTG NI
Sbjct  7    RMAVLVGCNYPNTRNELHGCINDVLTMKEVLVKRFGFDLRSVQLLTDAPGSVVLPTGANI  66

Query  200  RSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFREL  379
            + ALS ++  A +GD LF HYSGHGTR+P+          DE IVP DFNLITD DFR+L
Sbjct  67   KKALSHMIDQAEAGDVLFFHYSGHGTRIPS-VKRGHPFRHDEAIVPCDFNLITDVDFRQL  125

Query  380  VDSLPQGCRLTIVSDSCHSGGLIDKAKEQIG  472
            V+ LP+G  LT++SDSCHSGGLIDK KEQIG
Sbjct  126  VNRLPKGASLTVLSDSCHSGGLIDKEKEQIG  156



>emb|CDY35259.1| BnaA01g07720D [Brassica napus]
Length=323

 Score =   171 bits (433),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 105/153 (69%), Gaps = 3/153 (2%)
 Frame = +2

Query  20   RKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGRNI  199
            R AVL+G NYP TK EL GCVNDV  M   L+ R+GF ++D+ VL D   S  +PTG NI
Sbjct  10   RLAVLVGCNYPNTKNELHGCVNDVLAMKETLLTRFGFKQEDMEVLTDEPDSKIKPTGANI  69

Query  200  RSALSDLVKSA--GSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            ++AL  +V  A  GS + LF HYSGHGTR+P+          +  IVP DFNLITD DFR
Sbjct  70   KAALRRMVDKAQTGSENVLFFHYSGHGTRIPSVKPARPFKKDE-AIVPCDFNLITDVDFR  128

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIG  472
            ELV+ LP+G   T++SDSCHSGGLIDK KEQIG
Sbjct  129  ELVNQLPEGTSFTMISDSCHSGGLIDKEKEQIG  161



>ref|XP_006288211.1| hypothetical protein CARUB_v10001449mg [Capsella rubella]
 gb|EOA21109.1| hypothetical protein CARUB_v10001449mg [Capsella rubella]
Length=325

 Score =   171 bits (433),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 85/153 (56%), Positives = 104/153 (68%), Gaps = 3/153 (2%)
 Frame = +2

Query  20   RKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGRNI  199
            R AVL+G NYP T  EL GC+NDV  M   L+ R+GF ++DI VL D   S  +PTG NI
Sbjct  10   RLAVLVGCNYPNTSNELHGCINDVLAMKETLLTRFGFKQEDIEVLTDEAESKVKPTGANI  69

Query  200  RSALSDLVKSA--GSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            ++AL  ++  A  G+GD L  HYSGHGTR+P+          +  IVP DFNLITD DFR
Sbjct  70   KAALRRMMDKAQPGTGDVLLFHYSGHGTRIPSVKPAHPFKQDE-AIVPCDFNLITDVDFR  128

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIG  472
            ELV+ LP+G   T++SDSCHSGGLIDK KEQIG
Sbjct  129  ELVNQLPKGTSFTMISDSCHSGGLIDKEKEQIG  161



>ref|XP_010673225.1| PREDICTED: metacaspase-9-like isoform X1 [Beta vulgaris subsp. 
vulgaris]
Length=315

 Score =   171 bits (432),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 87/157 (55%), Positives = 107/157 (68%), Gaps = 4/157 (3%)
 Frame = +2

Query  2    GGREMARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQ  181
            GG+ MA   VL+G NYP T+ EL+GC+NDV  M + L+ R+GF E+DI +L D   S   
Sbjct  5    GGKRMA---VLVGCNYPNTEYELQGCINDVLAMKKMLIKRFGFEENDIELLTDAHDSSIS  61

Query  182  PTGRNIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITD  361
            PTG NI+ AL D+V  A  GD L+ HYSGHGT +P+     +    DE IVP DFNLITD
Sbjct  62   PTGANIKKALGDMVDRAEEGDVLYFHYSGHGTLIPS-LKPNETHRKDEAIVPCDFNLITD  120

Query  362  DDFRELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIG  472
             DFR+LV+ LP     TI+SDSCHSGGLID+ KEQIG
Sbjct  121  IDFRQLVNKLPPKTSFTILSDSCHSGGLIDQEKEQIG  157



>emb|CDY61770.1| BnaAnng17710D [Brassica napus]
Length=323

 Score =   171 bits (432),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 105/153 (69%), Gaps = 3/153 (2%)
 Frame = +2

Query  20   RKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGRNI  199
            R AVL+G NYP TK EL GCVNDV  M   L+ R+GF ++D+ VL D   S  +PTG NI
Sbjct  10   RLAVLVGCNYPNTKNELHGCVNDVLAMKETLLTRFGFKQEDMEVLTDEPDSKLKPTGANI  69

Query  200  RSALSDLVKSA--GSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            ++AL  +V  A  GS + LF HYSGHGTR+P+          +  IVP DFNLITD DFR
Sbjct  70   KAALRRMVDKAQTGSENVLFFHYSGHGTRIPSVKPARPFKKDE-AIVPCDFNLITDVDFR  128

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIG  472
            ELV+ LP+G   T++SDSCHSGGLIDK KEQIG
Sbjct  129  ELVNQLPEGTSFTMISDSCHSGGLIDKEKEQIG  161



>ref|NP_001142392.1| uncharacterized protein LOC100274565 [Zea mays]
 gb|ACF88387.1| unknown [Zea mays]
Length=391

 Score =   172 bits (436),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 94/131 (72%), Positives = 102/131 (78%), Gaps = 0/131 (0%)
 Frame = +2

Query  98   MHRCLVDRYGFSEDDITVLIDTDASYTQPTGRNIRSALSDLVKSAGSGDYLFVHYSGHGT  277
            M RCLVDR+GF E DI VL D D S  QPTG NIR AL+ LV  A  GD+LF HYSGHGT
Sbjct  1    MRRCLVDRFGFDEADIRVLTDADRSAPQPTGANIRRALARLVGDARPGDFLFFHYSGHGT  60

Query  278  RLPAetgeeddtgfdeCIVPSDFNLITDDDFRELVDSLPQGCRLTIVSDSCHSGGLIDKA  457
            RLPAETG+ DDTG+DECIVP D NLITD DFRELV  +P+GC  TIVSDSCHSGGL+D A
Sbjct  61   RLPAETGQHDDTGYDECIVPCDMNLITDQDFRELVQKVPEGCLFTIVSDSCHSGGLLDSA  120

Query  458  KEQIGESTHDN  490
            KEQIG ST  N
Sbjct  121  KEQIGNSTKQN  131



>ref|XP_010423614.1| PREDICTED: metacaspase-9 [Camelina sativa]
Length=325

 Score =   171 bits (432),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 86/158 (54%), Positives = 105/158 (66%), Gaps = 3/158 (2%)
 Frame = +2

