BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002D23

Length=513
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AFZ41795.1|  putative progesterone 5-beta-reductase                  258   1e-81   Duboisia hopwoodii
gb|AEX31544.1|  putative steroid 5beta-reductase                        257   2e-81   Solanum tuberosum [potatoes]
ref|XP_006353962.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    257   3e-81   
ref|NP_001266103.1|  putative steroid 5beta-reductase                   256   6e-81   
gb|ADG46023.1|  progesterone 5-beta-reductase                           256   6e-81   Atropa belladonna [deadly nightshade]
gb|ADK13080.1|  putative progesterone 5-beta-reductase                  256   6e-81   Nierembergia aristata
gb|ADG41743.1|  putative progesterone 5 beta-reductase                  256   7e-81   Nicotiana tabacum [American tobacco]
ref|XP_009771311.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    256   7e-81   Nicotiana sylvestris
dbj|BAH47641.1|  progesterone 5beta reductase-B                         256   8e-81   Nicotiana tabacum [American tobacco]
ref|XP_009599751.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    256   1e-80   Nicotiana tomentosiformis
gb|AIW09143.1|  progesterone 5-beta-reductase 1                         254   4e-80   Catharanthus roseus [chatas]
gb|ADG56540.1|  progesterone 5-beta-reductase                           249   4e-78   Nerium oleander [rose-bay]
ref|XP_011088171.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    245   1e-76   Sesamum indicum [beniseed]
gb|AIW09144.1|  progesterone 5-beta-reductase 2                         245   1e-76   Catharanthus roseus [chatas]
gb|AEY82379.1|  putative progesterone 5-beta-reductase                  244   2e-76   Withania somnifera [ashwagandha]
ref|XP_011088182.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    244   4e-76   Sesamum indicum [beniseed]
ref|XP_011088183.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    244   4e-76   
ref|XP_002510123.1|  conserved hypothetical protein                     243   1e-75   
ref|XP_009771310.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    243   2e-75   Nicotiana sylvestris
emb|CDO97253.1|  unnamed protein product                                241   6e-75   Coffea canephora [robusta coffee]
ref|XP_002285152.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    241   7e-75   Vitis vinifera
emb|CAD87012.1|  putative progesterone 5-beta-reductase                 241   8e-75   Digitalis obscura [willow-leaf foxglove]
gb|ABA77554.1|  progesterone 5-beta-reductase                           241   8e-75   Digitalis cariensis
gb|AAU88204.1|  progesterone 5-beta-reductase                           241   1e-74   Digitalis ferruginea [rusty foxglove]
gb|AEW67078.1|  putative progesterone 5-beta-reductase                  240   1e-74   Digitalis ferruginea subsp. schischkinii
gb|ABA77555.1|  progesterone 5-beta-reductase                           240   1e-74   Digitalis laevigata
gb|AEW67079.1|  putative progesterone 5-beta-reductase                  240   1e-74   Digitalis trojana
ref|XP_010497523.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    232   1e-74   
gb|AIA58905.1|  putative progesterone 5-beta-reductase                  240   2e-74   Malcolmia maritima
gb|ADG46029.1|  putative progesterone 5-beta-reductase                  239   2e-74   Corchorus capsularis [jute]
gb|ADG46022.1|  progesterone 5-beta-reductase                           239   3e-74   Mentha x piperita
gb|AHZ44506.1|  putative progesterone 5 beta-reductase                  239   3e-74   Iberis amara [bitter candytuft]
gb|AFZ42257.2|  putative progesterone 5-beta-reductase                  239   3e-74   Thymus serpyllum [creeping thyme]
ref|XP_009593701.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    239   4e-74   Nicotiana tomentosiformis
gb|ABB72433.1|  progesterone 5-beta-reductase                           239   4e-74   Digitalis nervosa
gb|AEW67076.1|  putative progesterone 5-beta-reductase                  239   4e-74   Digitalis cariensis
gb|AHI88613.1|  putative steroid 5-beta-reductase                       239   4e-74   Sinapis arvensis [charlock mustard]
gb|AGO01041.1|  putative progesterone 5-beta-reductase                  238   5e-74   Matthiola tricuspidata
ref|XP_010271744.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    238   6e-74   Nelumbo nucifera [Indian lotus]
gb|AGT29342.1|  putative progesterone 5-beta reductase                  238   6e-74   Barbarea vulgaris [upland cress]
ref|XP_006366601.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    238   6e-74   Solanum tuberosum [potatoes]
gb|ABA77560.1|  progesterone 5-beta-reductase                           238   6e-74   Digitalis sibirica
gb|AAS93802.1|  progesterone 5-beta-reductase                           238   6e-74   Digitalis grandiflora
gb|ABA77556.1|  progesterone 5-beta-reductase                           238   7e-74   Digitalis viridiflora
gb|AGT29344.1|  putative progesterone 5-beta reductase 1_2              238   7e-74   Thymus serpyllum [creeping thyme]
gb|ABB36652.1|  progesterone 5beta-reductase                            238   8e-74   Isoplexis chalcantha
gb|ABB36651.1|  progesterone 5beta-reductase                            238   8e-74   Isoplexis canariensis
gb|AAU95076.1|  progesterone 5 beta reductase                           238   9e-74   Digitalis subalpina
gb|AEX31542.1|  putative steroid 5beta-reductase                        238   9e-74   Vitis vinifera
gb|AAS93803.1|  progesterone 5-beta-reductase                           238   1e-73   Digitalis parviflora
sp|Q6PQJ9.1|5BPOR_DIGLA  RecName: Full=3-oxo-Delta(4,5)-steroid 5...    238   1e-73   Digitalis lanata [Grecian foxglove]
gb|AFZ41791.1|  putative progesterone 5-beta-reductase                  238   1e-73   Thymus vulgaris [garden thyme]
emb|CAC80137.1|  progesterone 5-beta-reductase                          238   1e-73   Digitalis purpurea
gb|ABA77558.1|  progesterone 5-beta-reductase                           237   2e-73   Digitalis davisiana
gb|AAS93805.1|  putative progesterone 5-beta-reductase                  237   2e-73   Digitalis purpurea
gb|ADG56545.1|  progesterone 5-beta-reductase                           237   2e-73   Erysimum rhaeticum
ref|XP_006413460.1|  hypothetical protein EUTSA_v10025425mg             237   2e-73   Eutrema salsugineum [saltwater cress]
gb|AFZ41796.1|  putative progesterone 5-beta-reductase                  237   3e-73   Sisymbrium officinale
gb|ABB36654.1|  progesterone 5beta-reductase                            236   3e-73   Isoplexis sceptrum
gb|AIF73578.1|  progesterone 5-beta-reductase                           236   3e-73   Digitalis lanata [Grecian foxglove]
gb|AEW67077.1|  putative progesterone 5-beta-reductase                  236   4e-73   Digitalis lamarckii
gb|AFZ42258.1|  putative progesterone 5-beta-reductase                  236   4e-73   Nasturtium officinale [watercress]
gb|AFW97632.1|  putative progesterone 5-beta-reductase                  236   4e-73   Salvia rosmarinus
gb|ADG56544.1|  progesterone 5-beta-reductase                           236   6e-73   Erysimum crepidifolium
gb|AEO36948.1|  progesterone 5beta-reductase                            236   7e-73   Erysimum capitatum var. purshii
ref|XP_002869731.1|  hypothetical protein ARALYDRAFT_914168             235   1e-72   Arabidopsis lyrata subsp. lyrata
gb|ABA77559.1|  progesterone 5-beta-reductase                           235   2e-72   Digitalis lutea [straw foxglove]
gb|AEO36946.1|  progesterone 5beta-reductase                            235   2e-72   Erysimum scoparium
ref|XP_010448593.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    234   2e-72   
gb|AEO36945.1|  progesterone 5beta-reductase                            235   2e-72   Erysimum albescens
gb|AEZ01594.1|  progesterone 5-beta-reductase                           234   2e-72   Erysimum cheiri [wallflower]
gb|AEZ01593.1|  progesterone 5-beta-reductase                           234   2e-72   Erysimum odoratum
gb|ABF51668.1|  progesterone 5-beta-reductase                           234   2e-72   Digitalis minor var. minor
ref|XP_006283899.1|  hypothetical protein CARUB_v10005016mg             234   2e-72   Capsella rubella
gb|KDP41649.1|  hypothetical protein JCGZ_16056                         234   3e-72   Jatropha curcas
ref|XP_007223026.1|  hypothetical protein PRUPE_ppa006894mg             234   3e-72   
gb|ADG56543.1|  progesterone 5-beta-reductase                           234   3e-72   Erysimum x marshallii
gb|KJB58603.1|  hypothetical protein B456_009G217500                    234   4e-72   Gossypium raimondii
emb|CAN63254.1|  hypothetical protein VITISV_028488                     244   4e-72   Vitis vinifera
ref|NP_001078438.1|  3-oxo-Delta(4,5)-steroid 5-beta-reductase          234   4e-72   Arabidopsis thaliana [mouse-ear cress]
ref|NP_194153.1|  3-oxo-Delta(4,5)-steroid 5-beta-reductase             234   4e-72   Arabidopsis thaliana [mouse-ear cress]
gb|ABB36653.1|  progesterone 5beta-reductase                            234   5e-72   Isoplexis isabelliana
gb|AEY82380.1|  putative progesterone 5-beta-reductase                  233   5e-72   Lunaria annua [honesty]
gb|AHZ44504.1|  putative progesterone 5 beta-reductase                  233   5e-72   Cochlearia officinalis [scurvy-grass]
gb|AAU88205.1|  progesterone 5-beta-reductase                           233   7e-72   Digitalis thapsi
ref|XP_010111562.1|  hypothetical protein L484_011348                   233   7e-72   Morus notabilis
ref|XP_004152001.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    233   8e-72   Cucumis sativus [cucumbers]
gb|AIW09146.1|  progesterone 5-beta-reductase 4                         233   9e-72   Catharanthus roseus [chatas]
ref|XP_006284965.1|  hypothetical protein CARUB_v10006268mg             233   1e-71   Capsella rubella
emb|CAA68126.1|  unnamed protein product                                233   1e-71   Arabidopsis thaliana [mouse-ear cress]
gb|AAU88203.1|  progesterone 5-beta-reductase                           233   1e-71   Digitalis purpurea subsp. heywoodii
gb|AGM16376.1|  putative progesterone 5-beta-reductase                  232   2e-71   Cakile maritima [European sea-rocket]
gb|AEX31541.1|  putative steroid 5beta-reductase                        232   2e-71   Armoracia rusticana [horseradish]
gb|AHI88614.1|  putative progesterone 5-beta-reductase                  232   2e-71   Hesperis matronalis
gb|ADG46028.1|  putative progesterone 5-beta-reductase                  232   2e-71   Calotropis procera
ref|XP_008220298.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    232   2e-71   Prunus mume [ume]
emb|CDY03474.1|  BnaC01g16080D                                          232   3e-71   
gb|AGL96526.1|  putative progesterone 5-beta-reductase                  231   3e-71   Brassica rapa subsp. pekinensis [bai cai]
ref|XP_010059860.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    231   3e-71   Eucalyptus grandis [rose gum]
emb|CDY08911.1|  BnaC08g11410D                                          231   3e-71   Brassica napus [oilseed rape]
gb|ADG56542.1|  progesterone 5-beta-reductase                           231   4e-71   Erysimum capitatum var. purshii
gb|ADG56539.1|  progesterone 5-beta-reductase                           231   4e-71   Hoya carnosa [honeyplant]
gb|AFZ42259.1|  putative progesterone 5-beta-reductase                  231   5e-71   Aethionema grandiflorum
gb|AEO36947.1|  progesterone 5beta-reductase                            231   5e-71   Erysimum caboverdeanum
gb|ADG56538.1|  progesterone 5-beta-reductase                           230   8e-71   Asclepias curassavica
ref|XP_009137807.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    230   9e-71   Brassica rapa
ref|XP_009109253.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    230   9e-71   Brassica rapa
gb|AHZ44508.1|  putative progesterone 5 beta-reductase                  230   9e-71   Stellaria media
ref|XP_004299763.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    230   1e-70   Fragaria vesca subsp. vesca
gb|ADG56546.1|  progesterone 5-beta-reductase                           230   1e-70   Gomphocarpus fruticosus
gb|EYU37597.1|  hypothetical protein MIMGU_mgv11b006498mg               230   1e-70   Erythranthe guttata [common monkey flower]
gb|ABA77557.1|  progesterone 5-beta-reductase                           229   2e-70   Digitalis ciliata
ref|XP_004289734.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    229   2e-70   Fragaria vesca subsp. vesca
gb|KJB58604.1|  hypothetical protein B456_009G217600                    229   2e-70   Gossypium raimondii
gb|AHZ44509.1|  putative progesterone 5 beta-reductase                  229   2e-70   Thlaspi arvense
gb|EPS65468.1|  progesterone 5-beta-reductase                           229   2e-70   Genlisea aurea
gb|AFN22088.1|  putative progesterone 5-beta-reductase                  229   2e-70   Draba aizoides
gb|AGT29341.1|  putative progesterone 5-beta reductase                  229   3e-70   Cardamine pratensis [cuckoo flower]
gb|EYU37596.1|  hypothetical protein MIMGU_mgv1a007982mg                229   3e-70   Erythranthe guttata [common monkey flower]
gb|AJE29749.1|  putative progesterone 5-beta-reductase                  229   4e-70   Cucurbita pepo
ref|XP_008356369.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    229   4e-70   
ref|XP_008447374.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    229   4e-70   Cucumis melo [Oriental melon]
ref|XP_008393755.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    228   5e-70   
ref|XP_006847874.1|  hypothetical protein AMTR_s00029p00093020          228   5e-70   Amborella trichopoda
ref|XP_003638459.1|  Progesterone 5-beta-reductase                      228   6e-70   
ref|XP_007136738.1|  hypothetical protein PHAVU_009G070100g             225   7e-70   Phaseolus vulgaris [French bean]
gb|KDO81569.1|  hypothetical protein CISIN_1g0159921mg                  228   8e-70   Citrus sinensis [apfelsine]
gb|AFZ41789.1|  putative progesterone 5-beta-reductase                  228   9e-70   Raphanus sativus
ref|XP_011088173.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    227   9e-70   
gb|AGN74845.1|  putative enone 5-beta-reductase                         228   9e-70   Lepidium sativum
gb|AHZ44505.1|  putative progesterone 5 beta-reductase                  227   1e-69   Draba verna
ref|XP_009360382.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    227   1e-69   Pyrus x bretschneideri [bai li]
ref|XP_008393756.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    227   1e-69   
gb|KDO81568.1|  hypothetical protein CISIN_1g0159921mg                  227   1e-69   Citrus sinensis [apfelsine]
ref|XP_008360976.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    227   2e-69   
gb|KDO81567.1|  hypothetical protein CISIN_1g0159921mg                  227   2e-69   Citrus sinensis [apfelsine]
ref|XP_010277137.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    227   2e-69   Nelumbo nucifera [Indian lotus]
ref|XP_006433602.1|  hypothetical protein CICLE_v10001370mg             227   2e-69   Citrus clementina [clementine]
ref|XP_003598452.1|  Progesterone 5-beta-reductase                      226   4e-69   Medicago truncatula
ref|XP_009360365.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    226   4e-69   Pyrus x bretschneideri [bai li]
ref|XP_007136737.1|  hypothetical protein PHAVU_009G070100g             226   5e-69   Phaseolus vulgaris [French bean]
gb|AFW16644.1|  putative progesterone 5beta-reductase                   226   6e-69   Passiflora incarnata
ref|XP_010521424.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    225   1e-68   
ref|XP_008377976.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    225   1e-68   
ref|XP_003636813.1|  Progesterone 5-beta-reductase                      225   1e-68   
ref|XP_003525919.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    224   1e-68   Glycine max [soybeans]
ref|XP_006374844.1|  hypothetical protein POPTR_0014s01970g             224   2e-68   
gb|ABK95134.1|  unknown                                                 224   2e-68   Populus trichocarpa [western balsam poplar]
gb|ABK96780.1|  unknown                                                 224   2e-68   Populus trichocarpa x Populus deltoides
ref|XP_010530504.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    224   3e-68   Tarenaya hassleriana [spider flower]
