BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002E04

Length=387
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009603227.1|  PREDICTED: transcription factor bHLH35-like ...  99.8    1e-22   Nicotiana tomentosiformis
ref|XP_009603228.1|  PREDICTED: transcription factor bHLH35-like ...  99.8    1e-22   Nicotiana tomentosiformis
ref|XP_009760781.1|  PREDICTED: transcription factor bHLH35-like ...  99.4    1e-22   Nicotiana sylvestris
ref|XP_009760780.1|  PREDICTED: transcription factor bHLH35-like ...  99.4    2e-22   Nicotiana sylvestris
ref|XP_004242918.1|  PREDICTED: transcription factor bHLH35           98.2    4e-22   Solanum lycopersicum
ref|XP_006344525.1|  PREDICTED: transcription factor bHLH35-like      98.2    5e-22   Solanum tuberosum [potatoes]
emb|CDP12676.1|  unnamed protein product                              96.7    2e-21   Coffea canephora [robusta coffee]
ref|XP_006586714.1|  PREDICTED: uncharacterized protein LOC100817...  95.9    2e-21   
ref|NP_001239951.1|  uncharacterized protein LOC100817978             96.3    2e-21   Glycine max [soybeans]
ref|XP_002263999.1|  PREDICTED: transcription factor bHLH35           96.3    2e-21   Vitis vinifera
ref|XP_011094110.1|  PREDICTED: transcription factor bHLH35           96.3    2e-21   Sesamum indicum [beniseed]
ref|XP_007223913.1|  hypothetical protein PRUPE_ppa010972mg           95.9    2e-21   
emb|CDP20243.1|  unnamed protein product                              95.9    3e-21   Coffea canephora [robusta coffee]
emb|CAN78766.1|  hypothetical protein VITISV_044397                   98.6    6e-21   Vitis vinifera
ref|XP_010048565.1|  PREDICTED: transcription factor bHLH35 isofo...  94.4    8e-21   Eucalyptus grandis [rose gum]
ref|XP_004296498.1|  PREDICTED: transcription factor bHLH35           94.4    8e-21   Fragaria vesca subsp. vesca
ref|XP_010048564.1|  PREDICTED: transcription factor bHLH35 isofo...  94.4    1e-20   Eucalyptus grandis [rose gum]
ref|XP_008223870.1|  PREDICTED: transcription factor bHLH35           94.0    1e-20   Prunus mume [ume]
ref|XP_011094113.1|  PREDICTED: transcription factor bHLH35-like ...  94.0    2e-20   Sesamum indicum [beniseed]
ref|XP_007014435.1|  Basic helix-loop-helix DNA-binding superfami...  94.0    2e-20   
ref|XP_008388700.1|  PREDICTED: transcription factor bHLH35           93.2    3e-20   Malus domestica [apple tree]
ref|XP_011094111.1|  PREDICTED: transcription factor bHLH35-like ...  93.6    3e-20   Sesamum indicum [beniseed]
gb|EYU18210.1|  hypothetical protein MIMGU_mgv1a022464mg              92.8    3e-20   Erythranthe guttata [common monkey flower]
ref|XP_007014436.1|  Basic helix-loop-helix DNA-binding superfami...  93.2    3e-20   
ref|XP_004487998.1|  PREDICTED: transcription factor bHLH35-like      92.8    4e-20   Cicer arietinum [garbanzo]
ref|XP_009348093.1|  PREDICTED: transcription factor bHLH35-like      92.4    5e-20   Pyrus x bretschneideri [bai li]
ref|XP_008358594.1|  PREDICTED: transcription factor bHLH35-like      92.4    5e-20   
ref|XP_010108742.1|  hypothetical protein L484_002994                 92.0    6e-20   
ref|XP_007138769.1|  hypothetical protein PHAVU_009G235700g           91.3    1e-19   Phaseolus vulgaris [French bean]
ref|XP_003595077.1|  Transcription factor bHLH                        90.1    4e-19   Medicago truncatula
ref|XP_010273597.1|  PREDICTED: transcription factor bHLH35           89.7    5e-19   Nelumbo nucifera [Indian lotus]
ref|XP_002518255.1|  DNA binding protein, putative                    89.4    5e-19   
ref|XP_011020045.1|  PREDICTED: transcription factor bHLH35-like ...  89.4    5e-19   Populus euphratica
ref|XP_011020046.1|  PREDICTED: transcription factor bHLH35-like ...  89.4    8e-19   Populus euphratica
gb|KDP42524.1|  hypothetical protein JCGZ_02482                       89.0    9e-19   Jatropha curcas
emb|CDP19017.1|  unnamed protein product                              88.6    1e-18   Coffea canephora [robusta coffee]
ref|XP_009359948.1|  PREDICTED: transcription factor bHLH35           88.2    1e-18   Pyrus x bretschneideri [bai li]
ref|XP_003546437.1|  PREDICTED: transcription factor bHLH35-like      88.2    2e-18   Glycine max [soybeans]
ref|XP_006381154.1|  hypothetical protein POPTR_0006s07440g           87.4    3e-18   
ref|XP_007154705.1|  hypothetical protein PHAVU_003G1408001g          86.3    6e-18   Phaseolus vulgaris [French bean]
ref|XP_004146337.1|  PREDICTED: transcription factor bHLH35-like      86.3    1e-17   Cucumis sativus [cucumbers]
gb|KHG05269.1|  Transcription factor bHLH35 -like protein             86.3    1e-17   Gossypium arboreum [tree cotton]
gb|KDO61950.1|  hypothetical protein CISIN_1g025665mg                 85.9    1e-17   Citrus sinensis [apfelsine]
ref|XP_006453236.1|  hypothetical protein CICLE_v100092852mg          85.9    1e-17   
gb|KJB83352.1|  hypothetical protein B456_013G242800                  85.5    2e-17   Gossypium raimondii
gb|KHN17635.1|  Transcription factor bHLH35                           85.5    2e-17   Glycine soja [wild soybean]
ref|XP_006453237.1|  hypothetical protein CICLE_v100092852mg          84.7    3e-17   Citrus clementina [clementine]
ref|XP_002325261.2|  hypothetical protein POPTR_0018s13860g           84.7    4e-17   Populus trichocarpa [western balsam poplar]
ref|XP_011017674.1|  PREDICTED: transcription factor bHLH35-like      84.3    4e-17   Populus euphratica
ref|XP_008453552.1|  PREDICTED: transcription factor bHLH35           82.8    2e-16   Cucumis melo [Oriental melon]
ref|XP_010667303.1|  PREDICTED: transcription factor bHLH35           82.4    2e-16   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_974948.1|  transcription factor bHLH35                         81.6    4e-16   Arabidopsis thaliana [mouse-ear cress]
gb|EYU43807.1|  hypothetical protein MIMGU_mgv1a015530mg              80.5    4e-16   Erythranthe guttata [common monkey flower]
ref|NP_974947.1|  transcription factor bHLH35                         81.3    5e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006593510.1|  PREDICTED: transcription factor bHLH35-like      80.9    7e-16   Glycine max [soybeans]
ref|XP_010483214.1|  PREDICTED: transcription factor bHLH35-like ...  80.9    7e-16   
ref|XP_010483213.1|  PREDICTED: transcription factor bHLH35-like ...  80.9    8e-16   
ref|XP_010443388.1|  PREDICTED: transcription factor bHLH35-like      80.9    8e-16   Camelina sativa [gold-of-pleasure]
ref|XP_010451830.1|  PREDICTED: transcription factor bHLH35           80.9    8e-16   
gb|AAM63723.1|  unknown                                               80.5    9e-16   Arabidopsis thaliana [mouse-ear cress]
ref|NP_568850.1|  transcription factor bHLH35                         80.5    1e-15   Arabidopsis thaliana [mouse-ear cress]
gb|KFK27270.1|  hypothetical protein AALP_AA8G360300                  80.5    1e-15   Arabis alpina [alpine rockcress]
sp|Q2HIV9.1|BH035_ARATH  RecName: Full=Transcription factor bHLH3...  80.5    1e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002864502.1|  basic helix-loop-helix family protein            80.5    1e-15   Arabidopsis lyrata subsp. lyrata
gb|KHN22657.1|  Transcription factor bHLH35                           79.7    2e-15   Glycine soja [wild soybean]
ref|XP_010548650.1|  PREDICTED: transcription factor bHLH27-like ...  78.6    3e-15   
ref|XP_010548649.1|  PREDICTED: transcription factor bHLH27-like ...  79.3    3e-15   Tarenaya hassleriana [spider flower]
ref|NP_001190556.1|  transcription factor bHLH35                      79.0    4e-15   Arabidopsis thaliana [mouse-ear cress]
emb|CDY52738.1|  BnaC09g53380D                                        77.8    4e-15   Brassica napus [oilseed rape]
ref|XP_006281955.1|  hypothetical protein CARUB_v10028169mg           77.8    4e-15   
ref|XP_011077906.1|  PREDICTED: transcription factor bHLH35-like      78.2    6e-15   Sesamum indicum [beniseed]
emb|CDX88610.1|  BnaA03g10390D                                        77.8    1e-14   
ref|XP_009132143.1|  PREDICTED: transcription factor bHLH35-like      77.4    1e-14   Brassica rapa
emb|CDY11882.1|  BnaC03g13080D                                        75.9    4e-14   Brassica napus [oilseed rape]
ref|XP_009380730.1|  PREDICTED: transcription factor bHLH35-like      75.5    5e-14   Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU38740.1|  hypothetical protein MIMGU_mgv1a022559mg              75.1    8e-14   Erythranthe guttata [common monkey flower]
ref|XP_010536889.1|  PREDICTED: transcription factor bHLH35 isofo...  73.9    2e-13   Tarenaya hassleriana [spider flower]
ref|XP_010536890.1|  PREDICTED: transcription factor bHLH35 isofo...  73.9    2e-13   Tarenaya hassleriana [spider flower]
emb|CDY47924.1|  BnaA02g08320D                                        73.9    2e-13   Brassica napus [oilseed rape]
ref|XP_010536888.1|  PREDICTED: transcription factor bHLH35 isofo...  73.9    2e-13   Tarenaya hassleriana [spider flower]
ref|XP_006341751.1|  PREDICTED: transcription factor bHLH35-like      73.2    3e-13   Solanum tuberosum [potatoes]
ref|XP_009126855.1|  PREDICTED: transcription factor bHLH35-like      72.8    5e-13   Brassica rapa
dbj|BAJ34262.1|  unnamed protein product                              72.0    6e-13   Eutrema halophilum
ref|XP_010929341.1|  PREDICTED: transcription factor bHLH35 isofo...  72.4    6e-13   Elaeis guineensis
ref|XP_009120236.1|  PREDICTED: transcription factor bHLH35           72.4    6e-13   Brassica rapa
gb|KJB53716.1|  hypothetical protein B456_009G002200                  72.4    6e-13   Gossypium raimondii
ref|XP_006401237.1|  hypothetical protein EUTSA_v10014506mg           72.4    7e-13   Eutrema salsugineum [saltwater cress]
ref|XP_010929340.1|  PREDICTED: transcription factor bHLH35 isofo...  72.4    9e-13   Elaeis guineensis
emb|CDY42237.1|  BnaC02g11780D                                        72.0    1e-12   Brassica napus [oilseed rape]
ref|XP_008811438.1|  PREDICTED: transcription factor bHLH35           72.0    1e-12   Phoenix dactylifera
ref|XP_009409750.1|  PREDICTED: transcription factor bHLH35           71.6    2e-12   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010046925.1|  PREDICTED: transcription factor bHLH35 isofo...  71.2    2e-12   Eucalyptus grandis [rose gum]
gb|KJB53715.1|  hypothetical protein B456_009G002200                  71.2    2e-12   Gossypium raimondii
ref|XP_010046924.1|  PREDICTED: transcription factor bHLH35 isofo...  71.2    2e-12   Eucalyptus grandis [rose gum]
ref|NP_001291248.1|  transcription factor bHLH35-like                 69.3    8e-12   Populus euphratica
ref|XP_002308108.2|  hypothetical protein POPTR_0006s07430g           69.3    1e-11   
ref|XP_010539408.1|  PREDICTED: transcription factor bHLH35-like      68.6    1e-11   Tarenaya hassleriana [spider flower]
ref|XP_009407095.1|  PREDICTED: transcription factor bHLH35-like      67.4    4e-11   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002309008.1|  hypothetical protein POPTR_0006s07410g           67.8    4e-11   
ref|XP_008451133.1|  PREDICTED: transcription factor bHLH35-like ...  66.6    7e-11   Cucumis melo [Oriental melon]
ref|XP_008451126.1|  PREDICTED: transcription factor bHLH35-like ...  66.6    8e-11   Cucumis melo [Oriental melon]
ref|XP_008451140.1|  PREDICTED: transcription factor bHLH35-like ...  66.6    8e-11   Cucumis melo [Oriental melon]
ref|XP_011020047.1|  PREDICTED: transcription factor bHLH35-like ...  66.2    1e-10   Populus euphratica
ref|XP_011020048.1|  PREDICTED: transcription factor bHLH35-like ...  65.9    1e-10   Populus euphratica
emb|CDY03557.1|  BnaC03g68160D                                        64.7    2e-10   
gb|KFK34607.1|  hypothetical protein AALP_AA5G167500                  65.9    2e-10   Arabis alpina [alpine rockcress]
ref|XP_006372182.1|  hypothetical protein POPTR_0018s13830g           65.5    2e-10   
gb|ABK92754.1|  unknown                                               64.7    2e-10   Populus trichocarpa [western balsam poplar]
ref|XP_006372183.1|  hypothetical protein POPTR_0018s13840g           64.3    4e-10   Populus trichocarpa [western balsam poplar]
ref|XP_002324689.2|  hypothetical protein POPTR_0018s13840g           64.7    4e-10   Populus trichocarpa [western balsam poplar]
ref|XP_002324688.1|  hypothetical protein POPTR_0018s13830g           64.3    5e-10   Populus trichocarpa [western balsam poplar]
ref|XP_006412786.1|  hypothetical protein EUTSA_v10027332mg           64.3    6e-10   
emb|CDY30182.1|  BnaA03g49880D                                        63.9    7e-10   Brassica napus [oilseed rape]
ref|XP_008799483.1|  PREDICTED: transcription factor bHLH35-like      63.5    8e-10   Phoenix dactylifera
ref|XP_009137878.1|  PREDICTED: transcription factor bHLH27           63.9    8e-10   Brassica rapa
ref|XP_002308107.2|  hypothetical protein POPTR_0006s07420g           63.5    9e-10   Populus trichocarpa [western balsam poplar]
ref|XP_010927251.1|  PREDICTED: transcription factor bHLH35-like      63.5    1e-09   Elaeis guineensis
ref|XP_004149508.1|  PREDICTED: transcription factor bHLH35-like      62.4    1e-09   
ref|XP_011020357.1|  PREDICTED: transcription factor bHLH35-like      62.4    1e-09   Populus euphratica
emb|CDY46719.1|  BnaC07g42240D                                        63.2    2e-09   Brassica napus [oilseed rape]
ref|XP_010438241.1|  PREDICTED: transcription factor bHLH27           63.2    2e-09   Camelina sativa [gold-of-pleasure]
ref|XP_004169968.1|  PREDICTED: transcription factor bHLH35-like      62.0    2e-09   
ref|XP_010447790.1|  PREDICTED: transcription factor bHLH27-like      63.2    2e-09   Camelina sativa [gold-of-pleasure]
gb|KHN07348.1|  Transcription factor bHLH35                           61.6    2e-09   Glycine soja [wild soybean]
ref|XP_011017676.1|  PREDICTED: transcription factor bHLH35-like      62.4    2e-09   Populus euphratica
ref|XP_009128266.1|  PREDICTED: transcription factor bHLH27-like ...  62.8    3e-09   Brassica rapa
ref|XP_006285089.1|  hypothetical protein CARUB_v10006422mg           62.4    3e-09   Capsella rubella
ref|XP_009128255.1|  PREDICTED: transcription factor bHLH27-like ...  62.4    3e-09   Brassica rapa
emb|CDX68608.1|  BnaC01g08450D                                        62.4    3e-09   
ref|NP_001078471.1|  transcription factor bHLH27                      62.4    3e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003579501.1|  PREDICTED: transcription factor bHLH35-like      62.4    4e-09   Brachypodium distachyon [annual false brome]
emb|CAB43668.1|  putative protein                                     62.4    4e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011017678.1|  PREDICTED: transcription factor bHLH35-like ...  61.2    4e-09   Populus euphratica
ref|XP_011017677.1|  PREDICTED: transcription factor bHLH35-like ...  61.6    5e-09   Populus euphratica
ref|XP_002869405.1|  basic helix-loop-helix family protein            61.6    5e-09   
ref|XP_008781924.1|  PREDICTED: uncharacterized protein LOC103701581  63.2    6e-09   
ref|NP_001031752.1|  transcription factor bHLH27                      61.2    6e-09   Arabidopsis thaliana [mouse-ear cress]
ref|NP_194722.2|  transcription factor bHLH27                         60.8    9e-09   Arabidopsis thaliana [mouse-ear cress]
emb|CAE04678.3|  OSJNBb0018A10.7                                      61.6    2e-08   Oryza sativa Japonica Group [Japonica rice]
gb|EMS52912.1|  hypothetical protein TRIUR3_34636                     58.5    3e-08   Triticum urartu
ref|XP_010541107.1|  PREDICTED: transcription factor bHLH27 isofo...  58.9    5e-08   Tarenaya hassleriana [spider flower]
emb|CAH66073.1|  H0215E01.1                                           59.7    5e-08   Oryza sativa [red rice]
ref|NP_001052406.1|  Os04g0301500                                     59.7    5e-08   
ref|XP_004975235.1|  PREDICTED: transcription factor bHLH35-like ...  58.2    8e-08   
ref|XP_010928971.1|  PREDICTED: transcription factor bHLH35-like      58.5    1e-07   
ref|XP_004975234.1|  PREDICTED: transcription factor bHLH35-like ...  58.2    1e-07   Setaria italica
gb|EMT28703.1|  hypothetical protein F775_52582                       58.2    1e-07   
dbj|BAC66785.1|  Transcription Factor                                 57.4    3e-07   Oryza sativa [red rice]
gb|ACU17597.1|  unknown                                               55.5    7e-07   Glycine max [soybeans]
ref|XP_010913730.1|  PREDICTED: transcription factor bHLH35-like ...  55.1    1e-06   Elaeis guineensis
ref|XP_010913729.1|  PREDICTED: transcription factor bHLH35-like ...  55.1    1e-06   Elaeis guineensis
gb|AFW57967.1|  putative HLH DNA-binding domain superfamily protein   55.8    1e-06   
gb|EPS72893.1|  hypothetical protein M569_01864                       53.5    2e-06   Genlisea aurea
gb|ACN33600.1|  unknown                                               54.7    2e-06   Zea mays [maize]
ref|NP_001147498.1|  DNA binding like                                 54.7    2e-06   Zea mays [maize]
ref|XP_004239187.1|  PREDICTED: transcription factor bHLH35 isofo...  53.9    3e-06   Solanum lycopersicum
gb|EMT26156.1|  Transcription factor bHLH35                           51.2    7e-06   
ref|XP_006653253.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...  53.1    7e-06   
ref|XP_008661887.1|  PREDICTED: DNA binding like isoform X1           53.1    9e-06   
gb|EEE60703.1|  hypothetical protein OsJ_14194                        52.8    1e-05   Oryza sativa Japonica Group [Japonica rice]
gb|AFW57244.1|  putative HLH DNA-binding domain superfamily protein   52.4    1e-05   
gb|AIB05458.1|  bHLH transcription factor                             52.4    1e-05   Zea mays [maize]
ref|NP_001151185.1|  DNA binding like                                 52.4    1e-05   
gb|EEC76984.1|  hypothetical protein OsI_15289                        52.4    1e-05   Oryza sativa Indica Group [Indian rice]
ref|NP_001173851.1|  Os04g0300600                                     52.4    1e-05   
ref|XP_004975237.1|  PREDICTED: transcription factor bHLH35-like ...  52.0    2e-05   
ref|XP_006845790.1|  hypothetical protein AMTR_s00019p00254380        52.0    2e-05   
ref|XP_004975236.1|  PREDICTED: transcription factor bHLH35-like ...  52.0    2e-05   Setaria italica
gb|EMT26157.1|  Transcription factor bHLH35                           52.0    2e-05   
ref|XP_002445107.1|  hypothetical protein SORBIDRAFT_07g004190        50.4    7e-05   Sorghum bicolor [broomcorn]
ref|XP_009418561.1|  PREDICTED: transcription factor bHLH35-like ...  50.1    8e-05   
ref|XP_009418559.1|  PREDICTED: transcription factor bHLH35-like ...  50.1    1e-04   
ref|XP_009418562.1|  PREDICTED: transcription factor bHLH35-like ...  49.7    1e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002452037.1|  hypothetical protein SORBIDRAFT_04g017390        49.7    1e-04   Sorghum bicolor [broomcorn]
ref|XP_010667302.1|  PREDICTED: transcription factor bHLH35-like      49.3    1e-04   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004952451.1|  PREDICTED: transcription factor bHLH35-like ...  49.3    2e-04   
gb|EMS52276.1|  hypothetical protein TRIUR3_12196                     47.4    4e-04   Triticum urartu
ref|XP_009418560.1|  PREDICTED: transcription factor bHLH35-like ...  47.0    9e-04   