Query  5    GREMARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQP  184
            G    R AVL+G NYP T+ EL GC+NDV  M   L+ R+GF ++DI VL D   +  +P
Sbjct  5    GMAKKRLAVLVGCNYPNTRNELHGCINDVLAMKETLLTRFGFKQEDIEVLTDEPEAKVKP  64

Query  185  TGRNIRSALSDLVKSA--GSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLIT  358
            TG NI++AL  +V  A  G GD L  HYSGHGTR+P+          +  IVP DFNLIT
Sbjct  65   TGANIKAALRRMVDKAQPGIGDVLLFHYSGHGTRIPSVKPAHPFKQDE-AIVPCDFNLIT  123

Query  359  DDDFRELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIG  472
            D DFRELV+ LP+G   T++SDSCHSGGLIDK KEQIG
Sbjct  124  DVDFRELVNQLPKGTSFTMISDSCHSGGLIDKEKEQIG  161



>ref|XP_009125548.1| PREDICTED: metacaspase-9 [Brassica rapa]
Length=323

 Score =   171 bits (432),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 105/153 (69%), Gaps = 3/153 (2%)
 Frame = +2

Query  20   RKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGRNI  199
            R AVL+G NYP TK EL GCVNDV  M   L+ R+GF ++D+ VL D   S  +PTG NI
Sbjct  10   RLAVLVGCNYPNTKNELHGCVNDVLAMKETLLTRFGFKQEDMEVLTDEPDSKLKPTGANI  69

Query  200  RSALSDLVKSA--GSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            ++AL  +V  A  GS + LF HYSGHGTR+P+          +  IVP DFNLITD DFR
Sbjct  70   KAALRRMVDKAQTGSENVLFFHYSGHGTRIPSVKPARPFKKDE-AIVPCDFNLITDVDFR  128

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIG  472
            ELV+ LP+G   T++SDSCHSGGLIDK KEQIG
Sbjct  129  ELVNQLPEGTSFTMISDSCHSGGLIDKEKEQIG  161



>ref|XP_004493282.1| PREDICTED: metacaspase-9-like [Cicer arietinum]
Length=319

 Score =   170 bits (431),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 87/162 (54%), Positives = 111/162 (69%), Gaps = 3/162 (2%)
 Frame = +2

Query  20   RKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLID--TDASYTQPTGR  193
            R AVL+G NYP T  EL GC+NDV  M   LV R+GF  ++I +LID    +S T PTG 
Sbjct  7    RLAVLVGCNYPNTPNELHGCINDVLAMKDMLVKRFGFDHENIELLIDEPNTSSSTMPTGA  66

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NI+ AL  ++  A +GD L+ HYSGHGTR+P+          +  IVP DFNLITD DFR
Sbjct  67   NIKKALGSMIDRAEAGDVLYFHYSGHGTRIPSMKYGHPFRHEE-AIVPCDFNLITDLDFR  125

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDNADA  499
            +LV+ LP+G  LTI+SDSCHSGGLIDK KEQIG ++ ++ +A
Sbjct  126  QLVNRLPKGTSLTILSDSCHSGGLIDKEKEQIGPNSLEDKNA  167



>ref|XP_007010767.1| Metacaspase 9 [Theobroma cacao]
 gb|EOY19577.1| Metacaspase 9 [Theobroma cacao]
Length=312

 Score =   170 bits (430),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 86/157 (55%), Positives = 106/157 (68%), Gaps = 1/157 (1%)
 Frame = +2

Query  20   RKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGRNI  199
            R AVL+G NY  T+ EL GC+NDV  M   LV+R+GF    I +L D   S   PTG NI
Sbjct  7    RLAVLVGCNYANTQHELHGCINDVVAMREVLVERFGFDPSHIELLTDAPGSLVMPTGANI  66

Query  200  RSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFREL  379
            +++L++++  A +GD LF HYSGHGTR+P+          DE IVP DFNLITD DFR+L
Sbjct  67   KASLNEMMNKAEAGDVLFFHYSGHGTRIPS-WKPGHHFRQDEAIVPCDFNLITDVDFRQL  125

Query  380  VDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDN  490
            V+ LP+G   TI+SDSCHSGGLIDK KEQIG S   N
Sbjct  126  VNRLPRGATFTILSDSCHSGGLIDKEKEQIGPSIVKN  162



>ref|XP_007161829.1| hypothetical protein PHAVU_001G101400g [Phaseolus vulgaris]
 gb|ESW33823.1| hypothetical protein PHAVU_001G101400g [Phaseolus vulgaris]
Length=317

 Score =   170 bits (430),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 87/157 (55%), Positives = 107/157 (68%), Gaps = 1/157 (1%)
 Frame = +2

Query  11   EMARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTG  190
            +  R AVL+G NYP T  EL GC+NDV  M   LV R+GF ++DI VL D   S   PTG
Sbjct  4    QKKRLAVLVGCNYPNTGNELHGCINDVLAMKETLVKRFGFDDNDIEVLTDAPNSCKLPTG  63

Query  191  RNIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDF  370
             NI+ AL+ LV  + +GD L+ HYSGHGTR+P+          +E IVP DFNLITD DF
Sbjct  64   ANIKQALAKLVDGSEAGDVLYFHYSGHGTRIPS-KKHGHHFHHEEAIVPCDFNLITDLDF  122

Query  371  RELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGEST  481
            R+LV+ L +G  LTI+SDSCHSGGLIDK KEQ+G S+
Sbjct  123  RQLVNRLAKGASLTILSDSCHSGGLIDKEKEQVGPSS  159



>ref|XP_010490925.1| PREDICTED: metacaspase-9-like [Camelina sativa]
Length=325

 Score =   170 bits (430),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 85/158 (54%), Positives = 106/158 (67%), Gaps = 3/158 (2%)
 Frame = +2

Query  5    GREMARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQP  184
            G    R AVL+G NYP T+ EL GC+NDV  M   L+ R+GF ++DI VL D   +  +P
Sbjct  5    GMVKKRLAVLVGCNYPHTRNELHGCINDVLAMKETLLTRFGFKQEDIEVLTDETEAKVKP  64

Query  185  TGRNIRSALSDLVKSA--GSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLIT  358
            TG NI++AL  ++  A  G+GD L  HYSGHGTR+P+          +  IVP DFNLIT
Sbjct  65   TGANIKAALRRMMDKAQPGTGDVLLFHYSGHGTRIPSVKPAHPFKQDE-AIVPCDFNLIT  123

Query  359  DDDFRELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIG  472
            D DFRELV+ LP+G   T++SDSCHSGGLIDK KEQIG
Sbjct  124  DVDFRELVNQLPKGTSFTMISDSCHSGGLIDKEKEQIG  161



