BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002E03

Length=320
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010101665.1|  putative isoaspartyl peptidase/L-asparaginase 2    170   3e-49   Morus notabilis
pdb|4PU6|A  Chain A, Crystal Structure Of Potassium-dependent Pla...    166   4e-49   Phaseolus vulgaris [French bean]
ref|XP_010270964.1|  PREDICTED: probable isoaspartyl peptidase/L-...    169   9e-49   Nelumbo nucifera [Indian lotus]
ref|XP_009586844.1|  PREDICTED: probable isoaspartyl peptidase/L-...    169   1e-48   Nicotiana tomentosiformis
ref|XP_009774504.1|  PREDICTED: probable isoaspartyl peptidase/L-...    168   2e-48   Nicotiana sylvestris
dbj|BAC66615.1|  L-asparaginase                                         168   2e-48   Glycine max [soybeans]
gb|ACF74335.1|  L-asparaginase                                          165   3e-48   Arachis hypogaea [goober]
ref|XP_010244253.1|  PREDICTED: probable isoaspartyl peptidase/L-...    167   4e-48   Nelumbo nucifera [Indian lotus]
ref|XP_007160884.1|  hypothetical protein PHAVU_001G025000g             167   4e-48   Phaseolus vulgaris [French bean]
gb|AGZ15413.1|  L-asparaginase                                          167   5e-48   Phaseolus vulgaris [French bean]
gb|EPS68558.1|  hypothetical protein M569_06206                         166   7e-48   Genlisea aurea
ref|XP_006354842.1|  PREDICTED: probable isoaspartyl peptidase/L-...    166   1e-47   Solanum tuberosum [potatoes]
ref|XP_003550318.1|  PREDICTED: probable isoaspartyl peptidase/L-...    166   1e-47   Glycine max [soybeans]
ref|XP_004238125.1|  PREDICTED: probable isoaspartyl peptidase/L-...    166   1e-47   
ref|NP_001236606.1|  L-asparaginase                                     166   2e-47   
emb|CBI19471.3|  unnamed protein product                                165   2e-47   Vitis vinifera
gb|KJB59852.1|  hypothetical protein B456_009G276200                    166   2e-47   Gossypium raimondii
ref|XP_002510160.1|  l-asparaginase, putative                           165   2e-47   Ricinus communis
ref|XP_002285006.1|  PREDICTED: probable isoaspartyl peptidase/L-...    165   2e-47   Vitis vinifera
ref|XP_007017138.1|  N-terminal nucleophile aminohydrolases (Ntn ...    165   3e-47   Theobroma cacao [chocolate]
ref|XP_008220275.1|  PREDICTED: probable isoaspartyl peptidase/L-...    164   5e-47   Prunus mume [ume]
ref|XP_007222672.1|  hypothetical protein PRUPE_ppa008583mg             164   6e-47   Prunus persica
ref|XP_009360082.1|  PREDICTED: probable isoaspartyl peptidase/L-...    164   7e-47   Pyrus x bretschneideri [bai li]
ref|XP_008377997.1|  PREDICTED: LOW QUALITY PROTEIN: probable iso...    164   7e-47   Malus domestica [apple tree]
ref|XP_008360985.1|  PREDICTED: probable isoaspartyl peptidase/L-...    164   8e-47   Malus domestica [apple tree]
ref|XP_011029297.1|  PREDICTED: probable isoaspartyl peptidase/L-...    163   1e-46   Populus euphratica
ref|XP_002320760.2|  L-asparaginase family protein                      163   1e-46   
ref|XP_003589126.1|  L-asparaginase                                     163   2e-46   Medicago truncatula
gb|KJB58572.1|  hypothetical protein B456_009G215700                    162   2e-46   Gossypium raimondii
gb|KHG29402.1|  hypothetical protein F383_14115                         162   2e-46   Gossypium arboreum [tree cotton]
gb|KDO84066.1|  hypothetical protein CISIN_1g020250mg                   162   2e-46   Citrus sinensis [apfelsine]
ref|XP_006434701.1|  hypothetical protein CICLE_v10001812mg             162   2e-46   Citrus clementina [clementine]
ref|XP_002302429.1|  L-asparaginase family protein                      162   3e-46   
ref|XP_009354155.1|  PREDICTED: probable isoaspartyl peptidase/L-...    162   4e-46   Pyrus x bretschneideri [bai li]
ref|XP_010503884.1|  PREDICTED: probable isoaspartyl peptidase/L-...    162   4e-46   Camelina sativa [gold-of-pleasure]
gb|KHG11184.1|  hypothetical protein F383_13364                         162   5e-46   Gossypium arboreum [tree cotton]
emb|CDP01286.1|  unnamed protein product                                161   6e-46   Coffea canephora [robusta coffee]
ref|XP_006406871.1|  hypothetical protein EUTSA_v10021131mg             161   6e-46   Eutrema salsugineum [saltwater cress]
ref|XP_010465623.1|  PREDICTED: probable isoaspartyl peptidase/L-...    161   6e-46   Camelina sativa [gold-of-pleasure]
ref|XP_002882982.1|  hypothetical protein ARALYDRAFT_479069             161   6e-46   
emb|CDY30139.1|  BnaC05g37230D                                          161   6e-46   Brassica napus [oilseed rape]
emb|CDY20183.1|  BnaA01g28190D                                          161   7e-46   Brassica napus [oilseed rape]
gb|KDP41685.1|  hypothetical protein JCGZ_16092                         161   8e-46   Jatropha curcas
emb|CDY28378.1|  BnaC01g35480D                                          161   8e-46   Brassica napus [oilseed rape]
ref|NP_566536.1|  probable isoaspartyl peptidase/L-asparaginase 2       161   8e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009146165.1|  PREDICTED: probable isoaspartyl peptidase/L-...    161   8e-46   Brassica rapa
ref|XP_010556428.1|  PREDICTED: probable isoaspartyl peptidase/L-...    161   9e-46   Tarenaya hassleriana [spider flower]
ref|XP_010487465.1|  PREDICTED: probable isoaspartyl peptidase/L-...    161   9e-46   Camelina sativa [gold-of-pleasure]
ref|XP_011017156.1|  PREDICTED: probable isoaspartyl peptidase/L-...    161   9e-46   Populus euphratica
ref|XP_006473269.1|  PREDICTED: probable isoaspartyl peptidase/L-...    161   1e-45   Citrus sinensis [apfelsine]
gb|KHG16262.1|  hypothetical protein F383_23830                         160   1e-45   Gossypium arboreum [tree cotton]
ref|XP_010061715.1|  PREDICTED: probable isoaspartyl peptidase/L-...    160   1e-45   Eucalyptus grandis [rose gum]
ref|XP_006298133.1|  hypothetical protein CARUB_v10014177mg             160   1e-45   Capsella rubella
ref|XP_009114923.1|  PREDICTED: probable isoaspartyl peptidase/L-...    160   1e-45   Brassica rapa
gb|KJB29444.1|  hypothetical protein B456_005G101000                    160   2e-45   Gossypium raimondii
ref|XP_004499019.1|  PREDICTED: probable isoaspartyl peptidase/L-...    160   2e-45   Cicer arietinum [garbanzo]
gb|KJB63904.1|  hypothetical protein B456_010G023000                    160   2e-45   Gossypium raimondii
ref|XP_007136713.1|  hypothetical protein PHAVU_009G067800g             159   4e-45   Phaseolus vulgaris [French bean]
gb|ABC01060.1|  L-asparaginase 2                                        159   4e-45   Phaseolus vulgaris [French bean]
ref|XP_004291067.1|  PREDICTED: probable isoaspartyl peptidase/L-...    159   8e-45   Fragaria vesca subsp. vesca
gb|KFK38965.1|  hypothetical protein AALP_AA3G183000                    156   6e-44   Arabis alpina [alpine rockcress]
ref|XP_008796480.1|  PREDICTED: probable isoaspartyl peptidase/L-...    156   8e-44   Phoenix dactylifera
ref|XP_010688589.1|  PREDICTED: probable isoaspartyl peptidase/L-...    155   1e-43   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010932217.1|  PREDICTED: probable isoaspartyl peptidase/L-...    155   1e-43   Elaeis guineensis
ref|XP_010927509.1|  PREDICTED: probable isoaspartyl peptidase/L-...    155   2e-43   Elaeis guineensis
ref|XP_004501550.1|  PREDICTED: probable isoaspartyl peptidase/L-...    155   2e-43   Cicer arietinum [garbanzo]
ref|XP_003603098.1|  L-asparaginase                                     155   2e-43   Medicago truncatula
ref|XP_003525910.1|  PREDICTED: probable isoaspartyl peptidase/L-...    154   5e-43   Glycine max [soybeans]
gb|AGV54259.1|  isoaspartyl peptidase/L-asparaginase 2                  154   6e-43   Phaseolus vulgaris [French bean]
gb|AES62108.2|  isoaspartyl peptidase/L-asparaginase                    152   1e-42   Medicago truncatula
gb|KHN04475.1|  Putative isoaspartyl peptidase/L-asparaginase 2         152   3e-42   Glycine soja [wild soybean]
ref|NP_001276238.1|  probable isoaspartyl peptidase/L-asparaginas...    152   3e-42   
ref|XP_008452604.1|  PREDICTED: probable isoaspartyl peptidase/L-...    150   2e-41   Cucumis melo [Oriental melon]
ref|XP_009418804.1|  PREDICTED: probable isoaspartyl peptidase/L-...    150   2e-41   
ref|XP_008796739.1|  PREDICTED: LOW QUALITY PROTEIN: probable iso...    150   2e-41   
gb|ABK22246.1|  unknown                                                 150   3e-41   Picea sitchensis
gb|KGN55235.1|  L-asparaginase                                          148   3e-41   Cucumis sativus [cucumbers]
ref|XP_004141273.1|  PREDICTED: probable isoaspartyl peptidase/L-...    148   6e-41   Cucumis sativus [cucumbers]
emb|CAK22360.1|  L-asparaginase                                         149   1e-40   Pinus sylvestris [Scotch pine]
tpg|DAA35670.1|  TPA: L-asparaginase-like family protein                142   4e-40   
emb|CAE04504.1|  OSJNBb0059K02.14                                       145   8e-40   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ32226.1|  hypothetical protein OsJ_16431                          145   8e-40   Oryza sativa Japonica Group [Japonica rice]
emb|CAC09349.1|  H0212B02.13                                            145   9e-40   Oryza sativa [red rice]
ref|XP_009413335.1|  PREDICTED: probable isoaspartyl peptidase/L-...    145   1e-39   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004977053.1|  PREDICTED: probable isoaspartyl peptidase/L-...    144   4e-39   Setaria italica
ref|XP_003580704.1|  PREDICTED: probable isoaspartyl peptidase/L-...    144   5e-39   Brachypodium distachyon [annual false brome]
ref|XP_008668775.1|  PREDICTED: probable isoaspartyl peptidase/L-...    144   5e-39   
gb|AAG28786.1|AF308474_1  asparaginase                                  143   1e-38   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ99727.1|  predicted protein                                      143   1e-38   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT11957.1|  Putative isoaspartyl peptidase/L-asparaginase 2         142   1e-38   
dbj|BAJ94612.1|  predicted protein                                      142   2e-38   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002447227.1|  hypothetical protein SORBIDRAFT_06g030910          142   2e-38   Sorghum bicolor [broomcorn]
ref|XP_003591857.1|  L-asparaginase                                     139   2e-37   
ref|XP_006855727.1|  hypothetical protein AMTR_s00044p00154340          131   6e-36   
ref|XP_006828602.1|  hypothetical protein AMTR_s00129p00062240          133   4e-35   Amborella trichopoda
ref|XP_006652926.1|  PREDICTED: probable isoaspartyl peptidase/L-...    127   5e-33   Oryza brachyantha
gb|ACN73030.1|  COSII_At3g16150                                         114   1e-30   Solanum cheesmaniae
gb|ACN73040.1|  COSII_At3g16150                                         112   8e-30   Solanum corneliomuelleri
gb|ACN73048.1|  COSII_At3g16150                                         110   8e-29   Solanum dulcamara [climbing nightshade]
gb|ACN73046.1|  COSII_At3g16150                                         110   8e-29   Solanum lycopersicoides
gb|ACN73047.1|  COSII_At3g16150                                         109   1e-28   Solanum sitiens
gb|ACN73039.1|  COSII_At3g16150                                         109   1e-28   Solanum peruvianum [Peruvian tomato]
ref|XP_002266571.1|  PREDICTED: isoaspartyl peptidase/L-asparagin...    114   3e-28   Vitis vinifera
gb|KEH32053.1|  isoaspartyl peptidase/L-asparaginase                    113   2e-27   Medicago truncatula
emb|CAN82634.1|  hypothetical protein VITISV_007448                     112   2e-27   Vitis vinifera
ref|XP_006485703.1|  PREDICTED: isoaspartyl peptidase/L-asparagin...    110   3e-27   
dbj|BAK02243.1|  predicted protein                                      111   5e-27   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_196427.1|  asparaginase                                          111   6e-27   Arabidopsis thaliana [mouse-ear cress]
emb|CAA84367.1|  asparaginase                                           111   6e-27   Arabidopsis thaliana [mouse-ear cress]
gb|KEH32051.1|  isoaspartyl peptidase/L-asparaginase                    110   8e-27   Medicago truncatula
gb|KDO65650.1|  hypothetical protein CISIN_1g0244722mg                  105   9e-27   Citrus sinensis [apfelsine]
ref|XP_002873339.1|  L-asparaginase                                     110   1e-26   Arabidopsis lyrata subsp. lyrata
ref|XP_006440815.1|  hypothetical protein CICLE_v10021205mg             110   1e-26   Citrus clementina [clementine]
ref|XP_010257935.1|  PREDICTED: isoaspartyl peptidase/L-asparagin...    110   2e-26   Nelumbo nucifera [Indian lotus]
ref|XP_006399296.1|  hypothetical protein EUTSA_v10014145mg             109   2e-26   Eutrema salsugineum [saltwater cress]
ref|XP_004508653.1|  PREDICTED: isoaspartyl peptidase/L-asparagin...    109   3e-26   Cicer arietinum [garbanzo]
emb|CDO98550.1|  unnamed protein product                                109   3e-26   Coffea canephora [robusta coffee]
ref|XP_009631666.1|  PREDICTED: isoaspartyl peptidase/L-asparagin...    108   4e-26   Nicotiana tomentosiformis
ref|XP_006289635.1|  hypothetical protein CARUB_v10003195mg             108   5e-26   Capsella rubella
ref|NP_001241157.1|  uncharacterized protein LOC100799400               108   6e-26   Glycine max [soybeans]
gb|EPS61830.1|  hypothetical protein M569_12962                         108   7e-26   Genlisea aurea
ref|XP_010452785.1|  PREDICTED: isoaspartyl peptidase/L-asparagin...    108   8e-26   Camelina sativa [gold-of-pleasure]
gb|AFK38769.1|  unknown                                                 108   8e-26   Medicago truncatula
ref|XP_010546212.1|  PREDICTED: isoaspartyl peptidase/L-asparagin...    108   8e-26   Tarenaya hassleriana [spider flower]
ref|XP_001776678.1|  predicted protein                                  107   1e-25   
ref|XP_010491430.1|  PREDICTED: isoaspartyl peptidase/L-asparagin...    108   1e-25   Camelina sativa [gold-of-pleasure]
ref|XP_008450657.1|  PREDICTED: isoaspartyl peptidase/L-asparagin...    108   1e-25   Cucumis melo [Oriental melon]
ref|XP_010423136.1|  PREDICTED: isoaspartyl peptidase/L-asparagin...    107   1e-25   Camelina sativa [gold-of-pleasure]
ref|XP_003562316.1|  PREDICTED: isoaspartyl peptidase/L-asparagin...    107   1e-25   Brachypodium distachyon [annual false brome]
ref|XP_009387638.1|  PREDICTED: isoaspartyl peptidase/L-asparagin...    107   2e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008811641.1|  PREDICTED: isoaspartyl peptidase/L-asparagin...    107   2e-25   Phoenix dactylifera
emb|CDX69978.1|  BnaA10g23270D                                          106   4e-25   
emb|CDY21508.1|  BnaC09g47840D                                          106   4e-25   Brassica napus [oilseed rape]
ref|XP_004135623.1|  PREDICTED: isoaspartyl peptidase/L-asparagin...    105   5e-25   Cucumis sativus [cucumbers]
gb|EMT01892.1|  Isoaspartyl peptidase/L-asparaginase                    108   6e-25   
ref|XP_010678369.1|  PREDICTED: isoaspartyl peptidase/L-asparagin...    105   6e-25   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004166036.1|  PREDICTED: isoaspartyl peptidase/L-asparagin...    105   6e-25   
ref|XP_006345098.1|  PREDICTED: isoaspartyl peptidase/L-asparagin...    105   8e-25   Solanum tuberosum [potatoes]
gb|KHN22484.1|  Putative isoaspartyl peptidase/L-asparaginase 2         100   8e-25   Glycine soja [wild soybean]
gb|KFK25178.1|  hypothetical protein AALP_AA8G076700                    105   1e-24   Arabis alpina [alpine rockcress]
ref|XP_011014964.1|  PREDICTED: isoaspartyl peptidase/L-asparagin...    105   1e-24   Populus euphratica
ref|XP_010906197.1|  PREDICTED: isoaspartyl peptidase/L-asparagin...    105   1e-24   
ref|XP_009122418.1|  PREDICTED: isoaspartyl peptidase/L-asparagin...    104   1e-24   Brassica rapa
ref|XP_006650293.1|  PREDICTED: isoaspartyl peptidase/L-asparagin...    104   1e-24   Oryza brachyantha
ref|XP_004241610.1|  PREDICTED: isoaspartyl peptidase/L-asparagin...    104   2e-24   Solanum lycopersicum
ref|XP_001771151.1|  predicted protein                                  104   2e-24   
ref|XP_011086915.1|  PREDICTED: isoaspartyl peptidase/L-asparagin...    104   2e-24   Sesamum indicum [beniseed]
ref|XP_002514609.1|  l-asparaginase, putative                           104   2e-24   Ricinus communis
ref|XP_007209366.1|  hypothetical protein PRUPE_ppa008761mg             104   2e-24   Prunus persica
ref|XP_006376770.1|  hypothetical protein POPTR_0012s06250g             103   3e-24   Populus trichocarpa [western balsam poplar]
gb|KJB51088.1|  hypothetical protein B456_008G200400                    103   4e-24   Gossypium raimondii
gb|KJB51085.1|  hypothetical protein B456_008G200400                    103   5e-24   Gossypium raimondii
ref|XP_009596886.1|  PREDICTED: isoaspartyl peptidase/L-asparagin...    103   5e-24   Nicotiana tomentosiformis
gb|KJB51084.1|  hypothetical protein B456_008G200400                    103   5e-24   Gossypium raimondii
ref|XP_007155205.1|  hypothetical protein PHAVU_003G182400g             103   5e-24   Phaseolus vulgaris [French bean]
emb|CDY21509.1|  BnaC09g47830D                                          103   5e-24   Brassica napus [oilseed rape]
gb|KJB39962.1|  hypothetical protein B456_007G040100                    103   5e-24   Gossypium raimondii
ref|XP_006442273.1|  hypothetical protein CICLE_v10023475mg             100   5e-24   
ref|XP_004299276.1|  PREDICTED: isoaspartyl peptidase/L-asparagin...    103   6e-24   Fragaria vesca subsp. vesca
ref|XP_008240074.1|  PREDICTED: isoaspartyl peptidase/L-asparagin...    103   6e-24   Prunus mume [ume]
ref|XP_009122419.1|  PREDICTED: isoaspartyl peptidase/L-asparagin...    102   7e-24   Brassica rapa
ref|NP_001050607.1|  Os03g0597600                                       102   8e-24   
gb|AAO59983.1|  putative L-asparaginase                                 102   8e-24   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010232895.1|  PREDICTED: isoaspartyl peptidase/L-asparagin...    102   9e-24   
ref|XP_006828428.1|  hypothetical protein AMTR_s00060p00098750        99.4    9e-24   
gb|EEC75690.1|  hypothetical protein OsI_12500                          102   1e-23   Oryza sativa Indica Group [Indian rice]
ref|XP_010031115.1|  PREDICTED: isoaspartyl peptidase/L-asparagin...    102   1e-23   Eucalyptus grandis [rose gum]
gb|EYU23631.1|  hypothetical protein MIMGU_mgv1a010176mg                102   2e-23   Erythranthe guttata [common monkey flower]
ref|XP_010101648.1|  Isoaspartyl peptidase/L-asparaginase 1             101   2e-23   Morus notabilis
gb|KHF98766.1|  hypothetical protein F383_16974                         101   2e-23   Gossypium arboreum [tree cotton]
ref|XP_010031103.1|  PREDICTED: isoaspartyl peptidase/L-asparagin...    101   2e-23   Eucalyptus grandis [rose gum]
gb|KDP31384.1|  hypothetical protein JCGZ_11760                         101   2e-23   Jatropha curcas
pdb|2GEZ|A  Chain A, Crystal Structure Of Potassium-Independent P...  99.4    3e-23   Lupinus luteus
ref|XP_004982478.1|  PREDICTED: isoaspartyl peptidase/L-asparagin...    101   3e-23   
gb|EYU36320.1|  hypothetical protein MIMGU_mgv11b023434mg             96.3    3e-23   Erythranthe guttata [common monkey flower]
ref|XP_004982477.1|  PREDICTED: isoaspartyl peptidase/L-asparagin...    100   4e-23   Setaria italica
ref|XP_008240025.1|  PREDICTED: LOW QUALITY PROTEIN: isoaspartyl ...    100   4e-23   Prunus mume [ume]
ref|XP_007037644.1|  N-terminal nucleophile aminohydrolases (Ntn ...    100   5e-23   Theobroma cacao [chocolate]
sp|P30364.1|ASPG_LUPAN  RecName: Full=Isoaspartyl peptidase/L-asp...    100   5e-23   Lupinus angustifolius
ref|XP_008450655.1|  PREDICTED: isoaspartyl peptidase/L-asparagin...    100   5e-23   
ref|XP_009785994.1|  PREDICTED: isoaspartyl peptidase/L-asparagin...    100   5e-23   Nicotiana sylvestris
gb|ACN32623.1|  L-asparaginase                                        99.4    1e-22   Withania somnifera [ashwagandha]
sp|P50288.1|ASPG_LUPAL  RecName: Full=Isoaspartyl peptidase/L-asp...  99.8    1e-22   Lupinus albus
sp|Q9ZSD6.1|ASPG_LUPLU  RecName: Full=Isoaspartyl peptidase/L-asp...  99.4    2e-22   Lupinus luteus
ref|NP_001149875.1|  transposon protein                               98.6    3e-22   Zea mays [maize]
ref|XP_008374666.1|  PREDICTED: isoaspartyl peptidase/L-asparagin...  97.8    5e-22   Malus domestica [apple tree]
gb|KJB51090.1|  hypothetical protein B456_008G200400                  97.4    7e-22   Gossypium raimondii
ref|XP_004236074.1|  PREDICTED: isoaspartyl peptidase/L-asparaginase  97.4    7e-22   Solanum lycopersicum
gb|KJB51083.1|  hypothetical protein B456_008G200400                  97.4    7e-22   Gossypium raimondii
ref|XP_001753813.1|  predicted protein                                96.3    2e-21   
ref|XP_008374665.1|  PREDICTED: isoaspartyl peptidase/L-asparagin...  95.9    2e-21   
ref|XP_002990172.1|  hypothetical protein SELMODRAFT_160700           95.5    3e-21   Selaginella moellendorffii
ref|XP_009346265.1|  PREDICTED: isoaspartyl peptidase/L-asparagin...  95.1    4e-21   Pyrus x bretschneideri [bai li]
ref|XP_009346253.1|  PREDICTED: isoaspartyl peptidase/L-asparagin...  94.4    1e-20   Pyrus x bretschneideri [bai li]
ref|XP_002992515.1|  hypothetical protein SELMODRAFT_236523           93.6    1e-20   Selaginella moellendorffii
ref|XP_004352518.1|  asparaginase                                     92.0    7e-20   Acanthamoeba castellanii str. Neff
ref|WP_038129740.1|  isoaspartyl peptidase                            84.0    4e-17   
ref|WP_022824798.1|  asparaginase                                     83.6    5e-17   Hymenobacter norwichensis
gb|KFK23966.1|  hypothetical protein AALP_AAs39002U000300             82.4    8e-17   Arabis alpina [alpine rockcress]
gb|EMS66458.1|  putative isoaspartyl peptidase/L-asparaginase 2       81.3    1e-16   Triticum urartu
gb|ABF91922.1|  asparaginase family protein                           82.4    2e-16   Myxococcus xanthus DK 1622
ref|WP_020478257.1|  asparaginase                                     82.4    3e-16   Myxococcus xanthus
ref|WP_021070783.1|  hypothetical protein                             80.9    5e-16   Sphingobacterium paucimobilis
sp|P30362.1|ASPG_LUPAR  RecName: Full=Isoaspartyl peptidase/L-asp...  80.1    1e-15   Lupinus arboreus
ref|WP_019515461.1|  hypothetical protein                             79.7    1e-15   Sphingomonas sp. Mn802worker
ref|WP_013929901.1|  asparaginase                                     79.3    2e-15   
ref|WP_013935658.1|  asparaginase                                     80.1    2e-15   Myxococcus macrosporus
ref|WP_029035777.1|  isoaspartyl peptidase                            78.6    4e-15   Salinimicrobium terrae
ref|WP_026759123.1|  isoaspartyl peptidase                            78.6    4e-15   Sediminimonas qiaohouensis
gb|EMT04919.1|  Putative isoaspartyl peptidase/L-asparaginase 2       75.9    4e-15   
ref|WP_017462721.1|  hypothetical protein                             78.6    5e-15   Dyella ginsengisoli
ref|WP_008666718.1|  isoaspartyl aminopeptidase                       79.7    5e-15   Rhodopirellula europaea
gb|ACN73049.1|  COSII_At3g16150                                       73.6    1e-14   Datura inoxia [downy thornapple]
ref|WP_008597184.1|  isoaspartyl peptidase                            77.0    1e-14   Nitratireductor pacificus
ref|WP_002635219.1|  asparaginase                                     77.8    1e-14   Myxococcus hansupus
ref|WP_031564450.1|  asparaginase                                     76.6    2e-14   Legionella wadsworthii
gb|EMB13625.1|  Asparaginase family protein                           78.2    2e-14   Rhodopirellula europaea 6C
ref|WP_007339179.1|  asparaginase family protein                      78.2    2e-14   Rhodopirellula baltica
ref|WP_011121656.1|  asparaginase                                     78.2    2e-14   Rhodopirellula baltica
ref|WP_039963566.1|  asparaginase                                     77.8    3e-14   Rhodopirellula europaea
ref|WP_028379843.1|  asparaginase                                     76.3    3e-14   Legionella cherrii
ref|XP_002443707.1|  hypothetical protein SORBIDRAFT_07g000640        75.9    3e-14   
ref|WP_010214369.1|  asparaginase                                     75.9    4e-14   Sphingomonas sp. PAMC 26621
ref|WP_044002327.1|  isoaspartyl peptidase                            75.9    4e-14   Hymenobacter swuensis
ref|WP_044017461.1|  isoaspartyl peptidase                            75.9    4e-14   Hymenobacter sp. APR13
ref|WP_012285180.1|  asparaginase                                     75.9    5e-14   Caulobacter sp. K31
ref|WP_031427028.1|  isoaspartyl peptidase                            75.5    5e-14   Flavimarina sp. Hel_I_48
ref|WP_010161672.1|  asparaginase                                     75.5    5e-14   Sphingomonas sp. PAMC 26617
ref|WP_007326981.1|  asparaginase                                     76.6    6e-14   Rhodopirellula baltica
ref|WP_026444808.1|  asparaginase                                     75.9    7e-14   Acidobacteriaceae bacterium URHE0068
ref|WP_026359875.1|  asparaginase                                     75.1    7e-14   Sphingomonas sp. PR090111-T3T-6A
ref|WP_035979508.1|  asparaginase                                     74.7    7e-14   
ref|WP_021585728.1|  asparaginase                                     74.7    8e-14   Ochrobactrum
ref|WP_042056129.1|  asparaginase                                     74.7    1e-13   
ref|WP_036514883.1|  asparaginase                                     75.1    1e-13   Oceanicaulis sp. HL-87
gb|ERS22956.1|  hypothetical protein HMPREF1301_00748                 74.3    1e-13   Propionibacterium sp. KPL2005
ref|WP_009099500.1|  peptidase T2 asparaginase 2                      75.9    1e-13   Rhodopirellula sp. SWK7
ref|WP_019671033.1|  asparaginase                                     73.9    2e-13   Eudoraea adriatica
ref|WP_015582013.1|  putative asparaginase                            74.3    2e-13   Cutibacterium avidum
ref|WP_004809461.1|  MULTISPECIES: asparaginase                       74.3    2e-13   Propionibacteriaceae
ref|WP_021107965.1|  MULTISPECIES: putative asparaginase              74.3    2e-13   Propionibacteriaceae
dbj|GAJ27960.1|  isoaspartyl peptidase/peptidase T2/asparaginase 2    74.7    2e-13   Acidomonas methanolica NBRC 104435
ref|WP_044559102.1|  asparaginase                                     74.7    2e-13   
ref|WP_018067653.1|  hypothetical protein                             73.6    2e-13   Martelella mediterranea
ref|WP_010654453.1|  asparaginase                                     73.6    2e-13   Fluoribacter dumoffii
dbj|GAL14163.1|  isoaspartyl aminopeptidase                           73.6    2e-13   Vibrio sp. C7
gb|EKJ99939.1|  peptidase T2 asparaginase 2                           75.1    2e-13   Rhodopirellula baltica SH28
ref|WP_021698251.1|  isoaspartyl aminopeptidase / Asp-X dipeptidase   74.3    2e-13   Brevundimonas abyssalis
ref|WP_037201211.1|  asparaginase                                     74.7    3e-13   Rhodopirellula baltica
ref|WP_026450921.1|  isoaspartyl peptidase                            73.2    3e-13   Aequorivita capsosiphonis
ref|WP_010405057.1|  asparaginase                                     73.2    3e-13   Sphingomonas echinoides
ref|WP_029376226.1|  hypothetical protein                             71.2    4e-13   
ref|WP_035564370.1|  isoaspartyl peptidase                            73.2    4e-13   Hymenobacter sp. IS2118
ref|WP_034259678.1|  isoaspartyl peptidase                            72.8    4e-13   Altibacter lentus
ref|WP_029418092.1|  asparaginase                                     73.6    4e-13   Brevundimonas bacteroides
dbj|GAM97716.1|  isoaspartyl aminopeptidase                           73.2    5e-13   alpha proteobacterium U9-1i
ref|WP_034955854.1|  asparaginase                                     73.2    5e-13   
ref|WP_012525549.1|  asparaginase                                     72.4    5e-13   Anaeromyxobacter sp. K
ref|WP_024706196.1|  isoaspartyl peptidase                            72.4    5e-13   Martelella sp. AD-3
ref|WP_039954582.1|  asparaginase                                     70.5    6e-13   
ref|WP_016666280.1|  beta-aspartyl-peptidase (threonine type)         72.8    6e-13   Propionibacterium sp. HGH0353
ref|WP_035385497.1|  isoaspartyl peptidase                            72.8    6e-13   Ferrimonas futtsuensis
ref|WP_027082000.1|  asparaginase                                     72.8    6e-13   Lysobacter sp. URHA0019
ref|WP_036801217.1|  asparaginase                                     73.2    6e-13   
ref|WP_014681491.1|  asparaginase                                     72.8    7e-13   Solitalea canadensis
ref|WP_022699204.1|  asparaginase                                     72.8    7e-13   Euryhalocaulis caribicus
ref|WP_019234302.1|  asparaginase                                     72.0    7e-13   Legionella anisa
ref|WP_006536744.1|  hypothetical protein                             70.5    8e-13   
ref|WP_013268124.1|  asparaginase                                     72.8    8e-13   Brevundimonas subvibrioides
gb|KEO86401.1|  asparaginase                                          72.8    8e-13   Erythrobacter sp. JL475
ref|WP_006470115.1|  asparaginase                                     72.0    9e-13   Ochrobactrum
ref|WP_034813444.1|  asparaginase                                     72.4    9e-13   Hyphomonas sp. L-53-1-40
ref|WP_042486626.1|  asparaginase                                     72.0    9e-13   
ref|XP_006434700.1|  hypothetical protein CICLE_v10001812mg           71.6    9e-13   
gb|KDO84067.1|  hypothetical protein CISIN_1g020250mg                 71.6    1e-12   Citrus sinensis [apfelsine]
ref|WP_041399821.1|  hypothetical protein                             72.0    1e-12   
emb|CEK12059.1|  Isoaspartyl peptidase/L-asparaginase                 71.6    1e-12   Legionella hackeliae
ref|WP_002629379.1|  Isoaspartyl aminopeptidase                       72.8    1e-12   Cystobacter fuscus
gb|KIU67028.1|  isoaspartyl peptidase                                 71.6    1e-12   Ochrobactrum anthropi
ref|WP_002610750.1|  asparaginase                                     72.8    1e-12   
gb|EIL95960.1|  peptidase T2 asparaginase 2                           70.1    1e-12   
ref|WP_014781721.1|  asparaginase                                     71.6    1e-12   
ref|WP_026947825.1|  isoaspartyl peptidase                            72.4    1e-12   
gb|ADY60562.1|  Beta-aspartyl-peptidase                               72.0    1e-12   
ref|WP_029926422.1|  isoaspartyl peptidase                            71.6    1e-12   
ref|WP_034482127.1|  isoaspartyl peptidase                            71.6    1e-12   
gb|ADO69581.1|  Asparaginase family protein                           72.8    1e-12   
dbj|BAK67233.1|  isoaspartyl peptidase                                72.0    1e-12   
ref|WP_040279245.1|  isoaspartyl peptidase                            71.2    2e-12   
ref|XP_010311027.1|  PREDICTED: isoaspartyl peptidase/L-asparaginase  71.6    2e-12   
gb|KFO07991.1|  Isoaspartyl peptidase/L-asparaginase                  71.6    2e-12   
ref|WP_036702819.1|  isoaspartyl peptidase                            71.2    2e-12   
ref|WP_034159907.1|  asparaginase                                     71.2    2e-12   
ref|WP_037498441.1|  asparaginase                                     71.2    2e-12   
ref|WP_036577602.1|  isoaspartyl peptidase                            68.9    2e-12   
ref|WP_043843225.1|  isoaspartyl peptidase                            70.9    2e-12   
ref|WP_012632868.1|  asparaginase                                     70.9    2e-12   
ref|WP_004242876.1|  asparaginase                                     71.6    2e-12   
ref|WP_011516162.1|  isoaspartyl peptidase                            70.9    2e-12   
ref|WP_007674727.1|  asparaginase                                     71.2    2e-12   
ref|WP_028029316.1|  isoaspartyl peptidase                            70.9    2e-12   
ref|WP_036971955.1|  isoaspartyl peptidase                            71.2    2e-12   
ref|WP_025091148.1|  isoaspartyl peptidase                            70.5    3e-12   
ref|WP_043062814.1|  isoaspartyl peptidase                            70.5    3e-12   
ref|WP_029279047.1|  isoaspartyl peptidase                            70.9    3e-12   
ref|WP_036563572.1|  isoaspartyl peptidase                            69.3    3e-12   
gb|EDL49202.1|  Asparaginase family protein                           71.2    3e-12   
dbj|GAM21702.1|  hypothetical protein SAMD00019534_048770             70.5    4e-12   
ref|WP_028786727.1|  hypothetical protein                             70.9    4e-12   
gb|KEO88513.1|  asparaginase                                          71.2    4e-12   
emb|CCG99639.1|  beta-aspartyl-peptidase (threonine type)             71.6    4e-12   
ref|WP_037536116.1|  asparaginase                                     70.1    4e-12   
ref|WP_020039631.1|  hypothetical protein                             70.1    4e-12   
ref|WP_019961999.1|  hypothetical protein                             70.9    4e-12   
ref|WP_015346819.1|  asparaginase family protein                      70.9    4e-12   
ref|WP_041374310.1|  asparaginase                                     70.5    5e-12   
ref|WP_029286785.1|  isoaspartyl peptidase                            70.5    5e-12   
ref|WP_017980664.1|  hypothetical protein                             70.1    5e-12   
gb|AAZ48940.1|  putative asparaginase                                 70.5    5e-12   
ref|WP_038665086.1|  asparaginase                                     70.1    5e-12   
gb|ACG79241.1|  asparaginase family protein                           70.5    5e-12   
gb|ETZ19905.1|  asparaginase                                          70.5    5e-12   
ref|XP_010153084.1|  PREDICTED: isoaspartyl peptidase/L-asparaginase  70.1    5e-12   
ref|WP_012566613.1|  asparaginase                                     70.5    5e-12   
gb|KFV94530.1|  Isoaspartyl peptidase/L-asparaginase                  70.1    5e-12   
ref|WP_011421418.1|  asparaginase                                     69.7    5e-12   
ref|WP_017506240.1|  asparaginase                                     70.5    5e-12   
ref|WP_014855981.1|  asparaginase                                     70.1    6e-12   
ref|WP_029685647.1|  isoaspartyl peptidase                            70.1    6e-12   
ref|WP_035882000.1|  isoaspartyl peptidase                            70.1    6e-12   
ref|WP_043347006.1|  isoaspartyl peptidase                            69.7    6e-12   
ref|WP_014111991.1|  isoaspartyl peptidase                            69.7    6e-12   
ref|WP_007139073.1|  asparaginase                                     70.1    6e-12   
ref|WP_038615622.1|  asparaginase                                     70.1    7e-12   
ref|WP_038554056.1|  isoaspartyl peptidase                            69.7    7e-12   
ref|WP_035017313.1|  asparaginase                                     70.1    7e-12   
ref|WP_041878371.1|  isoaspartyl peptidase                            70.1    7e-12   
ref|WP_017514466.1|  MULTISPECIES: isoaspartyl peptidase              69.7    7e-12   
ref|WP_036589721.1|  isoaspartyl peptidase                            69.3    7e-12   
gb|ENZ81746.1|  asparaginase                                          70.1    8e-12   
ref|XP_008635834.1|  PREDICTED: isoaspartyl peptidase/L-asparagin...  69.7    8e-12   
ref|WP_011952963.1|  MULTISPECIES: asparaginase                       69.7    8e-12   
ref|XP_009035666.1|  hypothetical protein AURANDRAFT_24129            69.7    8e-12   
ref|WP_017010453.1|  hypothetical protein                             68.9    8e-12   
ref|XP_010403848.1|  PREDICTED: isoaspartyl peptidase/L-asparaginase  69.7    8e-12   
ref|WP_029308076.1|  isoaspartyl peptidase                            69.7    8e-12   
ref|XP_008635833.1|  PREDICTED: isoaspartyl peptidase/L-asparagin...  69.7    8e-12   
ref|WP_026942775.1|  hypothetical protein                             69.7    8e-12   
ref|WP_040590526.1|  peptidase T                                      71.2    8e-12   
ref|WP_022692876.1|  asparaginase                                     69.3    8e-12   
ref|WP_039246062.1|  asparaginase                                     69.7    8e-12   
gb|ENY80360.1|  peptidase t2 asparaginase 2                           71.2    8e-12   
ref|WP_041258700.1|  isoaspartyl peptidase                            70.1    8e-12   
gb|KFO62165.1|  Isoaspartyl peptidase/L-asparaginase                  69.3    8e-12   
ref|XP_009980463.1|  PREDICTED: isoaspartyl peptidase/L-asparaginase  69.3    8e-12   
ref|WP_027273935.1|  isoaspartyl peptidase                            69.7    9e-12   
gb|KFV13897.1|  Isoaspartyl peptidase/L-asparaginase                  69.3    9e-12   
ref|WP_039479951.1|  isoaspartyl peptidase                            69.7    9e-12   
ref|XP_001655052.1|  AAEL010938-PA                                    69.7    9e-12   
gb|ABS15792.1|  peptidase T2 asparaginase 2                           69.3    9e-12   
ref|WP_040128753.1|  isoaspartyl peptidase                            69.3    9e-12   
ref|WP_036924880.1|  hypothetical protein                             69.3    9e-12   
ref|WP_024283520.1|  isoaspartyl peptidase                            69.7    9e-12   
ref|WP_027585210.1|  hypothetical protein                             69.7    9e-12   
ref|XP_003284830.1|  hypothetical protein DICPUDRAFT_86450            69.7    9e-12   
ref|WP_013480754.1|  peptidase T                                      70.9    1e-11   
ref|WP_014087697.1|  asparaginase                                     69.3    1e-11   
ref|WP_008263085.1|  asparaginase                                     69.7    1e-11   
ref|WP_017827805.1|  asparaginase                                     69.7    1e-11   
gb|KCZ93272.1|  putative asparaginase                                 69.3    1e-11   
ref|WP_013869538.1|  asparaginase                                     69.7    1e-11   
ref|WP_023582143.1|  exported L-asparaginase                          69.3    1e-11   
ref|WP_036894904.1|  isoaspartyl peptidase                            69.3    1e-11   
ref|WP_004394506.1|  peptidase                                        68.9    1e-11   
gb|EYR67010.1|  asparaginase                                          69.7    1e-11   
ref|WP_043406432.1|  asparaginase                                     69.7    1e-11   
ref|WP_036195963.1|  asparaginase                                     68.9    1e-11   
ref|WP_018478149.1|  hypothetical protein                             68.9    1e-11   
ref|WP_012695265.1|  asparaginase                                     68.9    1e-11   
gb|EAQ28085.1|  Asparaginase family protein                           69.7    1e-11   
ref|WP_023450523.1|  hypothetical protein                             68.6    1e-11   
ref|XP_009274058.1|  PREDICTED: isoaspartyl peptidase/L-asparagin...  68.6    1e-11   
ref|WP_040130221.1|  isoaspartyl peptidase                            68.9    1e-11   
ref|WP_019947258.1|  hypothetical protein                             68.9    1e-11   
ref|WP_028388303.1|  asparaginase                                     68.9    1e-11   
ref|XP_009331430.1|  PREDICTED: isoaspartyl peptidase/L-asparagin...  68.6    1e-11   
ref|WP_041251581.1|  isoaspartyl peptidase                            69.3    1e-11   
ref|WP_022822368.1|  asparaginase                                     69.7    1e-11   
ref|WP_024303192.1|  isoaspartyl peptidase                            68.9    1e-11   
ref|WP_044201602.1|  isoaspartyl peptidase                            69.3    1e-11   
ref|WP_028786895.1|  isoaspartyl peptidase                            68.9    1e-11   
ref|WP_015551865.1|  L-asparaginase                                   68.9    1e-11   
gb|ABS13359.1|  peptidase T2 asparaginase 2                           68.6    1e-11   
ref|WP_029096718.1|  isoaspartyl peptidase                            68.9    1e-11   
ref|WP_033193440.1|  asparaginase                                     68.9    2e-11   
ref|WP_028871694.1|  isoaspartyl peptidase                            68.6    2e-11   
gb|KFU97474.1|  Isoaspartyl peptidase/L-asparaginase                  67.0    2e-11   
ref|WP_020856646.1|  isoaspartyl peptidase                            68.9    2e-11   
ref|WP_044211699.1|  isoaspartyl peptidase                            68.6    2e-11   
ref|WP_044625442.1|  isoaspartyl peptidase                            69.3    2e-11   
ref|WP_036170114.1|  asparaginase                                     68.9    2e-11   
ref|WP_043879446.1|  isoaspartyl peptidase                            68.6    2e-11   
dbj|BAF88988.1|  aspartylglucosaminidase family protein               68.6    2e-11   
ref|WP_012844109.1|  asparaginase                                     68.9    2e-11   
ref|WP_036530644.1|  peptidase T                                      70.1    2e-11   
ref|WP_014066800.1|  asparaginase                                     68.9    2e-11   
ref|XP_009899977.1|  PREDICTED: isoaspartyl peptidase/L-asparaginase  68.2    2e-11   
ref|XP_010086228.1|  PREDICTED: isoaspartyl peptidase/L-asparaginase  67.0    2e-11   
gb|EZP70324.1|  Peptidase t2 asparaginase 2                           70.1    2e-11   
ref|XP_009331429.1|  PREDICTED: isoaspartyl peptidase/L-asparagin...  68.6    2e-11   
ref|XP_009274055.1|  PREDICTED: isoaspartyl peptidase/L-asparagin...  68.6    2e-11   
gb|KFW73576.1|  Isoaspartyl peptidase/L-asparaginase                  68.6    2e-11   
ref|XP_005705424.1|  L-asparaginase                                   68.6    2e-11   
gb|KFM05178.1|  Isoaspartyl peptidase/L-asparaginase                  68.6    2e-11   
ref|WP_024809732.1|  isoaspartyl peptidase                            68.6    2e-11   
ref|XP_005044172.1|  PREDICTED: isoaspartyl peptidase/L-asparagin...  68.6    2e-11   
ref|WP_029993827.1|  asparaginase                                     68.6    2e-11   
ref|WP_036936784.1|  isoaspartyl peptidase                            68.6    2e-11   
ref|WP_006158131.1|  isoaspartyl peptidase                            68.6    2e-11   
ref|WP_031526497.1|  isoaspartyl peptidase                            68.2    2e-11   
ref|WP_021704483.1|  isoaspartyl peptidase                            68.2    2e-11   
ref|WP_035310322.1|  asparaginase                                     68.9    2e-11   
ref|WP_028883974.1|  isoaspartyl peptidase                            68.2    2e-11   
dbj|GAM00880.1|  putative asparaginase                                70.1    2e-11   
ref|XP_005518193.1|  PREDICTED: isoaspartyl peptidase/L-asparagin...  68.2    2e-11   
ref|WP_034742359.1|  asparaginase                                     68.6    2e-11   
ref|WP_041393278.1|  asparaginase                                     68.2    3e-11   
ref|XP_005308899.1|  PREDICTED: isoaspartyl peptidase/L-asparagin...  68.2    3e-11   
gb|KFU84513.1|  L-asparaginase                                        68.2    3e-11   
ref|WP_006869130.1|  asparaginase                                     67.8    3e-11   
ref|XP_010001639.1|  PREDICTED: isoaspartyl peptidase/L-asparaginase  68.2    3e-11   
ref|WP_035322351.1|  asparaginase                                     68.2    3e-11   
ref|WP_020711514.1|  hypothetical protein                             68.6    3e-11   
ref|WP_006457273.1|  L-asparaginase                                   67.8    3e-11   
ref|WP_028356312.1|  isoaspartyl peptidase                            68.2    3e-11   
ref|XP_005431999.1|  PREDICTED: isoaspartyl peptidase/L-asparagin...  68.2    3e-11   
ref|WP_008649098.1|  isoaspartyl dipeptidase with L-asparaginase ...  68.2    3e-11   
ref|XP_010176718.1|  PREDICTED: isoaspartyl peptidase/L-asparaginase  67.8    3e-11   
ref|WP_011643102.1|  asparaginase                                     68.6    3e-11   
gb|KFZ52744.1|  Isoaspartyl peptidase/L-asparaginase                  67.8    3e-11   
ref|WP_025145785.1|  isoaspartyl peptidase                            68.2    3e-11   
gb|KFV68256.1|  Isoaspartyl peptidase/L-asparaginase                  67.8    3e-11   
gb|KFP72722.1|  Isoaspartyl peptidase/L-asparaginase                  67.8    3e-11   
ref|WP_043359343.1|  hypothetical protein                             67.8    3e-11   
ref|XP_009487985.1|  PREDICTED: isoaspartyl peptidase/L-asparaginase  67.8    3e-11   
gb|KFR15342.1|  Isoaspartyl peptidase/L-asparaginase                  67.8    3e-11   
ref|XP_009938748.1|  PREDICTED: isoaspartyl peptidase/L-asparaginase  67.8    3e-11   
ref|XP_009868772.1|  PREDICTED: isoaspartyl peptidase/L-asparaginase  67.8    3e-11   
gb|KFQ65000.1|  Isoaspartyl peptidase/L-asparaginase                  67.8    3e-11   
ref|WP_026443156.1|  asparaginase                                     68.2    3e-11   
ref|WP_041685996.1|  asparaginase                                     68.2    3e-11   
ref|XP_005240352.1|  PREDICTED: isoaspartyl peptidase/L-asparagin...  67.8    4e-11   
ref|WP_017229149.1|  isoaspartyl peptidase                            67.8    4e-11   
ref|WP_010408593.1|  asparaginase                                     67.4    4e-11   
ref|WP_035537181.1|  asparaginase                                     68.2    4e-11   
ref|XP_008500513.1|  PREDICTED: isoaspartyl peptidase/L-asparaginase  67.8    4e-11   
ref|WP_006658094.1|  asparaginase                                     68.2    4e-11   
ref|WP_036968277.1|  isoaspartyl peptidase                            68.2    4e-11   
gb|KFP07387.1|  Isoaspartyl peptidase/L-asparaginase                  67.8    4e-11   
ref|XP_005421201.1|  PREDICTED: isoaspartyl peptidase/L-asparagin...  67.8    4e-11   
ref|WP_022826191.1|  asparaginase                                     68.2    4e-11   
ref|XP_007210207.1|  hypothetical protein PRUPE_ppa016260mg           67.0    4e-11   
ref|XP_009092561.1|  PREDICTED: isoaspartyl peptidase/L-asparaginase  67.8    4e-11   
gb|KFR09396.1|  Isoaspartyl peptidase/L-asparaginase                  67.8    4e-11   
gb|ACU59072.1|  peptidase T2 asparaginase 2                           68.2    4e-11   
ref|WP_012248714.1|  isoaspartyl peptidase                            67.8    4e-11   
ref|WP_018477906.1|  asparaginase                                     67.4    4e-11   
ref|XP_009473914.1|  PREDICTED: isoaspartyl peptidase/L-asparaginase  67.4    4e-11   
ref|WP_007406475.1|  MULTISPECIES: asparaginase                       67.4    4e-11   
ref|WP_026166607.1|  isoaspartyl peptidase                            67.8    4e-11   
gb|EMC90197.1|  L-asparaginase                                        67.4    4e-11   
gb|ABC64158.1|  Asparaginase family protein                           68.2    4e-11   
ref|XP_005491197.1|  PREDICTED: isoaspartyl peptidase/L-asparagin...  67.4    5e-11   
ref|WP_005861753.1|  asparaginase                                     67.4    5e-11   
gb|KFP44170.1|  Isoaspartyl peptidase/L-asparaginase                  67.4    5e-11   
ref|WP_044221085.1|  isoaspartyl peptidase                            67.8    5e-11   
ref|XP_001844771.1|  N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase  67.4    5e-11   
ref|XP_009073064.1|  PREDICTED: isoaspartyl peptidase/L-asparaginase  67.4    5e-11   
ref|XP_005506804.1|  PREDICTED: isoaspartyl peptidase/L-asparagin...  67.4    5e-11   
ref|WP_034789999.1|  asparaginase                                     67.4    5e-11   
ref|WP_015264559.1|  asparaginase                                     67.8    5e-11   
gb|KFP70349.1|  Isoaspartyl peptidase/L-asparaginase                  67.4    5e-11   
ref|WP_029087137.1|  asparaginase                                     67.8    5e-11   
gb|KFO79014.1|  Isoaspartyl peptidase/L-asparaginase                  67.4    5e-11   
gb|KGT08938.1|  isoaspartyl peptidase                                 67.4    5e-11   
gb|KFP14896.1|  Isoaspartyl peptidase/L-asparaginase                  67.4    5e-11   
ref|WP_009492488.1|  asparaginase                                     67.4    5e-11   
ref|XP_010123313.1|  PREDICTED: isoaspartyl peptidase/L-asparaginase  67.4    5e-11   
ref|XP_009635858.1|  PREDICTED: isoaspartyl peptidase/L-asparaginase  67.4    5e-11   
gb|EDM34977.1|  asparaginase family protein                           67.8    5e-11   
ref|XP_009563046.1|  PREDICTED: isoaspartyl peptidase/L-asparaginase  67.4    5e-11   
ref|WP_014393966.1|  asparaginase                                     68.2    6e-11   
ref|WP_040574859.1|  hypothetical protein                             67.0    6e-11   
ref|WP_040966178.1|  asparaginase                                     67.4    6e-11   
ref|WP_041291023.1|  isoaspartyl peptidase                            67.0    6e-11   
ref|WP_040006961.1|  isoaspartyl peptidase                            67.4    6e-11   
ref|WP_044400909.1|  isoaspartyl peptidase                            67.8    6e-11   
emb|CCH56729.1|  beta-aspartyl-peptidase (threonine type)             67.4    6e-11   
gb|KIX22183.1|  isoaspartyl peptidase                                 67.4    6e-11   
ref|WP_037265155.1|  isoaspartyl peptidase                            67.0    6e-11   



