BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002E02

Length=571
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010312453.1|  PREDICTED: uncharacterized protein LOC101256825    109   2e-27   Solanum lycopersicum
ref|XP_006351125.1|  PREDICTED: uncharacterized protein LOC102579644    107   2e-26   Solanum tuberosum [potatoes]
ref|XP_009598534.1|  PREDICTED: uncharacterized protein LOC104094322    107   2e-26   Nicotiana tomentosiformis
ref|XP_009602459.1|  PREDICTED: uncharacterized protein LOC104097578    106   3e-26   Nicotiana tomentosiformis
ref|XP_006365540.1|  PREDICTED: uncharacterized protein LOC102581179    105   4e-26   Solanum tuberosum [potatoes]
gb|EYU44854.1|  hypothetical protein MIMGU_mgv1a017170mg                105   9e-26   Erythranthe guttata [common monkey flower]
gb|EYU45970.1|  hypothetical protein MIMGU_mgv1a017624mg                105   1e-25   Erythranthe guttata [common monkey flower]
ref|XP_007218658.1|  hypothetical protein PRUPE_ppa014065mg             105   2e-25   
ref|XP_006436030.1|  hypothetical protein CICLE_v10033281mg             104   2e-25   
ref|XP_008233598.1|  PREDICTED: uncharacterized protein LOC103332628    103   2e-25   Prunus mume [ume]
ref|XP_007132110.1|  hypothetical protein PHAVU_011G067300g             103   3e-25   Phaseolus vulgaris [French bean]
gb|ACX53672.1|  mitochondrial ATP synthase 6kDa subunit                 103   3e-25   Capsicum annuum
ref|XP_006480775.1|  PREDICTED: uncharacterized protein LOC102629016    103   3e-25   Citrus sinensis [apfelsine]
ref|XP_004294577.1|  PREDICTED: uncharacterized protein LOC101294636    103   4e-25   Fragaria vesca subsp. vesca
ref|XP_010322939.1|  PREDICTED: uncharacterized protein LOC101266038    103   4e-25   Solanum lycopersicum
ref|XP_004505891.1|  PREDICTED: uncharacterized protein LOC101508258    102   7e-25   Cicer arietinum [garbanzo]
gb|ABK95836.1|  unknown                                                 102   7e-25   Populus trichocarpa [western balsam poplar]
emb|CDP09025.1|  unnamed protein product                                102   8e-25   Coffea canephora [robusta coffee]
ref|XP_011075436.1|  PREDICTED: uncharacterized protein LOC105159...    102   1e-24   Sesamum indicum [beniseed]
emb|CDP00067.1|  unnamed protein product                                102   1e-24   Coffea canephora [robusta coffee]
ref|XP_011075437.1|  PREDICTED: uncharacterized protein LOC105159...    102   1e-24   
ref|XP_011073276.1|  PREDICTED: uncharacterized protein LOC105158275    102   1e-24   Sesamum indicum [beniseed]
gb|KHN32098.1|  hypothetical protein glysoja_028893                     102   1e-24   Glycine soja [wild soybean]
ref|XP_006592209.1|  PREDICTED: uncharacterized protein LOC100306...    101   1e-24   Glycine max [soybeans]
ref|XP_008370840.1|  PREDICTED: uncharacterized protein LOC103434280    102   1e-24   Malus domestica [apple tree]
ref|XP_007207407.1|  hypothetical protein PRUPE_ppa014536mg             101   2e-24   Prunus persica
ref|XP_003606613.1|  Mitochondrial ATP synthase subunit                 101   2e-24   
ref|XP_009337604.1|  PREDICTED: uncharacterized protein LOC103930038    101   2e-24   Pyrus x bretschneideri [bai li]
ref|XP_002262887.1|  PREDICTED: uncharacterized protein LOC100258053    101   2e-24   Vitis vinifera
ref|XP_004487037.1|  PREDICTED: uncharacterized protein LOC101489778    100   3e-24   Cicer arietinum [garbanzo]
ref|XP_008366331.1|  PREDICTED: uncharacterized protein LOC103429981    100   3e-24   
ref|XP_008357512.1|  PREDICTED: uncharacterized protein LOC103421264    100   5e-24   Malus domestica [apple tree]
gb|ACV50432.1|  mitochondrial ATP synthase 6kDa subunit                 100   5e-24   Jatropha curcas
ref|XP_006590995.1|  PREDICTED: uncharacterized protein LOC100778...    100   6e-24   Glycine max [soybeans]
ref|XP_010259959.1|  PREDICTED: uncharacterized protein LOC104599212    100   7e-24   Nelumbo nucifera [Indian lotus]
ref|XP_010260580.1|  PREDICTED: uncharacterized protein LOC104599658  99.8    9e-24   Nelumbo nucifera [Indian lotus]
ref|XP_009358352.1|  PREDICTED: uncharacterized protein LOC103948979  99.8    1e-23   Pyrus x bretschneideri [bai li]
ref|XP_002316297.1|  hypothetical protein POPTR_0010s21460g           99.8    1e-23   
gb|KDP44212.1|  hypothetical protein JCGZ_05679                       99.8    1e-23   Jatropha curcas
ref|XP_009353710.1|  PREDICTED: uncharacterized protein LOC103944950  99.4    1e-23   Pyrus x bretschneideri [bai li]
ref|XP_006429033.1|  hypothetical protein CICLE_v10013313mg           99.8    1e-23   
ref|XP_003597325.1|  Mitochondrial ATP synthase subunit               98.6    3e-23   
ref|XP_010685811.1|  PREDICTED: uncharacterized protein LOC104900151  98.6    3e-23   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007150286.1|  hypothetical protein PHAVU_005G141000g           98.2    3e-23   Phaseolus vulgaris [French bean]
gb|AGN52926.1|  hypothetical protein                                  98.2    3e-23   Silene latifolia
ref|XP_008233667.1|  PREDICTED: uncharacterized protein LOC103332698  99.8    6e-23   
ref|XP_008803418.1|  PREDICTED: uncharacterized protein LOC103716973  97.1    9e-23   Phoenix dactylifera
ref|XP_009387401.1|  PREDICTED: uncharacterized protein LOC103974324  96.7    1e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010907068.1|  PREDICTED: uncharacterized protein LOC105033831  96.3    2e-22   Elaeis guineensis
ref|XP_002531373.1|  conserved hypothetical protein                   96.3    2e-22   
ref|XP_006597281.1|  PREDICTED: uncharacterized protein LOC100306...  96.3    2e-22   
gb|KGN54234.1|  hypothetical protein Csa_4G294910                     96.3    2e-22   Cucumis sativus [cucumbers]
ref|XP_004142079.1|  PREDICTED: uncharacterized protein LOC101216317  95.5    3e-22   
ref|XP_006844730.1|  hypothetical protein AMTR_s00016p00253840        96.7    4e-22   
ref|XP_002281230.2|  PREDICTED: uncharacterized protein LOC100265565  95.1    5e-22   Vitis vinifera
ref|XP_007016482.1|  Uncharacterized protein TCM_041879               95.1    6e-22   
ref|XP_008447675.1|  PREDICTED: uncharacterized protein LOC103490081  95.1    6e-22   Cucumis melo [Oriental melon]
ref|XP_010922373.1|  PREDICTED: uncharacterized protein LOC105045706  95.1    6e-22   Elaeis guineensis
gb|EMS58891.1|  hypothetical protein TRIUR3_25815                     94.4    1e-21   Triticum urartu
ref|XP_006400935.1|  hypothetical protein EUTSA_v10015813mg           95.9    1e-21   
ref|XP_010043577.1|  PREDICTED: uncharacterized protein LOC104432752  94.0    1e-21   Eucalyptus grandis [rose gum]
gb|ACG36451.1|  hypothetical protein                                  94.0    2e-21   Zea mays [maize]
gb|ACG33389.1|  hypothetical protein                                  94.0    2e-21   Zea mays [maize]
dbj|BAB21526.1|  mitochondrial ATP synthase 6 KD subunit              93.6    2e-21   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008670608.1|  PREDICTED: 50S ribosomal protein L28, chloro...  97.1    2e-21   
ref|XP_008372674.1|  PREDICTED: uncharacterized protein LOC103436039  94.0    2e-21   Malus domestica [apple tree]
ref|NP_190227.1|  uncharacterized protein                             93.2    3e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010541396.1|  PREDICTED: uncharacterized protein LOC104814...  94.0    3e-21   Tarenaya hassleriana [spider flower]
ref|XP_010541397.1|  PREDICTED: uncharacterized protein LOC104814...  92.8    3e-21   Tarenaya hassleriana [spider flower]
gb|KJB20140.1|  hypothetical protein B456_003G134700                  92.8    4e-21   Gossypium raimondii
ref|XP_004960507.1|  PREDICTED: uncharacterized protein LOC101767...  92.8    4e-21   
gb|KHG28773.1|  ATP synthase 6 kDa subunit, mitochondrial             94.4    7e-21   Gossypium arboreum [tree cotton]
ref|XP_009126685.1|  PREDICTED: uncharacterized protein LOC103851567  92.0    8e-21   Brassica rapa
ref|XP_003565176.1|  PREDICTED: uncharacterized protein LOC100839898  92.0    8e-21   Brachypodium distachyon [annual false brome]
ref|NP_001050636.2|  Os03g0606200                                     92.0    9e-21   
ref|XP_010541395.1|  PREDICTED: uncharacterized protein LOC104814...  93.2    9e-21   Tarenaya hassleriana [spider flower]
ref|XP_006418898.1|  hypothetical protein EUTSA_v10003016mg           91.7    1e-20   Eutrema salsugineum [saltwater cress]
ref|XP_002461077.1|  hypothetical protein SORBIDRAFT_02g040270        91.7    1e-20   
ref|XP_009131984.1|  PREDICTED: uncharacterized protein LOC103856618  91.7    1e-20   Brassica rapa
ref|XP_003568999.1|  PREDICTED: uncharacterized protein LOC100845490  91.3    1e-20   Brachypodium distachyon [annual false brome]
gb|ACG44137.1|  hypothetical protein                                  91.3    2e-20   Zea mays [maize]
gb|KJB55912.1|  hypothetical protein B456_009G101000                  91.3    2e-20   Gossypium raimondii
gb|ACU44654.4|  mitochondrial ATP synthase 6 kDa subunit              90.1    4e-20   Triticum aestivum [Canadian hard winter wheat]
gb|ACV90429.4|  mitochondrial ATP synthase 6 kDa subunit              89.7    7e-20   Triticum aestivum [Canadian hard winter wheat]
dbj|BAJ85328.1|  predicted protein                                    90.9    8e-20   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AGU28454.1|  hypothetical protein                                  89.0    1e-19   Sinapis alba [bai jie]
gb|EAY90941.1|  hypothetical protein OsI_12555                        90.1    2e-19   Oryza sativa Indica Group [Indian rice]
tpg|DAA46137.1|  TPA: hypothetical protein ZEAMMB73_290343            87.8    4e-19   
gb|ACZ64508.1|  mitochondrial ATP synthase 6 kDa subunit              87.4    4e-19   Triticum monococcum subsp. aegilopoides [wild einkorn]
gb|EMT13071.1|  hypothetical protein F775_09785                       87.4    5e-19   
gb|AAR87233.1|  hypothetical protein                                  89.7    5e-19   Oryza sativa Japonica Group [Japonica rice]
tpg|DAA61086.1|  TPA: hypothetical protein ZEAMMB73_318338            85.9    2e-18   
ref|XP_008241219.1|  PREDICTED: uncharacterized protein LOC103339664  84.0    1e-17   Prunus mume [ume]
ref|XP_006379585.1|  hypothetical protein POPTR_0008s05310g           82.8    4e-17   
tpg|DAA56942.1|  TPA: hypothetical protein ZEAMMB73_025607            81.3    9e-17   
gb|ACU14706.1|  unknown                                               81.6    1e-16   Glycine max [soybeans]
ref|XP_010095037.1|  hypothetical protein L484_026343                 80.1    7e-16   
tpg|DAA56943.1|  TPA: hypothetical protein ZEAMMB73_025607            80.9    2e-15   
tpg|DAA46138.1|  TPA: hypothetical protein ZEAMMB73_290343            76.6    4e-14   
ref|XP_008466298.1|  PREDICTED: uncharacterized protein LOC103503749  73.9    5e-14   
ref|XP_006595013.1|  PREDICTED: uncharacterized protein LOC100784597  74.7    1e-13   Glycine max [soybeans]
gb|KHN30201.1|  hypothetical protein glysoja_010579                   74.3    2e-13   Glycine soja [wild soybean]
tpg|DAA52985.1|  TPA: hypothetical protein ZEAMMB73_849058            76.6    2e-13   
ref|NP_001050635.1|  Os03g0606100                                     74.3    5e-12   
gb|ACU17172.1|  unknown                                               60.1    1e-08   Glycine max [soybeans]
tpg|DAA54683.1|  TPA: hypothetical protein ZEAMMB73_470909            52.4    3e-06   
ref|XP_008662811.1|  PREDICTED: uncharacterized protein LOC103641229  51.6    2e-05   
sp|P80497.1|ATPY_SOLTU  RecName: Full=ATP synthase 6 kDa subunit,...  48.1    7e-05   Solanum tuberosum [potatoes]
gb|AFW61595.1|  hypothetical protein ZEAMMB73_703530                  51.6    1e-04   
gb|AFW89750.1|  hypothetical protein ZEAMMB73_984028                  51.6    1e-04   
ref|XP_002502480.1|  predicted protein                                46.2    6e-04   Micromonas commoda