>ref|XP_009603227.1| PREDICTED: transcription factor bHLH35-like isoform X1 [Nicotiana 
tomentosiformis]
Length=251

 Score = 99.8 bits (247),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/53 (89%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG+KTVVVSLTCSKRTDTM+K+CEIFESL+IKIISANITAFSGRLLKT FIE 
Sbjct  171  MGEKTVVVSLTCSKRTDTMVKVCEIFESLNIKIISANITAFSGRLLKTAFIEA  223



>ref|XP_009603228.1| PREDICTED: transcription factor bHLH35-like isoform X2 [Nicotiana 
tomentosiformis]
Length=250

 Score = 99.8 bits (247),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/53 (89%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG+KTVVVSLTCSKRTDTM+K+CEIFESL+IKIISANITAFSGRLLKT FIE 
Sbjct  170  MGEKTVVVSLTCSKRTDTMVKVCEIFESLNIKIISANITAFSGRLLKTAFIEA  222



>ref|XP_009760781.1| PREDICTED: transcription factor bHLH35-like isoform X2 [Nicotiana 
sylvestris]
Length=250

 Score = 99.4 bits (246),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/53 (89%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG+KTVVVSLTCSKRTDTM+K+CEIFESL+IKIISANITAFSGRLLKT FIE 
Sbjct  170  MGEKTVVVSLTCSKRTDTMVKVCEIFESLNIKIISANITAFSGRLLKTAFIEA  222



>ref|XP_009760780.1| PREDICTED: transcription factor bHLH35-like isoform X1 [Nicotiana 
sylvestris]
Length=251

 Score = 99.4 bits (246),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/53 (89%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG+KTVVVSLTCSKRTDTM+K+CEIFESL+IKIISANITAFSGRLLKT FIE 
Sbjct  171  MGEKTVVVSLTCSKRTDTMVKVCEIFESLNIKIISANITAFSGRLLKTAFIEA  223



>ref|XP_004242918.1| PREDICTED: transcription factor bHLH35 [Solanum lycopersicum]
Length=253

 Score = 98.2 bits (243),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 46/53 (87%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG+KTVVVSLTCSKRTDTM+K+CE+FESL+IKIISANITAFSGRLLKT FIE 
Sbjct  173  MGEKTVVVSLTCSKRTDTMVKVCEVFESLNIKIISANITAFSGRLLKTAFIEA  225



>ref|XP_006344525.1| PREDICTED: transcription factor bHLH35-like [Solanum tuberosum]
Length=252

 Score = 98.2 bits (243),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 46/53 (87%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG+KTVVVSLTCSKRTDTM+K+CE+FESL+IKIISANITAFSGRLLKT FIE 
Sbjct  172  MGEKTVVVSLTCSKRTDTMVKVCEVFESLNIKIISANITAFSGRLLKTAFIEA  224



>emb|CDP12676.1| unnamed protein product [Coffea canephora]
Length=261

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG+KT+VVSLTCSKRTDTM+K+CE+FESL++KII+ANITAFSGRLLKTVF+EV
Sbjct  149  MGEKTIVVSLTCSKRTDTMVKICEVFESLNLKIITANITAFSGRLLKTVFLEV  201



>ref|XP_006586714.1| PREDICTED: uncharacterized protein LOC100817978 isoform X1 [Glycine 
max]
Length=217

 Score = 95.9 bits (237),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIE  158
            MG+KTVVVSLTCSKRTDTM+KLCE+FESL +KII+ANIT+FSGRLLKTVFIE
Sbjct  163  MGEKTVVVSLTCSKRTDTMVKLCEVFESLKLKIITANITSFSGRLLKTVFIE  214