gb|ADG46027.1|  putative progesterone 5-beta-reductase                  224   4e-68   Coffea arabica [arabica coffee]
ref|XP_008236416.1|  PREDICTED: LOW QUALITY PROTEIN: 3-oxo-Delta(...    224   4e-68   
ref|XP_011092523.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    223   4e-68   Sesamum indicum [beniseed]
ref|XP_011029002.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    223   5e-68   Populus euphratica
gb|AFK42748.1|  unknown                                                 223   5e-68   Medicago truncatula
ref|XP_011017140.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    223   6e-68   Populus euphratica
ref|XP_006367946.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    223   6e-68   Solanum tuberosum [potatoes]
ref|XP_007201077.1|  hypothetical protein PRUPE_ppa006872mg             223   7e-68   Prunus persica
ref|XP_011016706.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    223   7e-68   Populus euphratica
ref|XP_006433107.1|  hypothetical protein CICLE_v10001388mg             223   9e-68   Citrus clementina [clementine]
ref|XP_009354120.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    223   9e-68   
ref|XP_003638458.1|  Progesterone 5-beta-reductase                      223   1e-67   
pdb|2V6F|A  Chain A, Structure Of Progesterone 5beta-Reductase Fr...    222   1e-67   Digitalis lanata [Grecian foxglove]
gb|AIW09145.1|  progesterone 5-beta-reductase 3                         222   2e-67   Catharanthus roseus [chatas]
gb|KJB29426.1|  hypothetical protein B456_005G100200                    221   3e-67   Gossypium raimondii
ref|XP_002272271.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    221   3e-67   Vitis vinifera
ref|XP_006472269.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    221   3e-67   Citrus sinensis [apfelsine]
gb|AFK45113.1|  unknown                                                 221   3e-67   Medicago truncatula
ref|XP_006387422.1|  hypothetical protein POPTR_1058s00200g             221   4e-67   
gb|AHZ44507.1|  putative progesterone 5 beta-reductase                  221   4e-67   Isatis tinctoria [woad]
ref|XP_007018551.1|  NAD(P)-binding Rossmann-fold superfamily pro...    220   8e-67   
ref|XP_003636810.1|  Progesterone 5-beta-reductase                      229   8e-67   
gb|AAO63776.1|  unknown                                                 219   2e-66   Populus tremuloides
ref|XP_006433101.1|  hypothetical protein CICLE_v10001374mg             219   2e-66   Citrus clementina [clementine]
ref|XP_006471790.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    219   2e-66   Citrus sinensis [apfelsine]
ref|XP_006433105.1|  hypothetical protein CICLE_v10001393mg             219   2e-66   Citrus clementina [clementine]
ref|XP_006471792.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    219   2e-66   Citrus sinensis [apfelsine]
ref|XP_006432526.1|  hypothetical protein CICLE_v10001422mg             218   6e-66   
ref|XP_006374846.1|  hypothetical protein POPTR_0014s01980g             217   6e-66   
ref|XP_006374845.1|  hypothetical protein POPTR_0014s01980g             217   6e-66   
ref|XP_006432524.1|  hypothetical protein CICLE_v10001422mg             218   7e-66   Citrus clementina [clementine]
ref|XP_004501803.1|  PREDICTED: uncharacterized protein LOC101510608    226   8e-66   
ref|XP_007223050.1|  hypothetical protein PRUPE_ppa006944mg             217   1e-65   
ref|XP_002518657.1|  conserved hypothetical protein                     217   1e-65   Ricinus communis
gb|AFZ41790.1|  putative progesterone 5-beta-reductase                  217   1e-65   Spinacia oleracea
ref|XP_006432522.1|  hypothetical protein CICLE_v100016291mg            212   2e-65   
ref|XP_006471787.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    216   2e-65   Citrus sinensis [apfelsine]
ref|XP_009360311.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    216   4e-65   Pyrus x bretschneideri [bai li]
ref|XP_009360316.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    216   4e-65   Pyrus x bretschneideri [bai li]
ref|XP_006386483.1|  hypothetical protein POPTR_0002s12150g             216   4e-65   
ref|XP_011022580.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    216   5e-65   Populus euphratica
ref|XP_004248770.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    215   7e-65   Solanum lycopersicum
ref|XP_006432523.1|  hypothetical protein CICLE_v10001412mg             215   8e-65   Citrus clementina [clementine]
ref|XP_006471285.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    215   8e-65   Citrus sinensis [apfelsine]
ref|XP_011069776.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    214   1e-64   Sesamum indicum [beniseed]
ref|XP_002304533.1|  hypothetical protein POPTR_0003s13440g             214   1e-64   Populus trichocarpa [western balsam poplar]
ref|XP_006495338.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    209   2e-64   Citrus sinensis [apfelsine]
ref|XP_007222999.1|  hypothetical protein PRUPE_ppa006780mg             214   2e-64   
ref|XP_004300685.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    213   3e-64   Fragaria vesca subsp. vesca
ref|XP_011028990.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    213   3e-64   Populus euphratica
ref|XP_006471280.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    213   3e-64   Citrus sinensis [apfelsine]
ref|XP_008351978.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    213   5e-64   Malus domestica [apple tree]
ref|XP_008367783.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    212   7e-64   
ref|XP_007223008.1|  hypothetical protein PRUPE_ppa006816mg             212   1e-63   
emb|CDP01226.1|  unnamed protein product                                211   1e-63   Coffea canephora [robusta coffee]
ref|XP_006432505.1|  hypothetical protein CICLE_v10001414mg             212   1e-63   Citrus clementina [clementine]
gb|AFW16645.1|  putative progesterone 5beta-reductase                   212   1e-63   Bupleurum falcatum
ref|XP_006495229.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    212   2e-63   Citrus sinensis [apfelsine]
ref|XP_011017142.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    211   2e-63   Populus euphratica
ref|XP_006374842.1|  hypothetical protein POPTR_0014s01950g             211   2e-63   
ref|XP_011017141.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    211   2e-63   Populus euphratica
ref|XP_006450012.1|  hypothetical protein CICLE_v10013989mg             211   4e-63   Citrus clementina [clementine]
ref|XP_002302422.2|  hypothetical protein POPTR_0002s12170g             209   1e-62   
ref|XP_008220361.1|  PREDICTED: uncharacterized protein LOC103320460    216   2e-62   Prunus mume [ume]
ref|XP_007042587.1|  Progesterone 5-beta-reductase, putative isof...    208   3e-62   
gb|ABD33275.2|  progesterone 5-beta-reductase, putative                 208   3e-62   Medicago truncatula
ref|XP_007042586.1|  Progesterone 5-beta-reductase, putative isof...    209   3e-62   
ref|XP_006432520.1|  hypothetical protein CICLE_v10003925mg             209   4e-62   
gb|AHC23071.1|  putative progesterone 5beta-reductase                   206   6e-62   Thymus x citriodorus
ref|XP_004499012.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    207   7e-62   Cicer arietinum [garbanzo]
ref|XP_003589112.1|  hypothetical protein MTR_1g018610                  208   7e-62   
ref|XP_006420622.1|  hypothetical protein CICLE_v10006945mg             207   7e-62   
gb|AHI88616.2|  progesterone 5-beta-reductase                           207   7e-62   Capsella bursa-pastoris
gb|AHC23070.1|  putative progesterone 5beta-reductase                   206   8e-62   Thymus x citriodorus
gb|ABD93571.1|  developmental process IMP                               200   9e-62   Solanum lycopersicum
ref|XP_010556421.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    207   9e-62   Tarenaya hassleriana [spider flower]
gb|AHC23069.1|  putative progesterone 5beta-reductase                   206   9e-62   Thymus x citriodorus
ref|XP_010556422.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    207   1e-61   Tarenaya hassleriana [spider flower]
ref|XP_007226426.1|  hypothetical protein PRUPE_ppa023813mg             206   1e-61   
ref|XP_010673631.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    205   6e-61   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006471279.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    203   3e-60   Citrus sinensis [apfelsine]
ref|XP_006432519.1|  hypothetical protein CICLE_v10001420mg             203   3e-60   Citrus clementina [clementine]
gb|AHI88615.1|  putative progesterone 5-beta-reductase                  203   4e-60   Tarenaya spinosa
ref|XP_006489807.1|  PREDICTED: uncharacterized protein LOC102610524    209   7e-60   
ref|XP_006472268.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    202   7e-60   Citrus sinensis [apfelsine]
ref|XP_006472267.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    202   8e-60   Citrus sinensis [apfelsine]
ref|XP_006433601.1|  hypothetical protein CICLE_v10001445mg             202   9e-60   Citrus clementina [clementine]
gb|ABK24388.1|  unknown                                                 201   1e-59   Picea sitchensis
gb|KJB32255.1|  hypothetical protein B456_005G233200                    201   2e-59   Gossypium raimondii
gb|ABD33273.2|  VEP1 , putative                                         201   3e-59   Medicago truncatula
ref|XP_003589110.1|  hypothetical protein MTR_1g018590                  201   3e-59   
gb|AES59361.2|  3-oxo-delta(4,5)-steroid 5-beta-reductase-like pr...    200   4e-59   Medicago truncatula
gb|KHN21407.1|  Hypothetical protein glysoja_042470                     197   5e-59   Glycine soja [wild soybean]
ref|XP_006374843.1|  hypothetical protein POPTR_0014s01960g             199   8e-59   
ref|XP_006387765.1|  hypothetical protein POPTR_0602s00210g             199   8e-59   
gb|ABK96579.1|  unknown                                                 199   1e-58   Populus trichocarpa x Populus deltoides
gb|ABR16676.1|  unknown                                                 198   3e-58   Picea sitchensis
ref|XP_006387764.1|  hypothetical protein POPTR_0602s00200g             199   3e-58   
ref|XP_006432518.1|  hypothetical protein CICLE_v10003867mg             196   4e-58   
gb|ABK24243.1|  unknown                                                 197   6e-58   Picea sitchensis
ref|XP_008790634.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    197   8e-58   Phoenix dactylifera
gb|KHG08322.1|  Uncharacterized protein F383_14595                      196   2e-57   Gossypium arboreum [tree cotton]
ref|XP_011042197.1|  PREDICTED: uncharacterized protein LOC105137942    201   7e-57   Populus euphratica
gb|ABR16709.1|  unknown                                                 194   1e-56   Picea sitchensis
ref|XP_008790041.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    193   3e-56   Phoenix dactylifera
ref|XP_010939097.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    194   6e-56   
gb|KJB83175.1|  hypothetical protein B456_013G233500                    190   2e-55   Gossypium raimondii
ref|XP_010099074.1|  hypothetical protein L484_011508                   187   2e-54   
ref|XP_010905260.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    186   2e-53   Elaeis guineensis
ref|XP_010905261.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    186   2e-53   Elaeis guineensis
gb|AFD96485.1|  putative enone 5-beta-reductase                         185   3e-53   Brassica oleracea var. gemmifera
ref|XP_010905259.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    185   4e-53   Elaeis guineensis
ref|XP_010687527.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    184   8e-53   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006379172.1|  hypothetical protein POPTR_0009s09500g             177   1e-52   
ref|XP_009137433.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    183   1e-52   Brassica rapa
emb|CBI22490.3|  unnamed protein product                                180   8e-52   Vitis vinifera
emb|CDY10994.1|  BnaA03g46530D                                          180   1e-51   Brassica napus [oilseed rape]
emb|CDX92623.1|  BnaC07g38810D                                          179   5e-51   
ref|XP_009396895.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    179   1e-50   Musa acuminata subsp. malaccensis [pisang utan]
gb|AIW09147.1|  progesterone 5-beta-reductase 5                         177   4e-50   Catharanthus roseus [chatas]
sp|K7WDL7.1|IRIS_CATRO  RecName: Full=Iridoid synthase                  175   2e-49   Catharanthus roseus [chatas]
gb|AHA82033.1|  iridoid synthase                                        174   2e-49   Catharanthus roseus [chatas]
ref|XP_010520747.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    174   5e-49   Tarenaya hassleriana [spider flower]
gb|AGN74846.1|  putative enone 5-beta-reductase                         173   9e-49   Brassica juncea var. juncea
ref|XP_009406008.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    172   4e-48   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDP01225.1|  unnamed protein product                                171   5e-48   Coffea canephora [robusta coffee]
gb|KDO36382.1|  hypothetical protein CISIN_1g046987mg                   160   1e-46   Citrus sinensis [apfelsine]
ref|XP_009394340.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    166   6e-46   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009394339.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    166   7e-46   
emb|CDM86919.1|  unnamed protein product                                164   2e-45   
gb|ADL28122.1|  putative progesterone 5-beta-reductase 2                164   3e-45   
gb|ACZ66261.1|  progesterone 5beta-reductase 2                          162   1e-44   
ref|XP_006665039.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    162   2e-44   
tpg|DAA45880.1|  TPA: hypothetical protein ZEAMMB73_620077              160   5e-44   
ref|XP_002465092.1|  hypothetical protein SORBIDRAFT_01g031950          160   8e-44   
ref|XP_003562377.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    159   3e-43   
ref|XP_002967522.1|  hypothetical protein SELMODRAFT_86462              157   7e-43   
dbj|BAJ93442.1|  predicted protein                                      157   1e-42   
ref|XP_002960184.1|  hypothetical protein SELMODRAFT_74145              157   1e-42   
ref|XP_002981288.1|  hypothetical protein SELMODRAFT_444825             157   1e-42   
dbj|BAK04809.1|  predicted protein                                      157   1e-42   
ref|XP_002969677.1|  hypothetical protein SELMODRAFT_92604              157   1e-42   
gb|ABD33272.2|  hypothetical protein MtrDRAFT_AC158501g31v2             156   2e-42   
ref|XP_002967521.1|  hypothetical protein SELMODRAFT_86439              156   2e-42   
ref|XP_001754205.1|  predicted protein                                  154   2e-41   
gb|EAY90583.1|  hypothetical protein OsI_12184                          154   3e-41   
ref|XP_007201878.1|  hypothetical protein PRUPE_ppa009693mg             150   3e-41   
ref|XP_002960090.1|  hypothetical protein SELMODRAFT_74346              152   4e-41   
ref|NP_001050440.1|  Os03g0436400                                       152   6e-41   
ref|XP_006339461.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    152   1e-40   
ref|XP_004983958.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    150   4e-40   
ref|XP_009762620.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    150   5e-40   
emb|CDM86889.1|  unnamed protein product                                149   8e-40   
ref|XP_003589109.1|  hypothetical protein MTR_1g018580                  147   4e-39   
ref|XP_004229838.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    145   3e-38   
dbj|BAH57049.1|  AT4G24220                                              144   5e-38   
ref|NP_001167740.1|  hypothetical protein                               143   3e-37   
ref|XP_002984047.1|  hypothetical protein SELMODRAFT_234421             142   3e-37   
ref|XP_002449263.1|  hypothetical protein SORBIDRAFT_05g006930          142   6e-37   
ref|XP_008657260.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    141   1e-36   
ref|XP_004983959.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    140   2e-36   