>ref|XP_010312453.1| PREDICTED: uncharacterized protein LOC101256825 [Solanum lycopersicum]
Length=55

 Score =   109 bits (272),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 49/55 (89%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = +2

Query  74   MRQFDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHKK  238
            MRQFDPWPVFFRREW RNWPFLVGFA+TGA+ITKMSLGLTEED KNS+FAQ+HKK
Sbjct  1    MRQFDPWPVFFRREWSRNWPFLVGFAVTGAIITKMSLGLTEEDKKNSRFAQKHKK  55



>ref|XP_006351125.1| PREDICTED: uncharacterized protein LOC102579644 [Solanum tuberosum]
Length=55

 Score =   107 bits (266),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 48/55 (87%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +2

Query  74   MRQFDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHKK  238
            MRQFDPWPVFFRREW RNWPFLVGFA+TGA+ITKMSLG TEE+ KNS+FAQRHKK
Sbjct  1    MRQFDPWPVFFRREWSRNWPFLVGFAVTGAIITKMSLGFTEEERKNSRFAQRHKK  55



>ref|XP_009598534.1| PREDICTED: uncharacterized protein LOC104094322 [Nicotiana tomentosiformis]
 ref|XP_009771567.1| PREDICTED: uncharacterized protein LOC104222083 [Nicotiana sylvestris]
Length=55

 Score =   107 bits (266),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 48/55 (87%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = +2

Query  74   MRQFDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHKK  238
            MR+FD WPVFFRREW RNWPFLVGFA+TGA+ITKMSLGLTEE+AKNS+FAQRHKK
Sbjct  1    MRKFDAWPVFFRREWSRNWPFLVGFAVTGAIITKMSLGLTEEEAKNSRFAQRHKK  55



>ref|XP_009602459.1| PREDICTED: uncharacterized protein LOC104097578 [Nicotiana tomentosiformis]
 ref|XP_009770561.1| PREDICTED: uncharacterized protein LOC104221240 [Nicotiana sylvestris]
Length=55

 Score =   106 bits (264),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 48/55 (87%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +2

Query  74   MRQFDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHKK  238
            MRQFDPWPVFFRREW RNWPFLVGFA+TGA+ITK+SLG TEED KNSKFA RHKK
Sbjct  1    MRQFDPWPVFFRREWSRNWPFLVGFAVTGAIITKLSLGFTEEDRKNSKFAMRHKK  55



>ref|XP_006365540.1| PREDICTED: uncharacterized protein LOC102581179 [Solanum tuberosum]
Length=55

 Score =   105 bits (263),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +2

Query  74   MRQFDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHKK  238
            MR+FDPWP+FFRREW RNWPFLVGFA+TG +ITKMSLG TEEDAKNS+FAQ+HKK
Sbjct  1    MRKFDPWPIFFRREWSRNWPFLVGFAVTGTIITKMSLGFTEEDAKNSRFAQKHKK  55



>gb|EYU44854.1| hypothetical protein MIMGU_mgv1a017170mg [Erythranthe guttata]
Length=90

 Score =   105 bits (263),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +2

Query  71   KMRQFDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRH  232
            +MR+FDPWPVFFRREW RNWPFLVGFA+TGA+ITK+SLGLTEEDAKNS+F QRH
Sbjct  34   EMRKFDPWPVFFRREWNRNWPFLVGFAVTGAIITKLSLGLTEEDAKNSRFVQRH  87



>gb|EYU45970.1| hypothetical protein MIMGU_mgv1a017624mg [Erythranthe guttata]
Length=56

 Score =   105 bits (261),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +2

Query  74   MRQFDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHK  235
            MR+FDPWPVFFRREW RNWPFLVGFA+TGA+ITK+SLGLTEEDAKNS+F QRH+
Sbjct  1    MRKFDPWPVFFRREWNRNWPFLVGFAVTGAIITKLSLGLTEEDAKNSRFVQRHQ  54



>ref|XP_007218658.1| hypothetical protein PRUPE_ppa014065mg [Prunus persica]
 gb|EMJ19857.1| hypothetical protein PRUPE_ppa014065mg [Prunus persica]
Length=88

 Score =   105 bits (261),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +2

Query  71   KMRQFDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHKK  238
            KMR+FDPWPVFF+REW RNWPFLVGFAITG +ITK SLGLTEEDAKNS+F QRHKK
Sbjct  33   KMRKFDPWPVFFKREWNRNWPFLVGFAITGTLITKFSLGLTEEDAKNSQFVQRHKK  88



>ref|XP_006436030.1| hypothetical protein CICLE_v10033281mg [Citrus clementina]
 ref|XP_006486079.1| PREDICTED: uncharacterized protein LOC102613102 isoform X1 [Citrus 
sinensis]
 gb|ESR49270.1| hypothetical protein CICLE_v10033281mg [Citrus clementina]
 gb|KDO67680.1| hypothetical protein CISIN_1g035444mg [Citrus sinensis]
Length=55

 Score =   104 bits (259),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 47/55 (85%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +2