>gb|EMS48949.1| Metacaspase-4 [Triticum urartu]
Length=412

 Score =   172 bits (435),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 96/139 (69%), Positives = 109/139 (78%), Gaps = 2/139 (1%)
 Frame = +2

Query  80   VNDVRRMH--RCLVDRYGFSEDDITVLIDTDASYTQPTGRNIRSALSDLVKSAGSGDYLF  253
              D  R H  +CLVDR+GF ED+ITVL+D  +S  QPTG NIR AL+ LV  A  GD+LF
Sbjct  29   ATDGPRTHSTQCLVDRFGFDEDNITVLLDRGSSGPQPTGANIRHALAKLVGDARRGDFLF  88

Query  254  VHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFRELVDSLPQGCRLTIVSDSCH  433
             HYSGHGTRLPAETG++DDTG+DECIVPSD NLITD DFR+LV  +P GC  TIVSDSCH
Sbjct  89   FHYSGHGTRLPAETGQDDDTGYDECIVPSDMNLITDQDFRDLVQKVPDGCIFTIVSDSCH  148

Query  434  SGGLIDKAKEQIGESTHDN  490
            SGGL+DKAKEQIG ST  N
Sbjct  149  SGGLLDKAKEQIGNSTKQN  167



>ref|XP_009122627.1| PREDICTED: metacaspase-9 [Brassica rapa]
Length=323

 Score =   169 bits (429),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 107/160 (67%), Gaps = 4/160 (3%)
 Frame = +2

Query  20   RKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGRNI  199
            R AVL+G NYP T+ EL GCVNDV  M   L  R+GF ++D+ VL D   S  +PTG NI
Sbjct  10   RLAVLVGCNYPNTRNELHGCVNDVLAMQETLTTRFGFKQEDMEVLTDKPESKVKPTGANI  69

Query  200  RSALSDLVKSAGS---GDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDF  370
            ++AL  +V+ A +   GD LF HYSGHGTR+P+          DE IVP DFNLITD DF
Sbjct  70   KAALRRMVEKAQNGPGGDVLFFHYSGHGTRIPS-VKPAHPFRQDEAIVPCDFNLITDVDF  128

Query  371  RELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDN  490
            RELV+ LP+G   T++SDSCHSGGLI K KEQIG  +  N
Sbjct  129  RELVNQLPKGTSFTMISDSCHSGGLIYKEKEQIGPFSSSN  168



>ref|XP_002322580.2| latex-abundant family protein [Populus trichocarpa]
 gb|EEF04341.2| latex-abundant family protein [Populus trichocarpa]
Length=344

 Score =   169 bits (429),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 107/164 (65%), Gaps = 3/164 (2%)
 Frame = +2

Query  11   EMARK--AVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQP  184
            EM +K  AVL+G NYP T+ EL GC+NDV  M   LV R+GF    + +L D   S   P
Sbjct  31   EMGKKRMAVLVGCNYPNTQNELHGCINDVLAMKEVLVKRFGFDASHVQLLTDAPGSVVLP  90

Query  185  TGRNIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDD  364
            TG NI+ AL  ++  A +GD LF HYSGHGT +P+          DE IVP DFNLITD 
Sbjct  91   TGANIKRALGHMIDQAEAGDVLFFHYSGHGTWIPS-NKPGHAFRQDEAIVPCDFNLITDV  149

Query  365  DFRELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDNAD  496
            DFR+LV+ LP+G  LTI+SDSCHSGGLIDK KEQIG +    A+
Sbjct  150  DFRQLVNRLPKGASLTILSDSCHSGGLIDKEKEQIGPNATITAN  193



>ref|XP_011041315.1| PREDICTED: metacaspase-9-like [Populus euphratica]
Length=315

 Score =   168 bits (426),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 87/156 (56%), Positives = 104/156 (67%), Gaps = 3/156 (2%)
 Frame = +2

Query  11   EMARK--AVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQP  184
            EM +K  AVL+G NYP T+ EL GC+NDV  M   LV R+GF    + +L D   S   P
Sbjct  2    EMGKKRMAVLVGCNYPDTQNELHGCINDVLAMKEVLVKRFGFDASHVQLLTDAPGSVVLP  61

Query  185  TGRNIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDD  364
            TG NI+ AL  ++  A +GD LF HYSGHGT +P+          DE IVP DFNLITD 
Sbjct  62   TGANIKRALGHMIDQAEAGDVLFFHYSGHGTWIPS-NKPGHAFRQDEAIVPCDFNLITDV  120

Query  365  DFRELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIG  472
            DFR+LV+ LP+G  LTI+SDSCHSGGLIDK KEQIG
Sbjct  121  DFRQLVNRLPKGASLTILSDSCHSGGLIDKEKEQIG  156



>gb|AET08883.1| metacaspase 2 [Aegilops speltoides]
 emb|CCC14967.1| MC2B protein [Aegilops speltoides]
Length=344

 Score =   169 bits (428),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 88/158 (56%), Positives = 105/158 (66%), Gaps = 2/158 (1%)
 Frame = +2

Query  5    GREMARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQP  184
            G    R A L+G NY GT+ EL+GC+NDV  +   LV R+GF+  D+ VL D   +   P
Sbjct  3    GETTKRLATLVGCNYVGTRYELRGCINDVDAVRDTLVARFGFAPADVAVLTDGRGAEVLP  62

Query  185  TGRNIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDD  364
            TG NIR AL+D+V  A  GD LF HYSGHGT +P      D    +E IVP+DFNLITD 
Sbjct  63   TGANIRRALADMVARAAPGDVLFFHYSGHGTLVPP--RHGDSGAEEEAIVPTDFNLITDV  120

Query  365  DFRELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGES  478
            DFR+LVD +P G   TIVSDSCHSGGLID+ KEQIG S
Sbjct  121  DFRQLVDRVPPGASFTIVSDSCHSGGLIDQEKEQIGPS  158



>gb|AET08884.1| metacaspase 2 [Aegilops tauschii]
 emb|CCC14978.1| MC2D protein [Aegilops tauschii]
Length=344

 Score =   169 bits (427),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 87/154 (56%), Positives = 104/154 (68%), Gaps = 2/154 (1%)
 Frame = +2

Query  20   RKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGRNI  199
            R A L+G NY GT+ EL+GC+NDV  +   LV R+GF+  D+ VL D   +   PTG NI
Sbjct  8    RLATLVGCNYVGTRYELRGCINDVDAVRAALVARFGFAPADVAVLTDGRGAEVLPTGANI  67