ref|XP_010099073.1|  hypothetical protein L484_011507                   131   3e-33   
gb|ACE96881.1|  putative protein                                        127   2e-32   
gb|ACE96889.1|  putative protein                                        127   3e-32   
gb|ACE96904.1|  putative protein                                        125   3e-31   
gb|ACE96903.1|  putative protein                                        124   3e-31   
ref|XP_011037153.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    125   1e-30   
ref|XP_006855299.1|  hypothetical protein AMTR_s00057p00056400          120   2e-30   
ref|XP_010649532.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    120   4e-29   
ref|XP_009787618.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    120   5e-29   
ref|XP_006372881.1|  hypothetical protein POPTR_0017s05940g             119   8e-29   
gb|ABK96577.1|  unknown                                                 118   3e-28   
ref|XP_006372880.1|  hypothetical protein POPTR_0017s05930g             117   4e-28   
ref|XP_004983960.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    117   4e-28   
ref|XP_002276159.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    117   5e-28   
ref|XP_011037089.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    117   5e-28   
ref|XP_006443046.1|  hypothetical protein CICLE_v10020613mg             117   6e-28   
ref|XP_006478687.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    117   7e-28   
ref|XP_002991995.1|  hypothetical protein SELMODRAFT_448625             117   7e-28   
ref|NP_001060201.2|  Os07g0601600                                       117   8e-28   
ref|XP_007154725.1|  hypothetical protein PHAVU_003G142200g             117   9e-28   
ref|XP_006443047.1|  hypothetical protein CICLE_v10023804mg             116   1e-27   
ref|XP_009603666.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    116   1e-27   
gb|KDO47326.1|  hypothetical protein CISIN_1g0282581mg                  112   2e-27   
ref|XP_006443045.1|  hypothetical protein CICLE_v10020568mg             115   3e-27   
ref|XP_007207642.1|  hypothetical protein PRUPE_ppa021134mg             115   4e-27   
ref|XP_006478688.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    115   4e-27   
gb|KHN02917.1|  Hypothetical protein glysoja_009783                     114   5e-27   
ref|XP_003529541.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    114   6e-27   
ref|XP_002991996.1|  hypothetical protein SELMODRAFT_448626             114   7e-27   
ref|XP_002277965.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    114   8e-27   
ref|XP_002989828.1|  hypothetical protein SELMODRAFT_160458             114   9e-27   
ref|XP_002991994.1|  hypothetical protein SELMODRAFT_186462             114   9e-27   
gb|AHA84141.1|  3-oxo-delta(4,5)-steroid 5-beta-reductase               114   1e-26   
ref|XP_007154348.1|  hypothetical protein PHAVU_003G111200g             114   1e-26   
gb|AIW09148.1|  progesterone 5-beta-reductase 6                         113   1e-26   
ref|XP_007154349.1|  hypothetical protein PHAVU_003G111300g             113   2e-26   
ref|XP_008221108.1|  PREDICTED: iridoid synthase                        113   2e-26   
gb|KDO36488.1|  hypothetical protein CISIN_1g042242mg                   111   3e-26   
ref|XP_006488686.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    112   5e-26   
ref|XP_011069777.1|  PREDICTED: iridoid synthase-like                   112   5e-26   
ref|XP_002989827.1|  hypothetical protein SELMODRAFT_235888             111   7e-26   
gb|KDO53351.1|  hypothetical protein CISIN_1g045430mg                   110   8e-26   
ref|XP_006425059.1|  hypothetical protein CICLE_v10030323mg             111   1e-25   
ref|XP_010043435.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    110   1e-25   
ref|XP_009371502.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    109   4e-25   
gb|KDO66878.1|  hypothetical protein CISIN_1g0376631mg                  107   6e-25   
ref|XP_008384807.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    108   6e-25   
ref|XP_009120390.1|  PREDICTED: iridoid synthase                        108   7e-25   
ref|XP_009347565.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    108   7e-25   
ref|XP_002960183.1|  hypothetical protein SELMODRAFT_402259             108   8e-25   
ref|XP_004295755.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    108   1e-24   
ref|XP_007016112.1|  NAD(P)-binding Rossmann-fold superfamily pro...    108   1e-24   
ref|XP_010685564.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    107   1e-24   
emb|CDY67905.1|  BnaCnng56900D                                          107   2e-24   
emb|CDY52126.1|  BnaA10g29550D                                          107   3e-24   
gb|AGO01040.1|  putative progesterone 5-beta-reductase                  107   3e-24   
ref|XP_008457377.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    106   4e-24   
gb|KEH34249.1|  3-oxo-delta(4,5)-steroid 5-beta-reductase-like pr...    106   4e-24   
ref|XP_008457376.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    106   4e-24   
ref|XP_004145319.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    106   5e-24   
ref|XP_003607179.1|  hypothetical protein MTR_4g073090                  105   8e-24   
ref|XP_003609735.1|  hypothetical protein MTR_4g121570                  105   8e-24   
ref|XP_010092100.1|  hypothetical protein L484_001148                   104   1e-23   
ref|XP_011080861.1|  PREDICTED: iridoid synthase                        105   1e-23   
ref|WP_039454192.1|  NAD-dependent dehydratase                          102   1e-23   
ref|XP_011032121.1|  PREDICTED: iridoid synthase                        105   1e-23   
gb|AAM36940.1|  conserved hypothetical protein                          104   2e-23   
gb|EMT09140.1|  hypothetical protein F775_25898                         104   2e-23   
ref|XP_010259353.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    103   3e-23   
gb|EYU45727.1|  hypothetical protein MIMGU_mgv1a018609mg                103   3e-23   
ref|WP_019300231.1|  NAD dependent epimerase/dehydratase                103   3e-23   
ref|WP_019303656.1|  NAD dependent epimerase/dehydratase                103   3e-23   
ref|XP_010098784.1|  hypothetical protein L484_000585                   103   4e-23   
ref|WP_010378792.1|  NAD dependent epimerase/dehydratase                103   5e-23   
ref|WP_024745109.1|  NAD-dependent dehydratase                          102   7e-23   
gb|KJB51009.1|  hypothetical protein B456_008G197000                    102   8e-23   
gb|KDP46500.1|  hypothetical protein JCGZ_08472                         102   8e-23   
ref|NP_200683.1|  NAD(P)-binding Rossmann-fold superfamily protein      102   9e-23   
ref|WP_039434936.1|  NAD-dependent dehydratase                          102   9e-23   
ref|WP_002802208.1|  hypothetical protein                               102   1e-22   
ref|WP_029219948.1|  NAD-dependent dehydratase                          102   1e-22   
ref|XP_004500265.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    102   1e-22   
ref|WP_017118699.1|  NAD dependent epimerase/dehydratase                102   1e-22   
ref|WP_034486429.1|  NAD-dependent dehydratase                          102   1e-22   
ref|WP_015073026.1|  oxidoreductase                                     102   1e-22   
gb|AGT29343.1|  putative progesterone 5-beta reductase                  102   1e-22   
ref|XP_006280672.1|  hypothetical protein CARUB_v10026635mg             102   2e-22   
ref|WP_007963504.1|  NAD dependent epimerase/dehydratase                101   2e-22   
ref|WP_007971235.1|  NAD dependent epimerase/dehydratase                101   2e-22   
ref|WP_017166275.1|  NAD dependent epimerase/dehydratase                101   2e-22   
ref|WP_022559177.1|  MULTISPECIES: hypothetical protein                 101   2e-22   
ref|XP_006401046.1|  hypothetical protein EUTSA_v10015494mg             101   2e-22   
ref|WP_017156613.1|  NAD dependent epimerase/dehydratase                101   2e-22   
ref|XP_002313382.2|  hypothetical protein POPTR_0009s05030g             101   2e-22   
ref|WP_015463169.1|  MULTISPECIES: hypothetical protein                 101   2e-22   
ref|WP_029819497.1|  NAD-dependent dehydratase                          101   2e-22   
ref|WP_011347453.1|  NAD dependent epimerase/dehydratase                101   2e-22   
ref|WP_033483167.1|  NAD-dependent dehydratase                          101   2e-22   
ref|WP_031422845.1|  NAD-dependent dehydratase                          101   2e-22   
ref|WP_014090247.1|  NAD dependent epimerase/dehydratase                101   2e-22   
ref|WP_008576655.1|  NAD dependent epimerase/dehydratase                101   3e-22   
ref|WP_042599156.1|  NAD-dependent dehydratase                          100   3e-22   
ref|XP_003609737.1|  hypothetical protein MTR_4g121590                  100   5e-22   
ref|WP_007281813.1|  oxidoreductase                                     100   5e-22   
ref|WP_010373324.1|  NAD dependent epimerase/dehydratase                100   5e-22   
ref|WP_014507837.1|  NAD dependent epimerase/dehydratase                100   6e-22   
gb|KFK27399.1|  hypothetical protein AALP_AA8G378100                    100   7e-22   
ref|XP_010272810.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    100   7e-22   
ref|XP_010272811.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    100   7e-22   
gb|KGK58255.1|  NAD-dependent dehydratase                               100   7e-22   
ref|WP_039409071.1|  NAD-dependent dehydratase                          100   7e-22   
ref|WP_005916734.1|  MULTISPECIES: hypothetical protein                 100   7e-22   
ref|WP_039586834.1|  NAD-dependent dehydratase                          100   8e-22   
ref|WP_005929774.1|  MULTISPECIES: NAD dependent epimerase/dehydr...    100   8e-22   
ref|WP_039577579.1|  NAD-dependent dehydratase                          100   8e-22   
ref|WP_042822590.1|  NAD-dependent dehydratase                        99.8    8e-22   
ref|XP_010454212.1|  PREDICTED: iridoid synthase-like isoform X1        100   9e-22   
ref|XP_010454219.1|  PREDICTED: iridoid synthase-like isoform X2      99.8    9e-22   
gb|KHN06235.1|  Hypothetical protein glysoja_030301                   99.8    1e-21   
ref|WP_006449597.1|  NAD dependent epimerase/dehydratase              99.4    1e-21   
ref|WP_023904087.1|  hypothetical protein                             99.4    1e-21   
ref|WP_002631381.1|  Nucleoside diphosphate sugar epimerase           99.4    1e-21   
ref|XP_010443624.1|  PREDICTED: iridoid synthase                      99.4    2e-21   
ref|XP_010483479.1|  PREDICTED: iridoid synthase-like                 99.0    2e-21   
ref|WP_039527127.1|  NAD-dependent dehydratase                        99.0    2e-21   
ref|XP_003552956.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...  99.0    2e-21   
ref|WP_039521715.1|  NAD-dependent dehydratase                        99.0    2e-21   
ref|WP_012438234.1|  NAD dependent epimerase/dehydratase              99.0    2e-21   
ref|WP_016902584.1|  NAD dependent epimerase/dehydratase              99.0    2e-21   
ref|WP_011037275.1|  NAD dependent epimerase/dehydratase              99.0    2e-21   
ref|XP_010104633.1|  hypothetical protein L484_022010                 99.0    2e-21   
dbj|GAE56516.1|  hypothetical protein XPR_3151                        98.6    2e-21   
ref|WP_039815830.1|  NAD-dependent dehydratase                        98.6    3e-21   
ref|WP_024938681.1|  NAD-dependent dehydratase                        98.6    3e-21   
ref|WP_039514425.1|  NAD-dependent dehydratase                        98.2    3e-21   
ref|WP_034880753.1|  NAD-dependent dehydratase                        98.2    3e-21   
gb|KJB34689.1|  hypothetical protein B456_006G078700                  97.4    4e-21   
ref|WP_035225966.1|  NAD-dependent dehydratase                        97.8    4e-21   
ref|XP_010520208.1|  PREDICTED: iridoid synthase isoform X2           97.8    4e-21   
ref|WP_019366346.1|  NAD dependent epimerase/dehydratase              97.8    4e-21   
ref|WP_010795227.1|  hypothetical protein                             97.8    5e-21   
ref|XP_002864587.1|  hypothetical protein ARALYDRAFT_496000           97.8    6e-21   
ref|XP_010520207.1|  PREDICTED: iridoid synthase isoform X1           97.8    6e-21   
ref|XP_010671934.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...  97.4    7e-21   
dbj|GAD10412.1|  hypothetical protein GFGA_1d0521                     98.2    7e-21   
ref|WP_010503124.1|  oxidoreductase                                   97.1    7e-21   
ref|XP_006841588.1|  hypothetical protein AMTR_s00003p00199110        97.1    1e-20   
ref|WP_022974216.1|  NAD dependent epimerase/dehydratase              96.7    1e-20   
ref|XP_006848213.1|  hypothetical protein AMTR_s00029p00242940        97.1    1e-20   
gb|KGB25251.1|  Nucleoside-diphosphate-sugar epimerase                94.7    2e-20   
ref|XP_002525638.1|  conserved hypothetical protein                   96.3    2e-20   
ref|XP_007146765.1|  hypothetical protein PHAVU_006G067800g           96.3    2e-20   
ref|WP_010342645.1|  NAD dependent epimerase/dehydratase              96.3    2e-20   
ref|WP_043095840.1|  NAD-dependent dehydratase                        95.9    2e-20   
ref|WP_005995663.1|  NAD dependent epimerase/dehydratase              95.9    2e-20   
ref|WP_017912517.1|  NAD dependent epimerase/dehydratase              95.9    2e-20   
gb|KDO36187.1|  hypothetical protein CISIN_1g037566mg                 95.9    2e-20   
ref|WP_015247641.1|  NAD dependent epimerase/dehydratase              95.5    3e-20   
ref|WP_037204462.1|  NAD-dependent dehydratase                        95.5    3e-20   
ref|WP_039420711.1|  NAD-dependent dehydratase                        95.1    4e-20   
ref|WP_044001184.1|  NAD-dependent dehydratase                        95.1    4e-20   
ref|WP_017638618.1|  NAD dependent epimerase/dehydratase              94.4    6e-20   
ref|XP_004508264.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...  94.7    7e-20   
dbj|GAL96441.1|  NAD dependent epimerase/dehydratase                  94.4    7e-20   
gb|EMT17902.1|  hypothetical protein F775_30194                       94.4    7e-20   
ref|WP_009593554.1|  Putative secreted protein                        94.4    7e-20   
ref|WP_003474153.1|  hypothetical protein                             94.4    7e-20   
ref|WP_021207631.1|  NAD dependent epimerase/dehydratase              94.4    7e-20   
gb|EXF43104.1|  NAD-dependent epimerase/dehydratase                   92.8    8e-20   
gb|AAP20856.1|  hypothetical protein OSJNBa0032H19.30                 94.0    8e-20   
gb|ABF96680.1|  progesterone 5-beta-reductase, putative               94.0    8e-20   
ref|WP_003472785.1|  hypothetical protein                             94.4    8e-20   
dbj|BAP31603.1|  nucleoside-diphosphate sugar epimerase               94.4    8e-20   
ref|WP_023445534.1|  MULTISPECIES: NAD dependent epimerase/dehydr...  94.0    9e-20   
ref|WP_037157291.1|  NAD-dependent dehydratase                        94.0    9e-20   
ref|WP_003292185.1|  NAD-dependent epimerase/dehydratase              94.0    9e-20   
emb|CBI19431.3|  unnamed protein product                              90.9    1e-19   
emb|CAQ43088.1|  hypothetical protein                                 94.0    1e-19   
gb|EEE59280.1|  hypothetical protein OsJ_11316                        94.4    1e-19   
ref|WP_031357998.1|  NAD-dependent dehydratase                        94.0    1e-19   
ref|XP_006591658.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...  93.6    1e-19   
ref|WP_037198014.1|  NAD-dependent dehydratase                        93.6    1e-19   
ref|NP_001050389.2|  Os03g0422600                                     93.6    1e-19   
ref|WP_042137883.1|  NAD-dependent dehydratase                        93.2    2e-19   
ref|WP_027601512.1|  MULTISPECIES: NAD-dependent dehydratase          93.2    2e-19   
ref|WP_034798529.1|  NAD-dependent dehydratase                        93.2    2e-19   
gb|EEC75505.1|  hypothetical protein OsI_12105                        92.8    2e-19   
gb|KHN22842.1|  Hypothetical protein glysoja_048138                   93.6    2e-19   
ref|WP_017909301.1|  NAD dependent epimerase/dehydratase              92.8    2e-19   