Query  74   MRQFDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHKK  238
            MR+FDPWP+FFRREW RNWPFLVGFAITG +ITK SLGLTEEDAKNS F QRHKK
Sbjct  1    MRKFDPWPIFFRREWNRNWPFLVGFAITGTIITKFSLGLTEEDAKNSPFVQRHKK  55



>ref|XP_008233598.1| PREDICTED: uncharacterized protein LOC103332628 [Prunus mume]
Length=55

 Score =   103 bits (258),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 47/55 (85%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +2

Query  74   MRQFDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHKK  238
            MR+FDPWPVFF+REW RNWPFLVGFAITG +ITK SLGLTEEDAKNS+F QRHKK
Sbjct  1    MRKFDPWPVFFKREWNRNWPFLVGFAITGTLITKFSLGLTEEDAKNSQFVQRHKK  55



>ref|XP_007132110.1| hypothetical protein PHAVU_011G067300g [Phaseolus vulgaris]
 gb|ESW04104.1| hypothetical protein PHAVU_011G067300g [Phaseolus vulgaris]
Length=55

 Score =   103 bits (258),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 47/55 (85%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +2

Query  74   MRQFDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHKK  238
            MR+FDPWPVFFRREW RNWPFLVGFA+TGA+ITK SLGLTEEDAKNSKF Q HK+
Sbjct  1    MRKFDPWPVFFRREWKRNWPFLVGFAVTGAIITKFSLGLTEEDAKNSKFVQAHKR  55



>gb|ACX53672.1| mitochondrial ATP synthase 6kDa subunit [Capsicum annuum]
Length=55

 Score =   103 bits (257),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +2

Query  74   MRQFDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHK  235
            MRQFDPWP+FFRREW RNWPFLVGFA+TG +ITK+SLG TEED KNS+FAQRHK
Sbjct  1    MRQFDPWPIFFRREWSRNWPFLVGFAVTGTIITKLSLGFTEEDRKNSRFAQRHK  54



>ref|XP_006480775.1| PREDICTED: uncharacterized protein LOC102629016 [Citrus sinensis]
 gb|KDO43696.1| hypothetical protein CISIN_1g042378mg [Citrus sinensis]
Length=55

 Score =   103 bits (257),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 47/55 (85%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +2

Query  74   MRQFDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHKK  238
            MR+FDPWPVFFRREW RNWPFLVGFAITG +ITK SLGLTEEDAKNS F QRHK+
Sbjct  1    MRKFDPWPVFFRREWNRNWPFLVGFAITGTIITKFSLGLTEEDAKNSPFVQRHKR  55



>ref|XP_004294577.1| PREDICTED: uncharacterized protein LOC101294636 [Fragaria vesca 
subsp. vesca]
Length=55

 Score =   103 bits (256),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +2

Query  74   MRQFDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHKK  238
            MR+FDPWP+FF+REW RNWPFLVGFAITG +ITK+SLGLTEEDAKNS F QRHK+
Sbjct  1    MRKFDPWPIFFKREWNRNWPFLVGFAITGTIITKLSLGLTEEDAKNSPFVQRHKR  55



>ref|XP_010322939.1| PREDICTED: uncharacterized protein LOC101266038 [Solanum lycopersicum]
Length=55

 Score =   103 bits (256),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +2

Query  74   MRQFDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHKK  238
            MR+FDPWP+FFRREW RNWPFLVGFA+TG +ITKMSLG TEEDAKNS F Q+HKK
Sbjct  1    MRKFDPWPIFFRREWSRNWPFLVGFAVTGTIITKMSLGFTEEDAKNSPFVQKHKK  55



>ref|XP_004505891.1| PREDICTED: uncharacterized protein LOC101508258 [Cicer arietinum]
Length=55

 Score =   102 bits (255),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +2

Query  74   MRQFDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHKK  238
            MR+FDPWPVFF+REW RNWPFLVGFA+TGAVITK+SLG TEEDAKNSKF Q HK+
Sbjct  1    MRKFDPWPVFFKREWKRNWPFLVGFAVTGAVITKLSLGFTEEDAKNSKFVQAHKR  55



>gb|ABK95836.1| unknown [Populus trichocarpa]
Length=56

 Score =   102 bits (255),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 47/55 (85%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +2

Query  74   MRQFDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHKK  238
            MR+FDPWPVFF+REW RNWPFLVGFAITGA+ITK SL LTEEDAKNS F QRHKK
Sbjct  1    MRKFDPWPVFFKREWNRNWPFLVGFAITGALITKFSLSLTEEDAKNSPFVQRHKK  55



>emb|CDP09025.1| unnamed protein product [Coffea canephora]
Length=62

 Score =   102 bits (255),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 47/55 (85%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +2

Query  74   MRQFDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHKK  238
            MRQFDPWPVFFRREW R WPFLVGFA+TG VITK SLGLTEEDAKNS FAQRH+ 
Sbjct  1    MRQFDPWPVFFRREWRRTWPFLVGFAVTGTVITKFSLGLTEEDAKNSPFAQRHRN  55



>ref|XP_011075436.1| PREDICTED: uncharacterized protein LOC105159912 isoform X1 [Sesamum 
indicum]
Length=60

 Score =   102 bits (254),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +2

Query  74   MRQFDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHKK  238
            MR+FDPWPVFFRREW RNWPFLVGFAITG +ITK SLGLTEEDAKNS F QRH +
Sbjct  1    MRKFDPWPVFFRREWNRNWPFLVGFAITGTIITKFSLGLTEEDAKNSPFVQRHHR  55



>emb|CDP00067.1| unnamed protein product [Coffea canephora]
Length=56

 Score =   102 bits (253),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +2

Query  74   MRQFDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHKK  238
            MR+FDPWPVFFRREW R WPFLVGFA+TG +ITKMSL LTEEDAKNS F QRHKK
Sbjct  1    MRKFDPWPVFFRREWNRCWPFLVGFAVTGTIITKMSLSLTEEDAKNSPFVQRHKK  55



>ref|XP_011075437.1| PREDICTED: uncharacterized protein LOC105159912 isoform X2 [Sesamum 
indicum]
Length=58

 Score =   102 bits (253),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +2

Query  74   MRQFDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHKK  238
            MR+FDPWPVFFRREW RNWPFLVGFAITG +ITK SLGLTEEDAKNS F QRH +
Sbjct  1    MRKFDPWPVFFRREWNRNWPFLVGFAITGTIITKFSLGLTEEDAKNSPFVQRHHR  55



>ref|XP_011073276.1| PREDICTED: uncharacterized protein LOC105158275 [Sesamum indicum]
 ref|XP_011075438.1| PREDICTED: uncharacterized protein LOC105159912 isoform X3 [Sesamum 
indicum]
Length=56

 Score =   102 bits (253),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +2

Query  74   MRQFDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHKK  238
            MR+FDPWPVFFRREW RNWPFLVGFAITG +ITK SLGLTEEDAKNS F QRH +
Sbjct  1    MRKFDPWPVFFRREWNRNWPFLVGFAITGTIITKFSLGLTEEDAKNSPFVQRHHR  55



>gb|KHN32098.1| hypothetical protein glysoja_028893 [Glycine soja]
Length=79

 Score =   102 bits (254),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +2

Query  74   MRQFDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHKK  238
            MR+FDPWPVFF+REW RNWPFLVGFA+TGA+ITK+SLGLTEEDAKNSKF + HK+
Sbjct  1    MRKFDPWPVFFKREWKRNWPFLVGFAVTGALITKLSLGLTEEDAKNSKFVKAHKR  55



>ref|XP_006592209.1| PREDICTED: uncharacterized protein LOC100306502 isoform X1 [Glycine 
max]
Length=55

 Score =   101 bits (252),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +2

Query  74   MRQFDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHKK  238
            MR+FDPWPVFF+REW RNWPFLVGFA+TGA+ITK+SLGLTEEDAKNSKF + HK+
Sbjct  1    MRKFDPWPVFFKREWKRNWPFLVGFAVTGALITKLSLGLTEEDAKNSKFVKAHKR  55



>ref|XP_008370840.1| PREDICTED: uncharacterized protein LOC103434280 [Malus domestica]
Length=56

 Score =   102 bits (253),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 47/55 (85%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +2

Query  74   MRQFDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHKK  238
            MR+FDPWPVFF+REW RNWPFLVGFAITG +ITK SLGLTEEDAKNS F QRHKK
Sbjct  1    MRKFDPWPVFFKREWRRNWPFLVGFAITGTLITKFSLGLTEEDAKNSPFVQRHKK  55



>ref|XP_007207407.1| hypothetical protein PRUPE_ppa014536mg [Prunus persica]
 ref|XP_008223224.1| PREDICTED: uncharacterized protein LOC103323040 [Prunus mume]
 gb|EMJ08606.1| hypothetical protein PRUPE_ppa014536mg [Prunus persica]
Length=55

 Score =   101 bits (252),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +2

Query  74   MRQFDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHKK  238
            MR+FDPWP+FF+REW RNWPFLVGFAITG +ITK SLGLTEEDAKNS F QRHK+
Sbjct  1    MRKFDPWPIFFKREWNRNWPFLVGFAITGTLITKFSLGLTEEDAKNSAFVQRHKR  55