>ref|NP_001239951.1| uncharacterized protein LOC100817978 [Glycine max]
 gb|ACU20892.1| unknown [Glycine max]
 gb|KHN35816.1| Transcription factor bHLH35 [Glycine soja]
Length=244

 Score = 96.3 bits (238),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/53 (85%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG+KTVVVSLTCSKRTDTM+KLCE+FESL +KII+ANIT+FSGRLLKTVFIE 
Sbjct  163  MGEKTVVVSLTCSKRTDTMVKLCEVFESLKLKIITANITSFSGRLLKTVFIEA  215



>ref|XP_002263999.1| PREDICTED: transcription factor bHLH35 [Vitis vinifera]
 emb|CBI17910.3| unnamed protein product [Vitis vinifera]
Length=244

 Score = 96.3 bits (238),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/53 (85%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG+KTVVVSLTCSKRTDTM+KLCE+FESL +KII+ANITAFSGRLLKTVF+E 
Sbjct  164  MGEKTVVVSLTCSKRTDTMVKLCEVFESLKLKIITANITAFSGRLLKTVFVEA  216



>ref|XP_011094110.1| PREDICTED: transcription factor bHLH35 [Sesamum indicum]
Length=240

 Score = 96.3 bits (238),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG+KT+VVSLTCSKRTDTM+KLCEIFESL +K+I+ANITAFSGRLLKTVF+E 
Sbjct  160  MGEKTIVVSLTCSKRTDTMVKLCEIFESLKLKVITANITAFSGRLLKTVFLEA  212



>ref|XP_007223913.1| hypothetical protein PRUPE_ppa010972mg [Prunus persica]
 gb|EMJ25112.1| hypothetical protein PRUPE_ppa010972mg [Prunus persica]
Length=228

 Score = 95.9 bits (237),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEVV  164
            MG+KTVV SLTCSKRTDTM+KLCE+FESL +KII+ANITAFSGR+LKTVFIEV+
Sbjct  162  MGEKTVVASLTCSKRTDTMVKLCEVFESLKLKIITANITAFSGRVLKTVFIEVI  215



>emb|CDP20243.1| unnamed protein product [Coffea canephora]
Length=235

 Score = 95.9 bits (237),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG+KT+VVSLTCSKRTDTM+K+CE+FESL++KII+ANITAFSGRLLKTVF+E 
Sbjct  155  MGEKTIVVSLTCSKRTDTMVKICEVFESLNLKIITANITAFSGRLLKTVFLEA  207



>emb|CAN78766.1| hypothetical protein VITISV_044397 [Vitis vinifera]
Length=805

 Score = 98.6 bits (244),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 45/53 (85%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG+KTVVVSLTCSKRTDTM+KLCE+FESL +KII+ANITAFSGRLLKTVF+E+
Sbjct  164  MGEKTVVVSLTCSKRTDTMVKLCEVFESLKLKIITANITAFSGRLLKTVFVEI  216



>ref|XP_010048565.1| PREDICTED: transcription factor bHLH35 isoform X2 [Eucalyptus 
grandis]
 gb|KCW80843.1| hypothetical protein EUGRSUZ_C02208 [Eucalyptus grandis]
Length=242

 Score = 94.4 bits (233),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG+KT+VVSLTCSKRTDTM+KLCE+FESL +KII+ANIT+FSGRLLKTVFIE 
Sbjct  162  MGEKTLVVSLTCSKRTDTMVKLCEVFESLKLKIITANITSFSGRLLKTVFIEA  214



>ref|XP_004296498.1| PREDICTED: transcription factor bHLH35 [Fragaria vesca subsp. 
vesca]
Length=244

 Score = 94.4 bits (233),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG+KTVVVSLTCSKRTDTM+KLCE+FESL +KII+ANITAF+GR+LKTVFIE 
Sbjct  164  MGEKTVVVSLTCSKRTDTMVKLCEVFESLKLKIITANITAFAGRVLKTVFIEA  216



>ref|XP_010048564.1| PREDICTED: transcription factor bHLH35 isoform X1 [Eucalyptus 
grandis]
 gb|KCW80844.1| hypothetical protein EUGRSUZ_C02208 [Eucalyptus grandis]
Length=251

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG+KT+VVSLTCSKRTDTM+KLCE+FESL +KII+ANIT+FSGRLLKTVFIE 
Sbjct  171  MGEKTLVVSLTCSKRTDTMVKLCEVFESLKLKIITANITSFSGRLLKTVFIEA  223



>ref|XP_008223870.1| PREDICTED: transcription factor bHLH35 [Prunus mume]
Length=242

 Score = 94.0 bits (232),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG+KTVV SLTCSKRTDTM+KLCE+FESL +KII+ANITAFSGR+LKTVFIE 
Sbjct  162  MGEKTVVASLTCSKRTDTMVKLCEVFESLKLKIITANITAFSGRVLKTVFIEA  214



>ref|XP_011094113.1| PREDICTED: transcription factor bHLH35-like isoform X2 [Sesamum 
indicum]
Length=269

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG+KT+VVSLTCSKRTDTM+KLCEIFESL +K+I+ANITAFS RLLKTVF+E 
Sbjct  189  MGEKTIVVSLTCSKRTDTMVKLCEIFESLKLKVITANITAFSERLLKTVFLEA  241



>ref|XP_007014435.1| Basic helix-loop-helix DNA-binding superfamily protein isoform 
1 [Theobroma cacao]
 gb|EOY32054.1| Basic helix-loop-helix DNA-binding superfamily protein isoform 
1 [Theobroma cacao]
Length=317

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/53 (85%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG+KTVVVS+TCSKRTDTM+KLCE+FESL +KII+ANITA SGRLLKTVFIEV
Sbjct  167  MGEKTVVVSITCSKRTDTMVKLCEVFESLKLKIITANITAVSGRLLKTVFIEV  219



>ref|XP_008388700.1| PREDICTED: transcription factor bHLH35 [Malus domestica]
Length=244

 Score = 93.2 bits (230),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG+KT+VVSLTCSKRTDTM+KLCE+FESL +KII+ANITAFSGR+LKTVF+E 
Sbjct  164  MGEKTLVVSLTCSKRTDTMVKLCEVFESLKLKIITANITAFSGRVLKTVFVEA  216



>ref|XP_011094111.1| PREDICTED: transcription factor bHLH35-like isoform X1 [Sesamum 
indicum]
 ref|XP_011094112.1| PREDICTED: transcription factor bHLH35-like isoform X1 [Sesamum 
indicum]
Length=287

 Score = 93.6 bits (231),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG+KT+VVSLTCSKRTDTM+KLCEIFESL +K+I+ANITAFS RLLKTVF+E 
Sbjct  207  MGEKTIVVSLTCSKRTDTMVKLCEIFESLKLKVITANITAFSERLLKTVFLEA  259



>gb|EYU18210.1| hypothetical protein MIMGU_mgv1a022464mg [Erythranthe guttata]
Length=233

 Score = 92.8 bits (229),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG+KT+VVS+TCSKR DTM+KLCE+FES+++KII+ANITAFSGRLLKTVF+E 
Sbjct  153  MGEKTIVVSITCSKRRDTMVKLCEVFESMNLKIITANITAFSGRLLKTVFLEA  205



>ref|XP_007014436.1| Basic helix-loop-helix DNA-binding superfamily protein isoform 
2 [Theobroma cacao]
 gb|EOY32055.1| Basic helix-loop-helix DNA-binding superfamily protein isoform 
2 [Theobroma cacao]
Length=246

 Score = 93.2 bits (230),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG+KTVVVS+TCSKRTDTM+KLCE+FESL +KII+ANITA SGRLLKTVFIE 
Sbjct  166  MGEKTVVVSITCSKRTDTMVKLCEVFESLKLKIITANITAVSGRLLKTVFIEA  218



>ref|XP_004487998.1| PREDICTED: transcription factor bHLH35-like [Cicer arietinum]
Length=249

 Score = 92.8 bits (229),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG+ T+VVSLTCSKRTDTM+KLCE+FESL +KII+ANIT+FSGRLLKTVFIE 
Sbjct  169  MGENTIVVSLTCSKRTDTMVKLCEVFESLKLKIITANITSFSGRLLKTVFIEA  221



>ref|XP_009348093.1| PREDICTED: transcription factor bHLH35-like [Pyrus x bretschneideri]
Length=242

 Score = 92.4 bits (228),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG+KTVVVSLTCSKRTDTM+KLCE+FESL +KII+ANIT+F+GR+LKTVF+E 
Sbjct  162  MGEKTVVVSLTCSKRTDTMVKLCEVFESLKLKIITANITSFNGRVLKTVFVEA  214



>ref|XP_008358594.1| PREDICTED: transcription factor bHLH35-like [Malus domestica]
Length=242

 Score = 92.4 bits (228),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG+KTVVVSLTCSKRTDTM+KLCE+FESL +KII+ANIT+F+GR+LKTVF+E 
Sbjct  162  MGEKTVVVSLTCSKRTDTMVKLCEVFESLKLKIITANITSFNGRVLKTVFVEA  214



>ref|XP_010108742.1| hypothetical protein L484_002994 [Morus notabilis]
 gb|EXC20104.1| hypothetical protein L484_002994 [Morus notabilis]
Length=230

 Score = 92.0 bits (227),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG+KT+VVSLTCSKRTDTM+KLCE+FESL +KII+ANITAFSGRLLKTV IE 
Sbjct  152  MGEKTLVVSLTCSKRTDTMVKLCEVFESLKLKIITANITAFSGRLLKTVLIEA  204



>ref|XP_007138769.1| hypothetical protein PHAVU_009G235700g [Phaseolus vulgaris]
 gb|ESW10763.1| hypothetical protein PHAVU_009G235700g [Phaseolus vulgaris]
Length=244

 Score = 91.3 bits (225),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG+KT VVSLTCSKRTDTM+KLCE+FESL +KII+ANIT+FSG+L KTVFIE 
Sbjct  164  MGEKTAVVSLTCSKRTDTMVKLCEVFESLKLKIITANITSFSGKLQKTVFIEA  216



>ref|XP_003595077.1| Transcription factor bHLH [Medicago truncatula]
 gb|AES65328.1| transcription factor [Medicago truncatula]
Length=244

 Score = 90.1 bits (222),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG+ T+VVSLTC+KR DTM+KLCE+FESL +KII+ANIT+FSGRLLKTVFIE 
Sbjct  164  MGENTMVVSLTCNKRADTMVKLCEVFESLKLKIITANITSFSGRLLKTVFIEA  216



>ref|XP_010273597.1| PREDICTED: transcription factor bHLH35 [Nelumbo nucifera]
Length=252

 Score = 89.7 bits (221),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            +G +T+V+SLTCS++TDTM+KLCE+FESL +KIISANITAFSGRLLKTVF+E 
Sbjct  171  VGDRTLVISLTCSRKTDTMVKLCEVFESLKLKIISANITAFSGRLLKTVFVEA  223



>ref|XP_002518255.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF44141.1| DNA binding protein, putative [Ricinus communis]
Length=213

 Score = 89.4 bits (220),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIE  158
            MG+KT++VSLTCSKRTDTM+KLCE+FESL +KII+ANIT  SGRLLKTVFIE
Sbjct  148  MGEKTLLVSLTCSKRTDTMVKLCEVFESLKLKIITANITTVSGRLLKTVFIE  199



>ref|XP_011020045.1| PREDICTED: transcription factor bHLH35-like isoform X1 [Populus 
euphratica]
Length=227

 Score = 89.4 bits (220),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG+KT+VVSLTCSKRTDTM+KLCE+FESL +KII+ANIT  SGR+LKTVFIE 
Sbjct  147  MGEKTLVVSLTCSKRTDTMVKLCEVFESLRVKIITANITTISGRVLKTVFIEA  199



>ref|XP_011020046.1| PREDICTED: transcription factor bHLH35-like isoform X2 [Populus 
euphratica]
Length=248

 Score = 89.4 bits (220),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG+KT+VVSLTCSKRTDTM+KLCE+FESL +KII+ANIT  SGR+LKTVFIE 
Sbjct  168  MGEKTLVVSLTCSKRTDTMVKLCEVFESLRVKIITANITTISGRVLKTVFIEA  220



>gb|KDP42524.1| hypothetical protein JCGZ_02482 [Jatropha curcas]
Length=253

 Score = 89.0 bits (219),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG+KT++VSLTCSKRTDTM+KLCE+FESL +KII+ANIT  SGRLLKTVFIE 
Sbjct  173  MGEKTLLVSLTCSKRTDTMVKLCEVFESLKLKIITANITTVSGRLLKTVFIEA  225