>ref|XP_010101665.1| putative isoaspartyl peptidase/L-asparaginase 2 [Morus notabilis]
 gb|EXB89231.1| putative isoaspartyl peptidase/L-asparaginase 2 [Morus notabilis]
Length=326

 Score =   170 bits (431),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 82/89 (92%), Positives = 85/89 (96%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLPLERQEEAK LLTRCLNLGISALRS+LPAIDVVELVVRELETDP+
Sbjct  4    WAIAVHGGAGVDPNLPLERQEEAKQLLTRCLNLGISALRSNLPAIDVVELVVRELETDPI  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FNSGRGSALT +GTVEMEASIMDG  RRC
Sbjct  64   FNSGRGSALTEQGTVEMEASIMDGQKRRC  92



>pdb|4PU6|A Chain A, Crystal Structure Of Potassium-dependent Plant-type 
L-asparaginase From Phaseolus Vulgaris In Complex With K+ Cations
 pdb|4PU6|C Chain C, Crystal Structure Of Potassium-dependent Plant-type 
L-asparaginase From Phaseolus Vulgaris In Complex With K+ Cations
 pdb|4PV2|A Chain A, Crystal Structure Of Potassium-dependent Plant-type 
L-asparaginase From Phaseolus Vulgaris In Complex With K+ And 
Na+ Cations
 pdb|4PV2|C Chain C, Crystal Structure Of Potassium-dependent Plant-type 
L-asparaginase From Phaseolus Vulgaris In Complex With K+ And 
Na+ Cations
 pdb|4PV3|A Chain A, Crystal Structure Of Potassium-dependent Plant-type 
L-asparaginase From Phaseolus Vulgaris In Complex With Na+ Cations
 pdb|4PV3|C Chain C, Crystal Structure Of Potassium-dependent Plant-type 
L-asparaginase From Phaseolus Vulgaris In Complex With Na+ Cations
Length=197

 Score =   166 bits (420),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 81/89 (91%), Positives = 83/89 (93%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDP LPLERQEEAK LLTRCLNLGISAL S++PAIDVVELVVRELETDPL
Sbjct  6    WAIAVHGGAGVDPTLPLERQEEAKQLLTRCLNLGISALNSNVPAIDVVELVVRELETDPL  65

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FNSGRGSALT KGTVEMEASIMDG  RRC
Sbjct  66   FNSGRGSALTEKGTVEMEASIMDGPKRRC  94