>ref|XP_003606613.1| Mitochondrial ATP synthase subunit [Medicago truncatula]
 gb|AES88810.1| ATP synthase 6 kDa subunit [Medicago truncatula]
 gb|AFK47270.1| unknown [Medicago truncatula]
Length=55

 Score =   101 bits (252),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +2

Query  74   MRQFDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHKK  238
            MRQFDPWPVFF+REW R WPFLVGFA+TGA++TK SLGLTEEDAKNSKF Q HK+
Sbjct  1    MRQFDPWPVFFKREWKRTWPFLVGFAVTGALVTKFSLGLTEEDAKNSKFVQHHKR  55



>ref|XP_009337604.1| PREDICTED: uncharacterized protein LOC103930038 [Pyrus x bretschneideri]
Length=56

 Score =   101 bits (251),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 47/55 (85%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +2

Query  74   MRQFDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHKK  238
            MR+FDPWPVFF+REW RNWPFLVGFAITG  ITK SLGLTEEDAKNS F QRHKK
Sbjct  1    MRKFDPWPVFFKREWKRNWPFLVGFAITGTFITKFSLGLTEEDAKNSPFVQRHKK  55



>ref|XP_002262887.1| PREDICTED: uncharacterized protein LOC100258053 [Vitis vinifera]
Length=55

 Score =   101 bits (251),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +2

Query  74   MRQFDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHKK  238
            M +FDPWPVFFRREW RNWPFLVGFAITG +ITK SLGLTEEDAKNS F QRHK+
Sbjct  1    MAKFDPWPVFFRREWNRNWPFLVGFAITGTIITKFSLGLTEEDAKNSPFVQRHKR  55



>ref|XP_004487037.1| PREDICTED: uncharacterized protein LOC101489778 [Cicer arietinum]
Length=55

 Score =   100 bits (250),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +2

Query  74   MRQFDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHKK  238
            MR+FDPWPVFF+REW RNWPFLVGF +TGAVITK+SLG TEEDAKNSKF Q HK+
Sbjct  1    MRKFDPWPVFFKREWKRNWPFLVGFGVTGAVITKLSLGFTEEDAKNSKFVQAHKR  55



>ref|XP_008366331.1| PREDICTED: uncharacterized protein LOC103429981 [Malus domestica]
Length=55

 Score =   100 bits (250),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +2

Query  74   MRQFDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHKK  238
            MR+FDPWP+FF+REW RNWPFLVGFAITG +ITK S GLTEEDAKNS F QRHK+
Sbjct  1    MRKFDPWPIFFKREWNRNWPFLVGFAITGTLITKFSJGLTEEDAKNSPFVQRHKR  55



>ref|XP_008357512.1| PREDICTED: uncharacterized protein LOC103421264 [Malus domestica]
Length=55

 Score =   100 bits (249),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +2

Query  74   MRQFDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHKK  238
            MR+FDPWP+FF+REW RNWPF+VGFAITG +ITK SLGLTEEDAKNS F QRHK+
Sbjct  1    MRKFDPWPIFFKREWNRNWPFIVGFAITGTLITKFSLGLTEEDAKNSPFVQRHKR  55



>gb|ACV50432.1| mitochondrial ATP synthase 6kDa subunit [Jatropha curcas]
Length=56

 Score =   100 bits (249),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 47/53 (89%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +2

Query  77   RQFDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHK  235
            R+FDPWPVFFRRE+ RNWPFLVGF ITGAVITK SLGLTEEDAKNSKF QRHK
Sbjct  3    RKFDPWPVFFRREFNRNWPFLVGFGITGAVITKFSLGLTEEDAKNSKFVQRHK  55



>ref|XP_006590995.1| PREDICTED: uncharacterized protein LOC100778481 isoform X1 [Glycine 
max]
 gb|KHN21989.1| hypothetical protein glysoja_008901 [Glycine soja]
Length=55

 Score =   100 bits (248),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +2

Query  74   MRQFDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHKK  238
            MR+FDPWPVFF+REW RNWPFLVGFA+TGA+ITK+SLGLTEE+AKNSKF + HK+
Sbjct  1    MRKFDPWPVFFKREWKRNWPFLVGFAVTGALITKLSLGLTEEEAKNSKFVKAHKR  55



>ref|XP_010259959.1| PREDICTED: uncharacterized protein LOC104599212 [Nelumbo nucifera]
Length=55

 Score =   100 bits (248),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +2

Query  74   MRQFDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHKK  238
            M +FDPWPVFFRREW RNWPFLVGFAITG ++TK SLGLTEEDAKNS F QRHK+
Sbjct  1    MPKFDPWPVFFRREWNRNWPFLVGFAITGTILTKFSLGLTEEDAKNSPFVQRHKR  55



>ref|XP_010260580.1| PREDICTED: uncharacterized protein LOC104599658 [Nelumbo nucifera]
Length=55

 Score = 99.8 bits (247),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +2

Query  74   MRQFDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHKK  238
            M +FDPW VFFRREW RNWPFLVGFAITG VITK+SLGLTEEDAKNS F QRHK+
Sbjct  1    MPKFDPWSVFFRREWSRNWPFLVGFAITGTVITKLSLGLTEEDAKNSPFVQRHKR  55



>ref|XP_009358352.1| PREDICTED: uncharacterized protein LOC103948979 [Pyrus x bretschneideri]
Length=55

 Score = 99.8 bits (247),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +2

Query  74   MRQFDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHKK  238
            MR+FDPWP+FF+REW RNWPFL GFAITG +ITK SLGLTEEDAKNS F QRHK+
Sbjct  1    MRKFDPWPIFFKREWNRNWPFLAGFAITGTLITKFSLGLTEEDAKNSPFVQRHKR  55



>ref|XP_002316297.1| hypothetical protein POPTR_0010s21460g [Populus trichocarpa]
 ref|XP_006378726.1| hypothetical protein POPTR_0010s21460g [Populus trichocarpa]
 gb|ABK93874.1| unknown [Populus trichocarpa]
 gb|ABK94367.1| unknown [Populus trichocarpa]
 gb|EEF02468.1| hypothetical protein POPTR_0010s21460g [Populus trichocarpa]
 gb|ERP56523.1| hypothetical protein POPTR_0010s21460g [Populus trichocarpa]
Length=56

 Score = 99.8 bits (247),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +2

Query  74   MRQFDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHKK  238
            MR+FDPWPVFFRREW RNWPFL GFAITG +ITK SL LTEEDAKNS F QRHK+
Sbjct  1    MRKFDPWPVFFRREWNRNWPFLAGFAITGTLITKFSLSLTEEDAKNSPFVQRHKR  55



>gb|KDP44212.1| hypothetical protein JCGZ_05679 [Jatropha curcas]
Length=61

 Score = 99.8 bits (247),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/53 (89%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +2

Query  77   RQFDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHK  235
            R+FDPWPVFFRRE+ RNWPFLVGF ITGAVITK SLGLTEEDAKNSKF QRHK
Sbjct  3    RKFDPWPVFFRREFNRNWPFLVGFGITGAVITKFSLGLTEEDAKNSKFVQRHK  55



>ref|XP_009353710.1| PREDICTED: uncharacterized protein LOC103944950 [Pyrus x bretschneideri]
Length=55

 Score = 99.4 bits (246),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +2

Query  74   MRQFDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHKK  238
            MR+FDPWP+FF+REW RNWPF+VGFAITG ++TK SLGLTEEDAKNS F QRHK+
Sbjct  1    MRKFDPWPIFFKREWNRNWPFIVGFAITGTLLTKFSLGLTEEDAKNSPFVQRHKR  55



>ref|XP_006429033.1| hypothetical protein CICLE_v10013313mg, partial [Citrus clementina]
 gb|ESR42273.1| hypothetical protein CICLE_v10013313mg, partial [Citrus clementina]
Length=67

 Score = 99.8 bits (247),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +2

Query  83   FDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHKK  238
            FDPWPVFFRREW RNWPFLVGFAITG +ITK SLGLTEEDAKNS F QRHK+
Sbjct  16   FDPWPVFFRREWNRNWPFLVGFAITGTIITKFSLGLTEEDAKNSPFVQRHKR  67



>ref|XP_003597325.1| Mitochondrial ATP synthase subunit [Medicago truncatula]
 gb|AES67576.1| ATP synthase 6 kDa subunit [Medicago truncatula]
Length=55

 Score = 98.6 bits (244),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +2

Query  74   MRQFDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHKK  238
            MR+FD WPVFF+REW RNWPFLVGFA+TGA++TK SLGL+EEDAKNSKF Q HK+
Sbjct  1    MRKFDAWPVFFKREWNRNWPFLVGFAVTGALVTKFSLGLSEEDAKNSKFVQAHKR  55



>ref|XP_010685811.1| PREDICTED: uncharacterized protein LOC104900151 [Beta vulgaris 
subsp. vulgaris]
Length=59

 Score = 98.6 bits (244),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +2

Query  77   RQFDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHK  235
            R+FDPWP+FF+REW RNWPFLVGFA+TG +ITK+SLGLTEE AKNSKF QRHK
Sbjct  5    RKFDPWPIFFKREWNRNWPFLVGFAVTGTIITKISLGLTEEQAKNSKFVQRHK  57