>emb|CDP19017.1| unnamed protein product [Coffea canephora]
Length=236

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            +G+KT+VVSL CSKRTDT++K+CE+FESL++KII+ANITAFSGRLL TVF+E 
Sbjct  156  IGQKTIVVSLACSKRTDTIVKICEVFESLNLKIITANITAFSGRLLNTVFLEA  208



>ref|XP_009359948.1| PREDICTED: transcription factor bHLH35 [Pyrus x bretschneideri]
Length=242

 Score = 88.2 bits (217),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG+KT+VVSLTCSKR DTM+KLCE+FESL +KII+ANITAFSGR+ KTVF+E 
Sbjct  162  MGEKTLVVSLTCSKRMDTMVKLCEVFESLKLKIITANITAFSGRVSKTVFVEA  214



>ref|XP_003546437.1| PREDICTED: transcription factor bHLH35-like [Glycine max]
 gb|KHN15341.1| Transcription factor bHLH35 [Glycine soja]
Length=243

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG+K VVVSLTCSKRTDTM+KLCE+FESL +KII+ANIT+FS RLLK VFIE 
Sbjct  163  MGEKIVVVSLTCSKRTDTMVKLCEVFESLKLKIITANITSFSDRLLKIVFIEA  215



>ref|XP_006381154.1| hypothetical protein POPTR_0006s07440g, partial [Populus trichocarpa]
 gb|ERP58951.1| hypothetical protein POPTR_0006s07440g, partial [Populus trichocarpa]
Length=217

 Score = 87.4 bits (215),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIE  158
            MG+KT++VSLTCSKRTDTM+KLCE+FESL +KII+ANIT  SGR+LKTVFIE
Sbjct  166  MGEKTLLVSLTCSKRTDTMVKLCEVFESLRVKIITANITTVSGRVLKTVFIE  217



>ref|XP_007154705.1| hypothetical protein PHAVU_003G1408001g, partial [Phaseolus vulgaris]
 gb|ESW26699.1| hypothetical protein PHAVU_003G1408001g, partial [Phaseolus vulgaris]
Length=211

 Score = 86.3 bits (212),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIE  158
            M +KT VVSLTCSKRTDTM+KLCE+FESL +K+I+ANIT+FSG LLKTVFIE
Sbjct  160  MREKTFVVSLTCSKRTDTMVKLCEVFESLKLKVITANITSFSGTLLKTVFIE  211



>ref|XP_004146337.1| PREDICTED: transcription factor bHLH35-like [Cucumis sativus]
 ref|XP_004161793.1| PREDICTED: transcription factor bHLH35-like [Cucumis sativus]
 gb|KGN65490.1| hypothetical protein Csa_1G425940 [Cucumis sativus]
Length=241

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG +T+VVS+TC KR D+M+KLCE+FESL++KII+ANITA SGRLLKTVFIE 
Sbjct  161  MGDRTIVVSMTCCKRADSMVKLCEVFESLNLKIITANITAVSGRLLKTVFIEA  213



>gb|KHG05269.1| Transcription factor bHLH35 -like protein [Gossypium arboreum]
Length=245

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG+KT+VVS+TCSK+TDTM++LCE+FESL +KII+ANIT  SGRLLKTVF+E 
Sbjct  165  MGEKTMVVSITCSKKTDTMVRLCEVFESLKLKIITANITVVSGRLLKTVFVEA  217



>gb|KDO61950.1| hypothetical protein CISIN_1g025665mg [Citrus sinensis]
 gb|KDO61951.1| hypothetical protein CISIN_1g025665mg [Citrus sinensis]
Length=249

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG+K +VVS+TCSKRTDTM+KLCE FESL +KII+ANITA +GRLLKT FIEV
Sbjct  166  MGEKILVVSVTCSKRTDTMVKLCEAFESLKLKIITANITAVAGRLLKTAFIEV  218



>ref|XP_006453236.1| hypothetical protein CICLE_v100092852mg [Citrus clementina]
 gb|ESR66476.1| hypothetical protein CICLE_v100092852mg [Citrus clementina]
Length=250

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG+K +VVS+TCSKRTDTM+KLCE FESL +KII+ANITA +GRLLKT FIEV
Sbjct  166  MGEKILVVSVTCSKRTDTMVKLCEAFESLKLKIITANITAVAGRLLKTAFIEV  218



>gb|KJB83352.1| hypothetical protein B456_013G242800 [Gossypium raimondii]
Length=245

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG++T+VVS+TCSK+TDTM++LCE+FESL +KII+ANITA SG+LLKTVF+E 
Sbjct  165  MGERTMVVSITCSKKTDTMVRLCEVFESLKLKIITANITAVSGKLLKTVFVEA  217



>gb|KHN17635.1| Transcription factor bHLH35 [Glycine soja]
Length=248

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG+KT VVSLTCSKRTDTM+KLC +FESL +K+I+ANIT+FSG LLKTVFI+ 
Sbjct  168  MGEKTFVVSLTCSKRTDTMVKLCAVFESLKLKVITANITSFSGTLLKTVFIQA  220



>ref|XP_006453237.1| hypothetical protein CICLE_v100092852mg [Citrus clementina]
 ref|XP_006474281.1| PREDICTED: transcription factor bHLH35-like [Citrus sinensis]
 gb|ESR66477.1| hypothetical protein CICLE_v100092852mg [Citrus clementina]
Length=246

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG+K +VVS+TCSKRTDTM+KLCE FESL +KII+ANITA +GRLLKT FIE 
Sbjct  166  MGEKILVVSVTCSKRTDTMVKLCEAFESLKLKIITANITAVAGRLLKTAFIEA  218



>ref|XP_002325261.2| hypothetical protein POPTR_0018s13860g [Populus trichocarpa]
 gb|EEF03826.2| hypothetical protein POPTR_0018s13860g [Populus trichocarpa]
Length=249

 Score = 84.7 bits (208),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG+ T++VSLTC+KRTDTM+KLCE+FESL +KII+ANIT  SGR+LKTVFIE 
Sbjct  169  MGENTLLVSLTCNKRTDTMVKLCEVFESLGLKIITANITTVSGRVLKTVFIEA  221



>ref|XP_011017674.1| PREDICTED: transcription factor bHLH35-like [Populus euphratica]
Length=249

 Score = 84.3 bits (207),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG+ T++VSLTC+KRTDTM+KLCE+FESL +KII+ANIT  SGR+LKTVFIE 
Sbjct  169  MGENTLLVSLTCNKRTDTMVKLCEVFESLGLKIITANITTVSGRVLKTVFIEA  221



>ref|XP_008453552.1| PREDICTED: transcription factor bHLH35 [Cucumis melo]
Length=278

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG +T+VVS+TC KR D+M+KLCE+FESL +KII+ANIT  SGRLLKTVFIE 
Sbjct  161  MGDRTIVVSMTCCKRADSMVKLCEVFESLKLKIITANITTVSGRLLKTVFIEA  213



>ref|XP_010667303.1| PREDICTED: transcription factor bHLH35 [Beta vulgaris subsp. 
vulgaris]
Length=269

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            +G++T+VVSLTCSKR  TM+KLCE+FESL +KII+A+ITAF+GRLLKTVF+E 
Sbjct  195  VGERTIVVSLTCSKREGTMVKLCEMFESLKLKIITAHITAFAGRLLKTVFLEA  247



>ref|NP_974948.1| transcription factor bHLH35 [Arabidopsis thaliana]
 dbj|BAA97365.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED96855.1| transcription factor bHLH35 [Arabidopsis thaliana]
Length=226

 Score = 81.6 bits (200),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG++T+VVS+TC+KRTDTM+KLCE+FESL++KI+++N+T+FSG +  TVFIEV
Sbjct  163  MGERTMVVSVTCNKRTDTMVKLCEVFESLNLKILTSNLTSFSGMIFHTVFIEV  215



>gb|EYU43807.1| hypothetical protein MIMGU_mgv1a015530mg [Erythranthe guttata]
Length=154

 Score = 80.5 bits (197),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIE  158
            MG+KTVVVS+TCSKR DTM KLC++FESL+++I++AN+TAFSG + KTVF+E
Sbjct  74   MGEKTVVVSITCSKRRDTMGKLCKVFESLNLQIVTANMTAFSGTISKTVFLE  125



>ref|NP_974947.1| transcription factor bHLH35 [Arabidopsis thaliana]
 gb|AAL24180.1| AT5g57150/MUL3_10 [Arabidopsis thaliana]
 gb|AED96854.1| transcription factor bHLH35 [Arabidopsis thaliana]
Length=219

 Score = 81.3 bits (199),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEVV  164
            MG++T+VVS+TC+KRTDTM+KLCE+FESL++KI+++N+T+FSG +  TVFIE+ 
Sbjct  163  MGERTMVVSVTCNKRTDTMVKLCEVFESLNLKILTSNLTSFSGMIFHTVFIEIA  216



>ref|XP_006593510.1| PREDICTED: transcription factor bHLH35-like [Glycine max]
Length=231

 Score = 80.9 bits (198),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 48/54 (89%), Gaps = 1/54 (2%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLL-KTVFIEV  161
            M +KT VV+LTCSKRTDTM+KLCE+FESL +K+I+ANIT+FSG LL KT FIEV
Sbjct  168  MREKTFVVNLTCSKRTDTMVKLCEVFESLKLKVIAANITSFSGTLLKKTAFIEV  221



>ref|XP_010483214.1| PREDICTED: transcription factor bHLH35-like isoform X2 [Camelina 
sativa]
Length=245

 Score = 80.9 bits (198),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG++T+VVS+TC+KRTDTM+KLCE+FESL++KI+++N+T+FSG +  TVFIE 
Sbjct  160  MGERTMVVSITCNKRTDTMVKLCEVFESLNLKILTSNLTSFSGMIFHTVFIEA  212



>ref|XP_010483213.1| PREDICTED: transcription factor bHLH35-like isoform X1 [Camelina 
sativa]
Length=247

 Score = 80.9 bits (198),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG++T+VVS+TC+KRTDTM+KLCE+FESL++KI+++N+T+FSG +  TVFIE 
Sbjct  162  MGERTMVVSITCNKRTDTMVKLCEVFESLNLKILTSNLTSFSGMIFHTVFIEA  214



>ref|XP_010443388.1| PREDICTED: transcription factor bHLH35-like [Camelina sativa]
 ref|XP_010443389.1| PREDICTED: transcription factor bHLH35-like [Camelina sativa]
Length=247

 Score = 80.9 bits (198),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG++T+VVS+TC+KRTDTM+KLCE+FESL++KI+++N+T+FSG +  TVFIE 
Sbjct  162  MGERTMVVSITCNKRTDTMVKLCEVFESLNLKILTSNLTSFSGMIFHTVFIEA  214



>ref|XP_010451830.1| PREDICTED: transcription factor bHLH35 [Camelina sativa]
Length=247

 Score = 80.9 bits (198),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG++T+VVS+TC+KRTDTM+KLCE+FESL++KI+++N+T+FSG +  TVFIE 
Sbjct  162  MGERTMVVSITCNKRTDTMVKLCEVFESLNLKILTSNLTSFSGMIFHTVFIEA  214



>gb|AAM63723.1| unknown [Arabidopsis thaliana]
Length=247

 Score = 80.5 bits (197),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG++T+VVS+TC+KRTDTM+KLCE+FESL++KI+++N+T+FSG +  TVFIE 
Sbjct  162  MGERTMVVSVTCNKRTDTMVKLCEVFESLNLKILTSNLTSFSGMIFHTVFIEA  214



>ref|NP_568850.1| transcription factor bHLH35 [Arabidopsis thaliana]
 gb|AED96853.1| transcription factor bHLH35 [Arabidopsis thaliana]
Length=247

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG++T+VVS+TC+KRTDTM+KLCE+FESL++KI+++N+T+FSG +  TVFIE 
Sbjct  162  MGERTMVVSVTCNKRTDTMVKLCEVFESLNLKILTSNLTSFSGMIFHTVFIEA  214



>gb|KFK27270.1| hypothetical protein AALP_AA8G360300 [Arabis alpina]
Length=246

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG++T+VVS+TC+KRTDTM+KLCE+FESL++KI+++N+T+FSG +  TVFIE 
Sbjct  161  MGERTMVVSVTCNKRTDTMVKLCEVFESLNLKILTSNLTSFSGMIFHTVFIEA  213



>sp|Q2HIV9.1|BH035_ARATH RecName: Full=Transcription factor bHLH35; AltName: Full=Basic 
helix-loop-helix protein 35; Short=AtbHLH35; Short=bHLH 35; 
AltName: Full=Transcription factor EN 41; AltName: Full=bHLH 
transcription factor bHLH035 [Arabidopsis thaliana]
 gb|ABD19653.1| At5g57150 [Arabidopsis thaliana]
Length=248