Query  200  RSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFREL  379
            R AL+D+V  A  GD LF HYSGHGT +P      D    +E IVP+DFNLITD DFR+L
Sbjct  68   RRALADMVARAAPGDVLFFHYSGHGTLVPP--RHGDGGAEEEAIVPTDFNLITDVDFRQL  125

Query  380  VDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGEST  481
            VD +P G   TIVSDSCHSGGLID+ KEQIG S 
Sbjct  126  VDRVPPGASFTIVSDSCHSGGLIDQEKEQIGPSV  159



>dbj|BAK00262.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=335

 Score =   168 bits (426),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 88/159 (55%), Positives = 103/159 (65%), Gaps = 2/159 (1%)
 Frame = +2

Query  5    GREMARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQP  184
            G+   R A L+G NY GT  EL+GC+NDV  +   LV R+GF+  D+ VL D   +   P
Sbjct  3    GQTNKRLATLVGCNYVGTPYELRGCINDVDAVRDTLVARFGFAPADVAVLTDVRGAEVLP  62

Query  185  TGRNIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDD  364
            TG NIR AL+D+V  A  GD LF HYSGHGT +P      +     E IVPSDFNLITD 
Sbjct  63   TGANIRRALADMVARAAPGDVLFFHYSGHGTLVPP--QHGEGGAEKEAIVPSDFNLITDV  120

Query  365  DFRELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGEST  481
            DFR LVD +P G   TIVSDSCHSGGLID+ KEQIG S 
Sbjct  121  DFRLLVDRVPPGASFTIVSDSCHSGGLIDQEKEQIGPSV  159



>ref|XP_006301624.1| hypothetical protein CARUB_v10022065mg [Capsella rubella]
 gb|EOA34522.1| hypothetical protein CARUB_v10022065mg [Capsella rubella]
Length=336

 Score =   168 bits (426),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 102/166 (61%), Positives = 117/166 (70%), Gaps = 31/166 (19%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGR  193
            MA+KA+LIGINY GTKAEL+GCVNDVRRMH  LV+RYGFSE +I +LIDTD+S  +PTG+
Sbjct  1    MAKKALLIGINYVGTKAELRGCVNDVRRMHISLVERYGFSEKNIKMLIDTDSSSIKPTGK  60

Query  194  NIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFR  373
            NIR AL DLV+ A  GD LFVHYSGHGTRLPAETGE+DDTG+DECIVPSD NLITD+   
Sbjct  61   NIRQALLDLVEPAKPGDVLFVHYSGHGTRLPAETGEDDDTGYDECIVPSDMNLITDE---  117

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGEST-HDNADADDA  508
                                       AKEQIGEST   N D+ D+
Sbjct  118  ---------------------------AKEQIGESTKKKNRDSGDS  136



>gb|AET08882.1| metacaspase 2 [Triticum monococcum]
 emb|CCC14972.1| MC2A protein [Triticum urartu]
Length=343

 Score =   168 bits (425),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 90/170 (53%), Positives = 107/170 (63%), Gaps = 4/170 (2%)
 Frame = +2

Query  5    GREMARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQ-  181
            G    R A L+G NY GT+ EL+GC+NDV  +   LV R+GF+  D+ VL D D    + 
Sbjct  3    GEASKRLATLVGCNYVGTRYELRGCINDVDAVRAALVARFGFAPADVAVLTDGDGRGAEV  62

Query  182  -PTGRNIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLIT  358
             PTG NIR AL+D+V  A  GD LF HYSGHGT +P   G+         IVP+DFNLIT
Sbjct  63   LPTGANIRRALADMVARAAPGDVLFFHYSGHGTLVPPRHGDGGAEEE--AIVPTDFNLIT  120

Query  359  DDDFRELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDNADADDA  508
            D DFR+LVD +P G   TIVSDSCHSGGLID+ KEQIG S      A  A
Sbjct  121  DVDFRQLVDRVPPGASFTIVSDSCHSGGLIDQEKEQIGPSVGSGPGAPSA  170



>ref|XP_010111290.1| hypothetical protein L484_027943 [Morus notabilis]
 gb|EXC30768.1| hypothetical protein L484_027943 [Morus notabilis]
Length=311

 Score =   167 bits (423),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 89/157 (57%), Positives = 105/157 (67%), Gaps = 2/157 (1%)
 Frame = +2

Query  20   RKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGRNI  199
            R  +L+G NYP T+ EL GCVNDV  M   LV R+GF  + I +L D   S   PTG NI
Sbjct  7    RLTLLVGCNYPNTQYELHGCVNDVVSMRDTLVSRFGFDPNHIELLTDQPGSSVTPTGENI  66

Query  200  RSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFREL  379
            + AL ++V  A +GD LF HYSGHGTR+P+     +    DE IVP DFNLITD DFR L
Sbjct  67   KRALGEMVDKAEAGDVLFFHYSGHGTRIPS-MKLGNRFRQDEAIVPCDFNLITDVDFRHL  125

Query  380  VDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGE-STHD  487
            V+ LP+G   TI+SDSCHSGGLIDK KEQIG  ST D
Sbjct  126  VNRLPKGASFTILSDSCHSGGLIDKEKEQIGPGSTRD  162



>ref|XP_001750356.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ84855.1| predicted protein [Monosiga brevicollis MX1]
Length=402

 Score =   169 bits (428),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 85/162 (52%), Positives = 112/162 (69%), Gaps = 10/162 (6%)
 Frame = +2

Query  14   MARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVD----------RYGFSEDDITVLIDT  163
            MA+KA+L+G NYPGT+A+L GCVNDV  MH  L D            GFS+ DITV+IDT
Sbjct  1    MAKKALLVGCNYPGTQAQLNGCVNDVWSMHTILTDLKVKVALSPGALGFSKSDITVMIDT  60

Query  164  DASYTQPTGRNIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSD  343
            D+    PTGRNI++ L++LV+S+ +GDYL  H+SGHGT++PAE    +  G DE I P+D
Sbjct  61   DSRDASPTGRNIKAGLNELVRSSKAGDYLVFHFSGHGTQIPAEGDTNEADGKDEAICPTD  120

Query  344  FNLITDDDFRELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQI  469
             N+I DDD RE+V+ LP G  LT+V+D CHSG ++D    QI
Sbjct  121  LNIIIDDDLREIVEQLPSGANLTVVTDCCHSGSMLDHTAVQI  162



>ref|XP_002283757.1| PREDICTED: metacaspase-9 [Vitis vinifera]
Length=316

 Score =   167 bits (422),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 101/154 (66%), Gaps = 1/154 (1%)
 Frame = +2

Query  20   RKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGRNI  199
            R AVL+G NY  T+ EL GC+NDV  M   LV R+GF    + +L D   S   PTG NI
Sbjct  7    RMAVLVGCNYHNTRNELHGCINDVLTMRETLVTRFGFQLSHVELLTDEPGSLVMPTGANI  66