>ref|XP_007150286.1| hypothetical protein PHAVU_005G141000g [Phaseolus vulgaris]
 ref|XP_007150287.1| hypothetical protein PHAVU_005G141000g [Phaseolus vulgaris]
 gb|ESW22280.1| hypothetical protein PHAVU_005G141000g [Phaseolus vulgaris]
 gb|ESW22281.1| hypothetical protein PHAVU_005G141000g [Phaseolus vulgaris]
Length=55

 Score = 98.2 bits (243),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +2

Query  74   MRQFDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHKK  238
            MR FDPW VFF+REW RNWPFLVGFA+TG VITK SLGLTEEDAKNSKF Q HK+
Sbjct  1    MRLFDPWSVFFKREWKRNWPFLVGFAVTGTVITKFSLGLTEEDAKNSKFVQAHKR  55



>gb|AGN52926.1| hypothetical protein, partial [Silene latifolia]
Length=53

 Score = 98.2 bits (243),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +2

Query  83   FDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHKK  238
            FDPWPVFF+REW RNWPFLVGFAITG +ITK+SLGLTEED KNS FAQRHK+
Sbjct  1    FDPWPVFFKREWNRNWPFLVGFAITGTIITKLSLGLTEEDEKNSPFAQRHKR  52



>ref|XP_008233667.1| PREDICTED: uncharacterized protein LOC103332698 [Prunus mume]
Length=131

 Score = 99.8 bits (247),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +2

Query  74   MRQFDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRH  232
            MR+FDPWPVFF+REW RNWPFLVGFAITG +IT  SLGLTEEDAKNS F QRH
Sbjct  1    MRKFDPWPVFFKREWNRNWPFLVGFAITGTLITYFSLGLTEEDAKNSPFVQRH  53



>ref|XP_008803418.1| PREDICTED: uncharacterized protein LOC103716973 [Phoenix dactylifera]
 ref|XP_008780621.1| PREDICTED: uncharacterized protein LOC103700457 [Phoenix dactylifera]
Length=55

 Score = 97.1 bits (240),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +2

Query  74   MRQFDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHKK  238
            MR+FDPWPVFFRRE+ RNWPFLVGFAITGAVI K++ GLTEEDAKNS+F Q H +
Sbjct  1    MRKFDPWPVFFRREFNRNWPFLVGFAITGAVIVKLTAGLTEEDAKNSRFVQEHNR  55



>ref|XP_009387401.1| PREDICTED: uncharacterized protein LOC103974324 [Musa acuminata 
subsp. malaccensis]
Length=56

 Score = 96.7 bits (239),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +2

Query  74   MRQFDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHKK  238
            M+ FDPWPVFF+RE+ RNWPFLVGFAITG +I KM+ GLTEEDAKNSKF Q HK+
Sbjct  1    MKTFDPWPVFFKREFNRNWPFLVGFAITGCIIVKMTAGLTEEDAKNSKFVQEHKR  55



>ref|XP_010907068.1| PREDICTED: uncharacterized protein LOC105033831 [Elaeis guineensis]
 ref|XP_010907069.1| PREDICTED: uncharacterized protein LOC105033831 [Elaeis guineensis]
 ref|XP_010907070.1| PREDICTED: uncharacterized protein LOC105033831 [Elaeis guineensis]
Length=55

 Score = 96.3 bits (238),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +2

Query  74   MRQFDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHKK  238
            MR+FDPWPVFFRRE+ RNWPFLVGFAITGAVI K++ GLTEEDAKNS+F Q H +
Sbjct  1    MRKFDPWPVFFRREFHRNWPFLVGFAITGAVIVKLTAGLTEEDAKNSRFVQEHNR  55



>ref|XP_002531373.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF31021.1| conserved hypothetical protein [Ricinus communis]
Length=57

 Score = 96.3 bits (238),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +2

Query  77   RQFDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHKK  238
            R FDPWPVFF+RE+ RNWPFLVGFAITG +ITK+SLGLTEEDAKNS F QRHK+
Sbjct  3    RWFDPWPVFFKREFNRNWPFLVGFAITGTIITKLSLGLTEEDAKNSPFVQRHKR  56



>ref|XP_006597281.1| PREDICTED: uncharacterized protein LOC100306247 isoform X1 [Glycine 
max]
 gb|KHN33411.1| hypothetical protein glysoja_005453 [Glycine soja]
Length=55

 Score = 96.3 bits (238),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +2

Query  74   MRQFDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHKK  238
            MR FDPWPVFF+REW RNWPFLVGFAITG +ITK+SLGL+EE+AK SKF Q HK+
Sbjct  1    MRLFDPWPVFFKREWKRNWPFLVGFAITGTLITKLSLGLSEEEAKKSKFVQAHKR  55



>gb|KGN54234.1| hypothetical protein Csa_4G294910 [Cucumis sativus]
Length=70

 Score = 96.3 bits (238),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +2

Query  74   MRQFDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHKK*F  244
            MR+FDPWPVFFRREW RNWPFLVGFAITG++ITKM+ G TEE+ KNS F QRH + F
Sbjct  1    MRKFDPWPVFFRREWKRNWPFLVGFAITGSLITKMTAGFTEEEVKNSPFVQRHNRYF  57



>ref|XP_004142079.1| PREDICTED: uncharacterized protein LOC101216317 [Cucumis sativus]
 ref|XP_004168294.1| PREDICTED: uncharacterized protein LOC101229099 [Cucumis sativus]
Length=55

 Score = 95.5 bits (236),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +2

Query  74   MRQFDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHKK  238
            MR+FDPWPVFFRREW RNWPFLVGFAITG++ITKM+ G TEE+ KNS F QRH +
Sbjct  1    MRKFDPWPVFFRREWKRNWPFLVGFAITGSLITKMTAGFTEEEVKNSPFVQRHNR  55



>ref|XP_006844730.1| hypothetical protein AMTR_s00016p00253840 [Amborella trichopoda]
 gb|ERN06405.1| hypothetical protein AMTR_s00016p00253840 [Amborella trichopoda]
Length=108

 Score = 96.7 bits (239),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 43/54 (80%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +2

Query  74   MRQFDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHK  235
            M +FDPWPVFFRREW RNWPFL+GFAITG +ITK +LG TEEDAKNS F QRHK
Sbjct  1    MARFDPWPVFFRREWNRNWPFLIGFAITGTIITKFTLGFTEEDAKNSPFVQRHK  54



>ref|XP_002281230.2| PREDICTED: uncharacterized protein LOC100265565 [Vitis vinifera]
Length=56

 Score = 95.1 bits (235),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +2

Query  74   MRQFDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHKK  238
            MR+FDPWPVFFRREW RNWPFLVGFA+TG +IT  SL LTEEDAK S F QRH++
Sbjct  1    MRKFDPWPVFFRREWNRNWPFLVGFAVTGIIITVYSLSLTEEDAKKSPFVQRHER  55



>ref|XP_007016482.1| Uncharacterized protein TCM_041879 [Theobroma cacao]
 gb|EOY34101.1| Uncharacterized protein TCM_041879 [Theobroma cacao]
Length=56

 Score = 95.1 bits (235),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +2

Query  77   RQFDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHKK  238
            R FDPWPVFF+RE+ RNWPFLVGFAITG +ITK SLGLTEEDAKNS F QRHK+
Sbjct  3    RWFDPWPVFFKREFNRNWPFLVGFAITGTIITKFSLGLTEEDAKNSPFVQRHKR  56



>ref|XP_008447675.1| PREDICTED: uncharacterized protein LOC103490081 [Cucumis melo]
Length=55

 Score = 95.1 bits (235),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +2

Query  74   MRQFDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHKK  238
            MR+FDPWPVFFRREW RNWPFLVGFAITGA ITKM+ G +EE+ KNS F QRH +
Sbjct  1    MRKFDPWPVFFRREWKRNWPFLVGFAITGAAITKMTAGFSEEEVKNSPFVQRHNR  55



>ref|XP_010922373.1| PREDICTED: uncharacterized protein LOC105045706 [Elaeis guineensis]
Length=55

 Score = 95.1 bits (235),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +2

Query  74   MRQFDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHKK  238
            MR+FDPWPVFFRRE+ RNWPFLVGFAITGA I K++ GLTEEDAKNS+F Q H +
Sbjct  1    MRKFDPWPVFFRREFNRNWPFLVGFAITGAFIVKLTAGLTEEDAKNSRFVQEHNR  55



>gb|EMS58891.1| hypothetical protein TRIUR3_25815 [Triticum urartu]
Length=59

 Score = 94.4 bits (233),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +2

Query  83   FDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHKK  238
            FDPWPVFFRREWGR WPF+ GFA+TGAVITKM+ G TEED KNSKF Q HKK
Sbjct  7    FDPWPVFFRREWGRTWPFIAGFAVTGAVITKMTAGFTEEDLKNSKFVQAHKK  58



>ref|XP_006400935.1| hypothetical protein EUTSA_v10015813mg [Eutrema salsugineum]
 gb|ESQ42388.1| hypothetical protein EUTSA_v10015813mg [Eutrema salsugineum]
Length=109

 Score = 95.9 bits (237),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = +2

Query  71   KMRQFDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHKK  238
            +MR FDPWPVFF+REW R WPFL GFA+TG +ITK++ GLTEEDAKNSKF Q+H++
Sbjct  54   EMRLFDPWPVFFKREWKRCWPFLTGFAVTGVLITKLTAGLTEEDAKNSKFVQQHRR  109