>ref|XP_010270964.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 2 [Nelumbo 
nucifera]
Length=329

 Score =   169 bits (428),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 83/89 (93%), Positives = 84/89 (94%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP ERQE+AK LLTRCLNLGISALRSSLPAIDVVELVVRELETDPL
Sbjct  4    WAIAVHGGAGVDPNLPQERQEQAKQLLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FNSGRGSALT KGTVEMEASIMDG  RRC
Sbjct  64   FNSGRGSALTEKGTVEMEASIMDGPRRRC  92



>ref|XP_009586844.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 2 [Nicotiana 
tomentosiformis]
Length=326

 Score =   169 bits (427),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/89 (91%), Positives = 84/89 (94%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP ERQEEAK LLTRCLN+GISALRSSLPAIDVVELVV+ELETDP+
Sbjct  4    WAIAVHGGAGVDPNLPAERQEEAKQLLTRCLNIGISALRSSLPAIDVVELVVKELETDPI  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FNSGRGSALT  GTVEMEASIMDG GRRC
Sbjct  64   FNSGRGSALTANGTVEMEASIMDGDGRRC  92



>ref|XP_009774504.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 2 [Nicotiana 
sylvestris]
Length=326

 Score =   168 bits (426),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/89 (91%), Positives = 84/89 (94%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP ERQE+AK LLTRCLN+GISALRSSLPAIDVVELVVRELETDP+
Sbjct  4    WAIAVHGGAGVDPNLPAERQEKAKQLLTRCLNIGISALRSSLPAIDVVELVVRELETDPI  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FNSGRGSALT  GTVEMEASIMDG GRRC
Sbjct  64   FNSGRGSALTANGTVEMEASIMDGDGRRC  92



>dbj|BAC66615.1| L-asparaginase [Glycine max]
Length=325

 Score =   168 bits (425),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/89 (93%), Positives = 84/89 (94%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLPLERQEEAK LLTRCLNLGISAL S+LPAIDVVELVVRELETDPL
Sbjct  4    WAIAVHGGAGVDPNLPLERQEEAKQLLTRCLNLGISALNSNLPAIDVVELVVRELETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FNSGRGSALT KGTVEMEASIMDG  RRC
Sbjct  64   FNSGRGSALTEKGTVEMEASIMDGPKRRC  92



>gb|ACF74335.1| L-asparaginase [Arachis hypogaea]
Length=237

 Score =   165 bits (418),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 81/89 (91%), Positives = 83/89 (93%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLPL RQEEAK LLTRCLNLGISAL S+LPAIDVVEL+VRELETDPL
Sbjct  4    WAIAVHGGAGVDPNLPLHRQEEAKQLLTRCLNLGISALNSNLPAIDVVELIVRELETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FNSGRGSALT KGTVEMEASIMDG  RRC
Sbjct  64   FNSGRGSALTEKGTVEMEASIMDGPKRRC  92



>ref|XP_010244253.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 2 [Nelumbo 
nucifera]
Length=329

 Score =   167 bits (423),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 83/89 (93%), Positives = 83/89 (93%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP ERQEEAK LLTRCLNLG SALRSSLPAIDVVELVVRELETDPL
Sbjct  4    WAIAVHGGAGVDPNLPQERQEEAKQLLTRCLNLGTSALRSSLPAIDVVELVVRELETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FNSGRGSALT KGTVEMEASIMDG  RRC
Sbjct  64   FNSGRGSALTAKGTVEMEASIMDGPRRRC  92



>ref|XP_007160884.1| hypothetical protein PHAVU_001G025000g [Phaseolus vulgaris]
 gb|ESW32878.1| hypothetical protein PHAVU_001G025000g [Phaseolus vulgaris]
Length=326

 Score =   167 bits (423),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 82/89 (92%), Positives = 84/89 (94%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLPLERQEEAK LLTRCLNLGISAL S++PAIDVVELVVRELETDPL
Sbjct  4    WAIAVHGGAGVDPNLPLERQEEAKQLLTRCLNLGISALNSNVPAIDVVELVVRELETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FNSGRGSALT KGTVEMEASIMDG  RRC
Sbjct  64   FNSGRGSALTEKGTVEMEASIMDGPKRRC  92



>gb|AGZ15413.1| L-asparaginase [Phaseolus vulgaris]
Length=326

 Score =   167 bits (422),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 82/89 (92%), Positives = 84/89 (94%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLPLERQEEAK LLTRCLNLGISAL S++PAIDVVELVVRELETDPL
Sbjct  4    WAIAVHGGAGVDPNLPLERQEEAKQLLTRCLNLGISALNSNVPAIDVVELVVRELETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FNSGRGSALT KGTVEMEASIMDG  RRC
Sbjct  64   FNSGRGSALTEKGTVEMEASIMDGPKRRC  92



>gb|EPS68558.1| hypothetical protein M569_06206 [Genlisea aurea]
Length=323

 Score =   166 bits (421),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 79/89 (89%), Positives = 83/89 (93%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP+ERQEEAK LLTRCLNLGISALR+   A+DVVELVVRELETDPL
Sbjct  4    WAIAVHGGAGVDPNLPMERQEEAKKLLTRCLNLGISALRTGASAVDVVELVVRELETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FNSGRGSALT + TVEMEASIMDGHGRRC
Sbjct  64   FNSGRGSALTERATVEMEASIMDGHGRRC  92



>ref|XP_006354842.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 2-like 
[Solanum tuberosum]
Length=325

 Score =   166 bits (420),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 80/89 (90%), Positives = 84/89 (94%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP ERQ++AK LLTRCLN+GISALRSSLPAIDVVELVVRELE+DPL
Sbjct  4    WAIAVHGGAGVDPNLPAERQKQAKELLTRCLNIGISALRSSLPAIDVVELVVRELESDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FNSGRGSALT  GTVEMEASIMDG GRRC
Sbjct  64   FNSGRGSALTANGTVEMEASIMDGDGRRC  92



>ref|XP_003550318.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 2-like 
[Glycine max]
Length=326

 Score =   166 bits (420),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 82/89 (92%), Positives = 83/89 (93%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLPLERQEEAK LLT CLNLGISAL S+LPAIDVVELVVRELETDPL
Sbjct  4    WAIAVHGGAGVDPNLPLERQEEAKQLLTHCLNLGISALNSNLPAIDVVELVVRELETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FNSGRGSALT KGTVEMEASIMDG  RRC
Sbjct  64   FNSGRGSALTEKGTVEMEASIMDGPKRRC  92



>ref|XP_004238125.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 2 [Solanum 
lycopersicum]
Length=325

 Score =   166 bits (419),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 80/89 (90%), Positives = 84/89 (94%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP ERQ++AK LLTRCLN+GISALRSSLPAIDVVELVVRELE+DPL
Sbjct  4    WAIAVHGGAGVDPNLPDERQQQAKQLLTRCLNIGISALRSSLPAIDVVELVVRELESDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FNSGRGSALT  GTVEMEASIMDG GRRC
Sbjct  64   FNSGRGSALTANGTVEMEASIMDGDGRRC  92



>ref|NP_001236606.1| L-asparaginase [Glycine max]
 gb|AAM23265.1| L-asparaginase [Glycine max]
Length=326

 Score =   166 bits (419),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 82/89 (92%), Positives = 83/89 (93%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLPLE QEEAK LLTRCLNLGISAL S+LPAIDVVELVVRELETDPL
Sbjct  4    WAIAVHGGAGVDPNLPLEHQEEAKQLLTRCLNLGISALNSNLPAIDVVELVVRELETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FNSGRGSALT KGTVEMEASIMDG  RRC
Sbjct  64   FNSGRGSALTEKGTVEMEASIMDGPKRRC  92



>emb|CBI19471.3| unnamed protein product [Vitis vinifera]
Length=308

 Score =   165 bits (418),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/89 (91%), Positives = 83/89 (93%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP +RQEEAK LLTRCLNLGISALRSSLPAIDVVELVVRELE+DPL
Sbjct  4    WAIAVHGGAGVDPNLPPQRQEEAKQLLTRCLNLGISALRSSLPAIDVVELVVRELESDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FNSGRGSALT  GTVEMEASIMDG  RRC
Sbjct  64   FNSGRGSALTENGTVEMEASIMDGPKRRC  92



>gb|KJB59852.1| hypothetical protein B456_009G276200 [Gossypium raimondii]
Length=325

 Score =   166 bits (419),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/89 (91%), Positives = 84/89 (94%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP ERQEEAK LLTRCL++GISALRS+LPAIDVVELVVRELETDPL
Sbjct  4    WAIAVHGGAGVDPNLPKERQEEAKRLLTRCLDIGISALRSNLPAIDVVELVVRELETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FNSGRGSALT KGTVEMEASIMDG  RRC
Sbjct  64   FNSGRGSALTEKGTVEMEASIMDGPKRRC  92



>ref|XP_002510160.1| l-asparaginase, putative [Ricinus communis]
 gb|EEF52347.1| l-asparaginase, putative [Ricinus communis]
Length=327

 Score =   165 bits (418),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/89 (91%), Positives = 83/89 (93%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP +RQEEAK LL RCLNLGISALRS+LPAIDVVELVVRELETDPL
Sbjct  4    WAIAVHGGAGVDPNLPPQRQEEAKQLLARCLNLGISALRSNLPAIDVVELVVRELETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FNSGRGSALT KGTVEMEASIMDG  RRC
Sbjct  64   FNSGRGSALTEKGTVEMEASIMDGPKRRC  92



>ref|XP_002285006.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 2 [Vitis 
vinifera]
 emb|CAN81785.1| hypothetical protein VITISV_024290 [Vitis vinifera]
Length=329

 Score =   165 bits (418),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/89 (91%), Positives = 83/89 (93%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP +RQEEAK LLTRCLNLGISALRSSLPAIDVVELVVRELE+DPL
Sbjct  4    WAIAVHGGAGVDPNLPPQRQEEAKQLLTRCLNLGISALRSSLPAIDVVELVVRELESDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FNSGRGSALT  GTVEMEASIMDG  RRC
Sbjct  64   FNSGRGSALTENGTVEMEASIMDGPKRRC  92



>ref|XP_007017138.1| N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily 
protein [Theobroma cacao]
 gb|EOY14363.1| N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily 
protein [Theobroma cacao]
Length=325

 Score =   165 bits (417),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 81/89 (91%), Positives = 83/89 (93%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP ERQEEAK LLTRCLN+GISALRS+LPAIDVVELVVRELETDPL
Sbjct  4    WAIAVHGGAGVDPNLPKERQEEAKRLLTRCLNIGISALRSNLPAIDVVELVVRELETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FNSGRGSALT  GTVEMEASIMDG  RRC
Sbjct  64   FNSGRGSALTENGTVEMEASIMDGPKRRC  92



>ref|XP_008220275.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 2 [Prunus 
mume]
Length=326

 Score =   164 bits (415),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 80/89 (90%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP+ERQE+AK LLTRCLNLGISALRS L AIDVVELVVRELETDP 
Sbjct  4    WAIAVHGGAGVDPNLPMERQEQAKQLLTRCLNLGISALRSDLAAIDVVELVVRELETDPF  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FNSGRGSALT KGTVEMEASIMDG  RRC
Sbjct  64   FNSGRGSALTEKGTVEMEASIMDGPKRRC  92



>ref|XP_007222672.1| hypothetical protein PRUPE_ppa008583mg [Prunus persica]
 gb|EMJ23871.1| hypothetical protein PRUPE_ppa008583mg [Prunus persica]
Length=326

 Score =   164 bits (415),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 80/89 (90%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP+ERQE+AK LLTRCLNLGISALRS L AIDVVELVVRELETDP 
Sbjct  4    WAIAVHGGAGVDPNLPMERQEQAKQLLTRCLNLGISALRSDLAAIDVVELVVRELETDPF  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FNSGRGSALT KGTVEMEASIMDG  RRC
Sbjct  64   FNSGRGSALTEKGTVEMEASIMDGPQRRC  92



>ref|XP_009360082.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 2 [Pyrus 
x bretschneideri]
Length=325

 Score =   164 bits (415),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 80/89 (90%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP+ERQE+AK LLTRCLNLGISALRS L AIDVVELVVRELETDP 
Sbjct  4    WAIAVHGGAGVDPNLPMERQEQAKQLLTRCLNLGISALRSDLAAIDVVELVVRELETDPF  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FNSGRGSALT KGTVEMEASIMDG  RRC
Sbjct  64   FNSGRGSALTAKGTVEMEASIMDGPKRRC  92



>ref|XP_008377997.1| PREDICTED: LOW QUALITY PROTEIN: probable isoaspartyl peptidase/L-asparaginase 
2 [Malus domestica]
Length=325

 Score =   164 bits (414),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 80/89 (90%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP+ERQE+AK LLTRCLNLGISALRS L AIDVVELVVRELETDP 
Sbjct  4    WAIAVHGGAGVDPNLPMERQEQAKQLLTRCLNLGISALRSDLTAIDVVELVVRELETDPF  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FNSGRGSALT KGTVEMEASIMDG  RRC
Sbjct  64   FNSGRGSALTAKGTVEMEASIMDGPKRRC  92



>ref|XP_008360985.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 2 [Malus 
domestica]
Length=325

 Score =   164 bits (414),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 80/89 (90%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP+ERQE+AK LLTRCLNLGISALRS L AIDVVELVVRELETDP 
Sbjct  4    WAIAVHGGAGVDPNLPMERQEQAKQLLTRCLNLGISALRSDLAAIDVVELVVRELETDPF  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FNSGRGSALT KGTVEMEASIMDG  RRC
Sbjct  64   FNSGRGSALTAKGTVEMEASIMDGPKRRC  92



>ref|XP_011029297.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 2 [Populus 
euphratica]
Length=328

 Score =   163 bits (413),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 80/89 (90%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP ERQEEAK LLTRCL +GISALRS+LPAIDVVELVVRELETDPL
Sbjct  4    WAIAVHGGAGVDPNLPRERQEEAKKLLTRCLQIGISALRSNLPAIDVVELVVRELETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FNSGRGSALT  GTVEMEASIMDG  RRC
Sbjct  64   FNSGRGSALTENGTVEMEASIMDGPKRRC  92



>ref|XP_002320760.2| L-asparaginase family protein [Populus trichocarpa]
 gb|EEE99075.2| L-asparaginase family protein [Populus trichocarpa]
Length=328

 Score =   163 bits (413),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 80/89 (90%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP ERQEEAK LLTRCL +GISALRS+LPAIDVVELVVRELETDPL
Sbjct  4    WAIAVHGGAGVDPNLPRERQEEAKKLLTRCLQIGISALRSNLPAIDVVELVVRELETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FNSGRGSALT  GTVEMEASIMDG  RRC
Sbjct  64   FNSGRGSALTENGTVEMEASIMDGPKRRC  92



>ref|XP_003589126.1| L-asparaginase [Medicago truncatula]
 gb|ABD32614.1| Peptidase T2, asparaginase 2 [Medicago truncatula]
 gb|AES59377.1| isoaspartyl peptidase/L-asparaginase [Medicago truncatula]
Length=325

 Score =   163 bits (412),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 81/89 (91%), Positives = 83/89 (93%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLPL+RQEEAK LLTR LNLGISALRS+L AIDVVELVVRELETDPL
Sbjct  4    WAIAVHGGAGVDPNLPLQRQEEAKQLLTRVLNLGISALRSNLSAIDVVELVVRELETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FNSGRGSALT KGTVEMEASIMDG  RRC
Sbjct  64   FNSGRGSALTEKGTVEMEASIMDGPKRRC  92



>gb|KJB58572.1| hypothetical protein B456_009G215700 [Gossypium raimondii]
Length=323

 Score =   162 bits (411),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/89 (89%), Positives = 84/89 (94%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP ERQ+EAK LLTRCL++GISALRS++PAIDVVELVVRELETDPL
Sbjct  4    WAIAVHGGAGVDPNLPKERQDEAKRLLTRCLDIGISALRSNVPAIDVVELVVRELETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FNSGRGSALT KGTVEMEASIMDG  RRC
Sbjct  64   FNSGRGSALTEKGTVEMEASIMDGPKRRC  92



>gb|KHG29402.1| hypothetical protein F383_14115 [Gossypium arboreum]
Length=323

 Score =   162 bits (411),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/89 (89%), Positives = 84/89 (94%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP ERQ+EAK LLTRCL++GISALRS++PAIDVVELVVRELETDPL
Sbjct  4    WAIAVHGGAGVDPNLPKERQDEAKRLLTRCLDIGISALRSNVPAIDVVELVVRELETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FNSGRGSALT KGTVEMEASIMDG  RRC
Sbjct  64   FNSGRGSALTEKGTVEMEASIMDGPKRRC  92



>gb|KDO84066.1| hypothetical protein CISIN_1g020250mg [Citrus sinensis]
Length=329

 Score =   162 bits (411),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/89 (89%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP++RQE AK LLTRCLNLGISALRS+ PAIDVVELVVRELETDPL
Sbjct  4    WAIAVHGGAGVDPNLPVQRQEAAKQLLTRCLNLGISALRSNCPAIDVVELVVRELETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FNSGRGSALT  GTVEMEASIMDG  RRC
Sbjct  64   FNSGRGSALTENGTVEMEASIMDGPKRRC  92



>ref|XP_006434701.1| hypothetical protein CICLE_v10001812mg [Citrus clementina]
 gb|ESR47941.1| hypothetical protein CICLE_v10001812mg [Citrus clementina]
Length=329

 Score =   162 bits (411),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/89 (89%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP++RQE AK LLTRCLNLGISALRS+ PAIDVVELVVRELETDPL
Sbjct  4    WAIAVHGGAGVDPNLPVQRQEAAKQLLTRCLNLGISALRSNCPAIDVVELVVRELETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FNSGRGSALT  GTVEMEASIMDG  RRC
Sbjct  64   FNSGRGSALTENGTVEMEASIMDGPKRRC  92



>ref|XP_002302429.1| L-asparaginase family protein [Populus trichocarpa]
 gb|EEE81702.1| L-asparaginase family protein [Populus trichocarpa]
Length=328

 Score =   162 bits (411),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 80/89 (90%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP ERQEEAK LL RCL+LGISALRS+LPAIDVVELVVRELETDPL
Sbjct  4    WAIAVHGGAGVDPNLPQERQEEAKKLLARCLDLGISALRSNLPAIDVVELVVRELETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FNSGRGSALT  GTVEMEASIMDG  RRC
Sbjct  64   FNSGRGSALTENGTVEMEASIMDGPKRRC  92



>ref|XP_009354155.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 2 [Pyrus 
x bretschneideri]
Length=325

 Score =   162 bits (410),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 79/89 (89%), Positives = 81/89 (91%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP+ERQE+AK LLTRCLNLGISALRS L AIDVVELVVRELE DP 
Sbjct  4    WAIAVHGGAGVDPNLPMERQEQAKQLLTRCLNLGISALRSDLAAIDVVELVVRELEADPF  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FNSGRGSALT KGTVEMEASIMDG  RRC
Sbjct  64   FNSGRGSALTAKGTVEMEASIMDGPKRRC  92



>ref|XP_010503884.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 2 [Camelina 
sativa]
Length=325

 Score =   162 bits (409),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 79/89 (89%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP ERQEEAK LLTRCLNLGI ALRS++ AIDVVELV+RELETDPL
Sbjct  4    WAIAVHGGAGVDPNLPAERQEEAKQLLTRCLNLGIVALRSNVSAIDVVELVIRELETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FNSGRGSALT KGTVEMEASIMDG  RRC
Sbjct  64   FNSGRGSALTEKGTVEMEASIMDGTKRRC  92



>gb|KHG11184.1| hypothetical protein F383_13364 [Gossypium arboreum]
Length=332

 Score =   162 bits (409),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 80/89 (90%), Positives = 83/89 (93%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP ERQEEAK LLTRCL++GISALRS+L AIDVVELVVRELETDPL
Sbjct  11   WAIAVHGGAGVDPNLPNERQEEAKRLLTRCLDIGISALRSNLSAIDVVELVVRELETDPL  70

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FNSGRGSALT KGTVEMEASIMDG  RRC
Sbjct  71   FNSGRGSALTEKGTVEMEASIMDGPKRRC  99



>emb|CDP01286.1| unnamed protein product [Coffea canephora]
Length=325

 Score =   161 bits (408),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 79/89 (89%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP +RQ+EAK LLTRCLNLGISALRSSLPAIDVVELVVR LE+DPL
Sbjct  4    WAIAVHGGAGVDPNLPPQRQDEAKQLLTRCLNLGISALRSSLPAIDVVELVVRALESDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FNSGRGSALT  GTVEMEASIMDG  RRC
Sbjct  64   FNSGRGSALTENGTVEMEASIMDGPKRRC  92



>ref|XP_006406871.1| hypothetical protein EUTSA_v10021131mg [Eutrema salsugineum]
 gb|ESQ48324.1| hypothetical protein EUTSA_v10021131mg [Eutrema salsugineum]
Length=325

 Score =   161 bits (408),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 78/89 (88%), Positives = 84/89 (94%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAG+DPNLP+ERQEEAK LLTRCL+LGI+ALRS++ AIDVVELVVRELETDPL
Sbjct  4    WAIAVHGGAGIDPNLPVERQEEAKQLLTRCLSLGIAALRSNVSAIDVVELVVRELETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FNSGRGSALT KGTVEMEASIMDG  RRC
Sbjct  64   FNSGRGSALTEKGTVEMEASIMDGTRRRC  92



>ref|XP_010465623.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 2 [Camelina 
sativa]
Length=325

 Score =   161 bits (408),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 78/89 (88%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAG+DPNLP ERQEEAK LLTRCLNLGI ALRS++ AIDVVELV+RELETDPL
Sbjct  4    WAIAVHGGAGIDPNLPAERQEEAKQLLTRCLNLGIVALRSNVSAIDVVELVIRELETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FNSGRGSALT KGTVEMEASIMDG  RRC
Sbjct  64   FNSGRGSALTEKGTVEMEASIMDGTKRRC  92



>ref|XP_002882982.1| hypothetical protein ARALYDRAFT_479069 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59241.1| hypothetical protein ARALYDRAFT_479069 [Arabidopsis lyrata subsp. 
lyrata]
Length=325

 Score =   161 bits (408),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 78/89 (88%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAG+DPNLP ERQEEAK LLTRCLNLGI ALRS++ AIDVVELV+RELETDPL
Sbjct  4    WAIAVHGGAGIDPNLPAERQEEAKQLLTRCLNLGIVALRSNISAIDVVELVIRELETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FNSGRGSALT KGTVEMEASIMDG  RRC
Sbjct  64   FNSGRGSALTEKGTVEMEASIMDGTKRRC  92



>emb|CDY30139.1| BnaC05g37230D [Brassica napus]
Length=324

 Score =   161 bits (408),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 76/89 (85%), Positives = 84/89 (94%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAG+DPNLP+ERQE+AK LLTRCLNLGI+ALRS++ AIDVVELV+RELETDPL
Sbjct  4    WAIAVHGGAGIDPNLPVERQEQAKQLLTRCLNLGIAALRSNVSAIDVVELVIRELETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FNSGRGSALT +GTVEMEASIMDG  RRC
Sbjct  64   FNSGRGSALTEQGTVEMEASIMDGTKRRC  92



>emb|CDY20183.1| BnaA01g28190D [Brassica napus]
Length=325

 Score =   161 bits (408),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 77/89 (87%), Positives = 83/89 (93%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAG+DPNLP+ERQE+AK LLTRCLNLGI+ALRS++ AIDVVELVVRELETDPL
Sbjct  4    WAIAVHGGAGIDPNLPVERQEQAKQLLTRCLNLGIAALRSNVSAIDVVELVVRELETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FNSGRGSALT  GTVEMEASIMDG  RRC
Sbjct  64   FNSGRGSALTENGTVEMEASIMDGTKRRC  92



>gb|KDP41685.1| hypothetical protein JCGZ_16092 [Jatropha curcas]
Length=327

 Score =   161 bits (408),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 79/89 (89%), Positives = 83/89 (93%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDP+LP +RQEEAK LL RCLNLGISALRS+LPAIDVVELVVRELE+DPL
Sbjct  4    WAIAVHGGAGVDPHLPQQRQEEAKQLLARCLNLGISALRSNLPAIDVVELVVRELESDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FNSGRGSALT KGTVEMEASIMDG  RRC
Sbjct  64   FNSGRGSALTEKGTVEMEASIMDGPRRRC  92



>emb|CDY28378.1| BnaC01g35480D [Brassica napus]
Length=325

 Score =   161 bits (407),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 77/89 (87%), Positives = 83/89 (93%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAG+DPNLP+ERQE+AK LLTRCLNLGI+ALRS++ AIDVVELVVRELETDPL
Sbjct  4    WAIAVHGGAGIDPNLPVERQEQAKQLLTRCLNLGIAALRSNVSAIDVVELVVRELETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FNSGRGSALT  GTVEMEASIMDG  RRC
Sbjct  64   FNSGRGSALTENGTVEMEASIMDGTKRRC  92



>ref|NP_566536.1| probable isoaspartyl peptidase/L-asparaginase 2 [Arabidopsis 
thaliana]
 sp|Q8GXG1.2|ASPGB_ARATH RecName: Full=Probable isoaspartyl peptidase/L-asparaginase 2; 
AltName: Full=L-asparagine amidohydrolase 2; Contains: RecName: 
Full=Isoaspartyl peptidase/L-asparaginase 2 subunit alpha; 
Contains: RecName: Full=Isoaspartyl peptidase/L-asparaginase 
2 subunit beta; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB02681.1| l-asparaginase (l-asparagine amidohydrolase) [Arabidopsis thaliana]
 gb|AAM63335.1| putative L-asparaginase [Arabidopsis thaliana]
 gb|ABD59062.1| At3g16150 [Arabidopsis thaliana]
 gb|AEE75777.1| probable isoaspartyl peptidase/L-asparaginase 2 [Arabidopsis 
thaliana]
Length=325

 Score =   161 bits (407),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 78/89 (88%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAG+DPNLP ERQEEAK LLTRCLNLGI ALRS++ AIDVVELV+RELETDPL
Sbjct  4    WAIAVHGGAGIDPNLPAERQEEAKQLLTRCLNLGIIALRSNVSAIDVVELVIRELETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FNSGRGSALT KGTVEMEASIMDG  RRC
Sbjct  64   FNSGRGSALTEKGTVEMEASIMDGTKRRC  92



>ref|XP_009146165.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 2 [Brassica 
rapa]
 emb|CDX97726.1| BnaA05g23530D [Brassica napus]
Length=324

 Score =   161 bits (407),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 76/89 (85%), Positives = 84/89 (94%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAG+DPNLP+ERQE+AK LLTRCLNLGI+ALRS++ AIDVVELV+RELETDPL
Sbjct  4    WAIAVHGGAGIDPNLPVERQEQAKQLLTRCLNLGIAALRSNVSAIDVVELVIRELETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FNSGRGSALT +GTVEMEASIMDG  RRC
Sbjct  64   FNSGRGSALTEQGTVEMEASIMDGTKRRC  92



>ref|XP_010556428.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 2 [Tarenaya 
hassleriana]
Length=328

 Score =   161 bits (407),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 80/89 (90%), Positives = 81/89 (91%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP ERQEEAK LLTRCLNLGISAL S+  AIDVVELVVRELETDPL
Sbjct  4    WAIAVHGGAGVDPNLPAERQEEAKQLLTRCLNLGISALESNASAIDVVELVVRELETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FNSGRGSALT KGTVEMEASIMDG  RRC
Sbjct  64   FNSGRGSALTEKGTVEMEASIMDGTRRRC  92



>ref|XP_010487465.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 2 [Camelina 
sativa]
Length=325