Query  200  RSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFREL  379
            + AL  +V  A  GD LF HYSGHGT++P+          DE IVP DFNLITD DFR+L
Sbjct  67   KKALDRMVDQAEPGDVLFFHYSGHGTKIPS-VKPHHPFSQDEAIVPCDFNLITDIDFRQL  125

Query  380  VDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGEST  481
            VD +P+G   TI+SDSCHSGGLIDK KEQIG S+
Sbjct  126  VDRIPKGANFTILSDSCHSGGLIDKEKEQIGPSS  159



>ref|XP_004291543.1| PREDICTED: metacaspase-9 [Fragaria vesca subsp. vesca]
Length=323

 Score =   167 bits (423),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 86/157 (55%), Positives = 105/157 (67%), Gaps = 1/157 (1%)
 Frame = +2

Query  8    REMARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPT  187
            ++  R AVL+G NYP T+ EL GC+NDV  M   LV R+GF  + I +L D  ++   PT
Sbjct  3    KQNKRLAVLVGCNYPNTRNELHGCINDVLTMRDTLVSRFGFDPNHIELLTDDGSASVLPT  62

Query  188  GRNIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDD  367
            G NI+ AL  +V  A  GD L+ HYSGHGTR+P+          DE IVP DFNLITD D
Sbjct  63   GANIKKALDAMVDQAEPGDVLYFHYSGHGTRIPS-LKPGRPFRQDEAIVPCDFNLITDVD  121

Query  368  FRELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGES  478
            FR+LV+ LP+G   TI+SDSCHSGGLIDK KEQIG S
Sbjct  122  FRQLVNRLPKGASFTILSDSCHSGGLIDKEKEQIGPS  158



>gb|AGJ94053.1| metacaspase-6 [Vitis vinifera]
Length=316

 Score =   167 bits (422),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 101/154 (66%), Gaps = 1/154 (1%)
 Frame = +2

Query  20   RKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGRNI  199
            R AVL+G NY  T+ EL GC+NDV  M   LV R+GF    + +L D   S   PTG NI
Sbjct  7    RMAVLVGCNYHNTRNELHGCINDVLTMRETLVTRFGFQLSHVELLTDEPGSLVMPTGANI  66

Query  200  RSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFREL  379
            + AL  +V  A  GD LF HYSGHGT++P+          DE IVP DFNLITD DFR+L
Sbjct  67   KKALDRMVDQAEPGDVLFFHYSGHGTKIPS-VKPHHPFSQDEAIVPCDFNLITDLDFRQL  125

Query  380  VDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGEST  481
            VD +P+G   TI+SDSCHSGGLIDK KEQIG S+
Sbjct  126  VDRIPKGANFTILSDSCHSGGLIDKEKEQIGPSS  159



>ref|XP_004978429.1| PREDICTED: metacaspase-9-like [Setaria italica]
Length=329

 Score =   167 bits (422),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 91/158 (58%), Positives = 105/158 (66%), Gaps = 6/158 (4%)
 Frame = +2

Query  26   AVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDA------SYTQPT  187
            A L+G NY GT  EL+GC+NDV  M   LV R+GF+  DITVL D D       S   PT
Sbjct  9    ATLVGCNYAGTPHELRGCINDVVAMRDTLVARFGFAPRDITVLTDDDGGRGSSPSAVLPT  68

Query  188  GRNIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDD  367
            G NI+ AL+++V  A  GD LF HYSGHGT +P   G   D   DE IVP DFNLITD D
Sbjct  69   GANIKRALAEMVSRAAPGDVLFFHYSGHGTLVPHRRGHGHDGRPDEAIVPCDFNLITDVD  128

Query  368  FRELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGEST  481
            FR+LVD +PQG   T+VSDSCHSGGLID+ KEQIG S 
Sbjct  129  FRQLVDRVPQGATFTMVSDSCHSGGLIDQEKEQIGPSA  166



>emb|CBI32852.3| unnamed protein product [Vitis vinifera]
Length=326

 Score =   167 bits (422),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 101/154 (66%), Gaps = 1/154 (1%)
 Frame = +2

Query  20   RKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGRNI  199
            R AVL+G NY  T+ EL GC+NDV  M   LV R+GF    + +L D   S   PTG NI
Sbjct  7    RMAVLVGCNYHNTRNELHGCINDVLTMRETLVTRFGFQLSHVELLTDEPGSLVMPTGANI  66

Query  200  RSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFREL  379
            + AL  +V  A  GD LF HYSGHGT++P+          DE IVP DFNLITD DFR+L
Sbjct  67   KKALDRMVDQAEPGDVLFFHYSGHGTKIPS-VKPHHPFSQDEAIVPCDFNLITDIDFRQL  125

Query  380  VDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGEST  481
            VD +P+G   TI+SDSCHSGGLIDK KEQIG S+
Sbjct  126  VDRIPKGANFTILSDSCHSGGLIDKEKEQIGPSS  159



>ref|XP_010251721.1| PREDICTED: metacaspase-9 isoform X1 [Nelumbo nucifera]
Length=338

 Score =   166 bits (419),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 105/171 (61%), Gaps = 14/171 (8%)
 Frame = +2

Query  20   RKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGRNI  199
            R A L+G NYP T  EL GC+NDV  M   LV+R+GF   DI +L D  +S   PTG NI
Sbjct  10   RLATLVGCNYPNTPNELHGCINDVHAMRDALVNRFGFDPSDIVLLTDAPSSLVMPTGANI  69

Query  200  RSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLI--------  355
            RSAL+ ++  A +GD LF HYSGHGTR+P+          DE IVP DFNLI        
Sbjct  70   RSALNRMIDQAEAGDVLFFHYSGHGTRIPS-ARPGHGFRHDEAIVPCDFNLITANVTNMT  128

Query  356  -----TDDDFRELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDNA  493
                 TD DFR LV+ LP+G   TI+SDSCHSGGLIDK KEQIG S    A
Sbjct  129  DCNSSTDVDFRHLVNRLPKGASFTIISDSCHSGGLIDKEKEQIGPSVASGA  179



>ref|XP_002517452.1| caspase, putative [Ricinus communis]
 gb|EEF44994.1| caspase, putative [Ricinus communis]
Length=325

 Score =   165 bits (417),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 86/165 (52%), Positives = 108/165 (65%), Gaps = 4/165 (2%)
 Frame = +2

Query  20   RKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDA---SYTQPTG  190
            R AVL+G NYP ++ EL GC+NDV  M   LV R+GF    I +L D  A   S   PTG
Sbjct  7    RMAVLVGCNYPNSRNELHGCINDVVTMRDVLVKRFGFDLSHIELLTDAPAPGSSQIMPTG  66