>ref|XP_010043577.1| PREDICTED: uncharacterized protein LOC104432752 [Eucalyptus grandis]
Length=55

 Score = 94.0 bits (232),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +2

Query  74   MRQFDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHKK  238
            MR+FDPWPVFF+RE+ R WPFLVGFA+TGA+ITK SLGL+EEDAK S F Q+HK+
Sbjct  1    MRKFDPWPVFFKREFSRTWPFLVGFAVTGAIITKFSLGLSEEDAKKSPFVQQHKR  55



>gb|ACG36451.1| hypothetical protein [Zea mays]
 tpg|DAA41578.1| TPA: hypothetical protein ZEAMMB73_832180 [Zea mays]
Length=57

 Score = 94.0 bits (232),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +2

Query  74   MRQFDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHKK  238
            M+ FDPWPVFFRREW RNWPFL GFAITG +ITKM+   TEED KNSKF Q HKK
Sbjct  1    MKTFDPWPVFFRREWKRNWPFLTGFAITGFIITKMTANFTEEDLKNSKFVQEHKK  55



>gb|ACG33389.1| hypothetical protein [Zea mays]
 gb|AFW74938.1| hypothetical protein ZEAMMB73_082553 [Zea mays]
 gb|AFW74939.1| hypothetical protein ZEAMMB73_082553 [Zea mays]
Length=56

 Score = 94.0 bits (232),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +2

Query  74   MRQFDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHKK  238
            M+ FDPWPVFFRREW RNWPFL GFAITG +ITKM+   TEED KNSKF Q HKK
Sbjct  1    MKTFDPWPVFFRREWKRNWPFLTGFAITGFIITKMTANFTEEDLKNSKFVQEHKK  55



>dbj|BAB21526.1| mitochondrial ATP synthase 6 KD subunit [Oryza sativa Japonica 
Group]
 gb|ACU44655.1| mitochondrial ATP synthase 6 kDa subunit [Oryza sativa Indica 
Group]
Length=58

 Score = 93.6 bits (231),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +2

Query  80   QFDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHKK  238
            +FDPWPVFFRREW R WPFL GFA+TGA+ITKM+ GLTEED KNSKF Q HKK
Sbjct  5    RFDPWPVFFRREWKRCWPFLTGFAVTGAIITKMTAGLTEEDLKNSKFVQAHKK  57



>ref|XP_008670608.1| PREDICTED: 50S ribosomal protein L28, chloroplastic [Zea mays]
Length=195

 Score = 97.1 bits (240),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = +2

Query  65   SRKMRQFDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHKK  238
            + +M+ FDPWPVFFRREW RNWPFL GFAITG +ITKM+   TEED KNSKF Q HKK
Sbjct  136  AEEMKTFDPWPVFFRREWKRNWPFLTGFAITGFIITKMTANFTEEDLKNSKFVQEHKK  193



>ref|XP_008372674.1| PREDICTED: uncharacterized protein LOC103436039 [Malus domestica]
Length=72

 Score = 94.0 bits (232),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +2

Query  74   MRQFDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHKK  238
            MR+FDPW VFF+ EW RNWPFL+ FAIT  +ITK SLGLTEEDAKNS F QRHKK
Sbjct  1    MRKFDPWLVFFKSEWNRNWPFLIDFAITDTLITKFSLGLTEEDAKNSPFVQRHKK  55



>ref|NP_190227.1| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_680457.1| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_001190570.1| uncharacterized protein [Arabidopsis thaliana]
 ref|XP_002866342.1| hypothetical protein ARALYDRAFT_496097 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_002875780.1| hypothetical protein ARALYDRAFT_485014 [Arabidopsis lyrata subsp. 
lyrata]
 emb|CAB62034.1| putative protein [Arabidopsis thaliana]
 gb|AAL32914.1| Unknown protein [Arabidopsis thaliana]
 gb|AAL36060.1| AT3g46430/F18L15_150 [Arabidopsis thaliana]
 gb|AAM10121.1| unknown protein [Arabidopsis thaliana]
 gb|AAM19926.1| AT3g46430/F18L15_150 [Arabidopsis thaliana]
 dbj|BAC42332.1| unknown protein [Arabidopsis thaliana]
 dbj|BAC43026.1| unknown protein [Arabidopsis thaliana]
 gb|EFH42601.1| hypothetical protein ARALYDRAFT_496097 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52039.1| hypothetical protein ARALYDRAFT_485014 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AED97213.1| uncharacterized protein AT5G59613 [Arabidopsis thaliana]
 gb|AED97214.1| uncharacterized protein AT5G59613 [Arabidopsis thaliana]
 gb|AEE78157.1| uncharacterized protein AT3G46430 [Arabidopsis thaliana]
 gb|KFK27490.1| hypothetical protein AALP_AA8G389900 [Arabis alpina]
 gb|KFK33979.1| hypothetical protein AALP_AA5G086300 [Arabis alpina]
Length=55

 Score = 93.2 bits (230),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +2

Query  74   MRQFDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHKK  238
            MR FDPWPVFF+REW R WPFL GFA+TG +ITK++ GLTEEDAKNSKF Q+H++
Sbjct  1    MRLFDPWPVFFKREWKRCWPFLTGFAVTGVLITKLTAGLTEEDAKNSKFVQQHRR  55



>ref|XP_010541396.1| PREDICTED: uncharacterized protein LOC104814874 isoform X2 [Tarenaya 
hassleriana]
Length=77

 Score = 94.0 bits (232),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +2

Query  74   MRQFDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHKK  238
            MR FDPWPVFF+REW R WPF+ GFA+TGA+ITK + GLTEEDAKNSKF Q H++
Sbjct  1    MRLFDPWPVFFKREWKRCWPFITGFAVTGAIITKFTAGLTEEDAKNSKFVQHHRR  55



>ref|XP_010541397.1| PREDICTED: uncharacterized protein LOC104814874 isoform X3 [Tarenaya 
hassleriana]
Length=55

 Score = 92.8 bits (229),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +2

Query  74   MRQFDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHKK  238
            MR FDPWPVFF+REW R WPF+ GFA+TGA+ITK + GLTEEDAKNSKF Q H++
Sbjct  1    MRLFDPWPVFFKREWKRCWPFITGFAVTGAIITKFTAGLTEEDAKNSKFVQHHRR  55



>gb|KJB20140.1| hypothetical protein B456_003G134700 [Gossypium raimondii]
 gb|KJB55915.1| hypothetical protein B456_009G101100 [Gossypium raimondii]
 gb|KJB55916.1| hypothetical protein B456_009G101100 [Gossypium raimondii]
Length=56

 Score = 92.8 bits (229),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 42/54 (78%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +2

Query  77   RQFDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHKK  238
            R FDPWPVFF+RE+ R WPFLVGFA+TG +ITK SLGLTEEDAKNS FAQ+HK+
Sbjct  3    RWFDPWPVFFKREFNRTWPFLVGFAVTGTIITKFSLGLTEEDAKNSPFAQKHKR  56



>ref|XP_004960507.1| PREDICTED: uncharacterized protein LOC101767414 isoform X1 [Setaria 
italica]
 ref|XP_004960508.1| PREDICTED: uncharacterized protein LOC101767414 isoform X2 [Setaria 
italica]
Length=56

 Score = 92.8 bits (229),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +2

Query  74   MRQFDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHKK  238
            M+ FDPWPVFFRREW RNWPFL GFAITG +ITKM+   TEED KNSKF Q HKK
Sbjct  1    MKTFDPWPVFFRREWRRNWPFLTGFAITGFLITKMTANFTEEDLKNSKFVQEHKK  55



>gb|KHG28773.1| ATP synthase 6 kDa subunit, mitochondrial [Gossypium arboreum]
Length=128

 Score = 94.4 bits (233),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 42/54 (78%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +2

Query  77   RQFDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHKK  238
            R FDPWPVFF+RE+ R WPFLVGFA+TG +ITK SLGLTEEDAKNS FAQ+HK+
Sbjct  3    RWFDPWPVFFKREFNRTWPFLVGFAVTGTIITKFSLGLTEEDAKNSPFAQKHKR  56



>ref|XP_009126685.1| PREDICTED: uncharacterized protein LOC103851567 [Brassica rapa]
Length=55

 Score = 92.0 bits (227),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +2

Query  74   MRQFDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHKK  238
            MR FDPWPVFF+REW R WPFL GFA+TG +ITK++ G TEEDAKNSKF Q+H++
Sbjct  1    MRLFDPWPVFFKREWKRTWPFLTGFAVTGVLITKLTAGFTEEDAKNSKFVQQHRR  55



>ref|XP_003565176.1| PREDICTED: uncharacterized protein LOC100839898 [Brachypodium 
distachyon]
Length=57

 Score = 92.0 bits (227),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +2

Query  74   MRQFDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHKK  238
            M  FDPWPVFFRREW RNWPFL GFA+TG +ITKM+ G TEED KNSKF Q HK+
Sbjct  1    MATFDPWPVFFRREWKRNWPFLAGFAVTGFLITKMTAGFTEEDLKNSKFVQEHKR  55