 Score =   161 bits (407),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 78/89 (88%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP ERQE+AK LLTRCLNLGI ALRS++ AIDVVELV+RELETDPL
Sbjct  4    WAIAVHGGAGVDPNLPAERQEQAKQLLTRCLNLGIVALRSNVSAIDVVELVIRELETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FNSGRGSALT KGTVEMEASIMDG  RRC
Sbjct  64   FNSGRGSALTEKGTVEMEASIMDGTKRRC  92



>ref|XP_011017156.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 2 [Populus 
euphratica]
Length=328

 Score =   161 bits (407),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 79/89 (89%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP ERQEEAK LL RCL+LGISALRS+LPAIDVVELVVR+LETDPL
Sbjct  4    WAIAVHGGAGVDPNLPQERQEEAKKLLARCLDLGISALRSNLPAIDVVELVVRDLETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FNSGRGSALT  GTVEMEASIMDG  RRC
Sbjct  64   FNSGRGSALTENGTVEMEASIMDGPKRRC  92



>ref|XP_006473269.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 2-like 
[Citrus sinensis]
Length=329

 Score =   161 bits (407),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/89 (88%), Positives = 81/89 (91%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP++RQE AK LLTRCLNLGIS LRS+ PAIDVVELVVRELETDPL
Sbjct  4    WAIAVHGGAGVDPNLPVQRQEAAKQLLTRCLNLGISGLRSNCPAIDVVELVVRELETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FNSGRGSALT  GTVEMEASIMDG  RRC
Sbjct  64   FNSGRGSALTENGTVEMEASIMDGPKRRC  92



>gb|KHG16262.1| hypothetical protein F383_23830 [Gossypium arboreum]
Length=325

 Score =   160 bits (406),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 79/89 (89%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP ERQEEAK LLTRCL++GISALRS+L AIDVVELVVRELETDPL
Sbjct  4    WAIAVHGGAGVDPNLPKERQEEAKRLLTRCLDIGISALRSNLSAIDVVELVVRELETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FNSGRGSALT  GTVEMEASIMDG  RRC
Sbjct  64   FNSGRGSALTENGTVEMEASIMDGPKRRC  92



>ref|XP_010061715.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 2 [Eucalyptus 
grandis]
 gb|KCW68699.1| hypothetical protein EUGRSUZ_F02300 [Eucalyptus grandis]
Length=325

 Score =   160 bits (406),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 77/89 (87%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP  RQEEAK +L RCLN+GISALRSSLPA+DVVELVVRELE+DP+
Sbjct  4    WAIAVHGGAGVDPNLPHHRQEEAKQVLARCLNMGISALRSSLPAVDVVELVVRELESDPV  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FNSGRGSALT KGT EMEASIMDG GRRC
Sbjct  64   FNSGRGSALTEKGTAEMEASIMDGVGRRC  92



>ref|XP_006298133.1| hypothetical protein CARUB_v10014177mg [Capsella rubella]
 gb|EOA31031.1| hypothetical protein CARUB_v10014177mg [Capsella rubella]
Length=325

 Score =   160 bits (406),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/89 (88%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP ERQE+AK LLTRCLNLGI ALRS++ AIDVVELV+RELETDPL
Sbjct  4    WAIAVHGGAGVDPNLPAERQEDAKQLLTRCLNLGIVALRSNVSAIDVVELVIRELETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FNSGRGSALT KGTVEMEASIMDG  RRC
Sbjct  64   FNSGRGSALTEKGTVEMEASIMDGTKRRC  92



>ref|XP_009114923.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 2 [Brassica 
rapa]
Length=325

 Score =   160 bits (406),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/89 (85%), Positives = 83/89 (93%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAG+DPNLP+ERQE+AK LLTRCLNLG++ALRS++ AIDVVELVVRELETDPL
Sbjct  4    WAIAVHGGAGIDPNLPVERQEQAKQLLTRCLNLGVAALRSNVSAIDVVELVVRELETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FNSGRGSALT  GTVEMEASIMDG  RRC
Sbjct  64   FNSGRGSALTENGTVEMEASIMDGTKRRC  92



>gb|KJB29444.1| hypothetical protein B456_005G101000 [Gossypium raimondii]
Length=326

 Score =   160 bits (405),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/89 (89%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP ERQEEAK LLT CL++GISALRS+LPAIDVVELVVRELETDPL
Sbjct  4    WAIAVHGGAGVDPNLPKERQEEAKRLLTHCLDIGISALRSNLPAIDVVELVVRELETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FNSGRGSALT  GTVEMEASIMDG  RRC
Sbjct  64   FNSGRGSALTDNGTVEMEASIMDGPKRRC  92



>ref|XP_004499019.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 2-like 
[Cicer arietinum]
Length=326

 Score =   160 bits (404),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 80/89 (90%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLPL RQEEAK LLTR LNLGISALRS+L AIDVVELVVRELETDP+
Sbjct  4    WAIAVHGGAGVDPNLPLNRQEEAKQLLTRVLNLGISALRSNLSAIDVVELVVRELETDPV  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FNSGRGSALT KGTVEMEASIMDG  RRC
Sbjct  64   FNSGRGSALTEKGTVEMEASIMDGPKRRC  92



>gb|KJB63904.1| hypothetical protein B456_010G023000 [Gossypium raimondii]
Length=325

 Score =   160 bits (404),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/89 (89%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP ERQEEAK LL RCL++GISALRS+L AIDVVELVVRELETDPL
Sbjct  4    WAIAVHGGAGVDPNLPNERQEEAKRLLNRCLDIGISALRSNLSAIDVVELVVRELETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FNSGRGSALT KGTVEMEASIMDG  RRC
Sbjct  64   FNSGRGSALTEKGTVEMEASIMDGPKRRC  92



>ref|XP_007136713.1| hypothetical protein PHAVU_009G067800g [Phaseolus vulgaris]
 gb|ESW08707.1| hypothetical protein PHAVU_009G067800g [Phaseolus vulgaris]
Length=326

 Score =   159 bits (403),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 77/89 (87%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP +RQE+AK LLTRCLNLGIS+LRS+  A+DVVELVVRELETDPL
Sbjct  4    WAIAVHGGAGVDPNLPPQRQEQAKQLLTRCLNLGISSLRSNASALDVVELVVRELETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FNSGRGSALT KGTVEMEASIMDG  RRC
Sbjct  64   FNSGRGSALTEKGTVEMEASIMDGSNRRC  92



>gb|ABC01060.1| L-asparaginase 2 [Phaseolus vulgaris]
Length=326

 Score =   159 bits (402),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 77/89 (87%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP +RQE+AK LLTRCLNLGIS+LRS+  A+DVVELVVRELETDPL
Sbjct  4    WAIAVHGGAGVDPNLPPQRQEQAKQLLTRCLNLGISSLRSNASALDVVELVVRELETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FNSGRGSALT KGTVEMEASIMDG  RRC
Sbjct  64   FNSGRGSALTDKGTVEMEASIMDGSNRRC  92



>ref|XP_004291067.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 2 [Fragaria 
vesca subsp. vesca]
Length=327

 Score =   159 bits (401),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 77/89 (87%), Positives = 79/89 (89%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLPLERQE+AK LLTRCLNLG SALR+ LPAIDVVELVVRELETDP 
Sbjct  4    WAIAVHGGAGVDPNLPLERQEQAKQLLTRCLNLGTSALRADLPAIDVVELVVRELETDPF  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FNSGRGSAL   G VEMEASIMDG  RRC
Sbjct  64   FNSGRGSALNENGRVEMEASIMDGPKRRC  92



>gb|KFK38965.1| hypothetical protein AALP_AA3G183000 [Arabis alpina]
Length=325

 Score =   156 bits (395),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 75/89 (84%), Positives = 81/89 (91%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAG+DPNLP ERQE+AK LLT CLNLGI+AL S++ AIDVVELVV+ELETDPL
Sbjct  4    WAIAVHGGAGIDPNLPAERQEQAKQLLTHCLNLGIAALSSNVSAIDVVELVVKELETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FNSGRGSALT KGTVEMEASIMDG  RRC
Sbjct  64   FNSGRGSALTEKGTVEMEASIMDGTKRRC  92



>ref|XP_008796480.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 2 [Phoenix 
dactylifera]
Length=330

 Score =   156 bits (394),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 72/89 (81%), Positives = 81/89 (91%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP ERQEEAK +L RCL++GI+ALR    A+DVVE+VVR+LETDP+
Sbjct  4    WAIAVHGGAGVDPNLPAERQEEAKGVLARCLHIGITALRGGAAAVDVVEMVVRQLETDPV  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FNSGRGSALT +GTVEMEASIMDGHGRRC
Sbjct  64   FNSGRGSALTRRGTVEMEASIMDGHGRRC  92



>ref|XP_010688589.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 2 [Beta 
vulgaris subsp. vulgaris]
Length=327

 Score =   155 bits (393),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 77/88 (88%), Positives = 81/88 (92%), Gaps = 0/88 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIA+HGGAGVDPNLPL+RQEEAK LLTRCLNL ISALRS+  AIDVVELVVRELETDPL
Sbjct  4    WAIALHGGAGVDPNLPLQRQEEAKQLLTRCLNLAISALRSNHSAIDVVELVVRELETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRR  316
            FNSGRGSAL+ KGTVEMEASIMDG  RR
Sbjct  64   FNSGRGSALSEKGTVEMEASIMDGPKRR  91



>ref|XP_010932217.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 2 [Elaeis 
guineensis]
Length=329

 Score =   155 bits (392),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 72/89 (81%), Positives = 81/89 (91%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP ERQEEAK ++ RCL++GI+ALR    A+DVVE+VVRELETDP+
Sbjct  4    WAIAVHGGAGVDPNLPAERQEEAKRVIARCLHIGITALRGGAAAVDVVEMVVRELETDPV  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FNSGRGSALT +GTVEMEASIMDGHGRRC
Sbjct  64   FNSGRGSALTRRGTVEMEASIMDGHGRRC  92



>ref|XP_010927509.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 2 [Elaeis 
guineensis]
Length=330

 Score =   155 bits (392),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/89 (83%), Positives = 80/89 (90%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP ERQEEAK +L+RCLNLGI+ALR    A+DVVE VVRELETDP+
Sbjct  4    WAIAVHGGAGVDPNLPAERQEEAKRVLSRCLNLGIAALRGGCAAVDVVEQVVRELETDPV  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FNSGRGSALT +GTVEMEASIMDG GRRC
Sbjct  64   FNSGRGSALTRRGTVEMEASIMDGRGRRC  92



>ref|XP_004501550.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 2-like 
[Cicer arietinum]
Length=325

 Score =   155 bits (391),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/89 (83%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP +RQE+AK LLT CLN+GI+ALRS++ A+DVVELVVRELET+PL
Sbjct  4    WAIAVHGGAGVDPNLPPQRQEQAKQLLTHCLNIGITALRSNVSAVDVVELVVRELETNPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FNSGRGSALT KGTVEMEASIMDG  RRC
Sbjct  64   FNSGRGSALTAKGTVEMEASIMDGTKRRC  92



>ref|XP_003603098.1| L-asparaginase [Medicago truncatula]
 gb|AES73349.1| isoaspartyl peptidase/L-asparaginase [Medicago truncatula]
Length=322

 Score =   155 bits (391),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/89 (85%), Positives = 80/89 (90%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP  RQ+EAK LLT CLNLGISALRS+  A+DVVELVVR+LETDPL
Sbjct  4    WAIAVHGGAGVDPNLPPHRQQEAKQLLTECLNLGISALRSNASALDVVELVVRKLETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FNSGRGSALT KGTVEMEASIMDG  RRC
Sbjct  64   FNSGRGSALTAKGTVEMEASIMDGTKRRC  92



>ref|XP_003525910.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 2-like 
[Glycine max]
Length=327

 Score =   154 bits (389),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 75/89 (84%), Positives = 80/89 (90%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP ERQE+AK LLTR LNLGISALRS   A+DVVELVVRELETDPL
Sbjct  4    WAIAVHGGAGVDPNLPPERQEQAKQLLTRVLNLGISALRSDASALDVVELVVRELETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FNSGRG+ALT KGT E+EASIMDG+ RRC
Sbjct  64   FNSGRGAALTEKGTAELEASIMDGYKRRC  92



>gb|AGV54259.1| isoaspartyl peptidase/L-asparaginase 2 [Phaseolus vulgaris]
Length=327

 Score =   154 bits (388),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 75/84 (89%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLPLERQEEAK LLT CLNLGISA  S++PA+DVV+LVVRELETDPL
Sbjct  4    WAIAVHGGAGVDPNLPLERQEEAKQLLTHCLNLGISAQNSNVPAVDVVKLVVRELETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDG  304
            FNSGRGSALT KGTVEMEASIMDG
Sbjct  64   FNSGRGSALTEKGTVEMEASIMDG  87



>gb|AES62108.2| isoaspartyl peptidase/L-asparaginase [Medicago truncatula]
Length=320

 Score =   152 bits (385),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/89 (84%), Positives = 80/89 (90%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP +RQEEAK LLT CLN+GI ALRS+  A+DVVELVVRELET+PL
Sbjct  4    WAIAVHGGAGVDPNLPPQRQEEAKQLLTHCLNIGIFALRSNGSAVDVVELVVRELETNPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FNSGRGSALT KGTVEMEASIMDG  RRC
Sbjct  64   FNSGRGSALTAKGTVEMEASIMDGTKRRC  92



>gb|KHN04475.1| Putative isoaspartyl peptidase/L-asparaginase 2 [Glycine soja]
Length=325

 Score =   152 bits (383),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 74/89 (83%), Positives = 80/89 (90%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP ERQ++AK LLTR LNLGISALRS+  A+DVVELVVRELETDPL
Sbjct  4    WAIAVHGGAGVDPNLPPERQDQAKQLLTRVLNLGISALRSNASALDVVELVVRELETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FNSGRG+ALT KGT E+EASIMDG  RRC
Sbjct  64   FNSGRGAALTEKGTAELEASIMDGSNRRC  92



>ref|NP_001276238.1| probable isoaspartyl peptidase/L-asparaginase 2-like [Glycine 
max]
 gb|AFA35112.1| asparaginase 2 [Glycine max]
Length=327

 Score =   152 bits (383),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 74/89 (83%), Positives = 80/89 (90%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP ERQ++AK LLTR LNLGISALRS+  A+DVVELVVRELETDPL
Sbjct  4    WAIAVHGGAGVDPNLPPERQDQAKQLLTRVLNLGISALRSNASALDVVELVVRELETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FNSGRG+ALT KGT E+EASIMDG  RRC
Sbjct  64   FNSGRGAALTEKGTAELEASIMDGSNRRC  92



>ref|XP_008452604.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 2 [Cucumis 
melo]
Length=322

 Score =   150 bits (378),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 74/89 (83%), Positives = 78/89 (88%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLPL RQ++AK  LTRCL+LGI ALRS+  AIDVVELVVRELE DPL
Sbjct  4    WAIAVHGGAGVDPNLPLHRQDDAKRFLTRCLDLGIHALRSNHSAIDVVELVVRELENDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FNSGRGSALT  GTVEMEASIMDG  RRC
Sbjct  64   FNSGRGSALTEDGTVEMEASIMDGPKRRC  92



>ref|XP_009418804.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 2 [Musa 
acuminata subsp. malaccensis]
Length=332

 Score =   150 bits (378),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 79/89 (89%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDP LP ERQEEA+ +L RCL +G + LR+ LPA+DVVE+VVRELETDP+
Sbjct  4    WAIAVHGGAGVDPKLPEERQEEARRVLRRCLGVGAAGLRAGLPAVDVVEMVVRELETDPV  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FNSGRGSALT +GTVEMEASIMDG GRRC
Sbjct  64   FNSGRGSALTQEGTVEMEASIMDGRGRRC  92



>ref|XP_008796739.1| PREDICTED: LOW QUALITY PROTEIN: probable isoaspartyl peptidase/L-asparaginase 
2 [Phoenix dactylifera]
Length=330

 Score =   150 bits (378),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 79/89 (89%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP ERQEEAK +L+RCL+LGI+ALR    A+DVVE+VVR LETDP+
Sbjct  4    WAIAVHGGAGVDPNLPAERQEEAKRVLSRCLHLGIAALRGGAAAVDVVEMVVRGLETDPV  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FNSGRG ALT +GTVEMEASIMDG GRRC
Sbjct  64   FNSGRGXALTRRGTVEMEASIMDGRGRRC  92



>gb|ABK22246.1| unknown [Picea sitchensis]
Length=370

 Score =   150 bits (379),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDP+LP+ERQ+EAK LL  CLNLG+SAL++S+PAIDVVEL+VRELET+P+
Sbjct  3    WAIAVHGGAGVDPSLPMERQQEAKDLLLHCLNLGVSALKASVPAIDVVELLVRELETNPV  62

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FNSGRGSAL+ KGTVEMEASIMDG   +C
Sbjct  63   FNSGRGSALSTKGTVEMEASIMDGFRNKC  91



>gb|KGN55235.1| L-asparaginase [Cucumis sativus]
Length=294

 Score =   148 bits (374),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 73/89 (82%), Positives = 78/89 (88%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDP+LPL RQ++AK  LTRCL+LGI ALRS+  AIDVVELVVRELE DPL
Sbjct  4    WAIAVHGGAGVDPDLPLHRQDDAKKFLTRCLDLGIHALRSNHSAIDVVELVVRELENDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FNSGRGSALT  GTVEMEASIMDG  RRC
Sbjct  64   FNSGRGSALTEDGTVEMEASIMDGPKRRC  92



>ref|XP_004141273.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 2-like 
[Cucumis sativus]
 ref|XP_004168272.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 2-like 
[Cucumis sativus]
Length=323

 Score =   148 bits (374),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 73/89 (82%), Positives = 78/89 (88%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDP+LPL RQ++AK  LTRCL+LGI ALRS+  AIDVVELVVRELE DPL
Sbjct  4    WAIAVHGGAGVDPDLPLHRQDDAKKFLTRCLDLGIHALRSNHSAIDVVELVVRELENDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FNSGRGSALT  GTVEMEASIMDG  RRC
Sbjct  64   FNSGRGSALTEDGTVEMEASIMDGPKRRC  92



>emb|CAK22360.1| L-asparaginase [Pinus sylvestris]
Length=375

 Score =   149 bits (375),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 81/89 (91%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDP LP+ERQ+EAK LL  CLNLG+SAL++S+PAIDVVEL+VRELET+P+
Sbjct  3    WAIAVHGGAGVDPCLPMERQQEAKDLLLHCLNLGVSALKASVPAIDVVELLVRELETNPV  62

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FNSGRGSAL+ KGTVEMEASIMDG   +C
Sbjct  63   FNSGRGSALSAKGTVEMEASIMDGFRNKC  91



>tpg|DAA35670.1| TPA: L-asparaginase-like family protein [Zea mays]
Length=170

 Score =   142 bits (358),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIA+HGGAGVDPNLP  RQEEAK +L RCL +G+  LR+   A+DVVE VVRELETDP 
Sbjct  4    WAIAIHGGAGVDPNLPEHRQEEAKRVLARCLQVGVDLLRAGAQALDVVEAVVRELETDPF  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FNSGRGSALT  GTVEMEASIMDG GRRC
Sbjct  64   FNSGRGSALTRAGTVEMEASIMDGRGRRC  92



>emb|CAE04504.1| OSJNBb0059K02.14 [Oryza sativa Japonica Group]
Length=333

 Score =   145 bits (367),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIA+HGGAGVDPNLP  RQEEAK +L RCL +G+ ALRS   A+DVVE VVRELE+DP 
Sbjct  4    WAIAIHGGAGVDPNLPEHRQEEAKRVLARCLQVGVDALRSGAAALDVVEAVVRELESDPF  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FNSGRGSALT  GTVEMEASIMDG GRRC
Sbjct  64   FNSGRGSALTRLGTVEMEASIMDGRGRRC  92



>gb|EAZ32226.1| hypothetical protein OsJ_16431 [Oryza sativa Japonica Group]
Length=333

 Score =   145 bits (367),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIA+HGGAGVDPNLP  RQEEAK +L RCL +G+ ALRS   A+DVVE VVRELE+DP 
Sbjct  4    WAIAIHGGAGVDPNLPEHRQEEAKRVLARCLQVGVDALRSGAAALDVVEAVVRELESDPF  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FNSGRGSALT  GTVEMEASIMDG GRRC
Sbjct  64   FNSGRGSALTRLGTVEMEASIMDGRGRRC  92



>emb|CAC09349.1| H0212B02.13 [Oryza sativa Indica Group]
 emb|CAJ86320.1| OSIGBa0113E10.3 [Oryza sativa Indica Group]
 gb|EAY95831.1| hypothetical protein OsI_17700 [Oryza sativa Indica Group]
Length=333

 Score =   145 bits (367),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIA+HGGAGVDPNLP  RQEEAK +L RCL +G+ ALRS   A+DVVE VVRELE+DP 
Sbjct  4    WAIAIHGGAGVDPNLPEHRQEEAKRVLARCLQVGVDALRSGAAALDVVEAVVRELESDPF  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FNSGRGSALT  GTVEMEASIMDG GRRC
Sbjct  64   FNSGRGSALTRLGTVEMEASIMDGRGRRC  92



>ref|XP_009413335.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 2 [Musa 
acuminata subsp. malaccensis]
Length=332

 Score =   145 bits (366),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 78/89 (88%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDP LP  RQEEA+ +L+RCL LG  AL++ L A+DVVE+VVRELETDP+
Sbjct  4    WAIAVHGGAGVDPCLPAVRQEEARRVLSRCLKLGAGALQAGLTAVDVVEMVVRELETDPV  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FNSGRGSALT +GTVEMEASIMDG GRRC
Sbjct  64   FNSGRGSALTRRGTVEMEASIMDGRGRRC  92



>ref|XP_004977053.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 2-like 
[Setaria italica]
Length=333

 Score =   144 bits (363),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIA+HGGAGVDPNLP  RQEEAK +L RCL  G+  LR+   A+DVVE VVRELETDP 
Sbjct  4    WAIAIHGGAGVDPNLPEHRQEEAKRVLARCLQTGVDLLRAGATALDVVEAVVRELETDPF  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FNSGRGSALT +GTVEMEASIMDG GRRC
Sbjct  64   FNSGRGSALTRRGTVEMEASIMDGRGRRC  92



>ref|XP_003580704.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 2 [Brachypodium 
distachyon]
Length=335

 Score =   144 bits (362),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIA+HGGAGVDPNLP  RQEEAK +L RCL LG+  LR+  PA+DVVE VVRELE+DP 
Sbjct  4    WAIAIHGGAGVDPNLPEHRQEEAKRVLARCLQLGVDLLRAGTPALDVVEAVVRELESDPC  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FNSGRGSAL+  G+VEMEASIMDG GRRC
Sbjct  64   FNSGRGSALSRSGSVEMEASIMDGRGRRC  92



>ref|XP_008668775.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 2 [Zea 
mays]
Length=337

 Score =   144 bits (362),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIA+HGGAGVDPNLP  RQEEAK +L RCL +G+  LR+   A+DVVE VVRELETDP 
Sbjct  4    WAIAIHGGAGVDPNLPEHRQEEAKRVLARCLQVGVDLLRAGAQALDVVEAVVRELETDPF  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FNSGRGSALT  GTVEMEASIMDG GRRC
Sbjct  64   FNSGRGSALTRAGTVEMEASIMDGRGRRC  92



>gb|AAG28786.1|AF308474_1 asparaginase [Hordeum vulgare subsp. vulgare]
Length=333

 Score =   143 bits (360),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIA+HGGAGVDPNLP  RQEEAK +L RCL +G+  LR+   A+DVVE VVRELETDP 
Sbjct  4    WAIAIHGGAGVDPNLPEHRQEEAKRVLARCLQVGVDLLRAGATALDVVEAVVRELETDPC  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FNSGRGSALT  GTVEMEASIMDG GRRC
Sbjct  64   FNSGRGSALTRAGTVEMEASIMDGRGRRC  92



>dbj|BAJ99727.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=333

 Score =   143 bits (360),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIA+HGGAGVDPNLP  RQEEAK +L RCL +G+  LR+   A+DVVE VVRELETDP 
Sbjct  4    WAIAIHGGAGVDPNLPEHRQEEAKRVLARCLQVGVDLLRAGATALDVVEAVVRELETDPC  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FNSGRGSALT  GTVEMEASIMDG GRRC
Sbjct  64   FNSGRGSALTRAGTVEMEASIMDGRGRRC  92



>gb|EMT11957.1| Putative isoaspartyl peptidase/L-asparaginase 2 [Aegilops tauschii]
Length=347

 Score =   142 bits (359),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIA+HGGAGVDPNLP  RQEEAK +L RCL +G+  LR+   A+DVVE VVRELETDP 
Sbjct  4    WAIAIHGGAGVDPNLPEHRQEEAKRVLARCLQVGVDLLRAGATALDVVEAVVRELETDPC  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FNSGRGSALT  GTVEMEASIMDG GRRC
Sbjct  64   FNSGRGSALTRAGTVEMEASIMDGRGRRC  92



>dbj|BAJ94612.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=334

 Score =   142 bits (358),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIA+HGGAGVDPNLP  RQEEAK +L RCL +G+  LR+   A+DVVE VVRELETDP 
Sbjct  4    WAIAIHGGAGVDPNLPEHRQEEAKRVLARCLQVGVDLLRAGATALDVVEAVVRELETDPC  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FNSGRGSALT  GTVEMEASIMDG GRRC
Sbjct  64   FNSGRGSALTRAGTVEMEASIMDGRGRRC  92



>ref|XP_002447227.1| hypothetical protein SORBIDRAFT_06g030910 [Sorghum bicolor]
 gb|EES11555.1| hypothetical protein SORBIDRAFT_06g030910 [Sorghum bicolor]
Length=337

 Score =   142 bits (357),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIA+HGGAGVDPNLP   QEEAK +L RCL +G+  LR+   A+DVVE VVRELETDP 
Sbjct  4    WAIAIHGGAGVDPNLPQHSQEEAKRVLARCLQVGVDLLRAGAQALDVVEAVVRELETDPF  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FNSGRGSALT  GTVEMEASIMDG GRRC
Sbjct  64   FNSGRGSALTRAGTVEMEASIMDGRGRRC  92



>ref|XP_003591857.1| L-asparaginase [Medicago truncatula]
Length=338

 Score =   139 bits (351),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 79/107 (74%), Gaps = 18/107 (17%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELV---------  205
            WAIAVHGGAGVDPNLP +RQEEAK LLT CLN+GI ALRS+  A+DVVEL          
Sbjct  4    WAIAVHGGAGVDPNLPPQRQEEAKQLLTHCLNIGIFALRSNGSAVDVVELCCMFSHSISL  63

Query  206  ---------VRELETDPLFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
                     VRELET+PLFNSGRGSALT KGTVEMEASIMDG  RRC
Sbjct  64   TLTNLYRDDVRELETNPLFNSGRGSALTAKGTVEMEASIMDGTKRRC  110



>ref|XP_006855727.1| hypothetical protein AMTR_s00044p00154340 [Amborella trichopoda]
 gb|ERN17194.1| hypothetical protein AMTR_s00044p00154340 [Amborella trichopoda]
Length=161

 Score =   131 bits (329),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 64/89 (72%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIA+HGG G+DP+LPL+ QEEA   L   L+LGISALRS+  A+DVVELVVRELE +PL
Sbjct  4    WAIAIHGGVGIDPSLPLQCQEEACQALLSALHLGISALRSASSAVDVVELVVRELELNPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FNSGRGSALT +GTVEM+ASIMDG  R+C
Sbjct  64   FNSGRGSALTAQGTVEMDASIMDGSTRKC  92