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG++T+VVS+TC+KRTDTM+KLCE+FESL++KI+++N+T+FSG +  TVFIE 
Sbjct  163  MGERTMVVSVTCNKRTDTMVKLCEVFESLNLKILTSNLTSFSGMIFHTVFIEA  215



>ref|XP_002864502.1| basic helix-loop-helix family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40761.1| basic helix-loop-helix family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=247

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG++T+VVS+TC+KRTDTM+KLCE+FESL++KI+++N+T+FSG +  TVFIE 
Sbjct  162  MGERTMVVSVTCNKRTDTMVKLCEVFESLNLKILTSNLTSFSGMIFHTVFIEA  214



>gb|KHN22657.1| Transcription factor bHLH35 [Glycine soja]
Length=249

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 47/54 (87%), Gaps = 1/54 (2%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLL-KTVFIEV  161
            M +KT VV+LTCSKRTDTM+KLCE+FESL +K+I+ANIT+FSG LL KT FIE 
Sbjct  168  MREKTFVVNLTCSKRTDTMVKLCEVFESLKLKVIAANITSFSGTLLKKTAFIEA  221



>ref|XP_010548650.1| PREDICTED: transcription factor bHLH27-like isoform X2 [Tarenaya 
hassleriana]
Length=169

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG+KT VV +TCSK+ DTM++LCE+FESL++KII+ANI++FSGRL  T+F+EV
Sbjct  87   MGEKTGVVCITCSKKRDTMVRLCEVFESLNLKIITANISSFSGRLSNTLFLEV  139



>ref|XP_010548649.1| PREDICTED: transcription factor bHLH27-like isoform X1 [Tarenaya 
hassleriana]
Length=245

 Score = 79.3 bits (194),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG+KT VV +TCSK+ DTM++LCE+FESL++KII+ANI++FSGRL  T+F+EV
Sbjct  163  MGEKTGVVCITCSKKRDTMVRLCEVFESLNLKIITANISSFSGRLSNTLFLEV  215



>ref|NP_001190556.1| transcription factor bHLH35 [Arabidopsis thaliana]
 gb|AED96856.1| transcription factor bHLH35 [Arabidopsis thaliana]
Length=264

 Score = 79.0 bits (193),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG++T+VVS+TC+KRTDTM+KLCE+FESL++KI+++N+T+FSG +  TVFIE+
Sbjct  163  MGERTMVVSVTCNKRTDTMVKLCEVFESLNLKILTSNLTSFSGMIFHTVFIEL  215



>emb|CDY52738.1| BnaC09g53380D [Brassica napus]
Length=165

 Score = 77.8 bits (190),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFI  155
            MG++TVVV++TC+KRTDTM+KLCE+FESL++KII++N+ +FSG +  TVFI
Sbjct  80   MGERTVVVNVTCNKRTDTMVKLCEVFESLNLKIITSNLNSFSGMIFNTVFI  130



>ref|XP_006281955.1| hypothetical protein CARUB_v10028169mg [Capsella rubella]
 gb|EOA14853.1| hypothetical protein CARUB_v10028169mg [Capsella rubella]
Length=181

 Score = 77.8 bits (190),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG++T+VVS+TC+KRTDTM+KLCE+FESL++KI+++N+T+FS  +  TVFIE 
Sbjct  96   MGERTMVVSITCNKRTDTMVKLCEVFESLNLKILTSNLTSFSEMIFHTVFIEA  148



>ref|XP_011077906.1| PREDICTED: transcription factor bHLH35-like [Sesamum indicum]
Length=250

 Score = 78.2 bits (191),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIE  158
            MG+KT+VVSL CSKR DTM+KLCE FESL +KII+ +I A  GRLLKTVF+E
Sbjct  170  MGEKTLVVSLECSKRRDTMIKLCEAFESLKLKIITCSINALPGRLLKTVFLE  221



>emb|CDX88610.1| BnaA03g10390D [Brassica napus]
Length=246

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG++T+VV++TC+KRTDTM+KLCE+FESL++KII++N+ +FSG +  T+FIE 
Sbjct  161  MGERTMVVNVTCNKRTDTMVKLCEVFESLNLKIITSNLNSFSGMIFNTLFIEA  213



>ref|XP_009132143.1| PREDICTED: transcription factor bHLH35-like [Brassica rapa]
Length=246

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG++T+VV++TC+KRTDTM+KLCE+FESL++KII++N+ +FSG +  T+FIE 
Sbjct  161  MGERTMVVNVTCNKRTDTMVKLCEVFESLNLKIITSNLNSFSGMIFNTLFIEA  213



>emb|CDY11882.1| BnaC03g13080D [Brassica napus]
Length=246

 Score = 75.9 bits (185),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG++T+VV++TC+KRTDTM+KLCE+FESL++KII+ N+ +FSG +  T+FIE 
Sbjct  161  MGERTMVVNVTCNKRTDTMVKLCEVFESLNLKIITFNLNSFSGMIFNTLFIEA  213



>ref|XP_009380730.1| PREDICTED: transcription factor bHLH35-like [Musa acuminata subsp. 
malaccensis]
Length=218

 Score = 75.5 bits (184),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG+KT+VVS+TC+K+ DTM+K+CE+FESL++K+++AN+T  SG LL T+FIE+
Sbjct  165  MGEKTMVVSITCNKKRDTMIKVCEVFESLNLKVLTANVTNVSGSLLDTLFIEL  217



>gb|EYU38740.1| hypothetical protein MIMGU_mgv1a022559mg [Erythranthe guttata]
Length=227

 Score = 75.1 bits (183),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIE  158
            MG+K V+VSLTCS R DT++KLCE FESL++KII++ I  FSG+L KTVFI+
Sbjct  147  MGEKNVMVSLTCSNRRDTIIKLCEAFESLNLKIITSTINHFSGKLFKTVFIQ  198



>ref|XP_010536889.1| PREDICTED: transcription factor bHLH35 isoform X2 [Tarenaya hassleriana]
Length=244

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG++TVVVS TC+KRTDTM KLCE+F++L++ I++ NIT+FSG L  T F++ 
Sbjct  163  MGERTVVVSTTCNKRTDTMAKLCEVFQTLNLNILTVNITSFSGMLFHTAFVQA  215



>ref|XP_010536890.1| PREDICTED: transcription factor bHLH35 isoform X3 [Tarenaya hassleriana]
Length=243

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG++TVVVS TC+KRTDTM KLCE+F++L++ I++ NIT+FSG L  T F++ 
Sbjct  162  MGERTVVVSTTCNKRTDTMAKLCEVFQTLNLNILTVNITSFSGMLFHTAFVQA  214



>emb|CDY47924.1| BnaA02g08320D [Brassica napus]
Length=246

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG++ +VV++TC+KRTDTM+KLCE+FESL++KI+++N+ +FSG +  T+FIE 
Sbjct  161  MGERIMVVNVTCNKRTDTMVKLCEVFESLNLKILTSNLNSFSGMIFNTLFIEA  213



>ref|XP_010536888.1| PREDICTED: transcription factor bHLH35 isoform X1 [Tarenaya hassleriana]
Length=246

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG++TVVVS TC+KRTDTM KLCE+F++L++ I++ NIT+FSG L  T F++ 
Sbjct  165  MGERTVVVSTTCNKRTDTMAKLCEVFQTLNLNILTVNITSFSGMLFHTAFVQA  217



>ref|XP_006341751.1| PREDICTED: transcription factor bHLH35-like [Solanum tuberosum]
Length=234

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            M  KTVVV+LTC KR DTM+KLC++FESL+IKIISA I A SG LL T FIE 
Sbjct  154  MRDKTVVVNLTCIKRRDTMVKLCDVFESLNIKIISATIFASSGTLLHTAFIEA  206



>ref|XP_009126855.1| PREDICTED: transcription factor bHLH35-like [Brassica rapa]
Length=246

 Score = 72.8 bits (177),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG++ +VV++TC+KRTDTM+KLCE+FESL++KI+++N+  FSG +  T+FIE 
Sbjct  161  MGERIMVVNVTCNKRTDTMVKLCEVFESLNLKILTSNLNYFSGMIFNTLFIEA  213



>dbj|BAJ34262.1| unnamed protein product [Thellungiella halophila]
Length=165

 Score = 72.0 bits (175),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            M ++T+VV++TC+KRTDTM+KLCE+FESL++KI+++++T+FSG +  T+FIE 
Sbjct  80   MRERTMVVNVTCNKRTDTMVKLCEVFESLNLKILTSSLTSFSGMIFNTLFIEA  132



>ref|XP_010929341.1| PREDICTED: transcription factor bHLH35 isoform X2 [Elaeis guineensis]
Length=248

 Score = 72.4 bits (176),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            +G KT+VVS+TC+++ DTM+++CE+F+SL++KII+ANIT+ SG LL T+F+E 
Sbjct  165  VGDKTLVVSITCNRKRDTMIRMCEVFDSLNLKIITANITSVSGSLLHTLFVET  217



>ref|XP_009120236.1| PREDICTED: transcription factor bHLH35 [Brassica rapa]
 emb|CDY38270.1| BnaA10g11180D [Brassica napus]
Length=246

 Score = 72.4 bits (176),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKT  146
            MG++TVVV++TC+KRTDTM+KLCE+FESL++KII++N+ +FSG +  T
Sbjct  161  MGERTVVVNVTCNKRTDTMVKLCEVFESLNLKIITSNLNSFSGMIFNT  208



>gb|KJB53716.1| hypothetical protein B456_009G002200 [Gossypium raimondii]
Length=224

 Score = 72.4 bits (176),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG  T++VS+TC+KR DTM+KLC++FESL++KII+AN+T  S  L  T+FI V
Sbjct  157  MGDNTLLVSITCTKRADTMLKLCQLFESLNLKIITANLTVVSANLFNTLFIRV  209



>ref|XP_006401237.1| hypothetical protein EUTSA_v10014506mg [Eutrema salsugineum]
 gb|ESQ42690.1| hypothetical protein EUTSA_v10014506mg [Eutrema salsugineum]
Length=246

 Score = 72.4 bits (176),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            M ++T+VV++TC+KRTDTM+KLCE+FESL++KI+++++T+FSG +  T+FIE 
Sbjct  161  MRERTMVVNVTCNKRTDTMVKLCEVFESLNLKILTSSLTSFSGMIFNTLFIEA  213



>ref|XP_010929340.1| PREDICTED: transcription factor bHLH35 isoform X1 [Elaeis guineensis]
Length=291

 Score = 72.4 bits (176),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            +G KT+VVS+TC+++ DTM+++CE+F+SL++KII+ANIT+ SG LL T+F+E 
Sbjct  208  VGDKTLVVSITCNRKRDTMIRMCEVFDSLNLKIITANITSVSGSLLHTLFVET  260



>emb|CDY42237.1| BnaC02g11780D [Brassica napus]
Length=242

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG++ +VV++ C+KRTDTM+KLCE+FESL++KI+++N+ +FSG +  T+FIE 
Sbjct  161  MGERIMVVNVKCNKRTDTMVKLCEVFESLNLKILTSNLNSFSGMIFNTLFIEA  213



>ref|XP_008811438.1| PREDICTED: transcription factor bHLH35 [Phoenix dactylifera]
Length=248

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            +G KT+VVS+ C+++ DTM+++CE+FESL++KII+ANIT+ SG LL T+F+E 
Sbjct  165  VGDKTLVVSIACNRKRDTMIRMCEVFESLNLKIITANITSVSGSLLHTLFVET  217



>ref|XP_009409750.1| PREDICTED: transcription factor bHLH35 [Musa acuminata subsp. 
malaccensis]
Length=260

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIE  158
            MG+KT+VVS+TC+K+ DTM+K+CE+FE L++K+I+ANIT+ S  LL T+F+E
Sbjct  165  MGEKTMVVSITCNKKRDTMIKVCELFEFLNLKVITANITSVSENLLHTLFVE  216



>ref|XP_010046925.1| PREDICTED: transcription factor bHLH35 isoform X2 [Eucalyptus 
grandis]
 gb|KCW78642.1| hypothetical protein EUGRSUZ_C00105 [Eucalyptus grandis]
Length=257

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = +3

Query  6    GKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIE  158
            G+K+VV+SLTCS R D M++LC+ FESL +KI++ANITA    LLK VFIE
Sbjct  166  GEKSVVISLTCSNRGDAMVRLCQAFESLKLKIVAANITALPEELLKMVFIE  216



>gb|KJB53715.1| hypothetical protein B456_009G002200 [Gossypium raimondii]
Length=237