>ref|NP_001050636.2| Os03g0606200 [Oryza sativa Japonica Group]
 gb|EEE59476.1| hypothetical protein OsJ_11685 [Oryza sativa Japonica Group]
 dbj|BAF12550.2| Os03g0606200 [Oryza sativa Japonica Group]
 gb|ADI49833.1| mitochondrial ATP synthase 6 kDa subunit [Oryza sativa Indica 
Group]
Length=58

 Score = 92.0 bits (227),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = +2

Query  80   QFDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHKK  238
            +FDPWPVFFRREW R WPFL GFA+TGA+ITKM+ G TEED KNSKF Q HKK
Sbjct  5    RFDPWPVFFRREWKRCWPFLTGFAVTGAIITKMTAGFTEEDLKNSKFVQAHKK  57



>ref|XP_010541395.1| PREDICTED: uncharacterized protein LOC104814874 isoform X1 [Tarenaya 
hassleriana]
Length=106

 Score = 93.2 bits (230),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +2

Query  74   MRQFDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHK  235
            MR FDPWPVFF+REW R WPF+ GFA+TGA+ITK + GLTEEDAKNSKF Q H+
Sbjct  1    MRLFDPWPVFFKREWKRCWPFITGFAVTGAIITKFTAGLTEEDAKNSKFVQHHR  54



>ref|XP_006418898.1| hypothetical protein EUTSA_v10003016mg [Eutrema salsugineum]
 gb|ESQ37334.1| hypothetical protein EUTSA_v10003016mg [Eutrema salsugineum]
Length=55

 Score = 91.7 bits (226),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +2

Query  74   MRQFDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHKK  238
            MR FDPWPVF +REW R WPFL GFA+TG +ITK++ GLTEEDAKNSKF Q+H++
Sbjct  1    MRLFDPWPVFLKREWKRCWPFLTGFAVTGVLITKLTAGLTEEDAKNSKFVQQHRR  55



>ref|XP_002461077.1| hypothetical protein SORBIDRAFT_02g040270 [Sorghum bicolor]
 ref|XP_002440470.1| hypothetical protein SORBIDRAFT_09g001440 [Sorghum bicolor]
 gb|EER97598.1| hypothetical protein SORBIDRAFT_02g040270 [Sorghum bicolor]
 gb|EES18900.1| hypothetical protein SORBIDRAFT_09g001440 [Sorghum bicolor]
Length=56

 Score = 91.7 bits (226),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +2

Query  74   MRQFDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHKK  238
            M+ FDPWPVFFRREW RNWPFL GFAITG +ITKM+   TEED KNSKF Q HK+
Sbjct  1    MKTFDPWPVFFRREWRRNWPFLTGFAITGFLITKMTANFTEEDLKNSKFVQEHKR  55



>ref|XP_009131984.1| PREDICTED: uncharacterized protein LOC103856618 [Brassica rapa]
 ref|XP_009131985.1| PREDICTED: uncharacterized protein LOC103856619 [Brassica rapa]
 ref|XP_009120475.1| PREDICTED: uncharacterized protein LOC103845383 [Brassica rapa]
Length=55

 Score = 91.7 bits (226),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +2

Query  74   MRQFDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHKK  238
            MR FDPWPVFF+REW R WPFL GFA+TG +ITK++ G TEEDAKNSKF Q+H++
Sbjct  1    MRLFDPWPVFFKREWKRCWPFLTGFAVTGVLITKLTAGFTEEDAKNSKFVQQHRR  55



>ref|XP_003568999.1| PREDICTED: uncharacterized protein LOC100845490 [Brachypodium 
distachyon]
Length=55

 Score = 91.3 bits (225),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +2

Query  74   MRQFDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHKK  238
            M+ FDPWPVFFRREW RNWPFL GFA+TG +ITK++ G TEED KNSKF Q H++
Sbjct  1    MKTFDPWPVFFRREWRRNWPFLAGFAVTGILITKLTAGFTEEDLKNSKFVQEHRR  55



>gb|ACG44137.1| hypothetical protein [Zea mays]
Length=56

 Score = 91.3 bits (225),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +2

Query  74   MRQFDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHKK  238
            M+ FDPWPVFFRREW RNWPFL GFAI G +ITKM+   TEED KNSKF Q HKK
Sbjct  1    MKTFDPWPVFFRREWKRNWPFLTGFAIPGFIITKMTANFTEEDLKNSKFVQEHKK  55



>gb|KJB55912.1| hypothetical protein B456_009G101000 [Gossypium raimondii]
 gb|KJB55913.1| hypothetical protein B456_009G101000 [Gossypium raimondii]
 gb|KJB55914.1| hypothetical protein B456_009G101000 [Gossypium raimondii]
Length=56

 Score = 91.3 bits (225),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +2

Query  77   RQFDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHKK  238
            R FDPWPVFF+RE+ R WPFLVGFA+TG +ITK SLGLTEED KNS FAQ+HK+
Sbjct  3    RWFDPWPVFFKREFNRTWPFLVGFAVTGTIITKFSLGLTEEDGKNSPFAQKHKR  56



>gb|ACU44654.4| mitochondrial ATP synthase 6 kDa subunit [Triticum aestivum]
Length=58

 Score = 90.1 bits (222),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +2

Query  80   QFDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHKK  238
            +FDPWPVFFRREW R WPFL GFA+TGA+ITKM+ G TEED  NSKF Q HKK
Sbjct  5    RFDPWPVFFRREWKRCWPFLTGFAVTGAIITKMTAGFTEEDLMNSKFVQAHKK  57



>gb|ACV90429.4| mitochondrial ATP synthase 6 kDa subunit [Triticum aestivum]
 gb|ACZ64509.1| mitochondrial ATP synthase 6 kDa subunit, partial [Aegilops crassa]
Length=51

 Score = 89.7 bits (221),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  89   PWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHKK  238
            PWPVFFRREWGR WPFL GFA+TGA+ITKM+ G TEED KNSKF Q HKK
Sbjct  1    PWPVFFRREWGRTWPFLAGFAVTGALITKMTAGFTEEDLKNSKFVQAHKK  50



>dbj|BAJ85328.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=100

 Score = 90.9 bits (224),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 40/51 (78%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +2

Query  83   FDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHK  235
            FDPWPVFFRREWGR WPFL GFA TGA+ITK++ G TEED KNSKF Q HK
Sbjct  47   FDPWPVFFRREWGRTWPFLAGFATTGAIITKITAGFTEEDLKNSKFVQAHK  97



>gb|AGU28454.1| hypothetical protein, partial [Sinapis alba]
Length=55

 Score = 89.0 bits (219),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +2

Query  77   RQFDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHKK  238
            R FDPWPVFF+REW R WPFL GFA+TG +ITK++ G TEEDAKNSKF Q+H++
Sbjct  2    RLFDPWPVFFKREWKRCWPFLTGFAVTGVLITKLTAGFTEEDAKNSKFVQQHRR  55



>gb|EAY90941.1| hypothetical protein OsI_12555 [Oryza sativa Indica Group]
Length=111

 Score = 90.1 bits (222),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 40/51 (78%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +2

Query  86   DPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHKK  238
            DPWPVFFRREW R WPFL GFA+TGA+ITKM+ G TEED KNSKF Q HKK
Sbjct  60   DPWPVFFRREWKRCWPFLTGFAVTGAIITKMTAGFTEEDLKNSKFVQAHKK  110



>tpg|DAA46137.1| TPA: hypothetical protein ZEAMMB73_290343 [Zea mays]
Length=56

 Score = 87.8 bits (216),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +2

Query  74   MRQFDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHKK  238
            M+ FDPWPVFF REW RN PFL GF ITG +ITKM+   TEED KNSKF Q HKK
Sbjct  1    MKTFDPWPVFFHREWKRNCPFLTGFTITGFIITKMTANFTEEDLKNSKFVQEHKK  55



>gb|ACZ64508.1| mitochondrial ATP synthase 6 kDa subunit [Triticum monococcum 
subsp. aegilopoides]
Length=51

 Score = 87.4 bits (215),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +2

Query  89   PWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHKK  238
            PWPVFFRREWGR WPFL GFA TGA+ITK++ G TEED KNSKF Q HKK
Sbjct  1    PWPVFFRREWGRTWPFLAGFATTGAIITKITAGFTEEDLKNSKFVQAHKK  50



>gb|EMT13071.1| hypothetical protein F775_09785 [Aegilops tauschii]
 emb|CDM87135.1| unnamed protein product [Triticum aestivum]
Length=55

 Score = 87.4 bits (215),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +2

Query  74   MRQFDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHKK  238
            M +FDPWPVFFRREW R WPFL GFA+TGA++TK++ G TEED + SKF Q H++
Sbjct  1    MARFDPWPVFFRREWARTWPFLAGFAVTGALVTKLTAGFTEEDLRASKFVQAHRR  55



>gb|AAR87233.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|AAT78768.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|ABF97531.1| expressed protein [Oryza sativa Japonica Group]
Length=145

 Score = 89.7 bits (221),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 40/51 (78%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +2

Query  86   DPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHKK  238
            DPWPVFFRREW R WPFL GFA+TGA+ITKM+ G TEED KNSKF Q HKK
Sbjct  94   DPWPVFFRREWKRCWPFLTGFAVTGAIITKMTAGFTEEDLKNSKFVQAHKK  144