>ref|XP_006828602.1| hypothetical protein AMTR_s00129p00062240 [Amborella trichopoda]
 gb|ERM96018.1| hypothetical protein AMTR_s00129p00062240 [Amborella trichopoda]
Length=326

 Score =   133 bits (335),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAG+DP+LPL+RQEEA   L   L+LGISALRS+  A+DVVELVVRELE +PL
Sbjct  4    WAIAVHGGAGIDPSLPLQRQEEACQALLSALHLGISALRSASSAVDVVELVVRELELNPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FNSG GSALT +GTVEM+ASIMDG  R+C
Sbjct  64   FNSGCGSALTAQGTVEMDASIMDGSTRKC  92



>ref|XP_006652926.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 2-like 
[Oryza brachyantha]
Length=328

 Score =   127 bits (320),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIA+HGGAGVDPNLP  RQEEAK +L RCL +G+ ALR    A+DVVE VVRELE+DP 
Sbjct  4    WAIAIHGGAGVDPNLPEHRQEEAKRVLARCLQVGVDALRGGAAAVDVVEAVVRELESDPF  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FNSGRGSALT  GTVEMEASIMDG GRRC
Sbjct  64   FNSGRGSALTRLGTVEMEASIMDGRGRRC  92



>gb|ACN73030.1| COSII_At3g16150, partial [Solanum cheesmaniae]
 gb|ACN73031.1| COSII_At3g16150, partial [Solanum galapagense]
 gb|ACN73032.1| COSII_At3g16150, partial [Solanum lycopersicum]
 gb|ACN73033.1| COSII_At3g16150, partial [Solanum pimpinellifolium]
 gb|ACN73034.1| COSII_At3g16150, partial [Solanum chmielewskii]
 gb|ACN73035.1| COSII_At3g16150, partial [Solanum neorickii]
 gb|ACN73036.1| COSII_At3g16150, partial [Solanum arcanum]
 gb|ACN73037.1| COSII_At3g16150, partial [Solanum huaylasense]
 gb|ACN73038.1| COSII_At3g16150, partial [Solanum peruvianum]
 gb|ACN73042.1| COSII_At3g16150, partial [Solanum habrochaites]
 gb|ACN73043.1| COSII_At3g16150, partial [Solanum pennellii]
 gb|ACN73044.1| COSII_At3g16150, partial [Solanum juglandifolium]
 gb|ACN73045.1| COSII_At3g16150, partial [Solanum ochranthum]
Length=64

 Score =   114 bits (286),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 56/61 (92%), Positives = 58/61 (95%), Gaps = 0/61 (0%)
 Frame = +2

Query  137  RCLNLGISALRSSLPAIDVVELVVRELETDPLFNSGRGSALTHKGTVEMEASIMDGHGRR  316
            RCLN+GISALRSSLPAIDVVELVVRELE+DPLFNSGRGSALT  GTVEMEASIMDG GRR
Sbjct  1    RCLNIGISALRSSLPAIDVVELVVRELESDPLFNSGRGSALTANGTVEMEASIMDGDGRR  60

Query  317  C  319
            C
Sbjct  61   C  61



>gb|ACN73040.1| COSII_At3g16150, partial [Solanum corneliomuelleri]
 gb|ACN73041.1| COSII_At3g16150, partial [Solanum chilense]
Length=64

 Score =   112 bits (281),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 55/61 (90%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = +2

Query  137  RCLNLGISALRSSLPAIDVVELVVRELETDPLFNSGRGSALTHKGTVEMEASIMDGHGRR  316
            RCLN+GISA RSSLPAIDVVELVVRELE+DPLFNSGRGSALT  GTVEMEASIMDG GRR
Sbjct  1    RCLNIGISAXRSSLPAIDVVELVVRELESDPLFNSGRGSALTANGTVEMEASIMDGDGRR  60

Query  317  C  319
            C
Sbjct  61   C  61



>gb|ACN73048.1| COSII_At3g16150, partial [Solanum dulcamara]
Length=64

 Score =   110 bits (274),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 54/61 (89%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = +2

Query  137  RCLNLGISALRSSLPAIDVVELVVRELETDPLFNSGRGSALTHKGTVEMEASIMDGHGRR  316
            RCLN+GISALRSSLPAIDVVE VVRELE+DPLFNSGRGSALT  G VEMEASIMDG GRR
Sbjct  1    RCLNIGISALRSSLPAIDVVERVVRELESDPLFNSGRGSALTANGKVEMEASIMDGDGRR  60

Query  317  C  319
            C
Sbjct  61   C  61



>gb|ACN73046.1| COSII_At3g16150, partial [Solanum lycopersicoides]
Length=64

 Score =   110 bits (274),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 54/61 (89%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = +2

Query  137  RCLNLGISALRSSLPAIDVVELVVRELETDPLFNSGRGSALTHKGTVEMEASIMDGHGRR  316
            RCLN+GISA RSS PAIDVVELVVRELE+DPLFNSGRGSALT  GTVEMEASIMDG GRR
Sbjct  1    RCLNIGISAXRSSRPAIDVVELVVRELESDPLFNSGRGSALTANGTVEMEASIMDGDGRR  60

Query  317  C  319
            C
Sbjct  61   C  61



>gb|ACN73047.1| COSII_At3g16150, partial [Solanum sitiens]
Length=64

 Score =   109 bits (273),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/61 (89%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = +2

Query  137  RCLNLGISALRSSLPAIDVVELVVRELETDPLFNSGRGSALTHKGTVEMEASIMDGHGRR  316
            RCLN+GISALRSS PAIDVVELVVRELE+DPLFNSGRGSALT  GTVE EASIMDG GRR
Sbjct  1    RCLNIGISALRSSRPAIDVVELVVRELESDPLFNSGRGSALTANGTVETEASIMDGDGRR  60

Query  317  C  319
            C
Sbjct  61   C  61



>gb|ACN73039.1| COSII_At3g16150, partial [Solanum peruvianum]
Length=64

 Score =   109 bits (273),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/61 (89%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = +2

Query  137  RCLNLGISALRSSLPAIDVVELVVRELETDPLFNSGRGSALTHKGTVEMEASIMDGHGRR  316
            RCLN+GISA RSSLPAI VVELVVRELE+DPLFNSGRGSALT  GTVEMEASIMDG GRR
Sbjct  1    RCLNIGISAXRSSLPAIXVVELVVRELESDPLFNSGRGSALTANGTVEMEASIMDGDGRR  60

Query  317  C  319
            C
Sbjct  61   C  61



>ref|XP_002266571.1| PREDICTED: isoaspartyl peptidase/L-asparaginase 1 [Vitis vinifera]
 emb|CBI15348.3| unnamed protein product [Vitis vinifera]
Length=322

 Score =   114 bits (286),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 71/90 (79%), Gaps = 1/90 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P +LPLER+E  +A L  CL +G++AL++  P +DVVELVVRELE +P
Sbjct  3    WAIALHGGAGDIPLSLPLERREPREAALRHCLQIGVAALQTKRPPLDVVELVVRELENNP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
             FN+GRGS LT  GTVEMEA IMDG+ ++C
Sbjct  63   NFNAGRGSVLTTDGTVEMEACIMDGNTKKC  92



>gb|KEH32053.1| isoaspartyl peptidase/L-asparaginase [Medicago truncatula]
Length=325

 Score =   113 bits (282),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 71/90 (79%), Gaps = 1/90 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P +LPLER++  +  L  CL +G+ AL+S++  +DVVELVVRELE  P
Sbjct  3    WAIALHGGAGDIPYSLPLERRQPREEALRHCLQIGVKALKSNMAPLDVVELVVRELENIP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
             FN+GRGS LT+KGTVEMEASIMDG+  +C
Sbjct  63   HFNAGRGSVLTNKGTVEMEASIMDGNTMKC  92



>emb|CAN82634.1| hypothetical protein VITISV_007448 [Vitis vinifera]
Length=310

 Score =   112 bits (281),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 70/90 (78%), Gaps = 1/90 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P +LP ER+E  +A L  CL +G++AL++  P +DVVELVVRELE +P
Sbjct  3    WAIALHGGAGDIPLSLPXERREPREAALRHCLQIGVAALQTKRPPLDVVELVVRELENNP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
             FN+GRGS LT  GTVEMEA IMDG+ ++C
Sbjct  63   NFNAGRGSVLTTDGTVEMEACIMDGNTKKC  92



>ref|XP_006485703.1| PREDICTED: isoaspartyl peptidase/L-asparaginase 1-like [Citrus 
sinensis]
Length=199

 Score =   110 bits (274),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 70/90 (78%), Gaps = 1/90 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P  +P ER++  +A L  CL++G+ AL+S   A+DVVELVVRELE +P
Sbjct  3    WAIALHGGAGDIPVTMPPERRQPREAALRHCLDIGVDALKSQKHALDVVELVVRELENNP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
             FN+G+GS LT+ GTVEMEA IMDG+ +RC
Sbjct  63   NFNAGKGSVLTNAGTVEMEACIMDGNTKRC  92



>dbj|BAK02243.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=320

 Score =   111 bits (278),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 68/90 (76%), Gaps = 1/90 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P  LP ER+E   A L RCL+LG +ALR+   A+DVVELVVRELE  P
Sbjct  3    WAIALHGGAGDIPRTLPPERREPRLATLRRCLDLGAAALRAGRSALDVVELVVRELEDCP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
             FN+G+GS LT  GTVEMEAS+MDG G RC
Sbjct  63   HFNAGKGSVLTSDGTVEMEASVMDGAGMRC  92



>ref|NP_196427.1| asparaginase [Arabidopsis thaliana]
 sp|P50287.2|ASPGA_ARATH RecName: Full=Isoaspartyl peptidase/L-asparaginase 1; AltName: 
Full=L-asparagine amidohydrolase 1; Contains: RecName: Full=Isoaspartyl 
peptidase/L-asparaginase 1 subunit alpha; Contains: 
RecName: Full=Isoaspartyl peptidase/L-asparaginase 1 subunit 
beta; Flags: Precursor [Arabidopsis thaliana]
 emb|CAB93711.1| asparaginase [Arabidopsis thaliana]
 gb|AAK62610.1| AT5g08100/T22D6_40 [Arabidopsis thaliana]
 gb|AAM10379.1| AT5g08100/T22D6_40 [Arabidopsis thaliana]
 gb|AED91247.1| asparaginase [Arabidopsis thaliana]
Length=315

 Score =   111 bits (277),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 69/90 (77%), Gaps = 1/90 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P +LP ER+   ++ L  CL+LGISAL+S  P +DV ELVVRELE  P
Sbjct  4    WAIALHGGAGDIPIDLPDERRIPRESALRHCLDLGISALKSGKPPLDVAELVVRELENHP  63

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
             FN+G+GS LT +GTVEMEASIMDG  +RC
Sbjct  64   DFNAGKGSVLTAQGTVEMEASIMDGKTKRC  93



>emb|CAA84367.1| asparaginase [Arabidopsis thaliana]
Length=315

 Score =   111 bits (277),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 69/90 (77%), Gaps = 1/90 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P +LP ER+   ++ L  CL+LGISAL+S  P +DV ELVVRELE  P
Sbjct  4    WAIALHGGAGDIPIDLPDERRIPRESALRHCLDLGISALKSGKPPLDVAELVVRELENHP  63

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
             FN+G+GS LT +GTVEMEASIMDG  +RC
Sbjct  64   DFNAGKGSVLTAQGTVEMEASIMDGKTKRC  93



>gb|KEH32051.1| isoaspartyl peptidase/L-asparaginase [Medicago truncatula]
Length=324

 Score =   110 bits (276),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 69/89 (78%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WA+A+HGGAGV  +LP E ++  +  L  CL +G+ AL+S++  +DVVELVVRELE  P 
Sbjct  3    WAVALHGGAGVPFSLPPEARQPREEALRHCLQIGVKALKSNMSPLDVVELVVRELENIPH  62

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FN+GRGS LT+KGTVEMEASIMDG+  +C
Sbjct  63   FNAGRGSVLTNKGTVEMEASIMDGNTMKC  91



>gb|KDO65650.1| hypothetical protein CISIN_1g0244722mg, partial [Citrus sinensis]
Length=91

 Score =   105 bits (262),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 69/89 (78%), Gaps = 1/89 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P  +P ER++  +A L  CL++G+ AL+S   A+DVVELVVRELE +P
Sbjct  3    WAIALHGGAGDIPVTMPPERRQPREAALRHCLDIGVDALKSQKHALDVVELVVRELENNP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRR  316
             FN+G+GS LT+ GTVEMEA IMDG+ +R
Sbjct  63   NFNAGKGSVLTNAGTVEMEACIMDGNTKR  91



>ref|XP_002873339.1| L-asparaginase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49598.1| L-asparaginase [Arabidopsis lyrata subsp. lyrata]
Length=315

 Score =   110 bits (276),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 69/90 (77%), Gaps = 1/90 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P +LP ER+   +  L  CL+LG+SAL+S  P +DV ELVVRELE  P
Sbjct  4    WAIALHGGAGDIPIDLPDERRIPRETALRHCLDLGVSALKSGKPPLDVAELVVRELENHP  63

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
             FN+G+GS LT +GTVEMEASIMDG+ +RC
Sbjct  64   DFNAGKGSVLTTQGTVEMEASIMDGNTKRC  93



>ref|XP_006440815.1| hypothetical protein CICLE_v10021205mg [Citrus clementina]
 gb|ESR54055.1| hypothetical protein CICLE_v10021205mg [Citrus clementina]
Length=320

 Score =   110 bits (275),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 70/90 (78%), Gaps = 1/90 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P  +P ER++  +A L  CL++G+ AL+S   A+DVVELVVRELE +P
Sbjct  3    WAIALHGGAGDIPVTMPPERRQPREAALRHCLDIGVDALKSQKHALDVVELVVRELENNP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
             FN+G+GS LT+ GTVEMEA IMDG+ +RC
Sbjct  63   NFNAGKGSVLTNAGTVEMEACIMDGNTKRC  92



>ref|XP_010257935.1| PREDICTED: isoaspartyl peptidase/L-asparaginase 1 [Nelumbo nucifera]
Length=319

 Score =   110 bits (274),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 68/90 (76%), Gaps = 1/90 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P +LP ER+   +A L  CL LG++AL++  P +DVVELVVRELE  P
Sbjct  3    WAIALHGGAGDIPLSLPPERRAPREAALRHCLQLGVAALKAKQPPLDVVELVVRELENSP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
             FN+G+GS LT +GTVEMEA IMDG+ + C
Sbjct  63   CFNAGKGSVLTTQGTVEMEACIMDGNTKNC  92



>ref|XP_006399296.1| hypothetical protein EUTSA_v10014145mg [Eutrema salsugineum]
 dbj|BAJ34155.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ40749.1| hypothetical protein EUTSA_v10014145mg [Eutrema salsugineum]
Length=315

 Score =   109 bits (273),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 68/90 (76%), Gaps = 1/90 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P +LP ER+   +  L  CL+LG+SAL+S  P +DV ELVVRELE  P
Sbjct  4    WAIALHGGAGDIPIDLPDERRIPRENALRYCLDLGVSALKSGKPPLDVAELVVRELENHP  63

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
             FN+G+GS LT +GTVEMEASIMDG  +RC
Sbjct  64   DFNAGKGSVLTTQGTVEMEASIMDGKTKRC  93



>ref|XP_004508653.1| PREDICTED: isoaspartyl peptidase/L-asparaginase-like [Cicer arietinum]
Length=322

 Score =   109 bits (273),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 68/90 (76%), Gaps = 1/90 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P +LP ER++  +  L  CL +G+ AL+S+ P ++VVELVVRELE  P
Sbjct  3    WAIALHGGAGDIPYSLPPERRQPREEALLHCLQIGVKALKSNTPPLEVVELVVRELENIP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
             FN+GRGS LT KGTVEMEASIMDG   +C
Sbjct  63   HFNAGRGSVLTTKGTVEMEASIMDGKTMKC  92



>emb|CDO98550.1| unnamed protein product [Coffea canephora]
Length=320

 Score =   109 bits (272),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 69/90 (77%), Gaps = 1/90 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P +LP ER++  +A L RCL +G++AL++   A+DVVELVVRELE  P
Sbjct  3    WAIALHGGAGDIPKDLPPERRKPREATLRRCLEIGVAALKAHKSALDVVELVVRELENCP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
             FN+GRGS LT  GTVEMEAS+MDG  + C
Sbjct  63   HFNAGRGSVLTTDGTVEMEASVMDGKTKNC  92



>ref|XP_009631666.1| PREDICTED: isoaspartyl peptidase/L-asparaginase-like [Nicotiana 
tomentosiformis]
Length=314

 Score =   108 bits (271),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 66/90 (73%), Gaps = 1/90 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P +LP E ++  +A L RCL +GI AL S    +DVVELVVRELE DP
Sbjct  3    WAIALHGGAGDIPRDLPPELRQPREACLHRCLQIGIDALNSHKSPLDVVELVVRELENDP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
             FN+GRGS LT  GTVEMEA IMDG  ++C
Sbjct  63   HFNAGRGSVLTSNGTVEMEACIMDGSTKKC  92



>ref|XP_006289635.1| hypothetical protein CARUB_v10003195mg [Capsella rubella]
 gb|EOA22533.1| hypothetical protein CARUB_v10003195mg [Capsella rubella]
Length=316

 Score =   108 bits (271),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 69/90 (77%), Gaps = 1/90 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P +LP ER+   +  L  CL+LG+SAL+S  P +DV ELVVRELE  P
Sbjct  4    WAIALHGGAGDIPIDLPDERRIPRETALRHCLDLGVSALKSGKPPLDVAELVVRELENHP  63

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
             FN+G+GS LT +GTVEMEASIM+G+ +RC
Sbjct  64   DFNAGKGSVLTTQGTVEMEASIMEGNTKRC  93



>ref|NP_001241157.1| uncharacterized protein LOC100799400 [Glycine max]
 ref|XP_006579427.1| PREDICTED: uncharacterized protein LOC100799400 isoform X1 [Glycine 
max]
 ref|XP_006579428.1| PREDICTED: uncharacterized protein LOC100799400 isoform X2 [Glycine 
max]
 gb|ACU20315.1| unknown [Glycine max]
 gb|KHN15197.1| Isoaspartyl peptidase/L-asparaginase [Glycine soja]
Length=322

 Score =   108 bits (270),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 67/90 (74%), Gaps = 1/90 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P +LP ER++  +  L  CL +G+ AL++ LP +DVVELVVRELE  P
Sbjct  3    WAIALHGGAGDIPLSLPPERRQPREEALRHCLQIGVEALKAKLPPLDVVELVVRELENIP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
             FN+GRGS LT +GTVEMEASIMDG    C
Sbjct  63   QFNAGRGSVLTCRGTVEMEASIMDGTTMNC  92



>gb|EPS61830.1| hypothetical protein M569_12962, partial [Genlisea aurea]
Length=307

 Score =   108 bits (269),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 69/90 (77%), Gaps = 1/90 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            W+IA+HGGAG  P +LP ER+E  +A L RCL +G+ A+ S   ++DVVELVVRELE +P
Sbjct  3    WSIALHGGAGDIPRSLPPERREPREAALRRCLQIGVEAIESGRSSLDVVELVVRELEDNP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
             FN+G+GS LT  GTVEMEA IMDG+ ++C
Sbjct  63   HFNAGKGSVLTSNGTVEMEACIMDGNTKKC  92



>ref|XP_010452785.1| PREDICTED: isoaspartyl peptidase/L-asparaginase 1 [Camelina sativa]
Length=316

 Score =   108 bits (269),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 68/90 (76%), Gaps = 1/90 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P +LP ER+   +  L  CL+LG+SAL+S  P +DV ELVVRELE  P
Sbjct  4    WAIALHGGAGDIPIDLPDERRIPRETALRHCLDLGVSALKSGKPPLDVAELVVRELENHP  63

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
             FN+G+GS LT +GTVEMEASIM+G  +RC
Sbjct  64   DFNAGKGSVLTTQGTVEMEASIMEGKTKRC  93



>gb|AFK38769.1| unknown [Medicago truncatula]
Length=324

 Score =   108 bits (269),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 68/89 (76%), Gaps = 0/89 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WA+A+HGGAGV  +LP E ++  +  L  CL +G+ AL+S++  +DVVELVVRELE  P 
Sbjct  3    WAVALHGGAGVPFSLPPEARQPREEALRHCLQIGVKALKSNMSPLDVVELVVRELENIPH  62

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FN+GRGS  T+KGTVEMEASIMDG+  +C
Sbjct  63   FNAGRGSVPTNKGTVEMEASIMDGNTMKC  91



>ref|XP_010546212.1| PREDICTED: isoaspartyl peptidase/L-asparaginase 1 [Tarenaya hassleriana]
Length=318

 Score =   108 bits (269),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 68/90 (76%), Gaps = 1/90 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P NLP+ER+   +A L  CL+LG+S+L+S    +DVVELVVRELE  P
Sbjct  4    WAIALHGGAGDIPVNLPVERRVPREAALRHCLDLGVSSLKSGKHPLDVVELVVRELENHP  63

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
             FN+G GS LT +GTVEMEA IMDG  +RC
Sbjct  64   NFNAGVGSVLTTQGTVEMEACIMDGKTKRC  93



>ref|XP_001776678.1| predicted protein [Physcomitrella patens]
 gb|EDQ58514.1| predicted protein [Physcomitrella patens]
Length=307

 Score =   107 bits (268),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 66/90 (73%), Gaps = 1/90 (1%)
 Frame = +2

Query  53   WAIAVHGGAG-VDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            W IA+HGGAG +  +LP  R+E  +A L +CL LG+SAL SS  A+DV ELVV+ELE +P
Sbjct  3    WGIALHGGAGDISKDLPRARKEAVEACLAQCLRLGVSALESSHAALDVAELVVKELEANP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            +FN+GRGS LT  GTVEMEA IMDG    C
Sbjct  63   VFNAGRGSVLTTDGTVEMEACIMDGPTMNC  92



>ref|XP_010491430.1| PREDICTED: isoaspartyl peptidase/L-asparaginase 1 [Camelina sativa]
Length=316

 Score =   108 bits (269),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 68/90 (76%), Gaps = 1/90 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P +LP ER+   +  L  CL+LG+SAL+S  P +DV ELVVRELE  P
Sbjct  4    WAIALHGGAGDIPIDLPEERRIPREIALRHCLDLGVSALKSGKPPLDVAELVVRELENHP  63

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
             FN+G+GS LT +GTVEMEASIM+G  +RC
Sbjct  64   DFNAGKGSVLTTQGTVEMEASIMEGKTKRC  93



>ref|XP_008450657.1| PREDICTED: isoaspartyl peptidase/L-asparaginase isoform X2 [Cucumis 
melo]
Length=319

 Score =   108 bits (269),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 68/90 (76%), Gaps = 2/90 (2%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P +LP +R++  +  L RCL +G+ AL+S  P +DVVELVVRELE  P
Sbjct  3    WAIALHGGAGDIPLSLPSDRRQPREETLRRCLQIGVQALKSQKPPLDVVELVVRELENCP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
             FN+GRGS LT KGTVEMEASIMD   +RC
Sbjct  63   HFNAGRGSVLTTKGTVEMEASIMDST-KRC  91



>ref|XP_010423136.1| PREDICTED: isoaspartyl peptidase/L-asparaginase 1-like [Camelina 
sativa]
Length=316

 Score =   107 bits (268),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 68/90 (76%), Gaps = 1/90 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P +LP ER+   +  L  CL+LG+SAL+S  P +DV ELVVRELE  P
Sbjct  4    WAIALHGGAGDIPIDLPDERRIPRETALRHCLDLGVSALKSGEPPLDVAELVVRELENHP  63

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
             FN+G+GS LT +GTVEMEASIM+G  +RC
Sbjct  64   DFNAGKGSVLTTQGTVEMEASIMEGKTKRC  93



>ref|XP_003562316.1| PREDICTED: isoaspartyl peptidase/L-asparaginase 1-like [Brachypodium 
distachyon]
Length=317

 Score =   107 bits (267),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 68/90 (76%), Gaps = 1/90 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P +LP ER+E   A L RCL+LG++AL++   A+DVVELVVRELE  P
Sbjct  3    WAIALHGGAGDIPRSLPPERREPRLATLRRCLDLGVAALQAGRTALDVVELVVRELENCP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
             FN+GRGS LT  GTVEMEASIMDG    C
Sbjct  63   HFNAGRGSVLTTDGTVEMEASIMDGTTMGC  92



>ref|XP_009387638.1| PREDICTED: isoaspartyl peptidase/L-asparaginase 1 [Musa acuminata 
subsp. malaccensis]
Length=324

 Score =   107 bits (267),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 68/90 (76%), Gaps = 1/90 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P +LP E +   +A L  CL LG++AL+++ P +DVVELVVRELE  P
Sbjct  3    WAIALHGGAGDIPLSLPAEGRAPREAALRHCLELGVAALKANRPPLDVVELVVRELENSP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
             FN+G+GS LT  GTVEMEA IMDG+ ++C
Sbjct  63   CFNAGKGSVLTTNGTVEMEACIMDGNTKKC  92



>ref|XP_008811641.1| PREDICTED: isoaspartyl peptidase/L-asparaginase 1-like [Phoenix 
dactylifera]
Length=325

 Score =   107 bits (267),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 70/90 (78%), Gaps = 1/90 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            W+IA+HGGAG  P +LP ER+   +A L +CL +G++AL++S P +DVVELVVRELE  P
Sbjct  3    WSIALHGGAGDIPYSLPPERRAPREAALRQCLAIGVAALKASRPPLDVVELVVRELENCP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
             FN+G+GS LT  GTVEMEA IMDG+ ++C
Sbjct  63   HFNAGKGSVLTTDGTVEMEACIMDGNTKKC  92



>emb|CDX69978.1| BnaA10g23270D [Brassica napus]
Length=315

 Score =   106 bits (265),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 67/90 (74%), Gaps = 1/90 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P +LP ER+   +  L  CL+LG+SAL+S    +DV ELVVRELE  P
Sbjct  4    WAIALHGGAGDIPIDLPDERRIPRETALRNCLDLGVSALKSGKHPLDVTELVVRELENHP  63

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
             FN+G+GS LT +GTVEMEASIMDG  +RC
Sbjct  64   DFNAGKGSVLTAQGTVEMEASIMDGKTKRC  93



>emb|CDY21508.1| BnaC09g47840D [Brassica napus]
Length=315

 Score =   106 bits (264),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 67/90 (74%), Gaps = 1/90 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P +LP ER+   +  L  CL+LG+SAL+S    +DV ELVVRELE  P
Sbjct  4    WAIALHGGAGDIPMDLPDERRIPRETALRHCLDLGVSALKSGRHPLDVTELVVRELENHP  63

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
             FN+G+GS LT +GTVEMEASIMDG  +RC
Sbjct  64   DFNAGKGSVLTTQGTVEMEASIMDGKTKRC  93



>ref|XP_004135623.1| PREDICTED: isoaspartyl peptidase/L-asparaginase-like [Cucumis 
sativus]
 gb|KGN66085.1| hypothetical protein Csa_1G570100 [Cucumis sativus]
Length=319

 Score =   105 bits (263),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 67/90 (74%), Gaps = 2/90 (2%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P +LP +R++  +  L RCL +G+ AL+S  P +DVVELVVRELE  P
Sbjct  3    WAIALHGGAGDIPLSLPSDRRQPREETLRRCLQIGVQALKSQKPPLDVVELVVRELENCP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
             FN+GRGS LT K TVEMEASIMD   +RC
Sbjct  63   HFNAGRGSVLTTKATVEMEASIMDST-KRC  91