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFI  155
            MG  T++VS+TC+KR DTM+KLC++FESL++KII+AN+T  S  L  T+FI
Sbjct  157  MGDNTLLVSITCTKRADTMLKLCQLFESLNLKIITANLTVVSANLFNTLFI  207



>ref|XP_010046924.1| PREDICTED: transcription factor bHLH35 isoform X1 [Eucalyptus 
grandis]
 gb|KCW78641.1| hypothetical protein EUGRSUZ_C00105 [Eucalyptus grandis]
Length=258

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = +3

Query  6    GKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIE  158
            G+K+VV+SLTCS R D M++LC+ FESL +KI++ANITA    LLK VFIE
Sbjct  167  GEKSVVISLTCSNRGDAMVRLCQAFESLKLKIVAANITALPEELLKMVFIE  217



>ref|NP_001291248.1| transcription factor bHLH35-like [Populus euphratica]
 gb|AIG53906.1| bHLH35 protein [Populus euphratica]
Length=247

 Score = 69.3 bits (168),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG+KT+ VSLTCSK TD M+++CE FE L +KII+ANIT  SG + KTV IEV
Sbjct  166  MGEKTLFVSLTCSKTTDAMIRICEAFEPLMLKIITANITTLSGMVKKTVLIEV  218



>ref|XP_002308108.2| hypothetical protein POPTR_0006s07430g [Populus trichocarpa]
 gb|EEE91631.2| hypothetical protein POPTR_0006s07430g [Populus trichocarpa]
Length=261

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG+KT++VSL C+K TD M ++CE+FESL +KII+AN T  SG + KTV IEV
Sbjct  172  MGEKTLLVSLACNKTTDAMTRICEVFESLKLKIITANATVLSGMIKKTVVIEV  224



>ref|XP_010539408.1| PREDICTED: transcription factor bHLH35-like [Tarenaya hassleriana]
 ref|XP_010539409.1| PREDICTED: transcription factor bHLH35-like [Tarenaya hassleriana]
 ref|XP_010539410.1| PREDICTED: transcription factor bHLH35-like [Tarenaya hassleriana]
Length=246

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG+ TVVVS+TC+KR DTM++L E+FE+L +KI++ NI +FSG L  T F+E 
Sbjct  166  MGESTVVVSITCNKRADTMVRLSEVFETLKLKILAVNIVSFSGILFHTAFVEA  218



>ref|XP_009407095.1| PREDICTED: transcription factor bHLH35-like [Musa acuminata subsp. 
malaccensis]
Length=241

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIE  158
            M +K++VVS+TC+K+  TM+K+CE+FESLD+K I+ANIT+ SG +L T+ +E
Sbjct  159  MDEKSMVVSITCTKKRHTMIKVCELFESLDLKFITANITSVSGSILHTLLVE  210



>ref|XP_002309008.1| hypothetical protein POPTR_0006s07410g [Populus trichocarpa]
 gb|EEE92531.1| hypothetical protein POPTR_0006s07410g [Populus trichocarpa]
Length=283

 Score = 67.8 bits (164),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG+KT++VSLTCSK  D M+K+CEIFES+ +KII+AN+   SG + KTV IE 
Sbjct  164  MGEKTLLVSLTCSKARDAMIKICEIFESMKLKIITANVAIVSGMVKKTVLIEA  216



>ref|XP_008451133.1| PREDICTED: transcription factor bHLH35-like isoform X2 [Cucumis 
melo]
Length=245

 Score = 66.6 bits (161),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFI  155
            MG+KT+VVS+TC +R D ++K+C++ ESL +KII+ANIT  + RLL T+F+
Sbjct  165  MGEKTMVVSMTCERRNDAVLKICQVIESLKLKIITANITVVANRLLSTLFL  215



>ref|XP_008451126.1| PREDICTED: transcription factor bHLH35-like isoform X1 [Cucumis 
melo]
Length=248

 Score = 66.6 bits (161),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFI  155
            MG+KT+VVS+TC +R D ++K+C++ ESL +KII+ANIT  + RLL T+F+
Sbjct  168  MGEKTMVVSMTCERRNDAVLKICQVIESLKLKIITANITVVANRLLSTLFL  218



>ref|XP_008451140.1| PREDICTED: transcription factor bHLH35-like isoform X3 [Cucumis 
melo]
Length=244

 Score = 66.6 bits (161),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFI  155
            MG+KT+VVS+TC +R D ++K+C++ ESL +KII+ANIT  + RLL T+F+
Sbjct  164  MGEKTMVVSMTCERRNDAVLKICQVIESLKLKIITANITVVANRLLSTLFL  214



>ref|XP_011020047.1| PREDICTED: transcription factor bHLH35-like isoform X1 [Populus 
euphratica]
Length=247

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG+KT++VSLTC K  D M+K+CEIFES+ +KII+AN+   SG + KTV IE 
Sbjct  164  MGEKTLLVSLTCGKARDAMIKICEIFESMKLKIITANVAIVSGMVKKTVLIEA  216



>ref|XP_011020048.1| PREDICTED: transcription factor bHLH35-like isoform X2 [Populus 
euphratica]
Length=224

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIE  158
            MG+KT++VSLTC K  D M+K+CEIFES+ +KII+AN+   SG + KTV IE
Sbjct  164  MGEKTLLVSLTCGKARDAMIKICEIFESMKLKIITANVAIVSGMVKKTVLIE  215



>emb|CDY03557.1| BnaC03g68160D [Brassica napus]
Length=158

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG+KTVVV +TCSK+ +T+++LC++ ESLD+ II+ N + FS RL  T+F++V
Sbjct  88   MGEKTVVVCITCSKKRETLLQLCKVLESLDLNIITTNFSLFSSRLSTTLFLQV  140



>gb|KFK34607.1| hypothetical protein AALP_AA5G167500 [Arabis alpina]
Length=265

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG+KTVVV +TCSKR DTM++LC++ ESL++ I++ N ++F+ RL  T+F++ 
Sbjct  185  MGEKTVVVCITCSKRRDTMLQLCKVLESLNLNILTTNFSSFASRLSSTLFLQA  237



>ref|XP_006372182.1| hypothetical protein POPTR_0018s13830g [Populus trichocarpa]
 gb|ERP49979.1| hypothetical protein POPTR_0018s13830g [Populus trichocarpa]
Length=274

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG+KT+ VSLTCS+  + M+K+CE+FESL +KII+A++T+ SG   KT+ IEV
Sbjct  164  MGEKTLFVSLTCSQAREAMVKICEVFESLKLKIITASVTSVSGMFKKTILIEV  216



>gb|ABK92754.1| unknown [Populus trichocarpa]
Length=215

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG+KT+ VSLTCSK  + M+++CE+FESL +KII+A++T  SG + KTV IE 
Sbjct  135  MGEKTLFVSLTCSKAREAMVRICEVFESLKLKIITASVTTVSGMVKKTVLIEA  187



>ref|XP_006372183.1| hypothetical protein POPTR_0018s13840g [Populus trichocarpa]
 gb|ERP49980.1| hypothetical protein POPTR_0018s13840g [Populus trichocarpa]
Length=216

 Score = 64.3 bits (155),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG+KT+ VSLTCSK  + M+++CE+FESL +KII+A++T  SG + KTV IE+
Sbjct  164  MGEKTLFVSLTCSKAREAMVRICEVFESLKLKIITASVTTVSGMVKKTVLIEM  216



>ref|XP_002324689.2| hypothetical protein POPTR_0018s13840g [Populus trichocarpa]
 gb|EEF03254.2| hypothetical protein POPTR_0018s13840g [Populus trichocarpa]
Length=244

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG+KT+ VSLTCSK  + M+++CE+FESL +KII+A++T  SG + KTV IE 
Sbjct  164  MGEKTLFVSLTCSKAREAMVRICEVFESLKLKIITASVTTVSGMVKKTVLIEA  216



>ref|XP_002324688.1| hypothetical protein POPTR_0018s13830g [Populus trichocarpa]
 gb|EEF03253.1| hypothetical protein POPTR_0018s13830g [Populus trichocarpa]
Length=244

 Score = 64.3 bits (155),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG+KT+ VSLTCS+  + M+K+CE+FESL +KII+A++T+ SG   KT+ IE 
Sbjct  164  MGEKTLFVSLTCSQAREAMVKICEVFESLKLKIITASVTSVSGMFKKTILIEA  216



>ref|XP_006412786.1| hypothetical protein EUTSA_v10027332mg [Eutrema salsugineum]
 gb|ESQ54239.1| hypothetical protein EUTSA_v10027332mg [Eutrema salsugineum]
Length=250

 Score = 64.3 bits (155),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEVV  164
            MG+KTVVV +TCSK+ +TM++LC++ ESL++ I++ N ++FS RL  T+F++V 
Sbjct  183  MGEKTVVVCITCSKKRETMLQLCKVLESLNLNILTTNFSSFSSRLSTTLFLQVT  236



>emb|CDY30182.1| BnaA03g49880D [Brassica napus]
Length=244

 Score = 63.9 bits (154),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIE  158
            MG++TVVV +TCSKR +TM++LC++ ESL++ I++ N ++FS RL  T+F++
Sbjct  183  MGERTVVVCITCSKRRETMLQLCKVLESLNLNIVTTNFSSFSSRLSTTLFLQ  234



>ref|XP_008799483.1| PREDICTED: transcription factor bHLH35-like [Phoenix dactylifera]
Length=241

 Score = 63.5 bits (153),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIE  158
            +G +T+VVS+ C+K+ D M+K+CE FESL++ II+A+ T+ SG LL T+F+E
Sbjct  158  VGDRTLVVSIACNKKRDAMVKVCEFFESLNLNIITASFTSVSGNLLHTLFVE  209



>ref|XP_009137878.1| PREDICTED: transcription factor bHLH27 [Brassica rapa]
Length=263

 Score = 63.9 bits (154),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG++TVVV +TCSKR +TM++LC++ ESL++ I++ N ++FS RL  T+F++ 
Sbjct  183  MGERTVVVCITCSKRRETMLQLCKVLESLNLNIVTTNFSSFSSRLSTTLFLQA  235



>ref|XP_002308107.2| hypothetical protein POPTR_0006s07420g [Populus trichocarpa]
 gb|EEE91630.2| hypothetical protein POPTR_0006s07420g [Populus trichocarpa]
Length=248

 Score = 63.5 bits (153),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG K + VSLTC++ TD M ++CE+FESL +KII+ANIT  S  + KTV IEV
Sbjct  168  MGGKNLFVSLTCNRTTDAMSRICEVFESLKLKIITANITTLSELVKKTVLIEV  220



>ref|XP_010927251.1| PREDICTED: transcription factor bHLH35-like [Elaeis guineensis]
Length=246

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIE  158
            +G +T+VVS++C+K+ DTM+K+CEI ESL++ II+A+IT+ S  LL T+F+E
Sbjct  163  VGDRTLVVSISCNKKRDTMIKVCEILESLNLNIITASITSVSRSLLHTLFVE  214



>ref|XP_004149508.1| PREDICTED: transcription factor bHLH35-like [Cucumis sativus]
Length=165

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFI  155
            MG+KT+VVS+TC +R + + K+C++ ESL +KII ANIT  + RLL T+F+
Sbjct  85   MGEKTMVVSMTCQRRNNAVFKICQVIESLKLKIIMANITVVANRLLSTLFL  135



>ref|XP_011020357.1| PREDICTED: transcription factor bHLH35-like [Populus euphratica]
Length=191

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG+KT++VS  C+K TD M ++ E+FESL +KII+AN TA SG +  TV IEV
Sbjct  113  MGEKTLLVSFECNKTTDAMSRIYEVFESLKLKIITANATALSGMIKTTVVIEV  165



>emb|CDY46719.1| BnaC07g42240D [Brassica napus]
Length=264

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG++TVVV +TCSKR +TM++LC++ ESL++ I++ N ++FS RL  T+F++ 
Sbjct  184  MGERTVVVCITCSKRRETMLQLCKVLESLNLNIVTTNFSSFSTRLSTTLFLQA  236



>ref|XP_010438241.1| PREDICTED: transcription factor bHLH27 [Camelina sativa]
Length=256

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG+KTVVV +TCSK+ +TM++LC++ ESL++ I++ N ++FS RL  T+F++ 
Sbjct  176  MGEKTVVVCITCSKKRETMLQLCKVLESLNLNILTTNFSSFSSRLSTTLFLQA  228



>ref|XP_004169968.1| PREDICTED: transcription factor bHLH35-like [Cucumis sativus]
Length=161