Query  191  RNIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDF  370
             NI+ AL  +V  A SGD L  HYSGHGT++P++         +  IVP DFNLITD DF
Sbjct  67   ANIKKALDQMVGKAESGDVLLFHYSGHGTKIPSKRPGHPFRQDE-AIVPCDFNLITDVDF  125

Query  371  RELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDNADADD  505
            R+LV+ LP+G   TI+SDSCHSGGLIDK KEQIG ++   A+A++
Sbjct  126  RQLVNRLPKGTSFTIISDSCHSGGLIDKEKEQIGPNSTITANAEN  170



>ref|XP_003554078.1| PREDICTED: metacaspase-9-like [Glycine max]
Length=322

 Score =   164 bits (416),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 85/167 (51%), Positives = 110/167 (66%), Gaps = 2/167 (1%)
 Frame = +2

Query  2    GGREMARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQ  181
            G ++  R AVL+G NYP T  EL GC+NDV  M   L  R+GF   +I +L D   S  +
Sbjct  5    GQKKNKRVAVLVGCNYPNTSNELHGCINDVLAMKDTLEKRFGFDPSNIELLTDAPHSSNK  64

Query  182  -PTGRNIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLIT  358
             PTG NI+ AL+++V  A +GD L+ HYSGHGTR+P++         +  IVP DFNLIT
Sbjct  65   LPTGANIKEALANMVDGAEAGDVLYFHYSGHGTRIPSKKHGHPFRHEEA-IVPCDFNLIT  123

Query  359  DDDFRELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDNADA  499
            D D R+LV+ +P+G  LTI+SDSCHSGGLIDK KEQIG S+    D+
Sbjct  124  DLDLRQLVNRVPKGASLTILSDSCHSGGLIDKEKEQIGPSSSTEKDS  170



>gb|KHN34591.1| Metacaspase-9 [Glycine soja]
Length=322

 Score =   164 bits (416),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 85/167 (51%), Positives = 110/167 (66%), Gaps = 2/167 (1%)
 Frame = +2

Query  2    GGREMARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQ  181
            G ++  R AVL+G NYP T  EL GC+NDV  M   L  R+GF   +I +L D   S  +
Sbjct  5    GQKKNKRVAVLVGCNYPNTSNELHGCINDVLAMKDTLEKRFGFDPSNIELLTDAPHSSNK  64

Query  182  -PTGRNIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLIT  358
             PTG NI+ AL+++V  A +GD L+ HYSGHGTR+P++         +  IVP DFNLIT
Sbjct  65   LPTGANIKEALANMVDGAEAGDVLYFHYSGHGTRIPSKKHGHPFRHEEA-IVPCDFNLIT  123

Query  359  DDDFRELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDNADA  499
            D D R+LV+ +P+G  LTI+SDSCHSGGLIDK KEQIG S+    D+
Sbjct  124  DLDLRQLVNRVPKGASLTILSDSCHSGGLIDKEKEQIGPSSSTEKDS  170



>ref|XP_010673221.1| PREDICTED: metacaspase-9-like [Beta vulgaris subsp. vulgaris]
Length=321

 Score =   164 bits (415),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 105/155 (68%), Gaps = 5/155 (3%)
 Frame = +2

Query  20   RKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDT-DASYTQPTGRN  196
            R A+L+G NY  T+ +L GC+NDV  M   LVDR+GF  + I +LID    S   PTG N
Sbjct  7    RMALLVGCNYTNTQYQLHGCINDVVSMQELLVDRFGFEPESIELLIDEGPGSKLLPTGVN  66

Query  197  IRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFRE  376
            I+ AL  ++  A +GD LF HYSGHGT +P++   + +      IVP DFNLITD DFR+
Sbjct  67   IKKALKKMIDEAEAGDVLFFHYSGHGTLVPSKHHLKREE----AIVPCDFNLITDVDFRQ  122

Query  377  LVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGEST  481
            LV+ LP+G   TI+SDSCHSGGLIDK KEQIG +T
Sbjct  123  LVNGLPKGASFTILSDSCHSGGLIDKEKEQIGPNT  157



>gb|EAY79833.1| hypothetical protein OsI_34992 [Oryza sativa Indica Group]
Length=341

 Score =   165 bits (417),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 89/155 (57%), Positives = 103/155 (66%), Gaps = 1/155 (1%)
 Frame = +2

Query  20   RKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGRNI  199
            + A L+G NY GT  EL+GC+NDV  M   LV R+GF+  D+TVL D   S   PTG NI
Sbjct  8    KLATLVGCNYAGTPNELQGCINDVAAMRDALVARFGFAPADVTVLTDDRGSPVLPTGANI  67

Query  200  RSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgf-deCIVPSDFNLITDDDFRE  376
            + AL+D+V  A  GD LF HYSGHGT +P   G     G  DE IVP DFNLITD DFR 
Sbjct  68   KRALADMVARAAPGDVLFFHYSGHGTLVPPVKGRRHGHGECDEAIVPCDFNLITDVDFRR  127

Query  377  LVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGEST  481
            LVD +P+G   T+VSDSCHSGGLID  KEQIG S 
Sbjct  128  LVDRVPRGASFTMVSDSCHSGGLIDLEKEQIGPSV  162



>ref|NP_001065680.1| Os11g0134700 [Oryza sativa Japonica Group]
 gb|ABA91319.1| latex-abundant protein, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF27525.1| Os11g0134700 [Oryza sativa Japonica Group]
 dbj|BAG89299.1| unnamed protein product [Oryza sativa Japonica Group]
Length=341

 Score =   164 bits (416),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 89/155 (57%), Positives = 103/155 (66%), Gaps = 1/155 (1%)
 Frame = +2

Query  20   RKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGRNI  199
            + A L+G NY GT  EL+GC+NDV  M   LV R+GF+  D+TVL D   S   PTG NI
Sbjct  8    KLATLVGCNYAGTPNELQGCINDVAAMRDALVARFGFAPADVTVLTDDRGSPVLPTGANI  67

Query  200  RSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgf-deCIVPSDFNLITDDDFRE  376
            + AL+D+V  A  GD LF HYSGHGT +P   G     G  DE IVP DFNLITD DFR 
Sbjct  68   KRALADMVARAAPGDVLFFHYSGHGTLVPPVKGRRHGHGECDEAIVPCDFNLITDVDFRR  127

Query  377  LVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGEST  481
            LVD +P+G   T+VSDSCHSGGLID  KEQIG S 
Sbjct  128  LVDRVPRGASFTMVSDSCHSGGLIDLEKEQIGPSV  162