>gb|EMT01892.1| Isoaspartyl peptidase/L-asparaginase [Aegilops tauschii]
Length=716

 Score =   108 bits (271),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 67/90 (74%), Gaps = 1/90 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P  LP ER+E   A L RCL+LG +ALR+   A+DVVELVVRELE  P
Sbjct  403  WAIALHGGAGDIPRTLPPERREPRLATLRRCLDLGAAALRAGRSALDVVELVVRELEDCP  462

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
             FN+G+GS LT  GTVEMEAS+MDG   RC
Sbjct  463  HFNAGKGSVLTSDGTVEMEASVMDGTDMRC  492



>ref|XP_010678369.1| PREDICTED: isoaspartyl peptidase/L-asparaginase 1 [Beta vulgaris 
subsp. vulgaris]
Length=316

 Score =   105 bits (263),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 67/90 (74%), Gaps = 1/90 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P NLP   +E  +  L  CL++G++AL+++   +DVVELVVRELE  P
Sbjct  3    WAIALHGGAGDIPLNLPQHEKEGRETALQHCLDIGVTALKAAHSPLDVVELVVRELENHP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            LFN+GRGS L  +G VEMEA IMDG+ ++C
Sbjct  63   LFNAGRGSVLNTEGNVEMEACIMDGNTKKC  92



>ref|XP_004166036.1| PREDICTED: isoaspartyl peptidase/L-asparaginase-like [Cucumis 
sativus]
Length=319

 Score =   105 bits (263),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 67/90 (74%), Gaps = 2/90 (2%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P +LP +R++  +  L RCL +G+ AL+S  P +DVVELVVRELE  P
Sbjct  3    WAIALHGGAGDIPLSLPSDRRQPREETLRRCLQIGVQALKSQKPPLDVVELVVRELENCP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
             FN+GRGS LT K TVEMEASIMD   +RC
Sbjct  63   HFNAGRGSVLTTKATVEMEASIMDST-KRC  91



>ref|XP_006345098.1| PREDICTED: isoaspartyl peptidase/L-asparaginase-like [Solanum 
tuberosum]
Length=315

 Score =   105 bits (262),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 52/90 (58%), Positives = 66/90 (73%), Gaps = 1/90 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P +LP E +E  +A L  CL +G+ A+++    +DVVELVVRELE +P
Sbjct  3    WAIALHGGAGDIPKDLPPELREPREASLRYCLQIGVDAIKAQKSPLDVVELVVRELENNP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
             FN+GRGS LT  GTVEMEA IMDG+ + C
Sbjct  63   YFNAGRGSVLTSNGTVEMEACIMDGNTKNC  92



>gb|KHN22484.1| Putative isoaspartyl peptidase/L-asparaginase 2 [Glycine soja]
Length=96

 Score =   100 bits (250),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 49/53 (92%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVR  211
            WAIAVHGGAGVDPNLPLERQEEAK LLTRCLNLGISAL S+LPAIDVVELVV 
Sbjct  4    WAIAVHGGAGVDPNLPLERQEEAKQLLTRCLNLGISALNSNLPAIDVVELVVH  56



>gb|KFK25178.1| hypothetical protein AALP_AA8G076700 [Arabis alpina]
Length=315

 Score =   105 bits (262),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 67/90 (74%), Gaps = 1/90 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P +LP ER+   +  L  CL++G+SAL+S    +DV ELVVRELE  P
Sbjct  4    WAIALHGGAGDIPIDLPDERRIPREIALRHCLDIGVSALKSGKSPLDVTELVVRELENHP  63

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
             FN+G+GS LT +GTVEMEASIMDG  +RC
Sbjct  64   DFNAGKGSVLTTEGTVEMEASIMDGKTKRC  93



>ref|XP_011014964.1| PREDICTED: isoaspartyl peptidase/L-asparaginase 1 [Populus euphratica]
Length=320

 Score =   105 bits (261),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/90 (58%), Positives = 68/90 (76%), Gaps = 1/90 (1%)
 Frame = +2

Query  53   WAIAVHGGAG-VDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG +  +LP ER+   +A L  CL LG++AL++    +DVVELVVRELE  P
Sbjct  3    WAIALHGGAGDISLSLPAERRLPREAALHHCLQLGVAALKAQKHPLDVVELVVRELENHP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
             FN+G+GS LT +GTVEMEA IMDG+ ++C
Sbjct  63   NFNAGKGSVLTSRGTVEMEACIMDGNSKKC  92



>ref|XP_010906197.1| PREDICTED: isoaspartyl peptidase/L-asparaginase 1 [Elaeis guineensis]
Length=364

 Score =   105 bits (261),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 68/90 (76%), Gaps = 1/90 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P +LP ER+   +A L  CL +G++AL++S   +DVVELVVRELE  P
Sbjct  38   WAIALHGGAGDIPYSLPPERRAPREAALRHCLAVGVAALKASRSPLDVVELVVRELENCP  97

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
             FN+GRGS LT  GTVEMEA IMDG+ ++C
Sbjct  98   HFNAGRGSVLTTSGTVEMEACIMDGNTKKC  127



>ref|XP_009122418.1| PREDICTED: isoaspartyl peptidase/L-asparaginase 1 [Brassica rapa]
Length=315

 Score =   104 bits (260),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 66/90 (73%), Gaps = 1/90 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P +LP ER+   +  L  CL+LG+SAL+S     DV ELVVRELE  P
Sbjct  4    WAIALHGGAGDIPIDLPDERRIPRETALRNCLDLGVSALKSGKHPPDVTELVVRELENHP  63

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
             FN+G+GS LT +GTVEMEASIMDG  +RC
Sbjct  64   DFNAGKGSVLTAQGTVEMEASIMDGKTKRC  93



>ref|XP_006650293.1| PREDICTED: isoaspartyl peptidase/L-asparaginase-like [Oryza brachyantha]
Length=323

 Score =   104 bits (260),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 67/90 (74%), Gaps = 1/90 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P +LP  R++   A L RCL+LG +ALR+  PA+DVVELVVRE+E  P
Sbjct  3    WAIALHGGAGDIPRSLPPHRRDPRLATLRRCLDLGTAALRAGHPALDVVELVVREMEDCP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
             FN+G GS LT  GTVEMEA +MDG+  RC
Sbjct  63   HFNAGVGSVLTTDGTVEMEACVMDGNTMRC  92



>ref|XP_004241610.1| PREDICTED: isoaspartyl peptidase/L-asparaginase-like [Solanum 
lycopersicum]
Length=314

 Score =   104 bits (260),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 66/90 (73%), Gaps = 1/90 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P +LP E ++  ++ L RCL++ I AL S    +DVVELVVRELE DP
Sbjct  3    WAIALHGGAGDIPRDLPPELRQLRESCLRRCLDIAIDALNSHKSPLDVVELVVRELENDP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
             FN+GRGS LT+ GTVEMEA IMDG  + C
Sbjct  63   HFNAGRGSVLTNNGTVEMEACIMDGGTKNC  92



>ref|XP_001771151.1| predicted protein [Physcomitrella patens]
 gb|EDQ64000.1| predicted protein [Physcomitrella patens]
Length=318

 Score =   104 bits (260),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/91 (56%), Positives = 69/91 (76%), Gaps = 2/91 (2%)
 Frame = +2

Query  53   WAIAVHGGAGV--DPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETD  226
            WAIA+HGGAG+     +  + ++  +A L   L++GI+ALR+SLPA++ VELVVR LE +
Sbjct  4    WAIALHGGAGMIAKEKMTADWKKRTEAALNEILDVGIAALRNSLPAVEAVELVVRALEDN  63

Query  227  PLFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
             LFN+G+GS LT+KGTVEMEASIMDG  + C
Sbjct  64   TLFNAGKGSVLTNKGTVEMEASIMDGRSKNC  94



>ref|XP_011086915.1| PREDICTED: isoaspartyl peptidase/L-asparaginase 1 [Sesamum indicum]
Length=321

 Score =   104 bits (260),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 67/90 (74%), Gaps = 1/90 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P ++P ER+E  +A L  CL +G+ A+++    +DVVELVVRELE +P
Sbjct  3    WAIALHGGAGDIPRSMPPERREPREAALRHCLQIGVDAIKAGRSPLDVVELVVRELEDNP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
             FN+G+GS LT  GTVEMEA IMDG+ + C
Sbjct  63   NFNAGKGSVLTSNGTVEMEACIMDGNTKNC  92



>ref|XP_002514609.1| l-asparaginase, putative [Ricinus communis]
 gb|EEF47715.1| l-asparaginase, putative [Ricinus communis]
Length=321

 Score =   104 bits (259),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 67/90 (74%), Gaps = 1/90 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P NLP ER+   +A L  CL +G++AL++    +DVVELVVRELE  P
Sbjct  3    WAIALHGGAGDIPLNLPPERRLPREAALRHCLEIGVAALQAQKHPLDVVELVVRELENHP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
             FN+G+GS LT +GTVEMEA IMDG  ++C
Sbjct  63   NFNAGKGSVLTTEGTVEMEACIMDGKTKKC  92



>ref|XP_007209366.1| hypothetical protein PRUPE_ppa008761mg [Prunus persica]
 gb|EMJ10565.1| hypothetical protein PRUPE_ppa008761mg [Prunus persica]
Length=320

 Score =   104 bits (259),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 69/90 (77%), Gaps = 2/90 (2%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P +LP ER+   +A L  CL++G+ AL++  PA+DVVELVVRELE  P
Sbjct  3    WAIALHGGAGDIPLSLPPERRLPREAGLRHCLHIGVEALKAKTPALDVVELVVRELENIP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
             FN+G+GS LT +GTVEMEA IMDG  +RC
Sbjct  63   HFNAGKGSVLTTQGTVEMEACIMDGT-KRC  91



>ref|XP_006376770.1| hypothetical protein POPTR_0012s06250g [Populus trichocarpa]
 gb|ERP54567.1| hypothetical protein POPTR_0012s06250g [Populus trichocarpa]
Length=320

 Score =   103 bits (258),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 68/90 (76%), Gaps = 1/90 (1%)
 Frame = +2

Query  53   WAIAVHGGAG-VDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG +  +LP ER+   +A L  CL +G++AL++    +DVVELVVRELE  P
Sbjct  3    WAIALHGGAGDISLSLPAERRLPREAALHHCLQIGVAALKAQKHPLDVVELVVRELENHP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
             FN+G+GS LT +GTVEMEA IMDG+ ++C
Sbjct  63   NFNAGKGSVLTSRGTVEMEACIMDGNSKKC  92



>gb|KJB51088.1| hypothetical protein B456_008G200400 [Gossypium raimondii]
Length=320

 Score =   103 bits (257),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 68/90 (76%), Gaps = 1/90 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIAVHGGAG  P +LP E++   +A L RCL++GI+AL++    +DVVELVVRELE +P
Sbjct  3    WAIAVHGGAGDIPLSLPPEKRLPREAGLRRCLDVGIAALKAHNHPLDVVELVVRELENNP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
             FN+G+GS LT  GTVEMEA IMDG   +C
Sbjct  63   HFNAGKGSVLTTSGTVEMEACIMDGKTMKC  92



>gb|KJB51085.1| hypothetical protein B456_008G200400 [Gossypium raimondii]
Length=320

 Score =   103 bits (257),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 68/90 (76%), Gaps = 1/90 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIAVHGGAG  P +LP E++   +A L RCL++GI+AL++    +DVVELVVRELE +P
Sbjct  3    WAIAVHGGAGDIPLSLPPEKRLPREAGLRRCLDVGIAALKAHNHPLDVVELVVRELENNP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
             FN+G+GS LT  GTVEMEA IMDG   +C
Sbjct  63   HFNAGKGSVLTTSGTVEMEACIMDGKTMKC  92



>ref|XP_009596886.1| PREDICTED: isoaspartyl peptidase/L-asparaginase 1-like [Nicotiana 
tomentosiformis]
Length=315

 Score =   103 bits (257),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 65/90 (72%), Gaps = 1/90 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P +LP E +E  +  L  CL +G+ AL++    +DVVELVVRELE +P
Sbjct  3    WAIALHGGAGDIPKDLPPELREPREVCLRYCLQMGVDALKAHKSPLDVVELVVRELENNP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
             FN+G+GS LT  GTVEMEA IMDG+ + C
Sbjct  63   YFNAGKGSVLTSNGTVEMEACIMDGNTKNC  92



>gb|KJB51084.1| hypothetical protein B456_008G200400 [Gossypium raimondii]
Length=320

 Score =   103 bits (257),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 68/90 (76%), Gaps = 1/90 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIAVHGGAG  P +LP E++   +A L RCL++GI+AL++    +DVVELVVRELE +P
Sbjct  3    WAIAVHGGAGDIPLSLPPEKRLPREAGLRRCLDVGIAALKAHNHPLDVVELVVRELENNP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
             FN+G+GS LT  GTVEMEA IMDG   +C
Sbjct  63   HFNAGKGSVLTTSGTVEMEACIMDGKTMKC  92



>ref|XP_007155205.1| hypothetical protein PHAVU_003G182400g [Phaseolus vulgaris]
 gb|ESW27199.1| hypothetical protein PHAVU_003G182400g [Phaseolus vulgaris]
Length=322

 Score =   103 bits (257),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 64/90 (71%), Gaps = 1/90 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P +LP ER+   +  L  CL +G+ AL++ LP +DVVE VVRELE  P
Sbjct  3    WAIALHGGAGDIPLSLPPERRHPREEALRHCLQIGVEALKAKLPPLDVVERVVRELENIP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
             FN+G+GS LT  GTVEMEASIMDG    C
Sbjct  63   QFNAGKGSVLTSNGTVEMEASIMDGTTMDC  92



>emb|CDY21509.1| BnaC09g47830D [Brassica napus]
Length=315

 Score =   103 bits (256),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 65/90 (72%), Gaps = 1/90 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGG G  P +LP E +   +  L  CL+LG+SAL+S    +DV ELVVRELE  P
Sbjct  4    WAIALHGGGGDIPIDLPDELRIPRETALRHCLDLGVSALKSGKHPLDVTELVVRELENHP  63

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
             FN+G+GS LT +GTVEMEASIMDG  +RC
Sbjct  64   YFNAGKGSVLTAQGTVEMEASIMDGKTKRC  93



>gb|KJB39962.1| hypothetical protein B456_007G040100 [Gossypium raimondii]
Length=321

 Score =   103 bits (256),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 68/90 (76%), Gaps = 1/90 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P +LP +R+   +A L  CL++GI+AL++    +DVVELVVRELE  P
Sbjct  3    WAIALHGGAGDIPHSLPPDRRLPREAGLRHCLDVGIAALKAHKHPLDVVELVVRELENYP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
             FN+G+GS LT  GTVEMEASIMDG  ++C
Sbjct  63   HFNAGKGSVLTSSGTVEMEASIMDGKSKKC  92



>ref|XP_006442273.1| hypothetical protein CICLE_v10023475mg [Citrus clementina]
 gb|ESR55513.1| hypothetical protein CICLE_v10023475mg [Citrus clementina]
Length=153

 Score =   100 bits (248),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 66/90 (73%), Gaps = 1/90 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGG G  P  +P ER++  +A L  CL++ + AL+S   A+DVVELVVRELE + 
Sbjct  3    WAIALHGGPGDIPVTMPPERRQPREAALRHCLDISVDALKSQKYALDVVELVVRELENNS  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
             FN+G+GS L + GTVEMEA IMDG+ +RC
Sbjct  63   NFNAGKGSVLINAGTVEMEACIMDGNTKRC  92



>ref|XP_004299276.1| PREDICTED: isoaspartyl peptidase/L-asparaginase 1 [Fragaria vesca 
subsp. vesca]
Length=321

 Score =   103 bits (256),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 68/90 (76%), Gaps = 2/90 (2%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P +L  ER++  +A L  CL +G+ AL+++ P +DVVELVVRELE  P
Sbjct  3    WAIALHGGAGDIPLSLSPERRQPREAALRHCLQIGVEALKANKPPLDVVELVVRELENIP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            +FN+G+GS LT  GTVEMEA IMDG  +RC
Sbjct  63   VFNAGKGSVLTSNGTVEMEACIMDGT-KRC  91



>ref|XP_008240074.1| PREDICTED: isoaspartyl peptidase/L-asparaginase 1 [Prunus mume]
Length=320

 Score =   103 bits (256),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 69/90 (77%), Gaps = 2/90 (2%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P +LP ER+   +A L  CL++G+ AL+++ PA DVVELVVRELE  P
Sbjct  3    WAIALHGGAGDIPLSLPPERRLPREAGLRHCLHIGVEALKANTPASDVVELVVRELENIP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
             FN+G+GS LT +GTVEMEA IMDG  +RC
Sbjct  63   HFNAGKGSVLTTQGTVEMEACIMDGT-KRC  91



>ref|XP_009122419.1| PREDICTED: isoaspartyl peptidase/L-asparaginase 1-like [Brassica 
rapa]
 emb|CDX69977.1| BnaA10g23260D [Brassica napus]
Length=314

 Score =   102 bits (255),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 52/90 (58%), Positives = 65/90 (72%), Gaps = 1/90 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGG G  P +LP E +   +  L  CL+LG+SAL+S    +DV ELVVRELE  P
Sbjct  3    WAIALHGGGGDIPIDLPDELRIPRETALRHCLDLGVSALKSGKHPLDVTELVVRELENHP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
             FN+G+GS LT +GT+EMEASIMDG  +RC
Sbjct  63   YFNAGKGSVLTAQGTIEMEASIMDGKTKRC  92



>ref|NP_001050607.1| Os03g0597600 [Oryza sativa Japonica Group]
 gb|ABF97457.1| transposon protein, putative, unclassified, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF12521.1| Os03g0597600 [Oryza sativa Japonica Group]
 dbj|BAG91444.1| unnamed protein product [Oryza sativa Japonica Group]
Length=317

 Score =   102 bits (255),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 67/90 (74%), Gaps = 1/90 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WA+A+HGGAG  P +LP +R+E   A L RCL+L  +ALRS   A+DVVELVVRELE  P
Sbjct  3    WAVALHGGAGDIPRSLPPDRREPRLATLRRCLDLATAALRSGRAALDVVELVVRELENCP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
             +N+G GS LT  GTVEMEA++MDG+  RC
Sbjct  63   HYNAGVGSVLTADGTVEMEAAVMDGNTLRC  92



>gb|AAO59983.1| putative L-asparaginase [Oryza sativa Japonica Group]
Length=308

 Score =   102 bits (255),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 67/90 (74%), Gaps = 1/90 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WA+A+HGGAG  P +LP +R+E   A L RCL+L  +ALRS   A+DVVELVVRELE  P
Sbjct  3    WAVALHGGAGDIPRSLPPDRREPRLATLRRCLDLATAALRSGRAALDVVELVVRELENCP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
             +N+G GS LT  GTVEMEA++MDG+  RC
Sbjct  63   HYNAGVGSVLTADGTVEMEAAVMDGNTLRC  92



>ref|XP_010232895.1| PREDICTED: isoaspartyl peptidase/L-asparaginase 1-like [Brachypodium 
distachyon]
Length=321

 Score =   102 bits (255),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 64/90 (71%), Gaps = 1/90 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+ GG G  P +LP ER E   A L RCL+LG+SAL+    A+DVVELVVRELE  P
Sbjct  3    WAIALQGGGGDIPRSLPPERAEPRLATLRRCLDLGVSALQDGRAALDVVELVVRELENCP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
             FN+G+GS LT  GTVEMEASIMDG    C
Sbjct  63   HFNAGKGSVLTSDGTVEMEASIMDGTTMGC  92



>ref|XP_006828428.1| hypothetical protein AMTR_s00060p00098750 [Amborella trichopoda]
 gb|ERM95844.1| hypothetical protein AMTR_s00060p00098750 [Amborella trichopoda]
Length=148

 Score = 99.4 bits (246),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 50/79 (63%), Positives = 62/79 (78%), Gaps = 0/79 (0%)
 Frame = +2

Query  83   VDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPLFNSGRGSALT  262
            ++P+LP +RQEEA       L+LGI ALRS+  A+DVVELVVRELE +PLFN G GSALT
Sbjct  1    MNPSLPRQRQEEACQAFLSALHLGIFALRSASSAVDVVELVVRELELNPLFNFGCGSALT  60

Query  263  HKGTVEMEASIMDGHGRRC  319
             +GTVEM+ASIM+G  R+C
Sbjct  61   AQGTVEMDASIMNGSTRKC  79



>gb|EEC75690.1| hypothetical protein OsI_12500 [Oryza sativa Indica Group]
Length=310

 Score =   102 bits (254),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 67/90 (74%), Gaps = 1/90 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WA+A+HGGAG  P +LP +R+E   A L RCL+L  +ALRS   A+DVVELVVRELE  P
Sbjct  3    WAVALHGGAGDIPRSLPPDRREPRLATLRRCLDLATAALRSGRAALDVVELVVRELENCP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
             +N+G GS LT  GTVEMEA++MDG+  RC
Sbjct  63   HYNAGVGSVLTADGTVEMEAAVMDGNTLRC  92



>ref|XP_010031115.1| PREDICTED: isoaspartyl peptidase/L-asparaginase 1-like [Eucalyptus 
grandis]
Length=318

 Score =   102 bits (253),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 62/85 (73%), Gaps = 0/85 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIA+HGGAGV   LP E +   +A L  CL LG+ AL+S    +DVVELVVRELE +P 
Sbjct  3    WAIALHGGAGVPLTLPPEGRLPREACLRHCLQLGVDALKSKKSPLDVVELVVRELENNPH  62

Query  233  FNSGRGSALTHKGTVEMEASIMDGH  307
            FN+G+GS LT  GTVEMEA IMDG+
Sbjct  63   FNAGKGSVLTSSGTVEMEACIMDGN  87



>gb|EYU23631.1| hypothetical protein MIMGU_mgv1a010176mg [Erythranthe guttata]
Length=320

 Score =   102 bits (253),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 66/90 (73%), Gaps = 1/90 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P ++P ER+E  +A L  CL +G+ A+++    +DVVELVVRELE +P
Sbjct  3    WAIALHGGAGDIPRSMPPERREPREAALRHCLQIGVDAIKAGRSPLDVVELVVRELEDNP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
             FN+GRGS LT  GTVEMEA +M G  ++C
Sbjct  63   HFNAGRGSVLTSNGTVEMEACVMVGDTKKC  92



>ref|XP_010101648.1| Isoaspartyl peptidase/L-asparaginase 1 [Morus notabilis]
 gb|EXB89117.1| Isoaspartyl peptidase/L-asparaginase 1 [Morus notabilis]
Length=316

 Score =   101 bits (252),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 67/90 (74%), Gaps = 1/90 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P  LP +R+   +  L  CL+LG+ AL++   A+DVVELVVRELE +P
Sbjct  3    WAIALHGGAGDIPLTLPPDRRLPREEALHHCLHLGVQALKAGNSALDVVELVVRELENNP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
             +N+G+GS LT +GTVEMEA IMDG  ++C
Sbjct  63   HYNAGKGSVLTSEGTVEMEACIMDGKTKKC  92



>gb|KHF98766.1| hypothetical protein F383_16974 [Gossypium arboreum]
Length=321

 Score =   101 bits (252),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 52/90 (58%), Positives = 67/90 (74%), Gaps = 1/90 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P +LP +R+   +  L  CL++GI+AL++    +DVVELVVRELE  P
Sbjct  3    WAIALHGGAGDIPHSLPPDRRLPREVGLRHCLDVGIAALKAHKHPLDVVELVVRELENYP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
             FN+G+GS LT  GTVEMEASIMDG  ++C
Sbjct  63   HFNAGKGSVLTSSGTVEMEASIMDGKSKKC  92



>ref|XP_010031103.1| PREDICTED: isoaspartyl peptidase/L-asparaginase 1-like [Eucalyptus 
grandis]
Length=319

 Score =   101 bits (252),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 63/86 (73%), Gaps = 1/86 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P  LP ER+   +A L  CL LG+ AL+S    +DVVELVVRELE +P
Sbjct  3    WAIALHGGAGDIPLTLPPERRLPREACLRHCLQLGVDALKSKKSPLDVVELVVRELENNP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGH  307
             FN+G+GS LT  GTVEMEA IMDG+
Sbjct  63   HFNAGKGSVLTSSGTVEMEACIMDGN  88



>gb|KDP31384.1| hypothetical protein JCGZ_11760 [Jatropha curcas]
Length=321

 Score =   101 bits (252),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 66/90 (73%), Gaps = 1/90 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P ++P ER+   +A L  CL +G++AL++    +DVVELVVRELE  P
Sbjct  3    WAIALHGGAGDIPFSMPPERRLPREATLRHCLQIGVAALQAQKHPLDVVELVVRELENHP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
             FN+G+GS LT  GTVEMEA IMDG  ++C
Sbjct  63   NFNAGKGSVLTTAGTVEMEACIMDGKTKKC  92



>pdb|2GEZ|A Chain A, Crystal Structure Of Potassium-Independent Plant Asparaginase
 pdb|2GEZ|C Chain C, Crystal Structure Of Potassium-Independent Plant Asparaginase
 pdb|2GEZ|E Chain E, Crystal Structure Of Potassium-Independent Plant Asparaginase
 pdb|2GEZ|G Chain G, Crystal Structure Of Potassium-Independent Plant Asparaginase
Length=195

 Score = 99.4 bits (246),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 66/90 (73%), Gaps = 1/90 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            W+IA+HGGAG  P +LP ER++  +  L  CL +G+ AL++  P +DVVELVVRELE   
Sbjct  7    WSIALHGGAGDIPFSLPPERRKPREEGLRHCLQIGVEALKAQKPPLDVVELVVRELENIE  66

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
             FN+G GS LT+ GTVEMEASIMDG+  +C
Sbjct  67   HFNAGIGSVLTNSGTVEMEASIMDGNTMKC  96



>ref|XP_004982478.1| PREDICTED: isoaspartyl peptidase/L-asparaginase 1-like isoform 
X2 [Setaria italica]
Length=303

 Score =   101 bits (251),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 64/90 (71%), Gaps = 1/90 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WA+A+HGGAG  P  LP E +E   A L RCL+LG +ALR    A+DVVELVVRELE  P
Sbjct  3    WALALHGGAGDVPRTLPPETREPRLAALRRCLDLGAAALRDGRAALDVVELVVRELEDCP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
             FN+GRGS LT  GTVEMEA +M+G   RC
Sbjct  63   HFNAGRGSVLTADGTVEMEACVMEGATLRC  92



>gb|EYU36320.1| hypothetical protein MIMGU_mgv11b023434mg [Erythranthe guttata]
Length=74

 Score = 96.3 bits (238),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP +RQE+AK LLTRCLNLGISALRSS  AIDVVELV+  L  D L
Sbjct  4    WAIAVHGGAGVDPNLPNQRQEQAKQLLTRCLNLGISALRSSHSAIDVVELVISILNFDNL  63

Query  233  F  235
             
Sbjct  64   I  64



>ref|XP_004982477.1| PREDICTED: isoaspartyl peptidase/L-asparaginase 1-like isoform 
X1 [Setaria italica]
Length=332

 Score =   100 bits (250),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 64/90 (71%), Gaps = 1/90 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WA+A+HGGAG  P  LP E +E   A L RCL+LG +ALR    A+DVVELVVRELE  P
Sbjct  3    WALALHGGAGDVPRTLPPETREPRLAALRRCLDLGAAALRDGRAALDVVELVVRELEDCP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
             FN+GRGS LT  GTVEMEA +M+G   RC
Sbjct  63   HFNAGRGSVLTADGTVEMEACVMEGATLRC  92