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFI  155
            MG+KT+VVS+TC +R + + K+C++ ESL +KII ANIT  + RLL T+F+
Sbjct  90   MGEKTMVVSMTCQRRNNAVFKICQVIESLKLKIIMANITVVANRLLSTLFL  140



>ref|XP_010447790.1| PREDICTED: transcription factor bHLH27-like [Camelina sativa]
Length=258

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG+KTVVV +TCSK+ +TM++LC++ ESL++ I++ N ++FS RL  T+F++ 
Sbjct  178  MGEKTVVVCITCSKKRETMLQLCKVLESLNLNILTTNFSSFSSRLSTTLFLQA  230



>gb|KHN07348.1| Transcription factor bHLH35 [Glycine soja]
Length=140

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +3

Query  39   SKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIE  158
             K TDT++KLCE+FESL +KI++ANIT+FS RLLKT FIE
Sbjct  100  QKDTDTVVKLCEVFESLKVKIVTANITSFSDRLLKTSFIE  139



>ref|XP_011017676.1| PREDICTED: transcription factor bHLH35-like [Populus euphratica]
Length=244

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG+KT+ VSLTCS+  + M+K+CE+FESL +KII+A++T+ SG + +T+ IE 
Sbjct  164  MGEKTLFVSLTCSQAREAMVKICEVFESLKLKIITASVTSVSGIVKQTILIEA  216



>ref|XP_009128266.1| PREDICTED: transcription factor bHLH27-like isoform X2 [Brassica 
rapa]
 emb|CDY43542.1| BnaA01g07020D [Brassica napus]
Length=263

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG+KTVVV +TCSK+ +TM++LC++ ESL++ I++ N ++FS RL  T+F++ 
Sbjct  183  MGEKTVVVCITCSKKRETMLQLCKLLESLNLNILTTNFSSFSSRLSTTLFLQA  235



>ref|XP_006285089.1| hypothetical protein CARUB_v10006422mg [Capsella rubella]
 gb|EOA17987.1| hypothetical protein CARUB_v10006422mg [Capsella rubella]
Length=257

 Score = 62.4 bits (150),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG+KTVVV +TCSK+ +TM++LC++ ESL++ +++ N ++FS RL  T+F++ 
Sbjct  177  MGEKTVVVCITCSKKRETMLQLCKVLESLNLNVLTTNFSSFSSRLSTTLFLQA  229



>ref|XP_009128255.1| PREDICTED: transcription factor bHLH27-like isoform X1 [Brassica 
rapa]
Length=267

 Score = 62.4 bits (150),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG+KTVVV +TCSK+ +TM++LC++ ESL++ I++ N ++FS RL  T+F++ 
Sbjct  187  MGEKTVVVCITCSKKRETMLQLCKLLESLNLNILTTNFSSFSSRLSTTLFLQA  239



>emb|CDX68608.1| BnaC01g08450D [Brassica napus]
Length=263

 Score = 62.4 bits (150),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG+KTVVV +TCSK+ +TM++LC++ ESL++ I++ N ++FS RL  T+F++ 
Sbjct  183  MGEKTVVVCITCSKKRETMLQLCKLLESLNLNILTTNFSSFSSRLSTTLFLQA  235



>ref|NP_001078471.1| transcription factor bHLH27 [Arabidopsis thaliana]
 sp|Q700E3.1|BH027_ARATH RecName: Full=Transcription factor bHLH27; AltName: Full=Basic 
helix-loop-helix protein 27; Short=AtbHLH27; Short=bHLH 27; 
AltName: Full=Transcription factor EN 42; AltName: Full=bHLH 
transcription factor bHLH027 [Arabidopsis thaliana]
 gb|AAS79544.1| At4g29930 [Arabidopsis thaliana]
 emb|CAG25855.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE85696.1| transcription factor bHLH27 [Arabidopsis thaliana]
Length=263

 Score = 62.4 bits (150),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEVV  164
            MG+KTVVV +TCSK+ +TM++LC++ ESL++ I++ N ++F+ RL  T+F++V 
Sbjct  174  MGEKTVVVCITCSKKRETMVQLCKVLESLNLNILTTNFSSFTSRLSTTLFLQVT  227



>ref|XP_003579501.1| PREDICTED: transcription factor bHLH35-like [Brachypodium distachyon]
Length=270

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +3

Query  6    GKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            G+K +VVS+TCSK+ D M K+C + E L +++I+ANIT+ SG L+ T+FIEV
Sbjct  187  GEKVLVVSVTCSKQRDAMPKVCRLLEELRLRVITANITSVSGCLMHTLFIEV  238



>emb|CAB43668.1| putative protein [Arabidopsis thaliana]
 emb|CAB79751.1| putative protein [Arabidopsis thaliana]
Length=277

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEVV  164
            MG+KTVVV +TCSK+ +TM++LC++ ESL++ I++ N ++F+ RL  T+F++V 
Sbjct  188  MGEKTVVVCITCSKKRETMVQLCKVLESLNLNILTTNFSSFTSRLSTTLFLQVT  241



>ref|XP_011017678.1| PREDICTED: transcription factor bHLH35-like isoform X2 [Populus 
euphratica]
Length=216

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            +G++T+ VSLTCSK  + M+++CE+FESL +KII+A++T  SG + KTV IE+
Sbjct  164  IGERTLFVSLTCSKAREAMIRICEVFESLKLKIITASVTTVSGMVKKTVLIEM  216



>ref|XP_011017677.1| PREDICTED: transcription factor bHLH35-like isoform X1 [Populus 
euphratica]
Length=244

 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            +G++T+ VSLTCSK  + M+++CE+FESL +KII+A++T  SG + KTV IE 
Sbjct  164  IGERTLFVSLTCSKAREAMIRICEVFESLKLKIITASVTTVSGMVKKTVLIEA  216



>ref|XP_002869405.1| basic helix-loop-helix family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45664.1| basic helix-loop-helix family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=256

 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG+KTVVV +TCSK+ +TM++LC++ ESL++ I++ N ++F+ RL  T+F++ 
Sbjct  176  MGEKTVVVCITCSKKRETMLQLCKVLESLNLNILTTNFSSFTSRLSTTLFLQA  228



>ref|XP_008781924.1| PREDICTED: uncharacterized protein LOC103701581 [Phoenix dactylifera]
Length=486

 Score = 63.2 bits (152),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 27/52 (52%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIE  158
            +G K  V+S TC+K+ D ++K+CE+FESL++KII+ANI + S  L  T+FIE
Sbjct  409  VGNKNFVISFTCNKKRDALIKMCEVFESLNLKIITANIISSSESLSHTLFIE  460



>ref|NP_001031752.1| transcription factor bHLH27 [Arabidopsis thaliana]
 dbj|BAD44437.1| bHLH transcription factor (bHLH027) - like protein [Arabidopsis 
thaliana]
 dbj|BAD95372.1| bHLH transcription factor - like protein [Arabidopsis thaliana]
 gb|AEE85695.1| transcription factor bHLH27 [Arabidopsis thaliana]
Length=225

 Score = 61.2 bits (147),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG+KTVVV +TCSK+ +TM++LC++ ESL++ I++ N ++F+ RL  T+F++ 
Sbjct  145  MGEKTVVVCITCSKKRETMVQLCKVLESLNLNILTTNFSSFTSRLSTTLFLQA  197



>ref|NP_194722.2| transcription factor bHLH27 [Arabidopsis thaliana]
 dbj|BAC42379.1| putative bHLH transcription factor bHLH027 [Arabidopsis thaliana]
 gb|AAO64804.1| At4g29930 [Arabidopsis thaliana]
 dbj|BAD43964.1| bHLH transcription factor (bHLH027) - like protein [Arabidopsis 
thaliana]
 dbj|BAD44039.1| bHLH transcription factor (bHLH027) - like protein [Arabidopsis 
thaliana]
 dbj|BAF00155.1| bHLH transcription factor (bHLH027) - like protein [Arabidopsis 
thaliana]
 gb|AEE85694.1| transcription factor bHLH27 [Arabidopsis thaliana]
Length=254

 Score = 60.8 bits (146),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            MG+KTVVV +TCSK+ +TM++LC++ ESL++ I++ N ++F+ RL  T+F++ 
Sbjct  174  MGEKTVVVCITCSKKRETMVQLCKVLESLNLNILTTNFSSFTSRLSTTLFLQA  226



>emb|CAE04678.3| OSJNBb0018A10.7 [Oryza sativa Japonica Group]
Length=426

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 25/53 (47%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            +G + +VVS+TCSKR D M ++C   E L +++I+ANIT+ +G L+ T+F+EV
Sbjct  227  VGDRVLVVSVTCSKRRDAMARVCRALEELRLRVITANITSVAGCLMHTLFVEV  279



>gb|EMS52912.1| hypothetical protein TRIUR3_34636 [Triticum urartu]
Length=202

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            + +K +VVS+TCSK+ D M K+C   E L +++I+ANIT+ SG L+ T+F+EV
Sbjct  118  VSEKVLVVSVTCSKQRDAMTKVCRALEELRLRVITANITSVSGCLMHTLFVEV  170



>ref|XP_010541107.1| PREDICTED: transcription factor bHLH27 isoform X1 [Tarenaya hassleriana]
Length=258

 Score = 58.9 bits (141),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 41/54 (76%), Gaps = 1/54 (2%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITA-FSGRLLKTVFIEV  161
            MG+K  VV +TC+K  +TM  LC++FESL++KII+AN ++  SGRL  T+FIE 
Sbjct  171  MGEKRGVVIITCNKERETMAGLCQVFESLNLKIITANFSSPLSGRLSATLFIEA  224



>emb|CAH66073.1| H0215E01.1 [Oryza sativa Indica Group]
Length=310

 Score = 59.7 bits (143),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = +3

Query  6    GKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            G + +VVS+TCSKR D M ++C   E L +++I+ANIT+ +G L+ T+F+EV
Sbjct  228  GDRVLVVSVTCSKRRDAMARVCRALEELRLRVITANITSVAGCLMHTLFVEV  279



>ref|NP_001052406.1| Os04g0301500 [Oryza sativa Japonica Group]
 dbj|BAF14320.1| Os04g0301500 [Oryza sativa Japonica Group]
 dbj|BAH01225.1| unnamed protein product [Oryza sativa Japonica Group]
Length=310

 Score = 59.7 bits (143),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = +3

Query  6    GKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            G + +VVS+TCSKR D M ++C   E L +++I+ANIT+ +G L+ T+F+EV
Sbjct  228  GDRVLVVSVTCSKRRDAMARVCRALEELRLRVITANITSVAGCLMHTLFVEV  279



>ref|XP_004975235.1| PREDICTED: transcription factor bHLH35-like isoform X2 [Setaria 
italica]
Length=242

 Score = 58.2 bits (139),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            +G++ +VVS+TC+KR D M ++C   E L +++I+A+ITA +G L+ TVF+EV
Sbjct  159  VGERLLVVSVTCAKRRDAMAQVCRAIEELRLRVITASITAVAGCLMHTVFVEV  211



>ref|XP_010928971.1| PREDICTED: transcription factor bHLH35-like [Elaeis guineensis]
Length=291

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 40/53 (75%), Gaps = 1/53 (2%)
 Frame = +3

Query  3    MGKKTVVVSLTCSK-RTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIE  158
            +  +T+V++ TC K R DT+ K+CE+FESL++ II+ANIT+  G L  T+F+E
Sbjct  213  VDNRTLVINFTCKKTRRDTLTKMCEVFESLNLNIIAANITSNPGSLSHTLFVE  265



>ref|XP_004975234.1| PREDICTED: transcription factor bHLH35-like isoform X1 [Setaria 
italica]
Length=274

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            +G++ +VVS+TC+KR D M ++C   E L +++I+A+ITA +G L+ TVF+EV
Sbjct  191  VGERLLVVSVTCAKRRDAMAQVCRAIEELRLRVITASITAVAGCLMHTVFVEV  243



>gb|EMT28703.1| hypothetical protein F775_52582 [Aegilops tauschii]
Length=296

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            + +K +VVS+TCSK+ D M K+C   E L +++I+ANIT+ SG L+ T+F+EV
Sbjct  212  VSEKVLVVSVTCSKQRDAMTKVCRALEELRLRVITANITSVSGCLMHTLFVEV  264



>dbj|BAC66785.1| Transcription Factor [Oryza sativa]
Length=310

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = +3

Query  6    GKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            G + +VVS+TCSKR D M ++C   E L +++I+ANIT+ +G  + T+F+EV
Sbjct  228  GDRVLVVSVTCSKRRDAMARVCRALEELRLRVITANITSVAGCPMHTLFVEV  279