>gb|AFZ41795.1| putative progesterone 5-beta-reductase [Duboisia hopwoodii]
Length=388

 Score =   258 bits (660),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 119/143 (83%), Positives = 132/143 (92%), Gaps = 0/143 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
             EEDDAPPKY+SVALI+GVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI
Sbjct  16   FEEDDAPPKYESVALIIGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            EYIQCDI N+ED QSKLSVLTDVTHVFYVTW +R+ E +NCE NGKM +NV++ IIP+CP
Sbjct  76   EYIQCDISNTEDTQSKLSVLTDVTHVFYVTWASRSTEVENCEINGKMFQNVLSVIIPNCP  135

Query  445  NLQHICLQTGRKHYIGPWESYLK  513
            NL+HICLQTGRKHY+GP+E Y K
Sbjct  136  NLRHICLQTGRKHYLGPFELYGK  158



>gb|AEX31544.1| putative steroid 5beta-reductase [Solanum tuberosum]
Length=387

 Score =   257 bits (657),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 118/143 (83%), Positives = 131/143 (92%), Gaps = 0/143 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
             EED+APPKY+SVALI+GVTGIVGNSLAEILPLADTPGGPWKVYGVARR RPSWNADHPI
Sbjct  15   FEEDEAPPKYESVALIIGVTGIVGNSLAEILPLADTPGGPWKVYGVARRARPSWNADHPI  74

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            EY+QCDI N ED QSKLSVLTDVTHVFYVTW NR++E +NCE NGKM RNV+N IIP+CP
Sbjct  75   EYVQCDISNPEDTQSKLSVLTDVTHVFYVTWANRSKEVENCEINGKMFRNVLNVIIPNCP  134

Query  445  NLQHICLQTGRKHYIGPWESYLK  513
            +L+HICLQTGRKHY+GP+E Y K
Sbjct  135  HLRHICLQTGRKHYLGPFELYGK  157



>ref|XP_006353962.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Solanum 
tuberosum]
Length=388

 Score =   257 bits (657),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 118/143 (83%), Positives = 131/143 (92%), Gaps = 0/143 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
             EED+APPKY+SVALI+GVTGIVGNSLAEILPLADTPGGPWKVYGVARR RPSWNADHPI
Sbjct  16   FEEDEAPPKYESVALIIGVTGIVGNSLAEILPLADTPGGPWKVYGVARRARPSWNADHPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            EY+QCDI N ED QSKLSVLTDVTHVFYVTW NR++E +NCE NGKM RNV+N IIP+CP
Sbjct  76   EYVQCDISNPEDTQSKLSVLTDVTHVFYVTWANRSKEVENCEINGKMFRNVLNVIIPNCP  135

Query  445  NLQHICLQTGRKHYIGPWESYLK  513
            +L+HICLQTGRKHY+GP+E Y K
Sbjct  136  HLRHICLQTGRKHYLGPFELYGK  158



>ref|NP_001266103.1| putative steroid 5beta-reductase [Solanum lycopersicum]
 gb|AEX31545.1| putative steroid 5beta-reductase [Solanum lycopersicum]
Length=387

 Score =   256 bits (655),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 118/143 (83%), Positives = 130/143 (91%), Gaps = 0/143 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
             E+D+APPKY+SVALI+GVTGIVGNSLAEILPLADTPGGPWKVYGVARR RPSWNADHPI
Sbjct  15   FEDDEAPPKYESVALIIGVTGIVGNSLAEILPLADTPGGPWKVYGVARRARPSWNADHPI  74

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            EY+QCDI N ED QSKLSVLTDVTHVFYVTW NR+ E +NCE NGKM RNV+N IIP+CP
Sbjct  75   EYVQCDISNPEDTQSKLSVLTDVTHVFYVTWANRSTEVENCEINGKMFRNVLNVIIPNCP  134

Query  445  NLQHICLQTGRKHYIGPWESYLK  513
            NL+HICLQTGRKHY+GP+E Y K
Sbjct  135  NLRHICLQTGRKHYLGPFELYGK  157



>gb|ADG46023.1| progesterone 5-beta-reductase [Atropa belladonna]
Length=387

 Score =   256 bits (655),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 118/143 (83%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
             EEDDAPPKYQSVALI+GVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADH I
Sbjct  15   FEEDDAPPKYQSVALIIGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHSI  74

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            EY+QCDI N ED QS LS+LTDVTHVFYVTW NR+ E +NCE NGKM RNV+N IIP+CP
Sbjct  75   EYVQCDISNPEDTQSNLSLLTDVTHVFYVTWANRSTEIENCEINGKMFRNVLNVIIPNCP  134

Query  445  NLQHICLQTGRKHYIGPWESYLK  513
            NL+HICLQ GRKHY+GP+E Y K
Sbjct  135  NLRHICLQAGRKHYLGPFELYGK  157



>gb|ADK13080.1| putative progesterone 5-beta-reductase [Nierembergia aristata]
Length=387

 Score =   256 bits (655),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
             EEDDAPPKYQSVALI+GVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI
Sbjct  15   FEEDDAPPKYQSVALIIGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  74

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            EYIQCDI N  D QSKLSVL+DVTHVFYVTW NR+ E +NCE NGKM +NV+N IIP+CP
Sbjct  75   EYIQCDISNPTDIQSKLSVLSDVTHVFYVTWANRSTEVENCEINGKMFKNVLNVIIPNCP  134

Query  445  NLQHICLQTGRKHYIGPWE  501
            NL+HICLQTGRKHY+GP+E
Sbjct  135  NLRHICLQTGRKHYLGPFE  153



>gb|ADG41743.1| putative progesterone 5 beta-reductase [Nicotiana tabacum]
Length=388

 Score =   256 bits (654),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 118/143 (83%), Positives = 131/143 (92%), Gaps = 0/143 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
             EEDDAPPKYQSVALI+GVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI
Sbjct  16   FEEDDAPPKYQSVALIIGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            +YIQCDI N ED QSKLS+LTDVTHVFYVTW +R+ E +NCE NGKM +NV++ IIP+CP
Sbjct  76   DYIQCDISNPEDTQSKLSLLTDVTHVFYVTWASRSTEVENCEINGKMFQNVLSVIIPNCP  135

Query  445  NLQHICLQTGRKHYIGPWESYLK  513
            NL+HICLQTGRKHY+GP+E Y K
Sbjct  136  NLRHICLQTGRKHYLGPFELYGK  158



>ref|XP_009771311.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Nicotiana 
sylvestris]
Length=388

 Score =   256 bits (654),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 118/143 (83%), Positives = 131/143 (92%), Gaps = 0/143 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
             EEDDAPPKYQSVALI+GVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI
Sbjct  16   FEEDDAPPKYQSVALIIGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            +YIQCDI N ED QSKLS+LTDVTHVFYVTW +R+ E +NCE NGKM +NV++ IIP+CP
Sbjct  76   DYIQCDISNPEDTQSKLSLLTDVTHVFYVTWASRSTEVENCEINGKMFQNVLSVIIPNCP  135

Query  445  NLQHICLQTGRKHYIGPWESYLK  513
            NL+HICLQTGRKHY+GP+E Y K
Sbjct  136  NLRHICLQTGRKHYLGPFELYGK  158



>dbj|BAH47641.1| progesterone 5beta reductase-B [Nicotiana tabacum]
Length=388

 Score =   256 bits (654),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 118/143 (83%), Positives = 131/143 (92%), Gaps = 0/143 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
             EEDDAPPKYQSVALI+GVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI
Sbjct  16   FEEDDAPPKYQSVALIIGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            +YIQCDI N ED QSKLS+LTDVTHVFYVTW +R+ E +NCE NGKM +NV++ IIP+CP
Sbjct  76   DYIQCDISNPEDTQSKLSLLTDVTHVFYVTWASRSTEVENCEINGKMFQNVLSVIIPNCP  135

Query  445  NLQHICLQTGRKHYIGPWESYLK  513
            NL+HICLQTGRKHY+GP+E Y K
Sbjct  136  NLRHICLQTGRKHYLGPFELYGK  158



>ref|XP_009599751.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Nicotiana 
tomentosiformis]
 dbj|BAH47640.1| progesterone 5beta reductase-A [Nicotiana tabacum]
Length=389

 Score =   256 bits (653),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 117/143 (82%), Positives = 131/143 (92%), Gaps = 0/143 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
             EEDDAPPKYQSVALI+GVTGIVGNSLAEILPLADTPGGPWKVYG+ARRPRPSWNADHPI
Sbjct  16   FEEDDAPPKYQSVALIIGVTGIVGNSLAEILPLADTPGGPWKVYGLARRPRPSWNADHPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            +YIQCDI N ED QSKLS+LTDVTHVFYVTW +R+ E +NCE NGKM +NVV+ +IP+CP
Sbjct  76   DYIQCDISNPEDTQSKLSLLTDVTHVFYVTWASRSTEVENCEINGKMFQNVVSVVIPNCP  135

Query  445  NLQHICLQTGRKHYIGPWESYLK  513
            NL+HICLQTGRKHY+GP+E Y K
Sbjct  136  NLRHICLQTGRKHYLGPFELYGK  158



>gb|AIW09143.1| progesterone 5-beta-reductase 1 [Catharanthus roseus]
Length=387

 Score =   254 bits (650),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 117/143 (82%), Positives = 129/143 (90%), Gaps = 0/143 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
             E DDAPPKYQSV LI+GVTGIVGNSLAEILPL+DTPGGPWKVYGVARRPRPSWNADHPI
Sbjct  16   FEFDDAPPKYQSVGLILGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPSWNADHPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            EYIQCDI + E+ +SKLS LTDVTHVFYVTWTN++ E +NCEANGKM RNV+NAIIP+CP
Sbjct  76   EYIQCDISDPEETESKLSKLTDVTHVFYVTWTNKSTEVENCEANGKMFRNVLNAIIPNCP  135

Query  445  NLQHICLQTGRKHYIGPWESYLK  513
            NLQHICLQTG KHY GP+E + K
Sbjct  136  NLQHICLQTGLKHYFGPFEFFGK  158



>gb|ADG56540.1| progesterone 5-beta-reductase [Nerium oleander]
Length=387

 Score =   249 bits (636),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 112/143 (78%), Positives = 130/143 (91%), Gaps = 0/143 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
             ++DDAP KYQSV LI+GVTGIVGNSLAEILPL+DTPGGPWKVYGVARRPRPSWNADHP+
Sbjct  16   FDDDDAPAKYQSVGLIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPSWNADHPV  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            EY+QCDI + EDA+SKLS LTDVTHVFYVTW +++ E +NCEANGKM RNV++AIIP+CP
Sbjct  76   EYVQCDISDKEDAESKLSKLTDVTHVFYVTWASKSTEVENCEANGKMFRNVLDAIIPNCP  135

Query  445  NLQHICLQTGRKHYIGPWESYLK  513
            NLQHICLQTG KHY+GP+E + K
Sbjct  136  NLQHICLQTGLKHYLGPFELFGK  158



>ref|XP_011088171.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase [Sesamum 
indicum]
Length=389

 Score =   245 bits (626),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 112/143 (78%), Positives = 132/143 (92%), Gaps = 0/143 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            +EED+AP K++SVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWN D+PI
Sbjct  16   IEEDEAPRKHESVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNDDNPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
             YIQCD+ + +DAQ+KLS LTD+THVFYVTWTNR+ E +NCEANGKML+NV++A+IP+CP
Sbjct  76   NYIQCDVSDPDDAQAKLSTLTDITHVFYVTWTNRSTEAENCEANGKMLKNVLDAVIPNCP  135

Query  445  NLQHICLQTGRKHYIGPWESYLK  513
             L+HICLQTGRKHYIGP+E + K
Sbjct  136  KLKHICLQTGRKHYIGPFEIFGK  158



>gb|AIW09144.1| progesterone 5-beta-reductase 2 [Catharanthus roseus]
Length=389

 Score =   245 bits (626),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            L++ DAPPKYQSV LI+GVTGIVGNSLAEILPL+DTPGGPWKVYGVARRPRPSWNADHP+
Sbjct  16   LDDFDAPPKYQSVGLILGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPSWNADHPV  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            EYIQCDI + EDAQS LS LTDVTHVFYVTW +++ E +NCE N KM RNV+NAIIP+CP
Sbjct  76   EYIQCDISDPEDAQSMLSKLTDVTHVFYVTWASKSTEVENCEVNSKMFRNVLNAIIPNCP  135

Query  445  NLQHICLQTGRKHYIGPWESYLK  513
            NLQHICLQTG KHY+GP+E + K
Sbjct  136  NLQHICLQTGLKHYLGPFELFGK  158



>gb|AEY82379.1| putative progesterone 5-beta-reductase [Withania somnifera]
Length=388

 Score =   244 bits (624),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 114/143 (80%), Positives = 126/143 (88%), Gaps = 0/143 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            LEED+APPKYQSVALI+GVTGIVGNSLA+ILPLADTPGGPWKVYGVARR RPSWN DHP+
Sbjct  15   LEEDEAPPKYQSVALIIGVTGIVGNSLADILPLADTPGGPWKVYGVARRSRPSWNTDHPM  74

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            EYIQCDI N+ED QSKLS+LTDVTHVFYV    R+ E +NCE NGKM +NVVN IIP+CP
Sbjct  75   EYIQCDISNAEDTQSKLSLLTDVTHVFYVASAKRSTEVENCEINGKMFQNVVNVIIPNCP  134

Query  445  NLQHICLQTGRKHYIGPWESYLK  513
             L+HICLQTGRKHY+GP E Y K
Sbjct  135  ELRHICLQTGRKHYLGPLELYGK  157



>ref|XP_011088182.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like isoform 
X1 [Sesamum indicum]
Length=390

 Score =   244 bits (623),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 107/143 (75%), Positives = 132/143 (92%), Gaps = 0/143 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            LEED+AP K++SVALI+GVTG+VGNSLAEILPL+DTPGGPWKVYGVARRPRPSW+ D+PI
Sbjct  16   LEEDEAPQKHESVALIIGVTGLVGNSLAEILPLSDTPGGPWKVYGVARRPRPSWSDDYPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
             YIQCD+LN +D Q+KLS LTD+THVFY TWTNR  E +NCEANG+ML+NV++A+IP+CP
Sbjct  76   NYIQCDVLNRDDTQAKLSTLTDITHVFYATWTNRPTEAENCEANGRMLQNVLDAVIPNCP  135

Query  445  NLQHICLQTGRKHYIGPWESYLK  513
            NL+HIC+QTGRKHY+GP+E++ K
Sbjct  136  NLKHICMQTGRKHYVGPFEAFGK  158



>ref|XP_011088183.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like isoform 
X2 [Sesamum indicum]
Length=389

 Score =   244 bits (623),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 107/143 (75%), Positives = 132/143 (92%), Gaps = 0/143 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            LEED+AP K++SVALI+GVTG+VGNSLAEILPL+DTPGGPWKVYGVARRPRPSW+ D+PI
Sbjct  15   LEEDEAPQKHESVALIIGVTGLVGNSLAEILPLSDTPGGPWKVYGVARRPRPSWSDDYPI  74

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
             YIQCD+LN +D Q+KLS LTD+THVFY TWTNR  E +NCEANG+ML+NV++A+IP+CP
Sbjct  75   NYIQCDVLNRDDTQAKLSTLTDITHVFYATWTNRPTEAENCEANGRMLQNVLDAVIPNCP  134