>ref|XP_008240025.1| PREDICTED: LOW QUALITY PROTEIN: isoaspartyl peptidase/L-asparaginase 
1-like [Prunus mume]
Length=321

 Score =   100 bits (250),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 52/90 (58%), Positives = 69/90 (77%), Gaps = 2/90 (2%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WA+A+HGGAG  P +LP +R+   +A L  CL++G+ AL+++ PA+DVVEL+VRELE  P
Sbjct  3    WAVALHGGAGDIPLSLPPKRRLPLEAGLRHCLHIGVEALKANTPALDVVELMVRELENIP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
             FN+G+GS LT  GTVEMEA IMDG  +RC
Sbjct  63   YFNAGKGSVLTTLGTVEMEACIMDGT-KRC  91



>ref|XP_007037644.1| N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily 
protein [Theobroma cacao]
 gb|EOY22145.1| N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily 
protein [Theobroma cacao]
Length=320

 Score =   100 bits (250),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 52/90 (58%), Positives = 67/90 (74%), Gaps = 1/90 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P +LP +R+   +A L  CL++GI+AL++    +DVVELVVRELE  P
Sbjct  3    WAIALHGGAGDIPLSLPPDRRLPREAGLRHCLDVGIAALKAHKHPLDVVELVVRELENHP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
             FN+G+GS LT  GTVEMEA IMDG  ++C
Sbjct  63   HFNAGKGSVLTTSGTVEMEACIMDGKTKKC  92



>sp|P30364.1|ASPG_LUPAN RecName: Full=Isoaspartyl peptidase/L-asparaginase; AltName: 
Full=L-asparagine amidohydrolase; Contains: RecName: Full=Isoaspartyl 
peptidase/L-asparaginase subunit alpha; Contains: 
RecName: Full=Isoaspartyl peptidase/L-asparaginase subunit beta; 
Flags: Precursor [Lupinus angustifolius]
 emb|CAA43099.1| developing seed L-asparaginase [Lupinus angustifolius]
Length=325

 Score =   100 bits (250),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 52/90 (58%), Positives = 65/90 (72%), Gaps = 1/90 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            W+IA+HGGAG  P +LP ER++  +  L  CL +G+ AL+S  P +DVVELVVRELE   
Sbjct  4    WSIALHGGAGDIPFSLPPERRQPREEGLRHCLQIGVEALKSQKPPLDVVELVVRELENIQ  63

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
             FN+G GS LT+ GTVEMEASIMDG   +C
Sbjct  64   HFNAGIGSVLTNSGTVEMEASIMDGKTMKC  93



>ref|XP_008450655.1| PREDICTED: isoaspartyl peptidase/L-asparaginase 1 isoform X1 
[Cucumis melo]
Length=327

 Score =   100 bits (249),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 68/98 (69%), Gaps = 10/98 (10%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELV--------  205
            WAIA+HGGAG  P +LP +R++  +  L RCL +G+ AL+S  P +DVVELV        
Sbjct  3    WAIALHGGAGDIPLSLPSDRRQPREETLRRCLQIGVQALKSQKPPLDVVELVCREFVLVQ  62

Query  206  VRELETDPLFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            VRELE  P FN+GRGS LT KGTVEMEASIMD   +RC
Sbjct  63   VRELENCPHFNAGRGSVLTTKGTVEMEASIMDST-KRC  99



>ref|XP_009785994.1| PREDICTED: isoaspartyl peptidase/L-asparaginase 1-like [Nicotiana 
sylvestris]
Length=315

 Score =   100 bits (249),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 64/90 (71%), Gaps = 1/90 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P +LP E +E  +  L  CL +G+ AL++    + VVELVVRELE +P
Sbjct  3    WAIALHGGAGDIPKDLPPELREPRETCLRYCLQMGVDALKAHKSPLGVVELVVRELENNP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
             FN+G+GS LT  GTVEMEA IMDG+ + C
Sbjct  63   YFNAGKGSVLTSNGTVEMEACIMDGNTKNC  92



>gb|ACN32623.1| L-asparaginase [Withania somnifera]
Length=280

 Score = 99.4 bits (246),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 66/90 (73%), Gaps = 1/90 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            W+IA+HGGAG  P +LP ER++  +  L  CL +G+ AL++  P +DVVELVVRELE   
Sbjct  4    WSIALHGGAGDIPFSLPPERRKPREEGLRHCLQIGVEALKAQKPPLDVVELVVRELENIE  63

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
             FN+G GS LT+ GTVEMEASIMDG+  +C
Sbjct  64   HFNAGIGSVLTNSGTVEMEASIMDGNTMKC  93



>sp|P50288.1|ASPG_LUPAL RecName: Full=Isoaspartyl peptidase/L-asparaginase; AltName: 
Full=L-asparagine amidohydrolase; Contains: RecName: Full=Isoaspartyl 
peptidase/L-asparaginase subunit alpha; Contains: 
RecName: Full=Isoaspartyl peptidase/L-asparaginase subunit beta; 
Flags: Precursor [Lupinus albus]
 gb|AAA33409.1| L-asparaginase [Lupinus albus]
Length=325

 Score = 99.8 bits (247),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/90 (58%), Positives = 66/90 (73%), Gaps = 1/90 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            W+IA+HGGAG  P +LP ER++  +  L  CL +GI AL++  P +DVVELVVRELE   
Sbjct  4    WSIALHGGAGDIPFSLPPERRKPREEGLRHCLQIGIEALKAQNPPLDVVELVVRELENIQ  63

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
             FN+G GS LT+ GTVEMEASIMDG+  +C
Sbjct  64   HFNAGIGSVLTNSGTVEMEASIMDGNTMKC  93



>sp|Q9ZSD6.1|ASPG_LUPLU RecName: Full=Isoaspartyl peptidase/L-asparaginase; Short=LlA; 
AltName: Full=L-asparagine amidohydrolase; AltName: Full=Potassium-independent 
L-asparaginase; Contains: RecName: Full=Isoaspartyl 
peptidase/L-asparaginase subunit alpha; Contains: 
RecName: Full=Isoaspartyl peptidase/L-asparaginase subunit 
beta; Flags: Precursor [Lupinus luteus]
 gb|AAD03742.1| L-asparaginase [Lupinus luteus]
Length=325

 Score = 99.4 bits (246),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 66/90 (73%), Gaps = 1/90 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            W+IA+HGGAG  P +LP ER++  +  L  CL +G+ AL++  P +DVVELVVRELE   
Sbjct  4    WSIALHGGAGDIPFSLPPERRKPREEGLRHCLQIGVEALKAQKPPLDVVELVVRELENIE  63

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
             FN+G GS LT+ GTVEMEASIMDG+  +C
Sbjct  64   HFNAGIGSVLTNSGTVEMEASIMDGNTMKC  93



>ref|NP_001149875.1| transposon protein [Zea mays]
 gb|ACG37065.1| transposon protein [Zea mays]
 tpg|DAA50236.1| TPA: L-asparaginase-like family protein [Zea mays]
Length=335

 Score = 98.6 bits (244),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 63/90 (70%), Gaps = 1/90 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WA+A+HGGAG  P  LP E +E   A L RCL++G +ALR    A+DVVELVVRELE  P
Sbjct  3    WALALHGGAGDVPRTLPPESREPRLATLRRCLDIGTAALREGRTALDVVELVVRELEDCP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
             FN+GRGS LT  GTVEMEA +M+G    C
Sbjct  63   HFNAGRGSVLTSAGTVEMEACVMEGATLHC  92



>ref|XP_008374666.1| PREDICTED: isoaspartyl peptidase/L-asparaginase 1-like [Malus 
domestica]
Length=326

 Score = 97.8 bits (242),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 67/90 (74%), Gaps = 2/90 (2%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P +LP ER+   +A L R L++G+ AL+++ P +DVVELVVRELE  P
Sbjct  3    WAIALHGGAGDIPLSLPPERRLPREAGLRRSLHIGVEALKANTPPLDVVELVVRELENIP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
             FN+G+GS LT  GTVEMEA IMD   +RC
Sbjct  63   HFNAGKGSVLTTDGTVEMEACIMDDK-KRC  91



>gb|KJB51090.1| hypothetical protein B456_008G200400 [Gossypium raimondii]
Length=319

 Score = 97.4 bits (241),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 67/90 (74%), Gaps = 2/90 (2%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIAVHGGAG  P +LP E++   +A L RCL++GI+AL++    +DVVELV RELE +P
Sbjct  3    WAIAVHGGAGDIPLSLPPEKRLPREAGLRRCLDVGIAALKAHNHPLDVVELV-RELENNP  61

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
             FN+G+GS LT  GTVEMEA IMDG   +C
Sbjct  62   HFNAGKGSVLTTSGTVEMEACIMDGKTMKC  91



>ref|XP_004236074.1| PREDICTED: isoaspartyl peptidase/L-asparaginase [Solanum lycopersicum]
Length=315

 Score = 97.4 bits (241),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 63/90 (70%), Gaps = 1/90 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P ++P E +E  +A L  CL   + AL++    +DVVE+VVRELE + 
Sbjct  3    WAIALHGGAGDIPKDMPPELREPREASLRYCLQTAVDALKAQKSPLDVVEIVVRELENNL  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
             FN+GRGS LT  GTVEMEA IMDG+ + C
Sbjct  63   YFNAGRGSVLTSNGTVEMEACIMDGNTKNC  92



>gb|KJB51083.1| hypothetical protein B456_008G200400 [Gossypium raimondii]
Length=319

 Score = 97.4 bits (241),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 67/90 (74%), Gaps = 2/90 (2%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIAVHGGAG  P +LP E++   +A L RCL++GI+AL++    +DVVELV RELE +P
Sbjct  3    WAIAVHGGAGDIPLSLPPEKRLPREAGLRRCLDVGIAALKAHNHPLDVVELV-RELENNP  61

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
             FN+G+GS LT  GTVEMEA IMDG   +C
Sbjct  62   HFNAGKGSVLTTSGTVEMEACIMDGKTMKC  91



>ref|XP_001753813.1| predicted protein [Physcomitrella patens]
 gb|EDQ81565.1| predicted protein [Physcomitrella patens]
Length=319

 Score = 96.3 bits (238),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 66/91 (73%), Gaps = 2/91 (2%)
 Frame = +2

Query  53   WAIAVHGGAGV--DPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETD  226
            WA+A+HGGAG+     +  + Q+  +  L   LN+GI+AL++ L A++ VELVV+ LE +
Sbjct  4    WALALHGGAGMIAQEKMSADWQKCTEEALNEILNIGITALQNKLTALETVELVVKALEDN  63

Query  227  PLFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
             LFN+G+GS LT+KGTVEMEASIMDG  + C
Sbjct  64   TLFNAGKGSVLTNKGTVEMEASIMDGRTKNC  94



>ref|XP_008374665.1| PREDICTED: isoaspartyl peptidase/L-asparaginase 1-like [Malus 
domestica]
Length=326

 Score = 95.9 bits (237),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 66/90 (73%), Gaps = 2/90 (2%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+ GGAG  P +LP ER+   +A +  CL++G+ AL+++ P +DVVELVVRELE  P
Sbjct  3    WAIALQGGAGDIPLSLPPERRLPREAGIRHCLHIGVEALKANTPPLDVVELVVRELENIP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
             FN+G+GS LT  GTVEMEA IMD   +RC
Sbjct  63   HFNAGKGSVLTTDGTVEMEACIMDDK-KRC  91



>ref|XP_002990172.1| hypothetical protein SELMODRAFT_160700 [Selaginella moellendorffii]
 gb|EFJ08732.1| hypothetical protein SELMODRAFT_160700 [Selaginella moellendorffii]
Length=298

 Score = 95.5 bits (236),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 51/89 (57%), Positives = 65/89 (73%), Gaps = 2/89 (2%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WA+A+HGGAG D     ER E A+++L  CL+LG++ L S   A+DVVELVVR LE + +
Sbjct  3    WALALHGGAG-DIKRS-ERTEAAESVLLECLSLGVAELESGRCALDVVELVVRALENNEM  60

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FN+G+GS LT +GTVEMEASIMDG    C
Sbjct  61   FNAGKGSVLTAEGTVEMEASIMDGATGDC  89



>ref|XP_009346265.1| PREDICTED: isoaspartyl peptidase/L-asparaginase 1-like [Pyrus 
x bretschneideri]
Length=321

 Score = 95.1 bits (235),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 52/90 (58%), Positives = 66/90 (73%), Gaps = 2/90 (2%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P +LP ER+   +A L   L++G+ AL+++ P +DVVELVVRELE  P
Sbjct  3    WAIALHGGAGDIPLSLPPERRLPREAGLRHSLHIGVVALKANTPPLDVVELVVRELENIP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
             FN+G+GS LT  GTVEMEA IMD   +RC
Sbjct  63   HFNAGKGSVLTTDGTVEMEACIMDDK-KRC  91



>ref|XP_009346253.1| PREDICTED: isoaspartyl peptidase/L-asparaginase 1-like [Pyrus 
x bretschneideri]
Length=326

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 66/90 (73%), Gaps = 2/90 (2%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P +L  ER+   +A +  CL++G+ AL+++   +DVVELVVRELE +P
Sbjct  3    WAIALHGGAGGIPLSLSPERRLPCEAGIRHCLHIGVEALKANTSPLDVVELVVRELENNP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
             FN+G+GS LT  GTVEMEA IMD   +RC
Sbjct  63   HFNAGKGSVLTTDGTVEMEACIMDDK-KRC  91



>ref|XP_002992515.1| hypothetical protein SELMODRAFT_236523 [Selaginella moellendorffii]
 gb|EFJ06453.1| hypothetical protein SELMODRAFT_236523 [Selaginella moellendorffii]
Length=298

 Score = 93.6 bits (231),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 64/89 (72%), Gaps = 2/89 (2%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WA+A+HGGAG D     ER E  +++L  CL+LG++ L S   A+DVVELVVR LE + +
Sbjct  3    WALALHGGAG-DIKRS-ERTEAVESVLLECLSLGVAELESGRCALDVVELVVRALENNEM  60

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FN+G+GS LT +GTVEMEASIMDG    C
Sbjct  61   FNAGKGSVLTAEGTVEMEASIMDGATGDC  89



>ref|XP_004352518.1| asparaginase [Acanthamoeba castellanii str. Neff]
 gb|ELR23041.1| asparaginase [Acanthamoeba castellanii str. Neff]
Length=350

 Score = 92.0 bits (227),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 61/90 (68%), Gaps = 1/90 (1%)
 Frame = +2

Query  53   WAIAVHGGAG-VDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WA+A+HGGAG +  ++PL+R+EE    L   L+ G+S L     A+D VE VVR LE DP
Sbjct  13   WALALHGGAGTISRSVPLDRREEYLKGLRTALDTGVSILAQGGTALDAVEAVVRTLEDDP  72

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            LFN+GRG+  TH  TVE++ASIMDG    C
Sbjct  73   LFNAGRGAVFTHDETVELDASIMDGRTLAC  102



>ref|WP_038129740.1| isoaspartyl peptidase [Verrucomicrobia bacterium SCGC AAA168-F10]
Length=315

 Score = 84.0 bits (206),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 57/85 (67%), Gaps = 1/85 (1%)
 Frame = +2

Query  53   WAIAVHGGAG-VDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG V P++P ER+    A L   L +G+  L     ++D VE  VR LE +P
Sbjct  15   WAIALHGGAGYVSPDMPEERKARYMAALDSALAIGVDILEQGGSSLDAVEQTVRFLEDNP  74

Query  230  LFNSGRGSALTHKGTVEMEASIMDG  304
            LFN+GRG+  T++G  E++A+IMDG
Sbjct  75   LFNAGRGAVFTNEGKNELDAAIMDG  99



>ref|WP_022824798.1| asparaginase [Hymenobacter norwichensis]
Length=327

 Score = 83.6 bits (205),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 60/89 (67%), Gaps = 2/89 (2%)
 Frame = +2

Query  53   WAIAVHGGAG-VDPNLPLERQEEA-KALLTRCLNLGISALRSSLPAIDVVELVVRELETD  226
            +++A+HGGAG + P L    +E A +A L   L +G + LR   PA+D VEL VR LE +
Sbjct  5    FSLAIHGGAGTISPALMTPEKELAYQAALRESLEVGYAVLREGGPALDAVELAVRSLEDN  64

Query  227  PLFNSGRGSALTHKGTVEMEASIMDGHGR  313
            PLFN+GRG+  TH+G  EM+A+IMDG  R
Sbjct  65   PLFNAGRGAVFTHEGHQEMDAAIMDGRDR  93



>gb|KFK23966.1| hypothetical protein AALP_AAs39002U000300 [Arabis alpina]
Length=222

 Score = 82.4 bits (202),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 51/84 (61%), Gaps = 27/84 (32%)
 Frame = +2

Query  149  LGISALRSSLPAIDVVELVVR---------------------------ELETDPLFNSGR  247
            L I+AL S++ AIDVVELVVR                           ELETDPLFNSGR
Sbjct  17   LRIAALSSNVSAIDVVELVVRYSSLTIVLFLISSSVFVDFVFLTTQVKELETDPLFNSGR  76

Query  248  GSALTHKGTVEMEASIMDGHGRRC  319
            GSALT KGTVEMEASIMDG  RRC
Sbjct  77   GSALTEKGTVEMEASIMDGTKRRC  100



>gb|EMS66458.1| putative isoaspartyl peptidase/L-asparaginase 2 [Triticum urartu]
Length=155

 Score = 81.3 bits (199),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 45/59 (76%), Gaps = 5/59 (8%)
 Frame = +2

Query  149  LGISALRSSLPAIDVVEL--VVRELETDPLFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            +GIS     LPA   V L  VVRELETDP FNSGRGSALT  GTVEMEASIMDGHGRRC
Sbjct  1    MGISV---HLPAFAFVSLKAVVRELETDPCFNSGRGSALTRAGTVEMEASIMDGHGRRC  56



>gb|ABF91922.1| asparaginase family protein [Myxococcus xanthus DK 1622]
Length=351

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 56/91 (62%), Gaps = 2/91 (2%)
 Frame = +2

Query  53   WAIAVHGGAGV--DPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETD  226
            W + +HGGAGV    NL  ER+EE +A LT+ L  G + L S   A+D V   VR LE  
Sbjct  29   WGLVIHGGAGVISRENLSPEREEEVRAALTQSLQAGHAVLASGGSALDAVSAAVRILEDS  88

Query  227  PLFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            P FN+G+G+  TH G  E++A+IMDG  R+ 
Sbjct  89   PYFNAGKGAVFTHDGVNELDAAIMDGTTRKA  119



>ref|WP_020478257.1| asparaginase [Myxococcus xanthus]
Length=373

 Score = 82.4 bits (202),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 56/91 (62%), Gaps = 2/91 (2%)
 Frame = +2

Query  53   WAIAVHGGAGV--DPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETD  226
            W + +HGGAGV    NL  ER+EE +A LT+ L  G + L S   A+D V   VR LE  
Sbjct  51   WGLVIHGGAGVISRENLSPEREEEVRAALTQSLQAGHAVLASGGSALDAVSAAVRILEDS  110

Query  227  PLFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            P FN+G+G+  TH G  E++A+IMDG  R+ 
Sbjct  111  PYFNAGKGAVFTHDGVNELDAAIMDGTTRKA  141



>ref|WP_021070783.1| hypothetical protein [Sphingobacterium paucimobilis]
 gb|ERJ59289.1| hypothetical protein M472_10935 [Sphingobacterium paucimobilis 
HER1398]
Length=301

 Score = 80.9 bits (198),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 52/83 (63%), Gaps = 0/83 (0%)
 Frame = +2

Query  56   AIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPLF  235
            A+A+HGGAG D       +++ K  L R  N G   L+   PAI VV  VV  LE DPLF
Sbjct  7    ALAIHGGAGPDNEFIRANKKQYKDSLQRIANTGYRMLKKGEPAISVVRSVVSMLEDDPLF  66

Query  236  NSGRGSALTHKGTVEMEASIMDG  304
            N+GRGSAL   G +EM+A+IM+G
Sbjct  67   NAGRGSALNKDGDIEMDAAIMNG  89



>sp|P30362.1|ASPG_LUPAR RecName: Full=Isoaspartyl peptidase/L-asparaginase; AltName: 
Full=L-asparagine amidohydrolase; Contains: RecName: Full=Isoaspartyl 
peptidase/L-asparaginase subunit alpha; Contains: 
RecName: Full=Isoaspartyl peptidase/L-asparaginase subunit beta; 
Flags: Precursor, partial [Lupinus arboreus]
 emb|CAA36824.1| asparaginase [Lupinus arboreus]
Length=306

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/74 (54%), Positives = 52/74 (70%), Gaps = 0/74 (0%)
 Frame = +2

Query  98   PLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPLFNSGRGSALTHKGTV  277
            P ER++  +  L  CL +G+ AL++    +DVVELVVRELE +  FN+G GS LT+ GTV
Sbjct  1    PPERRKPREEGLRHCLQIGVEALKARKSPLDVVELVVRELENNEHFNAGIGSVLTNSGTV  60

Query  278  EMEASIMDGHGRRC  319
            EMEASIMDG   +C
Sbjct  61   EMEASIMDGKSMKC  74



>ref|WP_019515461.1| hypothetical protein [Sphingomonas sp. Mn802worker]
Length=307

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 56/89 (63%), Gaps = 2/89 (2%)
 Frame = +2

Query  53   WAIAVHGGAGVDPN--LPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETD  226
            W + +HGGAG+     L  E+ E A+A LTR L  G + L +   +ID VE  VR LE D
Sbjct  5    WTLVIHGGAGIINRGVLTPEQDEGARAALTRALEAGAAVLANDGASIDAVEAAVRVLEDD  64

Query  227  PLFNSGRGSALTHKGTVEMEASIMDGHGR  313
            P FNS RG+ LT +G VE++A+IMDG  R
Sbjct  65   PHFNSARGAVLTFEGKVELDAAIMDGRDR  93



>ref|WP_013929901.1| asparaginase [Runella slithyformis]
 gb|AEI50604.1| Beta-aspartyl-peptidase [Runella slithyformis DSM 19594]
Length=310

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 53/87 (61%), Gaps = 0/87 (0%)
 Frame = +2

Query  56   AIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPLF  235
            A+AVHGGAG D +   + + E +  L + L  G   L     A+D VE  V  LE +  F
Sbjct  9    AMAVHGGAGPDSDFIKQHKAEHEEGLKKALTAGYGVLEKGGTALDAVEAAVCSLEDNEFF  68

Query  236  NSGRGSALTHKGTVEMEASIMDGHGRR  316
            N+GRGSA+ HKG VEM+ASIMDG  ++
Sbjct  69   NAGRGSAINHKGEVEMDASIMDGKTKK  95



>ref|WP_013935658.1| asparaginase [Myxococcus fulvus]
 gb|AEI62486.1| asparaginase family protein [Myxococcus fulvus HW-1]
Length=375

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 55/91 (60%), Gaps = 2/91 (2%)
 Frame = +2

Query  53   WAIAVHGGAGV--DPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETD  226
            W + +HGGAGV    NL  ER+ E +A LT+ L  G + L S   A+D V   VR LE  
Sbjct  54   WGLVIHGGAGVISRENLSPEREAEVRAALTQSLQAGHAVLASGGSALDAVSAAVRILEDS  113

Query  227  PLFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            P FN+G+G+  TH G  E++A+IMDG  R+ 
Sbjct  114  PYFNAGKGAVFTHDGVNELDAAIMDGKTRQA  144



>ref|WP_029035777.1| isoaspartyl peptidase [Salinimicrobium terrae]
Length=312

 Score = 78.6 bits (192),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 58/91 (64%), Gaps = 2/91 (2%)
 Frame = +2

Query  53   WAIAVHGGAG--VDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETD  226
            ++IA+HGGAG  +   + +E++++ +  L + L  G   L +  PAID VE  V+ LE  
Sbjct  7    YSIAIHGGAGTLLQGQMTVEKEKDYRNSLEQALEKGYDLLENGAPAIDAVEAAVKVLEDS  66

Query  227  PLFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            PLFN+G+GS  T  GT EM+A+IM+G  R+ 
Sbjct  67   PLFNAGKGSVFTADGTHEMDAAIMEGKDRQA  97



>ref|WP_026759123.1| isoaspartyl peptidase [Sediminimonas qiaohouensis]
Length=309

 Score = 78.6 bits (192),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 57/91 (63%), Gaps = 2/91 (2%)
 Frame = +2

Query  53   WAIAVHGGAGVDP--NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETD  226
            + +A+HGGAGV P  ++  ER+    A L R L  G   L+++  A+D V   V  LE +
Sbjct  5    FVLAIHGGAGVLPRHDMTPEREAACHAALARVLRAGEEVLKANGAALDAVTAAVSTLENE  64

Query  227  PLFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            PLFN+GRG+  T +GT EM+A+IMDG  RR 
Sbjct  65   PLFNAGRGAVFTREGTHEMDAAIMDGRNRRA  95



>gb|EMT04919.1| Putative isoaspartyl peptidase/L-asparaginase 2 [Aegilops tauschii]
Length=103

 Score = 75.9 bits (185),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIA+HGGAGVDPNLP  RQEEA+ +L RCL +G+  LRS   A+DVVE V  E+  +  
Sbjct  4    WAIAIHGGAGVDPNLPEHRQEEAERVLARCLQVGVDMLRSGATALDVVEAVGLEVVDNSY  63

Query  233  F  235
            F
Sbjct  64   F  64



>ref|WP_017462721.1| hypothetical protein [Dyella ginsengisoli]
Length=349

 Score = 78.6 bits (192),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 57/88 (65%), Gaps = 1/88 (1%)
 Frame = +2

Query  59   IAVHGGAGVD-PNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPLF  235
            + +H GAG    ++P  R++  +A LT+ L  G + L++  PAID V   +  LE DPLF
Sbjct  25   LVIHAGAGAPRKDMPPAREKAIRAALTQALLKGYAELKAGKPAIDGVTAALVVLEDDPLF  84

Query  236  NSGRGSALTHKGTVEMEASIMDGHGRRC  319
            N+GRGS  TH GT+EM+A+IMDG+  R 
Sbjct  85   NAGRGSVFTHAGTLEMDAAIMDGYTLRA  112



>ref|WP_008666718.1| isoaspartyl aminopeptidase [Rhodopirellula europaea]
 gb|EMI26698.1| isoaspartyl aminopeptidase [Rhodopirellula europaea SH398]
Length=473

 Score = 79.7 bits (195),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 41/90 (46%), Positives = 54/90 (60%), Gaps = 1/90 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAI +HGGAG  P  L     ++  A L   L  G   L     A+D VE V+R LE DP
Sbjct  33   WAIVIHGGAGSSPAQLGEASSQKRTAGLQHALQTGRDMLADGATAMDTVEAVIRTLEDDP  92

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            +FN+GRGS +T++G VEM++S+MDG    C
Sbjct  93   IFNAGRGSVVTNEGRVEMDSSVMDGKTLAC  122



>gb|ACN73049.1| COSII_At3g16150, partial [Datura inoxia]
Length=64

 Score = 73.6 bits (179),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/38 (92%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  206  VRELETDPLFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            VRELETDPLFNSGRGSALT  GTVEMEASIMDG GRRC
Sbjct  24   VRELETDPLFNSGRGSALTANGTVEMEASIMDGDGRRC  61



>ref|WP_008597184.1| isoaspartyl peptidase [Nitratireductor pacificus]
 gb|EKF18628.1| asparaginase [Nitratireductor pacificus pht-3B]
Length=309

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 54/87 (62%), Gaps = 2/87 (2%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKAL--LTRCLNLGISALRSSLPAIDVVELVVRELETD  226
            WA+A+HGGAG      L +QEEA+    L   L  G + L     AID VE  V  LE +
Sbjct  6    WALALHGGAGTILRSKLTKQEEARFREGLADALRAGTAVLEKGGAAIDAVERTVIALEEN  65