>tpg|DAA61086.1| TPA: hypothetical protein ZEAMMB73_318338 [Zea mays]
Length=56

 Score = 85.9 bits (211),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +2

Query  74   MRQFDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHKK  238
            M+ FDPWPVFF REW RN PFL GF ITG +ITKM+   TEED KNS F Q HKK
Sbjct  1    MKTFDPWPVFFHREWKRNCPFLTGFTITGFIITKMTANFTEEDLKNSNFVQEHKK  55



>ref|XP_008241219.1| PREDICTED: uncharacterized protein LOC103339664 [Prunus mume]
Length=56

 Score = 84.0 bits (206),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +2

Query  83   FDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHKK  238
            F+PWP+FF REW RNW FLVGFAITG +I K SLGLTEEDAK S F QR K+
Sbjct  5    FNPWPIFFEREWNRNWAFLVGFAITGTLIAKFSLGLTEEDAKTSPFVQRLKR  56



>ref|XP_006379585.1| hypothetical protein POPTR_0008s05310g [Populus trichocarpa]
 gb|ERP57382.1| hypothetical protein POPTR_0008s05310g [Populus trichocarpa]
Length=74

 Score = 82.8 bits (203),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  74   MRQFDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNS  214
            MR+FDPWPVFF+REW RNWPFLVGFAITGA+ITK SL LT  DAK +
Sbjct  1    MRKFDPWPVFFKREWNRNWPFLVGFAITGALITKFSLSLTGTDAKRT  47



>tpg|DAA56942.1| TPA: hypothetical protein ZEAMMB73_025607 [Zea mays]
Length=51

 Score = 81.3 bits (199),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = +2

Query  74   MRQFDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQ  226
            M+ FDPWPVFF REW RN PFL GF ITG +ITKM+   TEED KNSKF Q
Sbjct  1    MKTFDPWPVFFHREWKRNCPFLTGFTITGFIITKMTANFTEEDLKNSKFVQ  51



>gb|ACU14706.1| unknown [Glycine max]
Length=76

 Score = 81.6 bits (200),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = -2

Query  243  NYFLCLCANLEFLASSSVRPRDILVMTAPVMAKPTRNGQFRPHSRRKNTGHGSNCLIFRL  64
            N+ LC   NLEFLASSSVRPR+ LV+ APV A PTR GQ R HSR K TGHGSN  IF L
Sbjct  6    NHLLCALTNLEFLASSSVRPRESLVIRAPVTANPTRKGQLRFHSRLKKTGHGSNFRIFLL  65

Query  63   GFCTV  49
               T+
Sbjct  66   SSLTL  70



>ref|XP_010095037.1| hypothetical protein L484_026343 [Morus notabilis]
 gb|EXB58143.1| hypothetical protein L484_026343 [Morus notabilis]
Length=101

 Score = 80.1 bits (196),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 45/69 (65%), Gaps = 15/69 (22%)
 Frame = +2

Query  74   MRQFDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTE---------------EDAK  208
            MR+FDPWPVFFRREW RNWPFL GFAITG +ITK SLGLTE               +  K
Sbjct  1    MRKFDPWPVFFRREWNRNWPFLFGFAITGTIITKFSLGLTEAQEALSQDLLNELEQKTEK  60

Query  209  NSKFAQRHK  235
             S+F QR K
Sbjct  61   ASQFPQRKK  69



>tpg|DAA56943.1| TPA: hypothetical protein ZEAMMB73_025607 [Zea mays]
Length=174

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = +2

Query  74   MRQFDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQ  226
            M+ FDPWPVFF REW RN PFL GF ITG +ITKM+   TEED KNSKF Q
Sbjct  1    MKTFDPWPVFFHREWKRNCPFLTGFTITGFIITKMTANFTEEDLKNSKFVQ  51



>tpg|DAA46138.1| TPA: hypothetical protein ZEAMMB73_290343 [Zea mays]
Length=171

 Score = 76.6 bits (187),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +2

Query  74   MRQFDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSK  217
            M+ FDPWPVFF REW RN PFL GF ITG +ITKM+   TEED KNSK
Sbjct  1    MKTFDPWPVFFHREWKRNCPFLTGFTITGFIITKMTANFTEEDLKNSK  48



>ref|XP_008466298.1| PREDICTED: uncharacterized protein LOC103503749 [Cucumis melo]
Length=58

 Score = 73.9 bits (180),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 42/56 (75%), Gaps = 1/56 (2%)
 Frame = +2

Query  74   MRQFDPWP-VFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHKK  238
            MR+FD W  VFFR EW RNWPFL G AIT  +ITKM++G +EE+ KNS F +RH +
Sbjct  1    MRKFDTWSSVFFRPEWKRNWPFLFGVAITSPLITKMTIGFSEEEVKNSPFVKRHSR  56



>ref|XP_006595013.1| PREDICTED: uncharacterized protein LOC100784597 [Glycine max]
Length=121

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +2

Query  74   MRQFDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLT  193
            MR FDPWPVFF+REW RNWPFLVGFA+TG +ITK+SLGL+
Sbjct  1    MRLFDPWPVFFKREWKRNWPFLVGFAVTGTLITKLSLGLS  40



>gb|KHN30201.1| hypothetical protein glysoja_010579 [Glycine soja]
Length=127

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +2

Query  74   MRQFDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLT  193
            MR FDPWPVFF+REW RNWPFLVGFA+TG +ITK+SLGL+
Sbjct  1    MRLFDPWPVFFKREWKRNWPFLVGFAVTGTLITKLSLGLS  40



>tpg|DAA52985.1| TPA: hypothetical protein ZEAMMB73_849058 [Zea mays]
Length=342

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +2

Query  74   MRQFDPWPVFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNS  214
            M+ FDPWPVFF REW RN PFL GF ITG +ITKM+   TEED KNS
Sbjct  1    MKTFDPWPVFFHREWKRNCPFLTGFTITGFIITKMTANFTEEDLKNS  47



>ref|NP_001050635.1| Os03g0606100 [Oryza sativa Japonica Group]
 dbj|BAF12549.1| Os03g0606100 [Oryza sativa Japonica Group]
Length=792

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -2

Query  237  FLCLCANLEFLASSSVRPRDILVMTAPVMAKPTRNGQFRPHSRRKNTGHGSNCL  76
            FLC   NLEFL SSSV+P  ILVM APV AKP R GQ R HS RKNTGHGS  L
Sbjct  666  FLCAWTNLEFLRSSSVKPAVILVMMAPVTAKPVRKGQQRFHSLRKNTGHGSKRL  719



>gb|ACU17172.1| unknown [Glycine max]
Length=128

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = -2

Query  189  RPRDILVMTAPVMAKPTRNGQFRPHSRRKNTGHGSNCLIFRLGF  58
            RPR+ LVM  PV A PT+ GQ R HSR KNTGHGSN LIF   F
Sbjct  78   RPRESLVMRVPVTANPTKKGQLRFHSRLKNTGHGSNSLIFSFPF  121



>tpg|DAA54683.1| TPA: hypothetical protein ZEAMMB73_470909 [Zea mays]
Length=65

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +2

Query  131  PFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHKK  238
            PF+ GFAITG ++ KM+   TEED KNSKF Q HK+
Sbjct  29   PFITGFAITGFIVIKMTTNFTEEDLKNSKFIQEHKR  64



>ref|XP_008662811.1| PREDICTED: uncharacterized protein LOC103641229 [Zea mays]
Length=149

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +2

Query  122  RNWPFLVGFAITGAVITKMSLGLTEEDAKNSKF  220
             +WPF+ GFAITG ++TKM+   TEED KNSKF
Sbjct  90   HHWPFITGFAITGLIVTKMTTNFTEEDLKNSKF  122



>sp|P80497.1|ATPY_SOLTU RecName: Full=ATP synthase 6 kDa subunit, mitochondrial, partial 
[Solanum tuberosum]
Length=25

 Score = 48.1 bits (113),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 22/25 (88%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = +2

Query  74   MRQFDPWPVFFRREWGRNWPFLVGF  148
            MRQFDPWPVFFRREW RN PFLV F
Sbjct  1    MRQFDPWPVFFRREWSRNQPFLVXF  25



>gb|AFW61595.1| hypothetical protein ZEAMMB73_703530 [Zea mays]
Length=369

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  131  PFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHKK  238
            PF+ GFAITG +ITKM+   TEE+ KNSKF Q HK+
Sbjct  333  PFITGFAITGFIITKMTTNFTEENFKNSKFIQEHKR  368



>gb|AFW89750.1| hypothetical protein ZEAMMB73_984028 [Zea mays]
Length=369

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  131  PFLVGFAITGAVITKMSLGLTEEDAKNSKFAQRHKK  238
            PF+ GFAITG +ITKM+   TEE+ KNSKF Q HK+
Sbjct  333  PFITGFAITGFIITKMTTNFTEENFKNSKFIQEHKR  368



>ref|XP_002502480.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO63738.1| predicted protein [Micromonas sp. RCC299]
Length=57

 Score = 46.2 bits (108),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  98   VFFRREWGRNWPFLVGFAITGAVITKMSLGLTEEDAKNSKF  220
            VF  RE  + WPFL GFA+ G  +T+ +LG+TE D K S F
Sbjct  10   VFAAREAKKMWPFLAGFAVVGFGVTQATLGITEADKKKSAF  50



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 669314531515