Query  445  NLQHICLQTGRKHYIGPWESYLK  513
            NL+HIC+QTGRKHY+GP+E++ K
Sbjct  135  NLKHICMQTGRKHYVGPFEAFGK  157



>ref|XP_002510123.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF52310.1| conserved hypothetical protein [Ricinus communis]
Length=390

 Score =   243 bits (619),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = +1

Query  88   EEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPIE  267
            EEDDAP  +QSVAL++GVTGIVGNSLAEILPL+DTPGGPWKVYGVARRPRP+WNADHP+E
Sbjct  17   EEDDAPRSFQSVALVLGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPTWNADHPVE  76

Query  268  YIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCPN  447
            YIQCDI +S + QSKLS LTD+TH+FYVTWTNR  ED+NCE NG M RNV+ A+IP+ PN
Sbjct  77   YIQCDISDSAETQSKLSQLTDITHIFYVTWTNRQSEDENCEINGLMFRNVLQAVIPNAPN  136

Query  448  LQHICLQTGRKHYIGPWESYLK  513
            L+HICLQTG KHY+GP+ES  K
Sbjct  137  LRHICLQTGAKHYVGPFESLGK  158



>ref|XP_009771310.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Nicotiana 
sylvestris]
Length=390

 Score =   243 bits (619),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 130/144 (90%), Gaps = 1/144 (1%)
 Frame = +1

Query  85   LEEDDAP-PKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHP  261
            +++DDAP  KYQSVALI+GVTGIVGNSLAEILPL+DTPGGPWKVYGVARRPRPSWNADHP
Sbjct  16   IDQDDAPIQKYQSVALIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPSWNADHP  75

Query  262  IEYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSC  441
            IEYIQCDI N ED+QSKL++ +DVTHVFYVTW +R+ E +NCE NG+M +NV+NAIIP+C
Sbjct  76   IEYIQCDISNPEDSQSKLTLFSDVTHVFYVTWASRSTEIENCETNGEMFKNVLNAIIPNC  135

Query  442  PNLQHICLQTGRKHYIGPWESYLK  513
            PNL HICLQTGRKHY GP+E + K
Sbjct  136  PNLSHICLQTGRKHYHGPFELFGK  159



>emb|CDO97253.1| unnamed protein product [Coffea canephora]
Length=387

 Score =   241 bits (615),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 126/143 (88%), Gaps = 0/143 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
             EEDDAPP+YQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYG+ARRPRPSWNADHPI
Sbjct  16   FEEDDAPPQYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGLARRPRPSWNADHPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
             YIQCDI + +D QSKLS L D+TH+FYVTW NR+ E  NC+ NG M RN+++A+IPS P
Sbjct  76   HYIQCDISDPQDTQSKLSHLDDITHLFYVTWANRSTELDNCQVNGNMFRNLLSAVIPSSP  135

Query  445  NLQHICLQTGRKHYIGPWESYLK  513
            NL+HICLQTGRKHY+GP+E + K
Sbjct  136  NLRHICLQTGRKHYLGPFELFGK  158



>ref|XP_002285152.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Vitis 
vinifera]
Length=390

 Score =   241 bits (615),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
             +EDDAP  +QSV L++GVTGIVGNSLAEILPL+DTPGGPWKVYGVARRPRP WNADHP+
Sbjct  16   FDEDDAPRGFQSVGLVIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPDWNADHPV  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            EYIQCDI +SEDA +KLS LTDVTHVFYVTWTNR  E +NCEANG MLRNV+ A+IP+ P
Sbjct  76   EYIQCDISDSEDALAKLSPLTDVTHVFYVTWTNRATEIENCEANGTMLRNVLRALIPNAP  135

Query  445  NLQHICLQTGRKHYIGPWESYLK  513
            NL+HICLQTG KHYIGP+E++ K
Sbjct  136  NLRHICLQTGGKHYIGPFEAFGK  158



>emb|CAD87012.1| putative progesterone 5-beta-reductase [Digitalis obscura]
Length=389

 Score =   241 bits (614),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 129/143 (90%), Gaps = 0/143 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            LEEDDAPPK+ SVALIVGVTGI+GNSLAEILPLADTPGGPWKVYGVARR RP+W+ D+PI
Sbjct  16   LEEDDAPPKHSSVALIVGVTGIIGNSLAEILPLADTPGGPWKVYGVARRTRPAWHEDNPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
             Y+QCDI + +D+Q+KLS LTDVTHVFYVTW NR+ E +NCEAN KM RNV++A+IP+CP
Sbjct  76   NYVQCDISDPDDSQAKLSPLTDVTHVFYVTWANRSTEQENCEANSKMFRNVLDAVIPNCP  135

Query  445  NLQHICLQTGRKHYIGPWESYLK  513
            NL+HI LQTGRKHY+GP+ESY K
Sbjct  136  NLKHISLQTGRKHYMGPFESYGK  158



>gb|ABA77554.1| progesterone 5-beta-reductase [Digitalis cariensis]
Length=389

 Score =   241 bits (614),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 129/143 (90%), Gaps = 0/143 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            LEEDDAPPK+ SVALIVGVTGI+GNSLAEILPLADTPGGPWKVYGVARR RP+W+ D+PI
Sbjct  16   LEEDDAPPKHSSVALIVGVTGIIGNSLAEILPLADTPGGPWKVYGVARRTRPAWHEDNPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
             Y+QCDI + +D+Q+KLS LTDVTHVFYVTW NR+ E +NCEAN KM RNV++A+IP+CP
Sbjct  76   NYVQCDISDPDDSQAKLSPLTDVTHVFYVTWANRSTEQENCEANSKMFRNVLDAVIPNCP  135

Query  445  NLQHICLQTGRKHYIGPWESYLK  513
            NL+HI LQTGRKHY+GP+ESY K
Sbjct  136  NLKHISLQTGRKHYMGPFESYGK  158



>gb|AAU88204.1| progesterone 5-beta-reductase [Digitalis ferruginea]
Length=389

 Score =   241 bits (614),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 129/143 (90%), Gaps = 0/143 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            LEEDDAPPK+ SVALIVGVTGI+GNSLAEILPLADTPGGPWKVYGVARR RP+W+ D+PI
Sbjct  16   LEEDDAPPKHSSVALIVGVTGIIGNSLAEILPLADTPGGPWKVYGVARRTRPAWHEDNPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
             Y+QCDI + +D+Q+KLS LTDVTHVFYVTW NR+ E +NCEAN KM RNV++A+IP+CP
Sbjct  76   NYVQCDISDPDDSQAKLSPLTDVTHVFYVTWANRSTEQENCEANSKMFRNVLDAVIPNCP  135

Query  445  NLQHICLQTGRKHYIGPWESYLK  513
            NL+HI LQTGRKHY+GP+ESY K
Sbjct  136  NLKHISLQTGRKHYMGPFESYGK  158



>gb|AEW67078.1| putative progesterone 5-beta-reductase [Digitalis ferruginea 
subsp. schischkinii]
Length=389

 Score =   240 bits (613),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 129/143 (90%), Gaps = 0/143 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            LEEDDAPPK+ SVALIVGVTGI+GNSLAEILPLADTPGGPWKVYGVARR RP+W+ D+PI
Sbjct  16   LEEDDAPPKHSSVALIVGVTGIIGNSLAEILPLADTPGGPWKVYGVARRTRPAWHEDNPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
             Y+QCDI + +D+Q+KLS LTDVTHVFYVTW NR+ E +NCEAN KM RNV++A+IP+CP
Sbjct  76   NYVQCDISDPDDSQAKLSPLTDVTHVFYVTWANRSTEQENCEANSKMFRNVLDAVIPNCP  135

Query  445  NLQHICLQTGRKHYIGPWESYLK  513
            NL+HI LQTGRKHY+GP+ESY K
Sbjct  136  NLKHISLQTGRKHYMGPFESYGK  158



>gb|ABA77555.1| progesterone 5-beta-reductase [Digitalis laevigata]
 gb|AIF73579.1| progesterone 5-beta-reductase [Digitalis ferruginea subsp. ferruginea]
Length=389

 Score =   240 bits (613),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 129/143 (90%), Gaps = 0/143 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            LEEDDAPPK+ SVALIVGVTGI+GNSLAEILPLADTPGGPWKVYGVARR RP+W+ D+PI
Sbjct  16   LEEDDAPPKHSSVALIVGVTGIIGNSLAEILPLADTPGGPWKVYGVARRTRPAWHEDNPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
             Y+QCDI + +D+Q+KLS LTDVTHVFYVTW NR+ E +NCEAN KM RNV++A+IP+CP
Sbjct  76   NYVQCDISDPDDSQAKLSPLTDVTHVFYVTWANRSTEQENCEANSKMFRNVLDAVIPNCP  135

Query  445  NLQHICLQTGRKHYIGPWESYLK  513
            NL+HI LQTGRKHY+GP+ESY K
Sbjct  136  NLKHISLQTGRKHYMGPFESYGK  158



>gb|AEW67079.1| putative progesterone 5-beta-reductase [Digitalis trojana]
Length=389

 Score =   240 bits (613),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 129/143 (90%), Gaps = 0/143 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            LEEDDAPPK+ SVALIVGVTGI+GNSLAEILPLADTPGGPWKVYGVARR RP+W+ D+PI
Sbjct  16   LEEDDAPPKHSSVALIVGVTGIIGNSLAEILPLADTPGGPWKVYGVARRTRPAWHEDNPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
             Y+QCDI + +D+Q+KLS LTDVTHVFYVTW NR+ E +NCEAN KM RNV++A+IP+CP
Sbjct  76   NYVQCDISDPDDSQAKLSPLTDVTHVFYVTWANRSTEQENCEANSKMFRNVLDAVIPNCP  135

Query  445  NLQHICLQTGRKHYIGPWESYLK  513
            NL+HI LQTGRKHY+GP+ESY K
Sbjct  136  NLKHISLQTGRKHYMGPFESYGK  158



>ref|XP_010497523.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like, partial 
[Camelina sativa]
Length=152

 Score =   232 bits (592),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 105/137 (77%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            L++D+    Y+SVALI+GVTGIVGNSLAEILPL+DTPGGPWKVYGVARRPRPSWNADHPI
Sbjct  16   LDDDEPTQSYESVALIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPSWNADHPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            +YIQCD+ N++DA+SKLS LTDVTHVFYVTWTNR  E +NCEANG MLRNV+ A++P  P
Sbjct  76   DYIQCDVSNADDARSKLSPLTDVTHVFYVTWTNRESETENCEANGSMLRNVLRAVVPHAP  135

Query  445  NLQHICLQTGRKHYIGP  495
            NL+H+CLQTG KHY+GP
Sbjct  136  NLRHVCLQTGTKHYLGP  152



>gb|AIA58905.1| putative progesterone 5-beta-reductase [Malcolmia maritima]
Length=388

 Score =   240 bits (612),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 109/138 (79%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            L+ED+    Y+SVALI+GVTGIVGNSLAEILPL+DTPGGPWKVYGVARRPRPSWNADHPI
Sbjct  16   LDEDEPTQSYESVALIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPSWNADHPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            +YIQCD+ N+EDA+SKLS LTDVTHVFYVTWTNR  E +NCEANG MLRNV+ AI+P  P
Sbjct  76   DYIQCDVSNAEDARSKLSPLTDVTHVFYVTWTNRESESENCEANGSMLRNVLQAIVPHAP  135

Query  445  NLQHICLQTGRKHYIGPW  498
            NL+HICLQTG KHY+GP+
Sbjct  136  NLRHICLQTGTKHYVGPF  153



>gb|ADG46029.1| putative progesterone 5-beta-reductase [Corchorus capsularis]
 gb|ADK11283.1| putative progesterone 5-beta-reductase [Corchorus olitorius]
Length=387

 Score =   239 bits (611),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 126/143 (88%), Gaps = 0/143 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
             +EDDAPP+YQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYG+ARRPRPSWNADHPI
Sbjct  16   FDEDDAPPQYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGLARRPRPSWNADHPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
             YIQCDI + +D QSKLS L D+TH+FYVTW NR+ E  NC+ NG M RN+++A+IPS P
Sbjct  76   HYIQCDISDPQDTQSKLSHLDDITHLFYVTWANRSTELDNCQVNGNMFRNLLSAVIPSSP  135

Query  445  NLQHICLQTGRKHYIGPWESYLK  513
            NL+HICLQTGRKHY+GP+E + K
Sbjct  136  NLRHICLQTGRKHYLGPFELFGK  158



>gb|ADG46022.1| progesterone 5-beta-reductase [Mentha x piperita]
Length=389

 Score =   239 bits (611),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 131/143 (92%), Gaps = 0/143 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            LEED+APP YQSVAL+VGVTGIVGNSLAEILPL+DTPGGPWKVYGVARRPRP+WN DHPI
Sbjct  16   LEEDEAPPNYQSVALVVGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPAWNDDHPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
             YI+CD+ +S DA+ KLS LTD+T++FYVTWTN++ E +NCEANGKML+NV++A+IP+CP
Sbjct  76   TYIRCDVSDSGDAKEKLSPLTDLTNIFYVTWTNKSTEAENCEANGKMLKNVLDALIPNCP  135

Query  445  NLQHICLQTGRKHYIGPWESYLK  513
            NL+H+CL TGRKHY+GP+ES  K
Sbjct  136  NLKHVCLLTGRKHYVGPFESVGK  158



>gb|AHZ44506.1| putative progesterone 5 beta-reductase [Iberis amara]
Length=389

 Score =   239 bits (610),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
             ++D+    Y+SVALI+GVTGIVGNSLAEILPL+DTPGGPWKVYGVARRPRPSWNADHPI
Sbjct  16   FDDDEPSQSYESVALIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPSWNADHPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            +YIQCD+ N+EDA+SKLS LTDVTHVFYVTWTNR+ E  NCEANG MLRNV+ AIIP+ P
Sbjct  76   DYIQCDVSNAEDARSKLSPLTDVTHVFYVTWTNRSSEQDNCEANGSMLRNVLGAIIPNAP  135

Query  445  NLQHICLQTGRKHYIGPWESYLK  513
            NL+H+CLQTG KHY+GP+++  K
Sbjct  136  NLRHVCLQTGTKHYVGPFDNLEK  158



>gb|AFZ42257.2| putative progesterone 5-beta-reductase [Thymus serpyllum]
Length=389

 Score =   239 bits (610),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 129/143 (90%), Gaps = 0/143 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            LE DDAPP YQSVAL+VGVTGIVGNSLAEILPL+DTPGGPWKVYGVARRPRP+WN DHPI
Sbjct  16   LEVDDAPPNYQSVALVVGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPAWNEDHPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
             YI+CD+ +S DA+ KLS LTDVT++FYVTWTN++ E +NCEANGKML+NV++A+IP+CP
Sbjct  76   TYIRCDVSDSGDAKEKLSPLTDVTNIFYVTWTNKSTEAENCEANGKMLKNVLDALIPNCP  135

Query  445  NLQHICLQTGRKHYIGPWESYLK  513
            NL+HICL TGRKHY GP+ES  K
Sbjct  136  NLKHICLLTGRKHYTGPFESIGK  158



>ref|XP_009593701.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Nicotiana 
tomentosiformis]
Length=390

 Score =   239 bits (610),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 128/144 (89%), Gaps = 1/144 (1%)
 Frame = +1

Query  85   LEEDDAP-PKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHP  261
            +E+DDAP  K+QSVALI+GVTGIVGNSLAEILPL+DTPGGPWKVYGVARRPRPSWNADHP
Sbjct  16   VEQDDAPVQKHQSVALIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPSWNADHP  75

Query  262  IEYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSC  441
            IEYIQCDI N ED QSKL++L DVTHVFYVTW +R+ E QNCE NGKM +N++NAIIP+ 
Sbjct  76   IEYIQCDISNPEDTQSKLTLLGDVTHVFYVTWASRSTEIQNCETNGKMFKNLLNAIIPNY  135