>emb|CBX25424.1| hypothetical_protein [Oryza glaberrima]
Length=341

 Score =   164 bits (416),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 90/155 (58%), Positives = 104/155 (67%), Gaps = 1/155 (1%)
 Frame = +2

Query  20   RKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGRNI  199
            + A L+G NY GT  EL+GC+NDV  M   LV R+GF+  D+TVL D   S   PTG NI
Sbjct  8    KLATLVGCNYAGTPNELQGCINDVAAMRDALVARFGFAPADVTVLTDDRGSPVLPTGANI  67

Query  200  RSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgf-deCIVPSDFNLITDDDFRE  376
            + AL+D+V  A  GD LF HYSGHGT +P   G  D  G  DE IVP DFNLITD DFR 
Sbjct  68   KRALADMVARAAPGDVLFFHYSGHGTLVPPVKGRRDGHGECDEAIVPCDFNLITDVDFRR  127

Query  377  LVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGEST  481
            LVD +P+G   T+VSDSCHSGGLID  KEQIG S 
Sbjct  128  LVDRVPRGASFTMVSDSCHSGGLIDLEKEQIGPSV  162



>ref|XP_008227368.1| PREDICTED: metacaspase-9 [Prunus mume]
Length=326

 Score =   164 bits (414),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 86/157 (55%), Positives = 103/157 (66%), Gaps = 5/157 (3%)
 Frame = +2

Query  20   RKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASY----TQPT  187
            R AVL+G NYP T+ EL GC+NDV  M   LVDR+GF   +I +L D  A+       PT
Sbjct  8    RLAVLVGCNYPNTRNELHGCINDVVAMRGTLVDRFGFDPGNIQLLTDAAAAGSSSSVMPT  67

Query  188  GRNIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDD  367
            G NI+ AL  +V  A  GD L+ HYSGHGTR+P+          +  IVP DFNLITD D
Sbjct  68   GANIKKALGAMVDQAKPGDVLYFHYSGHGTRIPSLKPGNHFRQDE-AIVPCDFNLITDVD  126

Query  368  FRELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGES  478
            FR+LV+ LP+G   TI+SDSCHSGGLIDK KEQIG S
Sbjct  127  FRQLVNRLPKGASFTILSDSCHSGGLIDKEKEQIGPS  163



>ref|XP_002451746.1| hypothetical protein SORBIDRAFT_04g007090 [Sorghum bicolor]
 gb|EES04722.1| hypothetical protein SORBIDRAFT_04g007090 [Sorghum bicolor]
Length=333

 Score =   164 bits (414),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 87/156 (56%), Positives = 104/156 (67%), Gaps = 4/156 (3%)
 Frame = +2

Query  26   AVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDT---DASYTQPTGRN  196
            A L+G NY GT+ EL+GC+NDV  M   L+DR+GF+  ++TVL D        T PTG  
Sbjct  12   ATLVGCNYAGTEYELQGCINDVHAMRAVLLDRFGFAPANVTVLTDDHDDSGGGTIPTGAG  71

Query  197  IRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfd-eCIVPSDFNLITDDDFR  373
            +R ALSD+V  A  GD LF H+SGHGT +P           D E IVP DFNLITD DFR
Sbjct  72   VRRALSDMVARAAPGDVLFFHFSGHGTLVPPVVTGSGHGDRDDEAIVPCDFNLITDVDFR  131

Query  374  ELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGEST  481
            ELVD LP+G   T+VSDSCHSGGLID+ KEQIG +T
Sbjct  132  ELVDRLPRGATFTMVSDSCHSGGLIDQEKEQIGPTT  167



>ref|XP_011079135.1| PREDICTED: metacaspase-9 [Sesamum indicum]
Length=315

 Score =   163 bits (412),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 81/154 (53%), Positives = 104/154 (68%), Gaps = 4/154 (3%)
 Frame = +2

Query  20   RKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQPTGRNI  199
            + A+L+G NYP T  EL+GC NDV  MH  LV ++GF  + + ++ID   S T PTG NI
Sbjct  6    KMALLVGCNYPKTPNELRGCHNDVLAMHEVLVAQFGFDPNHVELMIDKPGSLTMPTGANI  65

Query  200  RSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDDFREL  379
            + ALS ++  A  GD LF HYSGHGT + A     + +  +E IVP DFNLIT  DFR+L
Sbjct  66   KKALSRMIDQAEPGDVLFFHYSGHGTLIKA----RNLSKIEEAIVPCDFNLITSVDFRQL  121

Query  380  VDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGEST  481
            V+ +P+G   TI+SDSCHSGGLIDK  EQIG S+
Sbjct  122  VNRVPKGATFTILSDSCHSGGLIDKETEQIGPSS  155



>ref|XP_004977462.1| PREDICTED: metacaspase-9-like [Setaria italica]
Length=335

 Score =   163 bits (413),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 94/170 (55%), Positives = 110/170 (65%), Gaps = 12/170 (7%)
 Frame = +2

Query  2    GGREMARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDA----  169
            G ++M   A L+G NY GT  EL+GC+NDV  M   LV R+GF+  DIT L D D     
Sbjct  3    GKKQML--ATLVGCNYAGTPDELRGCINDVLVMRDTLVARFGFAPRDITFLTDDDGGRGS  60

Query  170  --SYTQPTGRNIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSD  343
              S   PTG NI+ ALS++V  A  GD LF HYSGHGT +P         G+DE IVP D
Sbjct  61   SPSAVLPTGTNIKRALSEMVARAAPGDVLFFHYSGHGTLVP----RRHGHGYDEAIVPCD  116

Query  344  FNLITDDDFRELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDNA  493
            FNLITD DFR+LVD +PQG   T+VSDSCHSGGLID+ KEQIG S  D A
Sbjct  117  FNLITDVDFRQLVDRVPQGATFTMVSDSCHSGGLIDQEKEQIGPSVADLA  166



>ref|XP_006664310.1| PREDICTED: metacaspase-9-like [Oryza brachyantha]
Length=356

 Score =   164 bits (414),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 90/160 (56%), Positives = 106/160 (66%), Gaps = 4/160 (3%)
 Frame = +2

Query  2    GGREMARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQ  181
            GG++  + A L+G NY GT  ELKGC+NDV  M   LV R+GF+  D+ VL D   S   
Sbjct  4    GGKK--KLATLVGCNYAGTPNELKGCINDVVAMRDILVARFGFAPGDVAVLTDDRGSPVL  61

Query  182  PTGRNIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITD  361
            PTG NI+ AL+D+V  A +GD LF HYSGHGT +P    +    G DE IVP DFNLITD
Sbjct  62   PTGANIKRALADMVARAAAGDVLFFHYSGHGTLVPP--VKGHHGGCDEAIVPCDFNLITD  119