Query  227  PLFNSGRGSALTHKGTVEMEASIMDGH  307
            P+FN+GRGS LT +G +EM+A+IMDG 
Sbjct  66   PMFNAGRGSVLTSEGGIEMDAAIMDGR  92



>ref|WP_002635219.1| asparaginase [Myxococcus sp. (contaminant ex DSM 436)]
 gb|ERK91572.1| Isoaspartyl aminopeptidase protein [Myxococcus sp. (contaminant 
ex DSM 436)]
Length=371

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 54/91 (59%), Gaps = 2/91 (2%)
 Frame = +2

Query  53   WAIAVHGGAGV--DPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETD  226
            W + +HGGAGV    NL  ER+ E +A LT+ L  G + L     A+D V   VR LE  
Sbjct  50   WGLVIHGGAGVISRENLSPEREAEVRAALTQSLEAGHAVLARGGSALDAVSAAVRVLEDS  109

Query  227  PLFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            P FN+G+G+  TH G  E++A+IMDG  R+ 
Sbjct  110  PYFNAGKGAVFTHDGVNELDAAIMDGTTRKA  140



>ref|WP_031564450.1| asparaginase [Legionella wadsworthii]
Length=303

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 53/83 (64%), Gaps = 0/83 (0%)
 Frame = +2

Query  56   AIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPLF  235
            AIAVHGGA  D     E  +E +  L + + +G S L     A+D VE  V+ LE +PLF
Sbjct  5    AIAVHGGASEDYPFLQEHHQEFEKGLAKAIEMGYSILEKGGSALDAVEESVKILEDNPLF  64

Query  236  NSGRGSALTHKGTVEMEASIMDG  304
            N+GRGSAL  +G VEM+ASIM+G
Sbjct  65   NAGRGSALNCRGEVEMDASIMNG  87



>gb|EMB13625.1| Asparaginase family protein [Rhodopirellula europaea 6C]
Length=445

 Score = 78.2 bits (191),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 54/90 (60%), Gaps = 1/90 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAI +HGGAG  P  L     ++  A L   L  G   L     A+D VE V+R LE +P
Sbjct  5    WAIVIHGGAGSSPAQLGEASSQKRTAGLQHALQTGRDMLADGATAMDTVEAVIRTLEDNP  64

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            +FN+GRGS +T++G VEM++S+MDG    C
Sbjct  65   IFNAGRGSVVTNEGRVEMDSSVMDGKTLAC  94



>ref|WP_007339179.1| asparaginase family protein [Rhodopirellula baltica]
 gb|ELP31653.1| asparaginase family protein [Rhodopirellula baltica SWK14]
Length=471

 Score = 78.2 bits (191),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 53/90 (59%), Gaps = 1/90 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAI +HGGAG  P  L     ++    L   L  G   L     A+D VE V+R LE DP
Sbjct  33   WAIVIHGGAGSSPAQLGDASSKQRTKGLQHALQTGRDMLADGATAMDTVEAVIRTLEDDP  92

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            +FN+GRGS +T++G VEM++S+MDG    C
Sbjct  93   IFNAGRGSVVTNEGRVEMDSSVMDGKTLAC  122



>ref|WP_011121656.1| asparaginase [Rhodopirellula baltica]
 ref|NP_868129.1| L-asparaginase [Rhodopirellula baltica SH 1]
 emb|CAD78407.1| L-asparaginase [Rhodopirellula baltica SH 1]
Length=471

 Score = 78.2 bits (191),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 53/90 (59%), Gaps = 1/90 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAI +HGGAG  P  L     ++    L   L  G   L     A+D VE V+R LE DP
Sbjct  33   WAIVIHGGAGSSPAQLGDASSKQRTKGLQHALQTGRDMLADGATAMDTVEAVIRTLEDDP  92

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            +FN+GRGS +T++G VEM++S+MDG    C
Sbjct  93   IFNAGRGSVVTNEGRVEMDSSVMDGKTLAC  122



>ref|WP_039963566.1| asparaginase [Rhodopirellula europaea]
Length=473

 Score = 77.8 bits (190),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 54/90 (60%), Gaps = 1/90 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAI +HGGAG  P  L     ++  A L   L  G   L     A+D VE V+R LE +P
Sbjct  33   WAIVIHGGAGSSPAQLGEASSQKRTAGLQHALQTGRDMLADGATAMDTVEAVIRTLEDNP  92

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            +FN+GRGS +T++G VEM++S+MDG    C
Sbjct  93   IFNAGRGSVVTNEGRVEMDSSVMDGKTLAC  122



>ref|WP_028379843.1| asparaginase [Legionella cherrii]
Length=303

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 53/83 (64%), Gaps = 0/83 (0%)
 Frame = +2

Query  56   AIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPLF  235
            AIAVHGGA  + +   E Q+E K  L + + +G   L     A+D V+  VR LE +PLF
Sbjct  5    AIAVHGGASENYSFLQEHQKEFKQGLAKAVEMGYLVLDKGGSALDAVQEAVRILEDNPLF  64

Query  236  NSGRGSALTHKGTVEMEASIMDG  304
            N+G+GSAL  +G VEM+ASIM G
Sbjct  65   NAGKGSALNSRGEVEMDASIMSG  87



>ref|XP_002443707.1| hypothetical protein SORBIDRAFT_07g000640 [Sorghum bicolor]
 gb|EES13202.1| hypothetical protein SORBIDRAFT_07g000640 [Sorghum bicolor]
Length=299

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 58/100 (58%), Gaps = 17/100 (17%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAI--------------  187
            WA+A+ GG G  P +LP +  E   A L RCL+LG +ALR+  PAI              
Sbjct  3    WALAMQGGGGNIPRSLPPDITEPRLATLRRCLDLGAAALRAGQPAIYIYIYLSLMSPAAL  62

Query  188  --DVVELVVRELETDPLFNSGRGSALTHKGTVEMEASIMD  301
              D+  + VRELE  P FN+GRGS LT  GTVEMEA +M+
Sbjct  63   NADIYIMQVRELENCPHFNAGRGSVLTADGTVEMEARVME  102



>ref|WP_010214369.1| asparaginase [Sphingomonas sp. PAMC 26621]
Length=308

 Score = 75.9 bits (185),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 52/89 (58%), Gaps = 2/89 (2%)
 Frame = +2

Query  53   WAIAVHGGAG--VDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETD  226
            W + +HGGAG      L   + E A   L R L+ G + L     A+D VE  VR LE D
Sbjct  3    WTLMLHGGAGQMTPATLTPAQVEGATEALGRALDAGAAVLAGDGSALDAVEAAVRVLEDD  62

Query  227  PLFNSGRGSALTHKGTVEMEASIMDGHGR  313
            P FNSGRG+ALTH G  E++A+IMDG  R
Sbjct  63   PHFNSGRGAALTHDGVAELDAAIMDGRDR  91



>ref|WP_044002327.1| isoaspartyl peptidase [Hymenobacter swuensis]
 gb|AHJ98058.1| L-asparaginase [Hymenobacter swuensis DY53]
Length=316

 Score = 75.9 bits (185),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 56/87 (64%), Gaps = 4/87 (5%)
 Frame = +2

Query  53   WAIAVHGGAG-VDPNLPLERQEEA--KALLTRCLNLGISALRSSLPAIDVVELVVRELET  223
            +A+A+HGGAG + P L    +E A  +ALL   L  G + LR   PA+D VE  VR LE 
Sbjct  5    FALALHGGAGTISPALMTPDKEHAYQRALLA-ALEAGTAVLRQGGPALDAVEQAVRSLED  63

Query  224  DPLFNSGRGSALTHKGTVEMEASIMDG  304
             PLFN+GRG+  TH G  EM+A+IMDG
Sbjct  64   CPLFNAGRGAVFTHDGHHEMDAAIMDG  90



>ref|WP_044017461.1| isoaspartyl peptidase [Hymenobacter sp. APR13]
 gb|AII53569.1| hypothetical protein N008_16500 [Hymenobacter sp. APR13]
Length=323

 Score = 75.9 bits (185),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 54/86 (63%), Gaps = 2/86 (2%)
 Frame = +2

Query  53   WAIAVHGGAGVDPN--LPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETD  226
            +A+A+HGGAG      +  E+++   A L + L  G + LR   PA+D VE  VR LE  
Sbjct  5    FALAIHGGAGTISRQLMTPEKEQAYLAALRQSLEAGHAVLRQGGPALDAVEAAVRSLEDC  64

Query  227  PLFNSGRGSALTHKGTVEMEASIMDG  304
            PLFN+GRG+  TH G  EM+A+IMDG
Sbjct  65   PLFNAGRGAVFTHDGHHEMDAAIMDG  90



>ref|WP_012285180.1| asparaginase [Caulobacter sp. K31]
 gb|ABZ70252.1| peptidase T2 asparaginase 2 [Caulobacter sp. K31]
Length=338

 Score = 75.9 bits (185),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 56/86 (65%), Gaps = 2/86 (2%)
 Frame = +2

Query  53   WAIAVHGGAGV--DPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETD  226
            W++A+HGGAGV    +L  E+++  +A L   L  G   L+S   ++D VE  VR LE +
Sbjct  31   WSLAIHGGAGVLERGDLTPEKEKAYRAGLDAALEAGAKVLKSGGSSLDAVEATVRVLEDN  90

Query  227  PLFNSGRGSALTHKGTVEMEASIMDG  304
            PLFNSG+G+  T +G  E++ASIMDG
Sbjct  91   PLFNSGKGAVFTAEGKNELDASIMDG  116



>ref|WP_031427028.1| isoaspartyl peptidase [Leeuwenhoekiella sp. MAR_2009_132]
Length=313

 Score = 75.5 bits (184),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 55/86 (64%), Gaps = 2/86 (2%)
 Frame = +2

Query  53   WAIAVHGGAG--VDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETD  226
            ++IA+HGGAG  +   +  E++E  +  L   L+ G  AL S   A DVV L V+ LE  
Sbjct  4    FSIAIHGGAGTLLKGQMTPEKEENYRKTLENALSAGFEALNSGKSATDVVSLAVQILEDS  63

Query  227  PLFNSGRGSALTHKGTVEMEASIMDG  304
            PLFN+G+GS  T +GT EM+A+IM+G
Sbjct  64   PLFNAGKGSVFTAEGTHEMDAAIMEG  89



>ref|WP_010161672.1| asparaginase [Sphingomonas sp. PAMC 26617]
Length=308

 Score = 75.5 bits (184),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 52/89 (58%), Gaps = 2/89 (2%)
 Frame = +2

Query  53   WAIAVHGGAG--VDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETD  226
            W + +HGGAG      L   + E A   L R L+ G + L     A+D VE  VR LE D
Sbjct  3    WTLMLHGGAGQMTPATLTPAQVEGATEALGRALDAGAAVLAGDGSALDAVEAAVRVLEDD  62

Query  227  PLFNSGRGSALTHKGTVEMEASIMDGHGR  313
            P FNSGRG+ALTH G  E++A+IMDG  R
Sbjct  63   PHFNSGRGAALTHDGIAELDAAIMDGRDR  91



>ref|WP_007326981.1| asparaginase [Rhodopirellula baltica]
 gb|EGF26854.1| asparaginase family protein [Rhodopirellula baltica WH47]
Length=471

 Score = 76.6 bits (187),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 40/90 (44%), Positives = 53/90 (59%), Gaps = 1/90 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAI +HGGAG  P  L     ++    L   L  G   L     A+D VE V+R LE DP
Sbjct  33   WAIVIHGGAGSSPAQLGDASSKQRTKGLQHALQTGRDMLADGATAMDTVEAVIRTLEDDP  92

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            +FN+GRGS +T++G VEM++S+MDG    C
Sbjct  93   IFNAGRGSVVTNEGRVEMDSSVMDGKTLAC  122



>ref|WP_026444808.1| asparaginase [Acidobacteriaceae bacterium URHE0068]
Length=360

 Score = 75.9 bits (185),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 53/86 (62%), Gaps = 2/86 (2%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLE--RQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETD  226
            W I +HGGAG    L ++    +   A LTR L LG++ L+    AID V+  V  LE D
Sbjct  35   WVIEIHGGAGESEWLQMDPATADAYHASLTRALALGVAVLQKHGAAIDAVQAAVEVLEDD  94

Query  227  PLFNSGRGSALTHKGTVEMEASIMDG  304
            PLFN+GRG+A    G+ EM+ASIM+G
Sbjct  95   PLFNAGRGAAFAADGSTEMDASIMNG  120



>ref|WP_026359875.1| asparaginase [Sphingomonas sp. PR090111-T3T-6A]
Length=305

 Score = 75.1 bits (183),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 56/91 (62%), Gaps = 2/91 (2%)
 Frame = +2

Query  53   WAIAVHGGAG-VDPNLPLERQEE-AKALLTRCLNLGISALRSSLPAIDVVELVVRELETD  226
            W + +HGGAG + P +  E +++ A+  LT  L  G + LR    A+D VE  VR LE D
Sbjct  3    WTLMIHGGAGSMRPGVLTEAEDQGARVGLTAALEAGAAILRDGGSALDAVEAAVRVLEDD  62

Query  227  PLFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            P FN+GRGS  T +G +E +A+IMDG GR  
Sbjct  63   PHFNAGRGSVYTWEGRIECDAAIMDGRGREA  93



>ref|WP_035979508.1| asparaginase, partial [Kozakia baliensis]
Length=303

 Score = 74.7 bits (182),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 56/88 (64%), Gaps = 1/88 (1%)
 Frame = +2

Query  59   IAVHGGAGV-DPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPLF  235
            + +HGGAGV   +L  ER++ A+  L+  L+ G +AL++  PA + V   +  LE DP F
Sbjct  1    MVIHGGAGVVRTDLSPERRQAAENALSHALHDGYAALQAGRPATEAVTAAITVLENDPNF  60

Query  236  NSGRGSALTHKGTVEMEASIMDGHGRRC  319
            N+GRG+  TH G  EM+++IMDG  RR 
Sbjct  61   NAGRGAVFTHDGKNEMDSAIMDGMTRRA  88



>ref|WP_021585728.1| asparaginase [Ochrobactrum sp. EGD-AQ16]
 gb|ERI15537.1| asparaginase [Ochrobactrum sp. EGD-AQ16]
Length=310

 Score = 74.7 bits (182),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 52/89 (58%), Gaps = 2/89 (2%)
 Frame = +2

Query  59   IAVHGGAG--VDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            IA+HGGAG  +  N+  ER+    A L  CL  G+  LR    AID V   V  LE +PL
Sbjct  8    IALHGGAGTILKANMTPEREAAYHAELRECLQAGLDVLRKGGKAIDAVTASVMALEENPL  67

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            FN+GRG+  T   T EM+A+IMDG  R C
Sbjct  68   FNAGRGAVFTADETHEMDAAIMDGATRAC  96



>ref|WP_042056129.1| asparaginase [Acidomonas methanolica]
Length=314

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 55/83 (66%), Gaps = 1/83 (1%)
 Frame = +2

Query  59   IAVHGGAGV-DPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPLF  235
            + +HGGAGV   +L  E+++  +A L+R L+ G +AL++  PA D V   +  LE DP F
Sbjct  12   LVIHGGAGVIASSLTPEKRQAVEAALSRALHDGYAALQAGRPAQDAVTAAITVLEDDPHF  71

Query  236  NSGRGSALTHKGTVEMEASIMDG  304
            N+GRG+  TH G  EM+A+IMDG
Sbjct  72   NAGRGAVFTHDGRNEMDAAIMDG  94



>ref|WP_036514883.1| asparaginase [Oceanicaulis sp. HL-87]
Length=357

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 53/89 (60%), Gaps = 2/89 (2%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEA--KALLTRCLNLGISALRSSLPAIDVVELVVRELETD  226
            W+I +HGGAGV     ++ Q EA  +A L   L  G + LR     IDVVE +++  E D
Sbjct  30   WSIIIHGGAGVIERGDMDAQTEAAYRAALQSALEQGGAMLRDGADGIDVVEALIQAFEDD  89

Query  227  PLFNSGRGSALTHKGTVEMEASIMDGHGR  313
            P+FN+GRG   T  G VEM+AS+M G  R
Sbjct  90   PMFNAGRGGVFTADGRVEMDASVMIGSTR  118



>gb|ERS22956.1| hypothetical protein HMPREF1301_00748 [Propionibacterium sp. 
KPL2005]
 gb|ERS29637.1| hypothetical protein HMPREF1297_00456 [Propionibacterium sp. 
KPL2000]
Length=306

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 51/85 (60%), Gaps = 0/85 (0%)
 Frame = +2

Query  59   IAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPLFN  238
            + +HGGAG  P    E  E  +  L R  + G + L +  PA+D V   V  +E DPLFN
Sbjct  13   LVIHGGAGNVPPRTGEDAERFRLSLRRAFDAGQAVLDAGGPALDAVTASVVAMEDDPLFN  72

Query  239  SGRGSALTHKGTVEMEASIMDGHGR  313
            +GRG  LT KGTVE +A++M GHGR
Sbjct  73   AGRGGVLTAKGTVETDAAVMTGHGR  97



>ref|WP_009099500.1| peptidase T2 asparaginase 2 [Rhodopirellula sp. SWK7]
 gb|EMI43600.1| peptidase T2 asparaginase 2 [Rhodopirellula sp. SWK7]
Length=468

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/90 (46%), Positives = 52/90 (58%), Gaps = 1/90 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKAL-LTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P    E   E ++  L   L  G   L     A+D VE V+R +E DP
Sbjct  33   WAIAIHGGAGSSPAQLDEASSEKRSQGLQNALQKGRDLLAGGGTAVDTVEAVIRLMEDDP  92

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            +FN+GRG+ LT  G  E++ASIMDG    C
Sbjct  93   IFNAGRGAVLTEDGRAELDASIMDGKTLGC  122



>ref|WP_019671033.1| asparaginase [Eudoraea adriatica]
Length=310

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 53/85 (62%), Gaps = 2/85 (2%)
 Frame = +2

Query  56   AIAVHGGAG--VDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            A+A+HGGAG  +   +  E++   K +L   L+ G   L S L A+D VE  V+ELE   
Sbjct  5    ALAIHGGAGTLIKGMMTPEKERSYKEVLESALHKGYKLLESGLSAVDAVEAAVKELEDSH  64

Query  230  LFNSGRGSALTHKGTVEMEASIMDG  304
            LFN+G+GS  T +G  EM+ASIMDG
Sbjct  65   LFNAGKGSVFTSEGKHEMDASIMDG  89



>ref|WP_015582013.1| putative asparaginase [Propionibacterium avidum]
 gb|AGJ76737.1| putative asparaginase [Propionibacterium avidum 44067]
Length=341

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 51/85 (60%), Gaps = 0/85 (0%)
 Frame = +2

Query  59   IAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPLFN  238
            + +HGGAG  P    E  E  +  L R  + G + L +  PA+D V   V  +E DPLFN
Sbjct  48   LVIHGGAGNVPPRTGEDAERFRLSLRRAFDAGQAVLDAGGPALDAVTASVVAMEDDPLFN  107

Query  239  SGRGSALTHKGTVEMEASIMDGHGR  313
            +GRG  LT KGTVE +A++M GHGR
Sbjct  108  AGRGGVLTAKGTVETDAAVMTGHGR  132



>ref|WP_004809461.1| MULTISPECIES: asparaginase [Propionibacterium]
 gb|EGY78546.1| beta-aspartyl-peptidase [Propionibacterium avidum ATCC 25577]
Length=341

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 51/85 (60%), Gaps = 0/85 (0%)
 Frame = +2

Query  59   IAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPLFN  238
            + +HGGAG  P    E  E  +  L R  + G + L +  PA+D V   V  +E DPLFN
Sbjct  48   LVIHGGAGNVPPRTGEDAERFRLSLRRAFDAGQAVLDAGGPALDAVTASVVAMEDDPLFN  107

Query  239  SGRGSALTHKGTVEMEASIMDGHGR  313
            +GRG  LT KGTVE +A++M GHGR
Sbjct  108  AGRGGVLTAKGTVETDAAVMTGHGR  132



>ref|WP_021107965.1| MULTISPECIES: putative asparaginase [Propionibacterium]
 gb|ERF58570.1| putative asparaginase [Propionibacterium avidum TM16]
 gb|ERS39314.1| hypothetical protein HMPREF1271_00822 [Propionibacterium sp. 
KPL1838]
 gb|ERS69355.1| hypothetical protein HMPREF1279_00460 [Propionibacterium sp. 
KPL1852]
Length=341

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 51/85 (60%), Gaps = 0/85 (0%)
 Frame = +2

Query  59   IAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPLFN  238
            + +HGGAG  P    E  E  +  L R  + G + L +  PA+D V   V  +E DPLFN
Sbjct  48   LVIHGGAGNVPPRTGEDAERFRLSLRRAFDAGQAVLDAGGPALDAVTASVVAMEDDPLFN  107

Query  239  SGRGSALTHKGTVEMEASIMDGHGR  313
            +GRG  LT KGTVE +A++M GHGR
Sbjct  108  AGRGGVLTAKGTVETDAAVMTGHGR  132



>dbj|GAJ27960.1| isoaspartyl peptidase/peptidase T2/asparaginase 2 [Acidomonas 
methanolica NBRC 104435]
Length=380

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 55/83 (66%), Gaps = 1/83 (1%)
 Frame = +2

Query  59   IAVHGGAGV-DPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPLF  235
            + +HGGAGV   +L  E+++  +A L+R L+ G +AL++  PA D V   +  LE DP F
Sbjct  78   LVIHGGAGVIASSLTPEKRQAVEAALSRALHDGYAALQAGRPAQDAVTAAITVLEDDPHF  137

Query  236  NSGRGSALTHKGTVEMEASIMDG  304
            N+GRG+  TH G  EM+A+IMDG
Sbjct  138  NAGRGAVFTHDGRNEMDAAIMDG  160



>ref|WP_044559102.1| asparaginase [Azospirillum sp. B4]
Length=359

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 55/86 (64%), Gaps = 2/86 (2%)
 Frame = +2

Query  53   WAIAVHGGAG-VDPN-LPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETD  226
            WA+ +HGGAG VDP+ L  E     KA +T  L+ G + L +   A+D VE  V+ LE D
Sbjct  21   WALELHGGAGTVDPDKLTPEAAAAYKAGMTAALDAGTAVLTAGGTALDAVEAAVKVLEDD  80

Query  227  PLFNSGRGSALTHKGTVEMEASIMDG  304
            PLFN+GRG+  T  G  EM+++IMDG
Sbjct  81   PLFNAGRGAVFTAAGRNEMDSAIMDG  106



>ref|WP_018067653.1| hypothetical protein [Martelella mediterranea]
Length=307

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 56/91 (62%), Gaps = 2/91 (2%)
 Frame = +2

Query  53   WAIAVHGGAG--VDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETD  226
            +++AVHGGAG  +  N+  E++    A L R L+ G + LR    A+D V   V  LE +
Sbjct  3    YSLAVHGGAGTILKSNMTPEKEAAYHAGLRRALDAGETVLRDGGSALDAVTASVCALEDE  62

Query  227  PLFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            PLFN+GRG+  T +G  EM+A++MDG  RR 
Sbjct  63   PLFNAGRGAVFTDQGEQEMDAAVMDGRDRRA  93



>ref|WP_010654453.1| asparaginase [Fluoribacter dumoffii]
Length=303

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 53/87 (61%), Gaps = 0/87 (0%)
 Frame = +2

Query  56   AIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPLF  235
            AIAVHGGA  + +   E Q+E +  + + +  G S L     A+D VE  V  LE +PLF
Sbjct  5    AIAVHGGASENYSFLQEHQKEFEEGMAQAIKKGYSILEKGGSALDAVEETVAILEDNPLF  64

Query  236  NSGRGSALTHKGTVEMEASIMDGHGRR  316
            N+GRGSAL  +G VEM+ASIM G   R
Sbjct  65   NAGRGSALNCQGEVEMDASIMSGKDLR  91



>dbj|GAL14163.1| isoaspartyl aminopeptidase [Vibrio sp. C7]
Length=312

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 54/91 (59%), Gaps = 2/91 (2%)
 Frame = +2

Query  53   WAIAVHGGAG--VDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETD  226
            ++IA+HGGAG  +   +  E Q E +A L + +  G   L S   A+D V   V+ LE  
Sbjct  3    FSIAIHGGAGTILREQMTAELQREIEAALEKSVRAGHDILSSGGSAVDAVTAAVKVLEDS  62

Query  227  PLFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            P FN+GRGS LTH+  VEM+ASIM G G+  
Sbjct  63   PHFNAGRGSVLTHREMVEMDASIMSGRGKNA  93



>gb|EKJ99939.1| peptidase T2 asparaginase 2 [Rhodopirellula baltica SH28]
Length=443

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 53/90 (59%), Gaps = 1/90 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAI +HGGAG  P  L     ++    L   L  G   +     A+D VE V+R LE +P
Sbjct  5    WAIVIHGGAGSSPAQLGDASSKQRTKGLQHALQTGRDMVADGATAMDTVEAVIRTLEDNP  64

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            +FN+GRGS +T++G VEM++S+MDG    C
Sbjct  65   IFNAGRGSVVTNEGRVEMDSSVMDGKTLAC  94



>ref|WP_021698251.1| isoaspartyl aminopeptidase / Asp-X dipeptidase [Brevundimonas 
abyssalis]
 dbj|GAD60157.1| isoaspartyl aminopeptidase / Asp-X dipeptidase [Brevundimonas 
abyssalis TAR-001]
Length=354

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 56/86 (65%), Gaps = 2/86 (2%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEA--KALLTRCLNLGISALRSSLPAIDVVELVVRELETD  226
            W++A+HGGAGV     L  +++A  +A L+  L  G + LR+   A+D V+  V+ +E D
Sbjct  31   WSLAIHGGAGVIERADLSPEQDAAYRAALSTALEAGAAVLRNGGSALDAVQAAVQLMEDD  90

Query  227  PLFNSGRGSALTHKGTVEMEASIMDG  304
            PLFN+GRG+  T  G  E++A+IMDG
Sbjct  91   PLFNAGRGAVFTAAGANELDAAIMDG  116



>ref|WP_037201211.1| asparaginase [Rhodopirellula baltica]
Length=471

 Score = 74.7 bits (182),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 53/90 (59%), Gaps = 1/90 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAI +HGGAG  P  L     ++    L   L  G   +     A+D VE V+R LE +P
Sbjct  33   WAIVIHGGAGSSPAQLGDASSKQRTKGLQHALQTGRDMVADGATAMDTVEAVIRTLEDNP  92

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRC  319
            +FN+GRGS +T++G VEM++S+MDG    C
Sbjct  93   IFNAGRGSVVTNEGRVEMDSSVMDGKTLAC  122



>ref|WP_026450921.1| isoaspartyl peptidase [Aequorivita capsosiphonis]
Length=310

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 52/86 (60%), Gaps = 2/86 (2%)
 Frame = +2

Query  53   WAIAVHGGAG--VDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETD  226
            ++I +HGGAG  V   +  E++E+    L   L  G S L ++  A D VE  V  LE  
Sbjct  5    YSIVIHGGAGTLVKGLMTPEKEEQYNTALNEALEKGYSVLENNGSAKDAVEAAVNHLEDS  64

Query  227  PLFNSGRGSALTHKGTVEMEASIMDG  304
            PLFN+G+GS  T+ GT EM+A+IMDG
Sbjct  65   PLFNAGKGSVFTNDGTHEMDAAIMDG  90



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 552963472315