Query  442  PNLQHICLQTGRKHYIGPWESYLK  513
            PNL HICLQTGRKHY GP+E + K
Sbjct  136  PNLSHICLQTGRKHYHGPFELFGK  159



>gb|ABB72433.1| progesterone 5-beta-reductase [Digitalis nervosa]
Length=389

 Score =   239 bits (609),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = +1

Query  88   EEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPIE  267
            EEDDAPPK+ SVALIVGVTGI+GNSLAEILPLADTPGGPWKVYGVARR RP+W+ D+PI 
Sbjct  17   EEDDAPPKHSSVALIVGVTGIIGNSLAEILPLADTPGGPWKVYGVARRTRPAWHEDNPIN  76

Query  268  YIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCPN  447
            Y+QCDI + +D+Q+KLS LTDVTHVFYVTW NR+ E +NCEAN KM RNV++A+IP+CPN
Sbjct  77   YVQCDISDPDDSQAKLSPLTDVTHVFYVTWANRSTEQENCEANSKMFRNVLDAVIPNCPN  136

Query  448  LQHICLQTGRKHYIGPWESYLK  513
            L+HI LQTGRKHY+GP+ESY K
Sbjct  137  LKHISLQTGRKHYMGPFESYGK  158



>gb|AEW67076.1| putative progesterone 5-beta-reductase [Digitalis cariensis]
Length=389

 Score =   239 bits (609),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            LEEDDAPPK+ SVALIVGVTGI+GNSLAEILPLADTPGGPWKVYGVARR RP+W+ D+PI
Sbjct  16   LEEDDAPPKHSSVALIVGVTGIIGNSLAEILPLADTPGGPWKVYGVARRTRPAWHEDNPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
             Y+QCDI + +D+Q+KLS L DVTHVFYVTW NR+ E +NCEAN KM RNV++A+IP+CP
Sbjct  76   NYVQCDISDPDDSQAKLSPLADVTHVFYVTWANRSTEQENCEANSKMFRNVLDAVIPNCP  135

Query  445  NLQHICLQTGRKHYIGPWESYLK  513
            NL+HI LQTGRKHY+GP+ESY K
Sbjct  136  NLKHISLQTGRKHYMGPFESYGK  158



>gb|AHI88613.1| putative steroid 5-beta-reductase [Sinapis arvensis]
Length=390

 Score =   239 bits (609),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 106/140 (76%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
             +ED+  P Y+SVALIVGVTGIVGNSLAEILPL+DTPGGPWKVYGVARRPRPSWNADHPI
Sbjct  16   FDEDEPTPSYESVALIVGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPSWNADHPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            +YIQCD+ N+EDA+SKLS LTDVTHVFYVTWTNR+ E +NC+ NG MLRNV+ A++P+ P
Sbjct  76   DYIQCDVSNAEDAKSKLSTLTDVTHVFYVTWTNRSSEVENCKVNGSMLRNVLRAVVPNAP  135

Query  445  NLQHICLQTGRKHYIGPWES  504
            NL+H+CLQT  KHY+GP++S
Sbjct  136  NLRHVCLQTRTKHYLGPFDS  155



>gb|AGO01041.1| putative progesterone 5-beta-reductase [Matthiola tricuspidata]
Length=387

 Score =   238 bits (608),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 126/143 (88%), Gaps = 0/143 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            LEED+    Y+SVALI+GVTGIVGNSLAEILPL+DTPGGPWKVYGVARRPRPSWNADHPI
Sbjct  16   LEEDEPTQSYESVALIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPSWNADHPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            +YIQCDI ++EDA+SKLS L DVTHVFYVTWTNR  E +NCEANG MLRNV+ AI+P  P
Sbjct  76   DYIQCDISDAEDARSKLSSLADVTHVFYVTWTNRPSEGENCEANGSMLRNVLQAIVPHAP  135

Query  445  NLQHICLQTGRKHYIGPWESYLK  513
            NL+H+CLQTG KHY+GP+++  K
Sbjct  136  NLRHVCLQTGTKHYLGPFDNLGK  158



>ref|XP_010271744.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Nelumbo 
nucifera]
Length=389

 Score =   238 bits (608),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 123/141 (87%), Gaps = 0/141 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
             EED  P K+QSV LI+GVTG+VGNSLAEILPL+DTPGGPWKVYGVARRPRPSWNADHPI
Sbjct  16   FEEDVVPLKHQSVGLIIGVTGVVGNSLAEILPLSDTPGGPWKVYGVARRPRPSWNADHPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            EYIQCD+ + E+ QSKLS LTDVTH+FYVTWTNR  E  NCEANG MLRNV+ A+IP+ P
Sbjct  76   EYIQCDVSDPEETQSKLSPLTDVTHIFYVTWTNRHTESANCEANGAMLRNVLTAVIPNAP  135

Query  445  NLQHICLQTGRKHYIGPWESY  507
            NL HICLQTG KHY+GP+ES+
Sbjct  136  NLNHICLQTGLKHYVGPFESF  156



>gb|AGT29342.1| putative progesterone 5-beta reductase [Barbarea vulgaris]
Length=388

 Score =   238 bits (608),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 107/141 (76%), Positives = 127/141 (90%), Gaps = 0/141 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            L++D+    Y+SVALI+GVTGIVGNSLAEILPL+DTPGGPWKVYGVARRPRPSWNADHPI
Sbjct  16   LDDDEPTQSYESVALIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPSWNADHPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            +YIQCD+ N+EDA+SKLS LTDVTHVFYVTWTNR  E +NCEANG MLRNV+ AI+P  P
Sbjct  76   DYIQCDVSNAEDARSKLSPLTDVTHVFYVTWTNRESEHENCEANGTMLRNVLQAIVPHAP  135

Query  445  NLQHICLQTGRKHYIGPWESY  507
            NL+H+CLQTG KHY+GP++++
Sbjct  136  NLRHVCLQTGTKHYVGPFDNH  156



>ref|XP_006366601.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Solanum 
tuberosum]
Length=388

 Score =   238 bits (608),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
             EEDD P  +QSVALI+GVTGIVGNSLAEILP ADTPGGPWKVYGVARRPRPSWN DHPI
Sbjct  16   FEEDDVPQNFQSVALIIGVTGIVGNSLAEILPCADTPGGPWKVYGVARRPRPSWNVDHPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            EYIQCDI N E+AQSKL++LTDVTHVFYVTW NR  E +NCE NGKM +NV++AIIP+CP
Sbjct  76   EYIQCDISNKEEAQSKLTLLTDVTHVFYVTWANRPTEVENCEINGKMFQNVLDAIIPNCP  135

Query  445  NLQHICLQTGRKHYIGPWESYLK  513
            NL HICLQTG KHY G +E + K
Sbjct  136  NLSHICLQTGLKHYHGSFELFGK  158



>gb|ABA77560.1| progesterone 5-beta-reductase [Digitalis sibirica]
Length=389

 Score =   238 bits (608),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            LEEDDAP K+ SVALIVGVTGI+GNSLAEILPLADTPGGPWKVYGVARR RP+W+ D+PI
Sbjct  16   LEEDDAPTKHSSVALIVGVTGIIGNSLAEILPLADTPGGPWKVYGVARRTRPAWHEDNPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
             YIQCDI + +D+Q+KLS LTDVTHVFYVTW NR+ E +NCEAN KM RNV++A+IP+CP
Sbjct  76   NYIQCDISDPDDSQAKLSPLTDVTHVFYVTWANRSTEQENCEANSKMFRNVLDAVIPNCP  135

Query  445  NLQHICLQTGRKHYIGPWESYLK  513
            NL+HI LQTGRKHY+GP+ESY K
Sbjct  136  NLKHISLQTGRKHYMGPFESYGK  158



>gb|AAS93802.1| progesterone 5-beta-reductase [Digitalis grandiflora]
Length=389

 Score =   238 bits (608),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            LEEDDAP K+ SVALIVGVTGI+GNSLAEILPLADTPGGPWKVYGVARR RP+W+ D+PI
Sbjct  16   LEEDDAPTKHSSVALIVGVTGIIGNSLAEILPLADTPGGPWKVYGVARRTRPAWHEDNPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
             YIQCDI + +D+Q+KLS LTDVTHVFYVTW NR+ E +NCEAN KM RNV++A+IP+CP
Sbjct  76   NYIQCDISDPDDSQAKLSPLTDVTHVFYVTWANRSTEQENCEANSKMFRNVLDAVIPNCP  135

Query  445  NLQHICLQTGRKHYIGPWESYLK  513
            NL+HI LQTGRKHY+GP+ESY K
Sbjct  136  NLKHISLQTGRKHYMGPFESYGK  158



>gb|ABA77556.1| progesterone 5-beta-reductase [Digitalis viridiflora]
Length=389

 Score =   238 bits (608),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            LEEDDAP K+ SVALIVGVTGI+GNSLAEILPLADTPGGPWKVYGVARR RP+W+ D+PI
Sbjct  16   LEEDDAPTKHSSVALIVGVTGIIGNSLAEILPLADTPGGPWKVYGVARRTRPAWHEDNPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
             YIQCDI + +D+Q+KLS LTDVTHVFYVTW NR+ E +NCEAN KM RNV++A+IP+CP
Sbjct  76   NYIQCDISDPDDSQAKLSPLTDVTHVFYVTWANRSTEQENCEANSKMFRNVLDAVIPNCP  135

Query  445  NLQHICLQTGRKHYIGPWESYLK  513
            NL+HI LQTGRKHY+GP+ESY K
Sbjct  136  NLKHISLQTGRKHYMGPFESYGK  158



>gb|AGT29344.1| putative progesterone 5-beta reductase 1_2 [Thymus serpyllum]
Length=389

 Score =   238 bits (608),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 108/140 (77%), Positives = 128/140 (91%), Gaps = 0/140 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            LE DDAPP YQSVAL+VGVTGIVGNSLAEILPL+DTPGGPWKVYGVARRPRP+WN DHP+
Sbjct  16   LEVDDAPPNYQSVALVVGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPAWNEDHPV  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
             YI+CD+ +S DA+ KLS LTDVT++FYVTWTN++ E +NCEANGKML+NV++A+IP+CP
Sbjct  76   TYIRCDVSDSGDAKEKLSPLTDVTNIFYVTWTNKSTEAENCEANGKMLKNVLDALIPNCP  135

Query  445  NLQHICLQTGRKHYIGPWES  504
            NL+HICL TGRKHY GP+ES
Sbjct  136  NLKHICLLTGRKHYTGPFES  155



>gb|ABB36652.1| progesterone 5beta-reductase [Isoplexis chalcantha]
Length=389

 Score =   238 bits (607),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            LEEDDAP K+ SVALIVGVTGI+GNSLAEILPLADTPGGPWKVYGVARR RP+W+ D+PI
Sbjct  16   LEEDDAPSKHSSVALIVGVTGIIGNSLAEILPLADTPGGPWKVYGVARRTRPAWHEDNPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
             Y+QCDI + +D+Q+KLS LTDVTHVFYVTW NR+ E +NCEAN KM RNV++A+IP+CP
Sbjct  76   NYVQCDISDPDDSQAKLSHLTDVTHVFYVTWANRSTEQENCEANSKMFRNVLDAVIPNCP  135

Query  445  NLQHICLQTGRKHYIGPWESYLK  513
            NL+HI LQTGRKHY+GP+ESY K
Sbjct  136  NLKHISLQTGRKHYMGPFESYGK  158



>gb|ABB36651.1| progesterone 5beta-reductase [Isoplexis canariensis]
Length=389

 Score =   238 bits (607),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            LEEDDAP K+ SVALIVGVTGI+GNSLAEILPLADTPGGPWKVYGVARR RP+W+ D+PI
Sbjct  16   LEEDDAPSKHSSVALIVGVTGIIGNSLAEILPLADTPGGPWKVYGVARRTRPAWHEDNPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
             Y+QCDI + +D+Q+KLS LTDVTHVFYVTW NR+ E +NCEAN KM RNV++A+IP+CP
Sbjct  76   NYVQCDISDPDDSQAKLSHLTDVTHVFYVTWANRSTEQENCEANSKMFRNVLDAVIPNCP  135

Query  445  NLQHICLQTGRKHYIGPWESYLK  513
            NL+HI LQTGRKHY+GP+ESY K
Sbjct  136  NLKHISLQTGRKHYMGPFESYGK  158



>gb|AAU95076.1| progesterone 5 beta reductase [Digitalis subalpina]
 gb|ABF48559.1| putative progesterone 5 beta reductase [Digitalis minor]
Length=389

 Score =   238 bits (607),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            LEEDDAP K+ SVALIVGVTGI+GNSLAEILPLADTPGGPWKVYGVARR RP+W+ D+PI
Sbjct  16   LEEDDAPSKHSSVALIVGVTGIIGNSLAEILPLADTPGGPWKVYGVARRTRPAWHEDNPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
             Y+QCDI + +D+Q+KLS LTDVTHVFYVTW NR+ E +NCEAN KM RNV++A+IP+CP
Sbjct  76   NYVQCDISDPDDSQAKLSPLTDVTHVFYVTWANRSTEQENCEANSKMFRNVLDAVIPNCP  135

Query  445  NLQHICLQTGRKHYIGPWESYLK  513
            NL+HI LQTGRKHY+GP+ESY K
Sbjct  136  NLKHISLQTGRKHYMGPFESYGK  158



>gb|AEX31542.1| putative steroid 5beta-reductase [Vitis vinifera]
Length=390

 Score =   238 bits (607),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
             +EDDAP  +Q+V L++GVTGIVG+SLAEILPL+DTPGGPWKVYGVARRPRP WNADHP+
Sbjct  16   FDEDDAPRGFQNVGLVIGVTGIVGDSLAEILPLSDTPGGPWKVYGVARRPRPDWNADHPV  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            EYIQCDI +SEDA +KLS LTDVTHVFYVTWTNR  E +NCEANG MLRNV+ A+IP+ P
Sbjct  76   EYIQCDISDSEDALAKLSPLTDVTHVFYVTWTNRATEIENCEANGTMLRNVLRALIPNAP  135

Query  445  NLQHICLQTGRKHYIGPWESYLK  513
            NL+HICLQTG KHYIGP+E++ K
Sbjct  136  NLRHICLQTGGKHYIGPFEAFGK  158



>gb|AAS93803.1| progesterone 5-beta-reductase [Digitalis parviflora]
Length=389

 Score =   238 bits (606),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            LEEDDAP K+ SVALIVGVTGI+GNSLAEILPLADTPGGPWKVYGVARR RPSW+ D+PI
Sbjct  16   LEEDDAPSKHSSVALIVGVTGIIGNSLAEILPLADTPGGPWKVYGVARRTRPSWHEDNPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
             Y+QCDI + +D+Q+KLS LTDVTHVFYVTW NR+ E +NCEAN +M RNV++A+IP+CP
Sbjct  76   NYVQCDISDPDDSQAKLSPLTDVTHVFYVTWANRSTEQENCEANSQMFRNVLDAVIPNCP  135

Query  445  NLQHICLQTGRKHYIGPWESYLK  513
            NL+HI LQTGRKHY+GP+ESY K
Sbjct  136  NLKHISLQTGRKHYMGPFESYGK  158



>sp|Q6PQJ9.1|5BPOR_DIGLA RecName: Full=3-oxo-Delta(4,5)-steroid 5-beta-reductase; AltName: 
Full=Delta(4)-3-oxosteroid 5-beta-reductase; AltName: Full=Delta-4,5-steroid 
5-beta-reductase; Short=At5beta-StR; AltName: 
Full=Progesterone 5-beta-reductase; Short=5beta-POR 
[Digitalis lanata]
 gb|AAS76634.1| progesterone 5-beta-reductase [Digitalis lanata]
 gb|AAS93804.1| progesterone 5-beta-reductase [Digitalis lanata]
Length=389