Query  362  DDFRELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGEST  481
             DFR LVD +P G   T+VSDSCHSGGLID  KEQIG S 
Sbjct  120  VDFRRLVDLVPHGASFTMVSDSCHSGGLIDLEKEQIGPSV  159



>ref|XP_010232359.1| PREDICTED: metacaspase-9 [Brachypodium distachyon]
Length=351

 Score =   163 bits (413),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 90/166 (54%), Positives = 107/166 (64%), Gaps = 11/166 (7%)
 Frame = +2

Query  8    REMARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQ--  181
            + + R A L+G NY GT +EL+GC+NDVR     LV R+GF+  DI VL D D S +   
Sbjct  8    KTVKRLATLVGCNYAGTHSELRGCINDVRAARDTLVSRFGFAPGDIAVLTDEDRSESGHH  67

Query  182  -----PTGRNIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAe----tgeeddtgfdeCIV  334
                 PTG NI+ AL+D+V  A  GD LF HYSGHGT +P       G E+    +E IV
Sbjct  68   RTLLLPTGANIKRALADMVARASPGDVLFFHYSGHGTLVPPRPGHGHGHEESEKDEEAIV  127

Query  335  PSDFNLITDDDFRELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIG  472
            P DFNLIT  D R +VD LPQG RLT+VSDSCHSGGLID  KEQIG
Sbjct  128  PCDFNLITGADLRRVVDMLPQGSRLTVVSDSCHSGGLIDMEKEQIG  173



>gb|KJB67854.1| hypothetical protein B456_010G215000 [Gossypium raimondii]
Length=319

 Score =   162 bits (411),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 88/165 (53%), Positives = 108/165 (65%), Gaps = 10/165 (6%)
 Frame = +2

Query  20   RKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQ------  181
            R AVL+G NYP T+ EL GC+NDV  M   LV R+GF   +I +L D  A+  +      
Sbjct  7    RLAVLVGCNYPNTQYELHGCINDVVAMKDVLVKRFGFDPTNIELLTDASAATGEGPSLMV  66

Query  182  -PTGRNIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLIT  358
             PTG NI++ALS +V  A +GD L+ HYSG GTR+P         G DE IVP DFNLIT
Sbjct  67   LPTGENIKAALSKMVSQAEAGDVLYFHYSGPGTRIP---KPAHLFGHDEAIVPCDFNLIT  123

Query  359  DDDFRELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDNA  493
            D DFR+L++ L +G   TI+SDSCHSGGLIDK KEQIG ST+  A
Sbjct  124  DVDFRQLINQLTKGASFTILSDSCHSGGLIDKEKEQIGPSTYRAA  168



>ref|XP_002454039.1| hypothetical protein SORBIDRAFT_04g023560 [Sorghum bicolor]
 gb|EES07015.1| hypothetical protein SORBIDRAFT_04g023560 [Sorghum bicolor]
Length=318

 Score =   162 bits (411),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 91/174 (52%), Positives = 112/174 (64%), Gaps = 9/174 (5%)
 Frame = +2

Query  5    GREMARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTD--ASYT  178
            G++    A L+G NY GT+ EL+GC+NDV  +   L+DR+GF+  D+TVL D    A   
Sbjct  4    GKKKKMLATLVGCNYAGTENELRGCINDVHAIRAVLLDRFGFAPGDVTVLTDEPGAAGGV  63

Query  179  QPTGRNIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfd---eCIVPSDFN  349
             PTG  +R AL+D+V  A  GD LF H+SGHGT +P         G D   E IVP DFN
Sbjct  64   LPTGAGVRRALADMVARAAPGDVLFFHFSGHGTLVPPVVSAAGYGGRDDDDEAIVPCDFN  123

Query  350  LITDDDFRELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGESTHDNADADDAD  511
            LITD DFRELVD +P+G   T+VSDSCHSGGLID+ KEQIG     +ADA D D
Sbjct  124  LITDVDFRELVDRVPRGATFTMVSDSCHSGGLIDQEKEQIGP----DADAADRD  173



>ref|XP_007205546.1| hypothetical protein PRUPE_ppa008597mg [Prunus persica]
 gb|EMJ06745.1| hypothetical protein PRUPE_ppa008597mg [Prunus persica]
Length=326

 Score =   162 bits (410),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 85/157 (54%), Positives = 103/157 (66%), Gaps = 5/157 (3%)
 Frame = +2

Query  20   RKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASY----TQPT  187
            R AVL+G NYP T+ EL GC+NDV  M   LV+R+GF   +I +L D  A+       PT
Sbjct  8    RLAVLVGCNYPNTRNELHGCINDVVAMRGTLVNRFGFDPGNIQLLTDAAAAGSSSSVMPT  67

Query  188  GRNIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSDFNLITDDD  367
            G NI+ AL  +V  A  GD L+ HYSGHGTR+P+          +  IVP DFNLITD D
Sbjct  68   GANIKKALGAMVDQAKPGDVLYFHYSGHGTRIPSLKPGNPFRQDE-AIVPCDFNLITDVD  126

Query  368  FRELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGES  478
            FR+LV+ LP+G   TI+SDSCHSGGLIDK KEQIG S
Sbjct  127  FRQLVNRLPKGASFTILSDSCHSGGLIDKEKEQIGPS  163



>ref|XP_009364872.1| PREDICTED: metacaspase-9 [Pyrus x bretschneideri]
Length=326

 Score =   162 bits (409),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 87/165 (53%), Positives = 104/165 (63%), Gaps = 10/165 (6%)
 Frame = +2

Query  11   EMARKAVLIGINYPGTKAELKGCVNDVRRMHRCLVDRYGFSEDDITVLIDTDASYTQ---  181
            E  R AVL+G NYP T+ EL GC+NDV  M   LV R+GF   DI +L D  A+      
Sbjct  5    ERKRLAVLVGCNYPNTRNELHGCINDVLTMRDTLVSRFGFDPSDIQLLTDAAAAADAGSG  64

Query  182  ------PTGRNIRSALSDLVKSAGSGDYLFVHYSGHGTRLPAetgeeddtgfdeCIVPSD  343
                  PTG NI+ AL ++V  A  GD L+ HYSGHGTR+P+          +  IVP D
Sbjct  65   GSSSVLPTGANIKKALGEMVDQAKPGDVLYFHYSGHGTRIPSLKPGNPFRQDE-AIVPCD  123

Query  344  FNLITDDDFRELVDSLPQGCRLTIVSDSCHSGGLIDKAKEQIGES  478
            FNLITD DFR+LV+ LP+G   TI+SDSCHSGGLIDK KEQIG S
Sbjct  124  FNLITDVDFRQLVNRLPKGASFTIISDSCHSGGLIDKEKEQIGPS  168



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 557408213115