>gb|ACU17597.1| unknown [Glycine max]
Length=220

 Score = 55.5 bits (132),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIK  98
            MG+KT VVSLTCSKRTDTM+KLC +FESL +K
Sbjct  168  MGEKTFVVSLTCSKRTDTMVKLCAVFESLKLK  199



>ref|XP_010913730.1| PREDICTED: transcription factor bHLH35-like isoform X2 [Elaeis 
guineensis]
Length=235

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIE  158
            +G K   +S TC+K+ D ++K+CE+F SL++ II+ANIT+ S  L   +FIE
Sbjct  158  VGNKNFSISFTCNKKRDALIKMCEVFASLNLNIITANITSSSESLSHMLFIE  209



>ref|XP_010913729.1| PREDICTED: transcription factor bHLH35-like isoform X1 [Elaeis 
guineensis]
Length=236

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIE  158
            +G K   +S TC+K+ D ++K+CE+F SL++ II+ANIT+ S  L   +FIE
Sbjct  159  VGNKNFSISFTCNKKRDALIKMCEVFASLNLNIITANITSSSESLSHMLFIE  210



>gb|AFW57967.1| putative HLH DNA-binding domain superfamily protein [Zea mays]
Length=329

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            +G   +VVS+TC KR D M ++C   E L +++I+AN+T+ +G  + TVF+EV
Sbjct  247  VGDHVLVVSVTCRKRRDAMARVCRAIEDLRLRVITANVTSVAGCHVHTVFVEV  299



>gb|EPS72893.1| hypothetical protein M569_01864 [Genlisea aurea]
Length=146

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 43/55 (78%), Gaps = 3/55 (5%)
 Frame = +3

Query  3    MGKKTVVVSLT-CSKR-TDTMMKLCEIFESLDIKIISANITAFSGRLL-KTVFIE  158
            +G+KT++VSLT CSKR  D ++++C +FE L++KII+AN+TA    LL  T+FI+
Sbjct  69   VGEKTIIVSLTSCSKRREDALIQICHVFELLNLKIITANLTALRDNLLTTTIFIQ  123



>gb|ACN33600.1| unknown [Zea mays]
 gb|AFW57968.1| putative HLH DNA-binding domain superfamily protein [Zea mays]
 gb|AIB05517.1| bHLH transcription factor, partial [Zea mays]
Length=262

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            +G   +VVS+TC KR D M ++C   E L +++I+AN+T+ +G  + TVF+EV
Sbjct  176  VGDHVLVVSVTCRKRRDAMARVCRAIEDLRLRVITANVTSVAGCHVHTVFVEV  228



>ref|NP_001147498.1| DNA binding like [Zea mays]
 gb|ACG27738.1| DNA binding like [Zea mays]
Length=264

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            +G   +VVS+TC KR D M ++C   E L +++I+AN+T+ +G  + TVF+EV
Sbjct  178  VGDHVLVVSVTCRKRRDAMARVCRAIEDLRLRVITANVTSVAGCHVHTVFVEV  230



>ref|XP_004239187.1| PREDICTED: transcription factor bHLH35 isoform X1 [Solanum lycopersicum]
Length=231

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            M  + VVV+LTC KR DTM+KLC++FESL+IKII+ NI A+S  LL T +IE 
Sbjct  151  MRDRIVVVNLTCIKRKDTMIKLCDVFESLNIKIITTNIIAYSETLLNTTYIEA  203



>gb|EMT26156.1| Transcription factor bHLH35 [Aegilops tauschii]
Length=125

 Score = 51.2 bits (121),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = +3

Query  6    GKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIE  158
            G K +VVS+ C  R D M K+C + +SL + IISAN+T  SG +  T  ++
Sbjct  43   GDKLLVVSVACRHRKDAMAKVCRVLQSLQLAIISANVTVASGTVTHTALLQ  93



>ref|XP_006653253.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor bHLH35-like 
[Oryza brachyantha]
Length=260

 Score = 53.1 bits (126),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = +3

Query  6    GKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIE  158
            G++T+ VS+ C++  D M+K+C   E+L +K++SAN+ A  G ++ T+F++
Sbjct  186  GERTMAVSIRCARTRDAMVKVCRAMEALRLKVVSANVAAVDGSIVHTMFVQ  236



>ref|XP_008661887.1| PREDICTED: DNA binding like isoform X1 [Zea mays]
Length=340

 Score = 53.1 bits (126),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIE  158
            +G   +VVS+TC KR D M ++C   E L +++I+AN+T+ +G  + TVF+E
Sbjct  176  VGDHVLVVSVTCRKRRDAMARVCRAIEDLRLRVITANVTSVAGCHVHTVFVE  227



>gb|EEE60703.1| hypothetical protein OsJ_14194 [Oryza sativa Japonica Group]
Length=268

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            +G+KTV VS+ C+K    M K+C   ESL +K++SA++ A  G ++ T+F+EV
Sbjct  214  VGEKTVAVSIRCAKTRGAMAKVCHAVESLYLKVVSASVAAVDGTIVHTMFVEV  266



>gb|AFW57244.1| putative HLH DNA-binding domain superfamily protein [Zea mays]
Length=258

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/53 (40%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            +G + +VV++TCSK  D M ++C   E L +++I+A++T+ +G L+ T+F+EV
Sbjct  171  VGDRVLVVNVTCSKGRDAMARVCRAVEELRLRVITASVTSVAGCLMHTIFVEV  223



>gb|AIB05458.1| bHLH transcription factor, partial [Zea mays]
Length=258

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/53 (40%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            +G + +VV++TCSK  D M ++C   E L +++I+A++T+ +G L+ T+F+EV
Sbjct  171  VGDRVLVVNVTCSKGRDAMARVCRAVEELRLRVITASVTSVAGCLMHTIFVEV  223



>ref|NP_001151185.1| DNA binding like [Zea mays]
 gb|ACG41902.1| DNA binding like [Zea mays]
Length=261

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/53 (40%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            +G + +VV++TCSK  D M ++C   E L +++I+A++T+ +G L+ T+F+EV
Sbjct  174  VGDRVLVVNVTCSKGRDAMARVCRAVEELRLRVITASVTSVAGCLMHTIFVEV  226



>gb|EEC76984.1| hypothetical protein OsI_15289 [Oryza sativa Indica Group]
Length=285

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = +3

Query  6    GKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIE  158
            G+KTV VS+ C+K    M K+C   ESL +K++SA++ A  G ++ T+F+E
Sbjct  213  GEKTVAVSIRCAKTRGAMAKVCHAVESLHLKVVSASVAAVDGTIVHTMFVE  263



>ref|NP_001173851.1| Os04g0300600 [Oryza sativa Japonica Group]
 emb|CAE05570.2| OSJNBb0013O03.11 [Oryza sativa Japonica Group]
 dbj|BAH92579.1| Os04g0300600 [Oryza sativa Japonica Group]
Length=293

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            +G+KTV VS+ C+K    M K+C   ESL +K++SA++ A  G ++ T+F+EV
Sbjct  239  VGEKTVAVSIRCAKTRGAMAKVCHAVESLYLKVVSASVAAVDGTIVHTMFVEV  291



>ref|XP_004975237.1| PREDICTED: transcription factor bHLH35-like isoform X2 [Setaria 
italica]
Length=255

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            +G++ +VVS+TC K  D M ++C   E L +++I+A+IT+ +G L+ T+F+EV
Sbjct  194  VGERVLVVSVTCGKGRDAMARVCRAVEELRLRVITASITSVAGCLMHTIFVEV  246



>ref|XP_006845790.1| hypothetical protein AMTR_s00019p00254380 [Amborella trichopoda]
 gb|ERN07465.1| hypothetical protein AMTR_s00019p00254380 [Amborella trichopoda]
Length=248

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIE  158
            MG+KT VV ++C K  + M  L   FESL ++II+A+ TA  G + KTVF+E
Sbjct  196  MGEKTFVVRISCLKGRNAMANLFRAFESLKLRIITASTTAMHGHIFKTVFVE  247



>ref|XP_004975236.1| PREDICTED: transcription factor bHLH35-like isoform X1 [Setaria 
italica]
Length=277

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = +3

Query  6    GKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            G++ +VVS+TC K  D M ++C   E L +++I+A+IT+ +G L+ T+F+EV
Sbjct  194  GERVLVVSVTCGKGRDAMARVCRAVEELRLRVITASITSVAGCLMHTIFVEV  245



>gb|EMT26157.1| Transcription factor bHLH35 [Aegilops tauschii]
Length=292

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = +3

Query  6    GKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIE  158
            G K +VVS+ C  R D M K+C  FESL + +ISAN+T  SG +  T  ++
Sbjct  213  GDKLLVVSVACRHRKDAMGKVCRAFESLRLAVISANVTVASGTVTHTALLQ  263



>ref|XP_002445107.1| hypothetical protein SORBIDRAFT_07g004190 [Sorghum bicolor]
 gb|EES14602.1| hypothetical protein SORBIDRAFT_07g004190 [Sorghum bicolor]
Length=288

 Score = 50.4 bits (119),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 21/53 (40%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            +G + +VV++TC K  D M ++C   E L +++I+A+IT+ +G L+ T+F+EV
Sbjct  203  VGDRVLVVNVTCGKGRDAMARVCRAVEELRLRVITASITSVAGCLMHTIFVEV  255



>ref|XP_009418561.1| PREDICTED: transcription factor bHLH35-like isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=264

 Score = 50.1 bits (118),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 20/53 (38%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            +G    V+ +TCSK+   M+++CE+ ESLD++I++A++ + SG +  T+ +EV
Sbjct  167  LGNGISVIIITCSKKRHAMVRVCEVVESLDLRIVAASVASRSGMVFHTLMVEV  219



>ref|XP_009418559.1| PREDICTED: transcription factor bHLH35-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=284

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/53 (38%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            +G    V+ +TCSK+   M+++CE+ ESLD++I++A++ + SG +  T+ +EV
Sbjct  187  LGNGISVIIITCSKKRHAMVRVCEVVESLDLRIVAASVASRSGMVFHTLMVEV  239



>ref|XP_009418562.1| PREDICTED: transcription factor bHLH35-like isoform X4 [Musa 
acuminata subsp. malaccensis]
Length=259

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/53 (38%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            +G    V+ +TCSK+   M+++CE+ ESLD++I++A++ + SG +  T+ +EV
Sbjct  162  LGNGISVIIITCSKKRHAMVRVCEVVESLDLRIVAASVASRSGMVFHTLMVEV  214



>ref|XP_002452037.1| hypothetical protein SORBIDRAFT_04g017390 [Sorghum bicolor]
 gb|EES05013.1| hypothetical protein SORBIDRAFT_04g017390 [Sorghum bicolor]
Length=282

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = +3

Query  6    GKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIE  158
            G K +VVS+ C+ R D + K+C   + L +++I+AN+TA SG ++ T  ++
Sbjct  198  GDKVLVVSVACTHRRDAVAKVCRALDGLRLRVIAANVTAASGTVMHTALVQ  248



>ref|XP_010667302.1| PREDICTED: transcription factor bHLH35-like [Beta vulgaris subsp. 
vulgaris]
Length=250

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIEV  161
            +G + V+VSL+C  +   ++KLCE+ ESL +K+ +A+IT    ++LKTV++E 
Sbjct  177  VGGRIVIVSLSCVNKKGILVKLCEMLESLKLKVTTAHITVVGPKILKTVYVEA  229



>ref|XP_004952451.1| PREDICTED: transcription factor bHLH35-like isoform X1 [Setaria 
italica]
Length=287

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = +3

Query  6    GKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIE  158
            G K +VVS+ C  R D + K+C   E L +++I+AN+TA SG +  T  ++
Sbjct  204  GDKVLVVSVACRHRRDAVAKVCRALEGLRLRVIAANVTAASGTVTHTALVQ  254



>gb|EMS52276.1| hypothetical protein TRIUR3_12196 [Triticum urartu]
Length=197

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = +3

Query  6    GKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIE  158
            G K +VVS+ C  R D M K+C   +SL + +ISAN+T  SG +  T  ++
Sbjct  117  GDKLLVVSVACRHRKDAMGKVCRALQSLRLAVISANVTVASGTVTHTALLQ  167



>ref|XP_009418560.1| PREDICTED: transcription factor bHLH35-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=282

 Score = 47.0 bits (110),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 18/52 (35%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = +3

Query  3    MGKKTVVVSLTCSKRTDTMMKLCEIFESLDIKIISANITAFSGRLLKTVFIE  158
            +G    V+ +TCSK+   M+++CE+ ESLD++I++A++ + SG +  T+ ++
Sbjct  187  LGNGISVIIITCSKKRHAMVRVCEVVESLDLRIVAASVASRSGMVFHTLMVD  238



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 563429479010