 Score =   238 bits (606),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            LEEDDA PK+ SVALIVGVTGI+GNSLAEILPLADTPGGPWKVYGVARR RP+W+ D+PI
Sbjct  16   LEEDDAQPKHSSVALIVGVTGIIGNSLAEILPLADTPGGPWKVYGVARRTRPAWHEDNPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
             Y+QCDI + +D+Q+KLS LTDVTHVFYVTW NR+ E +NCEAN KM RNV++A+IP+CP
Sbjct  76   NYVQCDISDPDDSQAKLSPLTDVTHVFYVTWANRSTEQENCEANSKMFRNVLDAVIPNCP  135

Query  445  NLQHICLQTGRKHYIGPWESYLK  513
            NL+HI LQTGRKHY+GP+ESY K
Sbjct  136  NLKHISLQTGRKHYMGPFESYGK  158



>gb|AFZ41791.1| putative progesterone 5-beta-reductase [Thymus vulgaris]
Length=389

 Score =   238 bits (606),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 108/140 (77%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            LE DDAPP YQSVAL+VGVTGIVGNSLAEILPL+DTPGGPWKVYGVARRPRP+WN DHPI
Sbjct  16   LEVDDAPPNYQSVALVVGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPAWNEDHPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
             YI+CD+ +S DA+ KLS LTDVT++FYVTWTN++ E +NCEANGKML+NV+ A+IP+CP
Sbjct  76   TYIRCDVSDSGDAEEKLSPLTDVTNIFYVTWTNKSTEAENCEANGKMLKNVLEALIPNCP  135

Query  445  NLQHICLQTGRKHYIGPWES  504
            NL+H CL TGRKHY GP+ES
Sbjct  136  NLKHFCLLTGRKHYTGPFES  155



>emb|CAC80137.1| progesterone 5-beta-reductase [Digitalis purpurea]
Length=389

 Score =   238 bits (606),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            LEEDDAPPK+ SVALIVGVTGI+GNSLAEILPLADTPGGPWKVYGVARR RP+W+ D+PI
Sbjct  16   LEEDDAPPKHSSVALIVGVTGIIGNSLAEILPLADTPGGPWKVYGVARRTRPAWHEDNPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
             YIQCDI + +D+ +KLS LTDVTHVFYVTW NR+ E +NCEAN KM RNV++A+IP+CP
Sbjct  76   NYIQCDISDPDDSLAKLSPLTDVTHVFYVTWANRSTEPENCEANSKMFRNVLDAVIPNCP  135

Query  445  NLQHICLQTGRKHYIGPWESYLK  513
            NL+HI LQTGRKHY+GP+ESY K
Sbjct  136  NLKHISLQTGRKHYMGPFESYGK  158



>gb|ABA77558.1| progesterone 5-beta-reductase [Digitalis davisiana]
Length=389

 Score =   237 bits (605),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            LEEDDAP K+ SVALIVGVTGI+GNSLAEILPLADTPGGPWKVYGVARR RP+W+ D+PI
Sbjct  16   LEEDDAPTKHSSVALIVGVTGIIGNSLAEILPLADTPGGPWKVYGVARRTRPAWHEDNPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
             YIQCDI + +D+Q+KLS LTDVTHVFYVTW NR+ E +NCEAN KM RNV++A+IP+CP
Sbjct  76   NYIQCDISDPDDSQAKLSPLTDVTHVFYVTWANRSTEPENCEANSKMFRNVLDAVIPNCP  135

Query  445  NLQHICLQTGRKHYIGPWESYLK  513
            NL+HI LQTGRKHY+GP+ESY K
Sbjct  136  NLKHISLQTGRKHYMGPFESYGK  158



>gb|AAS93805.1| putative progesterone 5-beta-reductase [Digitalis purpurea]
Length=389

 Score =   237 bits (605),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            LEEDDAPPK+ SVALIVGVTGI+GNSLAEILPLADTPGGPWKVYGVARR RP+W+ D+PI
Sbjct  16   LEEDDAPPKHSSVALIVGVTGIIGNSLAEILPLADTPGGPWKVYGVARRTRPAWHEDNPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
             YIQCDI + +D+ +KLS LTDVTHVFYVTW NR+ E +NCEAN KM RNV++A+IP+CP
Sbjct  76   NYIQCDISDPDDSLAKLSPLTDVTHVFYVTWANRSTEPENCEANSKMFRNVLDAVIPNCP  135

Query  445  NLQHICLQTGRKHYIGPWESYLK  513
            NL+HI LQTGRKHY+GP+ESY K
Sbjct  136  NLKHISLQTGRKHYMGPFESYGK  158



>gb|ADG56545.1| progesterone 5-beta-reductase [Erysimum rhaeticum]
Length=389

 Score =   237 bits (605),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 107/138 (78%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            L++D+    Y+SVALI+GVTGIVGNSLAEILPL+DTPGGPWKVYGVARRPRPSWNADHPI
Sbjct  16   LDDDEPTQSYESVALIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPSWNADHPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            +YIQCD+ N+EDA+SKLS LTDVTHVFYVTWTNR  E +NCEANG M+RNV+ AI+P  P
Sbjct  76   DYIQCDVSNAEDARSKLSPLTDVTHVFYVTWTNRESESENCEANGSMIRNVLQAIVPHAP  135

Query  445  NLQHICLQTGRKHYIGPW  498
            NL+HICLQTG KHY+GP+
Sbjct  136  NLRHICLQTGTKHYVGPF  153



>ref|XP_006413460.1| hypothetical protein EUTSA_v10025425mg [Eutrema salsugineum]
 gb|ESQ54913.1| hypothetical protein EUTSA_v10025425mg [Eutrema salsugineum]
Length=390

 Score =   237 bits (604),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 106/143 (74%), Positives = 129/143 (90%), Gaps = 0/143 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            L+ED+    Y+SVALI+GVTGIVGNSLAEILPL+DTPGGPWKVYGVARRPRPSWNADHPI
Sbjct  16   LDEDEPTQSYESVALIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPSWNADHPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            +YIQCD+ ++E+A+SKLS LTDVTHVFYVTWTNR+ E +NC+ANG MLRNV+ A++P+ P
Sbjct  76   DYIQCDVSDAEEARSKLSRLTDVTHVFYVTWTNRSSETENCDANGSMLRNVLRAVLPNAP  135

Query  445  NLQHICLQTGRKHYIGPWESYLK  513
            NL+H+CLQTG KHYIGP+++  K
Sbjct  136  NLRHVCLQTGTKHYIGPFDNLEK  158



>gb|AFZ41796.1| putative progesterone 5-beta-reductase [Sisymbrium officinale]
Length=388

 Score =   237 bits (604),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 106/143 (74%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
             ++D+    Y+SVALI+GVTGIVGNSLAEILPL+DTPGGPWKVYGVARRPRPSWNADHPI
Sbjct  16   FDDDEPTQSYESVALIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPSWNADHPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            +YIQCD+ N+ED +SKLS LTDVTHVFYVTWTNR+ E  NCEANG MLRNV+ A++P+ P
Sbjct  76   DYIQCDVSNAEDVRSKLSPLTDVTHVFYVTWTNRSSESDNCEANGSMLRNVLRAVVPNAP  135

Query  445  NLQHICLQTGRKHYIGPWESYLK  513
            NL+H+CLQTG KHYIGP+ +  K
Sbjct  136  NLRHVCLQTGTKHYIGPFSNLEK  158



>gb|ABB36654.1| progesterone 5beta-reductase [Isoplexis sceptrum]
Length=389

 Score =   236 bits (603),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            LEEDDA PK+ SVALIVGVTGI+GNSLAEILPLADTPGGPWKVYGVARR RP W+ D+PI
Sbjct  16   LEEDDAQPKHSSVALIVGVTGIIGNSLAEILPLADTPGGPWKVYGVARRTRPVWHEDNPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
             Y+QCDI + +D+Q+KLS LTDVTHVFYVTW NR+ E +NCEAN KM RNV++A+IP+CP
Sbjct  76   NYVQCDISDPDDSQAKLSPLTDVTHVFYVTWANRSTEQENCEANSKMFRNVLDAVIPNCP  135

Query  445  NLQHICLQTGRKHYIGPWESYLK  513
            NL+HI LQTGRKHY+GP+ESY K
Sbjct  136  NLKHISLQTGRKHYMGPFESYGK  158



>gb|AIF73578.1| progesterone 5-beta-reductase [Digitalis lanata]
Length=389

 Score =   236 bits (603),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            LEEDDA PK+ SVALIVGVTGI+GNSLAEILPLADTPGGPWKVYGV+RR RP+W+ D+PI
Sbjct  16   LEEDDAQPKHSSVALIVGVTGIIGNSLAEILPLADTPGGPWKVYGVSRRTRPAWHEDNPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
             Y+QCDI + +D+Q+KLS LTDVTHVFYVTW NR+ E +NCEAN KM RNV++A+IP+CP
Sbjct  76   NYVQCDISDPDDSQAKLSPLTDVTHVFYVTWANRSTEQENCEANSKMFRNVLDAVIPNCP  135

Query  445  NLQHICLQTGRKHYIGPWESYLK  513
            NL+HI LQTGRKHY+GP+ESY K
Sbjct  136  NLKHISLQTGRKHYMGPFESYGK  158



>gb|AEW67077.1| putative progesterone 5-beta-reductase [Digitalis lamarckii]
Length=389

 Score =   236 bits (603),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            LEEDDAPPK+ SVALIVGVTGI+GNSLAEILP ADTPGGPWKVYGVARR RP+W+ D+PI
Sbjct  16   LEEDDAPPKHSSVALIVGVTGIIGNSLAEILPRADTPGGPWKVYGVARRTRPAWHEDNPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
             Y+QCDI + +D+Q+KLS L DVTHVFYVTW NR+ E +NCEAN KM RNV++A+IP+CP
Sbjct  76   NYVQCDISDPDDSQAKLSPLADVTHVFYVTWANRSTEQENCEANSKMFRNVLDAVIPNCP  135

Query  445  NLQHICLQTGRKHYIGPWESYLK  513
            NL+HI LQTGRKHY+GP+ESY K
Sbjct  136  NLKHISLQTGRKHYMGPFESYGK  158



>gb|AFZ42258.1| putative progesterone 5-beta-reductase [Nasturtium officinale]
Length=388

 Score =   236 bits (603),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 107/141 (76%), Positives = 125/141 (89%), Gaps = 0/141 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            L+ED+    Y+SVALIVGVTGIVGNSLAEILPL+DTPGGPWKVYGVARRPRPSWNADHPI
Sbjct  16   LDEDEPTLSYESVALIVGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPSWNADHPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            +YIQCD+ N++D +SKLS LTDVTHVFYVTWT+R  E  NCEANG MLRNV+ AI+P  P
Sbjct  76   DYIQCDVSNADDTRSKLSPLTDVTHVFYVTWTSRESEHDNCEANGSMLRNVLQAIVPHAP  135

Query  445  NLQHICLQTGRKHYIGPWESY  507
            NL+H+CLQTG KHY+GP+++Y
Sbjct  136  NLRHVCLQTGTKHYVGPFDNY  156



>gb|AFW97632.1| putative progesterone 5-beta-reductase [Rosmarinus officinalis]
Length=389

 Score =   236 bits (603),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            ++ED+ PP YQSVAL+VGVTGIVGNSLAEILPL+DTPGGPWKVYGVARRPRPSWN DHPI
Sbjct  16   IDEDEPPPNYQSVALVVGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPSWNEDHPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
             YI CD+ + +D +SKL+ LTD+T++FYVTWTNR+ E++NCEANGKML+NV+N +IP+CP
Sbjct  76   NYISCDVSDPDDVKSKLAPLTDITNIFYVTWTNRSTEEENCEANGKMLKNVLNVVIPNCP  135

Query  445  NLQHICLQTGRKHYIGPWESYLK  513
            NL+HICL TGRKHY+GP+ S  K
Sbjct  136  NLKHICLLTGRKHYLGPFNSVWK  158



>gb|ADG56544.1| progesterone 5-beta-reductase [Erysimum crepidifolium]
Length=389

 Score =   236 bits (602),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 107/138 (78%), Positives = 123/138 (89%), Gaps = 0/138 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            L++D+    Y+SVALI+GVTGIVGNSLAEILPL+DTPGGPWKVYGVARRPRPSWNADHPI
Sbjct  16   LDDDEPSQSYESVALIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPSWNADHPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            +YIQCD+ N+EDA+SKLS LTDVTHVFYVTWT R  E +NCEANG MLRNV+ AI+P  P
Sbjct  76   DYIQCDVSNAEDARSKLSPLTDVTHVFYVTWTKRESESENCEANGSMLRNVLQAIVPHAP  135

Query  445  NLQHICLQTGRKHYIGPW  498
            NL+HICLQTG KHY+GP+
Sbjct  136  NLRHICLQTGTKHYLGPF  153



>gb|AEO36948.1| progesterone 5beta-reductase [Erysimum capitatum var. purshii]
Length=389

 Score =   236 bits (601),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 107/138 (78%), Positives = 123/138 (89%), Gaps = 0/138 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            L++D+    Y+SVALI+GVTGIVGNSLAEILPL+DTPGGPWKVYGVARRPRPSWNADHPI
Sbjct  16   LDDDEPSQSYESVALIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPSWNADHPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            +YIQCD+ N+EDA+SKLS LTDVTHVFYVTWT R  E +NCEANG MLRNV+ AI+P  P
Sbjct  76   DYIQCDVSNAEDARSKLSPLTDVTHVFYVTWTKRESESENCEANGSMLRNVLQAIVPHAP  135

Query  445  NLQHICLQTGRKHYIGPW  498
            NL+HICLQTG KHY+GP+
Sbjct  136  NLRHICLQTGTKHYLGPF  153



>ref|XP_002869731.1| hypothetical protein ARALYDRAFT_914168 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45990.1| hypothetical protein ARALYDRAFT_914168 [Arabidopsis lyrata subsp. 
lyrata]
Length=388

 Score =   235 bits (599),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            L++D+    Y+SVALI+GVTGIVGNSLAEILPL+DTPGGPWKVYGVARRPRP+WNADHPI
Sbjct  16   LDDDEPSQSYESVALIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPTWNADHPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            +YIQCD+ ++EDA+SKLS LTDVTHVFYVTWTNR  E +NCEANG MLRNV+ AI+P+ P
Sbjct  76   DYIQCDVSDAEDARSKLSPLTDVTHVFYVTWTNRESESENCEANGSMLRNVLRAIVPNAP  135

Query  445  NLQHICLQTGRKHYIGPW  498
            NL+H+CLQTG KHY+GP+
Sbjct  136  NLRHVCLQTGTKHYVGPF  153



>gb|ABA77559.1| progesterone 5-beta-reductase [Digitalis lutea]
Length=389

 Score =   235 bits (599),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 107/143 (75%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            L+EDDAP K+ SVALIVGVTGI+GNSLAEILPLADTPGGPWKVYGVARR RP+W+ D+PI
Sbjct  16   LDEDDAPTKHSSVALIVGVTGIIGNSLAEILPLADTPGGPWKVYGVARRTRPAWHEDNPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
             Y+QCDI + +D+Q+KLS LTDVTHVFYVTW NR+ E +NCEAN KM RNV++ +IP+CP
Sbjct  76   NYVQCDISDPDDSQAKLSPLTDVTHVFYVTWANRSTEQENCEANSKMFRNVLDTVIPNCP  135

Query  445  NLQHICLQTGRKHYIGPWESYLK  513
            NL+HI LQTGRKHY+GP+ESY K
Sbjct  136  NLKHISLQTGRKHYMGPFESYGK  158



>gb|AEO36946.1| progesterone 5beta-reductase [Erysimum scoparium]
Length=390

 Score =   235 bits (599),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 106/138 (77%), Positives = 123/138 (89%), Gaps = 0/138 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            L++D+    Y+SVALI+GVTGIVGNSLAEILPL+DTPGGPWKVYGVARRPRPSWNADHPI
Sbjct  16   LDDDEPSQSYESVALIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPSWNADHPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            +YIQCD+ N+E+A+SKLS LTDVTHVFYVTWT R  E +NCEANG MLRNV+ AI+P  P
Sbjct  76   DYIQCDVSNAEEARSKLSPLTDVTHVFYVTWTKRESESENCEANGSMLRNVLQAIVPHAP  135

Query  445  NLQHICLQTGRKHYIGPW  498
            NL+HICLQTG KHY+GP+
Sbjct  136  NLRHICLQTGTKHYVGPF  153



>ref|XP_010448593.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase [Camelina 
sativa]
Length=388

 Score =   234 bits (598),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            L++D+    Y+SVALI+GVTGIVGNSLAEILPL+DTPGGPWKVYGVARRPRPSWNADHPI
Sbjct  16   LDDDEPTQSYESVALIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPSWNADHPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            +YIQCD+ N++DA+SKLS LTDVTHVFYVTWTNR  E +NCEANG MLRNV+ A++P  P
Sbjct  76   DYIQCDVSNADDARSKLSPLTDVTHVFYVTWTNRESETENCEANGSMLRNVLRAVVPHAP  135

Query  445  NLQHICLQTGRKHYIGPW  498
            NL+H+CLQTG KHY+GP+
Sbjct  136  NLRHVCLQTGTKHYLGPF  153



>gb|AEO36945.1| progesterone 5beta-reductase [Erysimum albescens]
Length=390

 Score =   235 bits (599),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 106/138 (77%), Positives = 123/138 (89%), Gaps = 0/138 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            L++D+    Y+SVALI+GVTGIVGNSLAEILPL+DTPGGPWKVYGVARRPRPSWNADHPI
Sbjct  16   LDDDEPSQSYESVALIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPSWNADHPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            +YIQCD+ N+E+A+SKLS LTDVTHVFYVTWT R  E +NCEANG MLRNV+ AI+P  P
Sbjct  76   DYIQCDVSNAEEARSKLSPLTDVTHVFYVTWTKRESESENCEANGSMLRNVLQAIVPHAP  135

Query  445  NLQHICLQTGRKHYIGPW  498
            NL+HICLQTG KHY+GP+
Sbjct  136  NLRHICLQTGTKHYVGPF  153



>gb|AEZ01594.1| progesterone 5-beta-reductase [Erysimum cheiri]
Length=389

 Score =   234 bits (598),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 106/138 (77%), Positives = 123/138 (89%), Gaps = 0/138 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            L++D+    Y+SVALI+GVTGIVGNSLAEILPL+DTPGGPWKVYGVARRPRPSWNADHPI
Sbjct  16   LDDDEPTQSYESVALIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPSWNADHPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            +YIQCD+ N+E+A+SKLS LTDVTHVFYVTWT R  E +NCEANG MLRNV+ AI+P  P
Sbjct  76   DYIQCDVSNAEEARSKLSPLTDVTHVFYVTWTKRESESENCEANGSMLRNVLQAIVPHAP  135

Query  445  NLQHICLQTGRKHYIGPW  498
            NL+HICLQTG KHY+GP+
Sbjct  136  NLRHICLQTGTKHYLGPF  153



>gb|AEZ01593.1| progesterone 5-beta-reductase [Erysimum odoratum]
Length=389

 Score =   234 bits (598),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 123/138 (89%), Gaps = 0/138 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            L++D+    Y+SVAL++GVTGIVGNSLAEILPL+DTPGGPWKVYG ARRPRPSWNADHPI
Sbjct  16   LDDDEPSQSYESVALVIGVTGIVGNSLAEILPLSDTPGGPWKVYGAARRPRPSWNADHPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            +YIQCD+ N+E+A+SKLS LTDVTHVFYVTWTNR  E +NCEANG MLRNV+ AI+P  P
Sbjct  76   DYIQCDVSNAEEARSKLSPLTDVTHVFYVTWTNRESESENCEANGSMLRNVLQAIVPHAP  135

Query  445  NLQHICLQTGRKHYIGPW  498
            NL+HICLQTG KHY+GP+
Sbjct  136  NLRHICLQTGTKHYLGPF  153



>gb|ABF51668.1| progesterone 5-beta-reductase [Digitalis minor var. minor]
Length=389

 Score =   234 bits (598),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            LEEDDAPPK+ SVALIVGVTGI+GNSLAEILPLADTPGGPWKVYGVARR RP+W+ D+PI
Sbjct  16   LEEDDAPPKHSSVALIVGVTGIIGNSLAEILPLADTPGGPWKVYGVARRTRPAWHEDNPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
             YIQCDI + +D+Q+KLS LTDVTHVFYVTW NR  E +N EAN KM RNV++A+IP+CP
Sbjct  76   NYIQCDISDPDDSQAKLSPLTDVTHVFYVTWANRPTEPENREANSKMFRNVLDAVIPNCP  135

Query  445  NLQHICLQTGRKHYIGPWESYLK  513
            NL+HI LQTGRKHY+GP+ESY K
Sbjct  136  NLKHISLQTGRKHYMGPFESYGK  158



>ref|XP_006283899.1| hypothetical protein CARUB_v10005016mg [Capsella rubella]
 gb|EOA16797.1| hypothetical protein CARUB_v10005016mg [Capsella rubella]
Length=388

 Score =   234 bits (597),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            L+ED+    Y+SVALI+GVTGIVGNSLAEILPL+DTPGGPWKVYGVARRPRP+WNADHPI
Sbjct  16   LDEDEPTQSYESVALIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPNWNADHPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            +YIQCD+ +++DA+SKLS LTDVTHVFYVTWTNR  E +NCEANG MLRNV+ AI+P  P
Sbjct  76   DYIQCDVSDADDARSKLSPLTDVTHVFYVTWTNRESESENCEANGAMLRNVLRAIVPHAP  135

Query  445  NLQHICLQTGRKHYIGPW  498
            NL+H+CLQTG KHY+GP+
Sbjct  136  NLRHVCLQTGTKHYVGPF  153



>gb|KDP41649.1| hypothetical protein JCGZ_16056 [Jatropha curcas]
Length=390

 Score =   234 bits (597),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 106/139 (76%), Positives = 120/139 (86%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
             EEDDAP  YQSV L++GVTGIVGNSLAEILPL+DTPGGPWKVYGVARRPRP+WNADHPI
Sbjct  16   FEEDDAPRSYQSVGLVLGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPNWNADHPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            EYIQCDI +  + QSKLS LTDVTH+FYVTW NR+ E +NCE NG M RNV+ A+IP+ P
Sbjct  76   EYIQCDISDQAETQSKLSQLTDVTHIFYVTWANRSSEAENCEINGLMFRNVLQAVIPNAP  135

Query  445  NLQHICLQTGRKHYIGPWE  501
            NL HICLQTG KHY+GP+E
Sbjct  136  NLGHICLQTGTKHYLGPFE  154



>ref|XP_007223026.1| hypothetical protein PRUPE_ppa006894mg [Prunus persica]
 gb|EMJ24225.1| hypothetical protein PRUPE_ppa006894mg [Prunus persica]
Length=391

 Score =   234 bits (597),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 129/143 (90%), Gaps = 0/143 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
             +ED+AP   +SV L++GVTGIVGNSLAEILP++DTPGGPWKVYGVARRPRP+WNADHP+
Sbjct  16   FDEDEAPRSPESVGLVIGVTGIVGNSLAEILPISDTPGGPWKVYGVARRPRPNWNADHPV  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            EYIQCDI +++DA++KLS L+DVTH+FYVTWTNR+ E +NCEANG M RNV+N++IP+ P
Sbjct  76   EYIQCDISDADDAKAKLSPLSDVTHIFYVTWTNRSTEAENCEANGAMFRNVLNSVIPNAP  135

Query  445  NLQHICLQTGRKHYIGPWESYLK  513
            NL+H+CLQTG KHY+GP+E++ K
Sbjct  136  NLRHVCLQTGAKHYVGPFEAFGK  158



>gb|ADG56543.1| progesterone 5-beta-reductase [Erysimum x marshallii]
Length=389

 Score =   234 bits (596),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 106/138 (77%), Positives = 123/138 (89%), Gaps = 0/138 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            L++D+    Y+SVALI+GVTGIVGNSLAEILPL+DTPGGPWKVYGVARRPRPSWNADHPI
Sbjct  16   LDDDEPSRSYESVALIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPSWNADHPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            +YIQCD+ N+E+A+SKLS LTDVTHVFYVTWT R  E +NCEANG MLRNV+ AI+P  P
Sbjct  76   DYIQCDVSNAEEARSKLSPLTDVTHVFYVTWTKRESESENCEANGSMLRNVLQAIVPHAP  135

Query  445  NLQHICLQTGRKHYIGPW  498
            NL+HICLQTG KHY+GP+
Sbjct  136  NLRHICLQTGTKHYLGPF  153



>gb|KJB58603.1| hypothetical protein B456_009G217500 [Gossypium raimondii]
Length=391

 Score =   234 bits (596),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 123/139 (88%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
             EED+AP  +QSV LI+GVTGIVGNSLAEILPL+DTPGGPWKVYGVARRPRP+WNADHPI
Sbjct  16   FEEDEAPRSFQSVGLIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPNWNADHPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            EYIQCD+ +  D +SKLS LTDVTH+FYV+W NRT E +NCE NG MLRNV++++IP+ P
Sbjct  76   EYIQCDVSDPNDTESKLSQLTDVTHIFYVSWINRTSEAENCEINGSMLRNVLHSVIPNAP  135

Query  445  NLQHICLQTGRKHYIGPWE  501
            NL+HICLQTG KHY+GP+E
Sbjct  136  NLRHICLQTGAKHYLGPFE  154



>emb|CAN63254.1| hypothetical protein VITISV_028488 [Vitis vinifera]
Length=1000

 Score =   244 bits (624),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
             +EDDAP  +QSV L++GVTGIVGNSLAEILPL+DTPGGPWKVYGVARRPRP WNADHP+
Sbjct  626  FDEDDAPRGFQSVGLVIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPDWNADHPV  685

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            EYIQCDI +SEDA +KLS LTDVTHVFYVTWTNR  E +NCEANG MLRNV+ A+IP+ P
Sbjct  686  EYIQCDISDSEDALAKLSPLTDVTHVFYVTWTNRATEIENCEANGTMLRNVLRALIPNAP  745

Query  445  NLQHICLQTGRKHYIGPWESYLK  513
            NL+HICLQTG KHYIGP+E++ K
Sbjct  746  NLRHICLQTGGKHYIGPFEAFGK  768



>ref|NP_001078438.1| 3-oxo-Delta(4,5)-steroid 5-beta-reductase [Arabidopsis thaliana]
 gb|AEE84869.1| 3-oxo-Delta(4,5)-steroid 5-beta-reductase [Arabidopsis thaliana]
Length=387

 Score =   234 bits (596),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 123/138 (89%), Gaps = 0/138 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            L+ED+    ++SVALI+GVTGIVGNSLAEILPL+DTPGGPWKVYGVARRPRP+WNADHPI
Sbjct  15   LDEDEPSQSFESVALIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPTWNADHPI  74

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            +YIQCD+ ++ED +SKLS LTDVTHVFYVTWTNR  E +NCEANG MLRNV+ AIIP  P
Sbjct  75   DYIQCDVSDAEDTRSKLSPLTDVTHVFYVTWTNRESESENCEANGSMLRNVLQAIIPYAP  134

Query  445  NLQHICLQTGRKHYIGPW  498
            NL+H+CLQTG KHY+GP+
Sbjct  135  NLRHVCLQTGTKHYLGPF  152



>ref|NP_194153.1| 3-oxo-Delta(4,5)-steroid 5-beta-reductase [Arabidopsis thaliana]
 sp|Q9STX2.1|VEP1_ARATH RecName: Full=3-oxo-Delta(4,5)-steroid 5-beta-reductase; AltName: 
Full=Delta(4)-3-oxosteroid 5-beta-reductase; AltName: Full=Delta-4,5-steroid 
5-beta-reductase; Short=At5beta-StR; AltName: 
Full=Progesterone 5-beta-reductase; Short=5beta-POR; 
AltName: Full=Protein VEIN PATTERNING 1 [Arabidopsis thaliana]
 emb|CAB45057.1| putative protein [Arabidopsis thaliana]
 emb|CAB79332.1| putative protein [Arabidopsis thaliana]
 gb|AAL32529.1| putative protein [Arabidopsis thaliana]
 gb|AAM64873.1| induced upon wounding stress [Arabidopsis thaliana]
 gb|AAP37838.1| At4g24220 [Arabidopsis thaliana]
 gb|ABU55811.1| progesterone 5-beta-reductase [Arabidopsis thaliana]
 gb|AEE84868.1| 3-oxo-Delta(4,5)-steroid 5-beta-reductase [Arabidopsis thaliana]
Length=388

 Score =   234 bits (596),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 123/138 (89%), Gaps = 0/138 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            L+ED+    ++SVALI+GVTGIVGNSLAEILPL+DTPGGPWKVYGVARRPRP+WNADHPI
Sbjct  16   LDEDEPSQSFESVALIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPTWNADHPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            +YIQCD+ ++ED +SKLS LTDVTHVFYVTWTNR  E +NCEANG MLRNV+ AIIP  P
Sbjct  76   DYIQCDVSDAEDTRSKLSPLTDVTHVFYVTWTNRESESENCEANGSMLRNVLQAIIPYAP  135

Query  445  NLQHICLQTGRKHYIGPW  498
            NL+H+CLQTG KHY+GP+
Sbjct  136  NLRHVCLQTGTKHYLGPF  153



>gb|ABB36653.1| progesterone 5beta-reductase [Isoplexis isabelliana]
Length=389

 Score =   234 bits (596),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            LEEDDAP K+ SVALIVGVTGI+GNSLAEILPLADTPGGPWKVYGVARR RP+W+ D+PI
Sbjct  16   LEEDDAPSKHSSVALIVGVTGIIGNSLAEILPLADTPGGPWKVYGVARRTRPAWHEDNPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
             Y+QCDI + +D+Q+KLS LTDVTHVFYVTW NR+ E +N EAN KM RNV++A+IP+CP
Sbjct  76   NYVQCDISDPDDSQAKLSHLTDVTHVFYVTWANRSTEQENREANSKMFRNVLDAVIPNCP  135

Query  445  NLQHICLQTGRKHYIGPWESYLK  513
            NL+HI LQTGRKHY+GP+ESY K
Sbjct  136  NLKHISLQTGRKHYMGPFESYGK  158



>gb|AEY82380.1| putative progesterone 5-beta-reductase [Lunaria annua]
Length=389

 Score =   233 bits (595),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 106/143 (74%), Positives = 126/143 (88%), Gaps = 0/143 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
             EED+    Y+SVALI+GVTGIVGNSLAEILPL+DTPGGPWKVYGVARRPRPSWNADHPI
Sbjct  16   FEEDEPTQSYESVALIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPSWNADHPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            +YIQCD+ +++DA+SKLS LTDVTHVFYVTWTNR  E  +CEANG MLRNV+ AI+P+ P
Sbjct  76   DYIQCDVSDADDARSKLSPLTDVTHVFYVTWTNRPSEHDSCEANGSMLRNVLRAIVPNAP  135

Query  445  NLQHICLQTGRKHYIGPWESYLK  513
            NL+H+CLQTG KHY+GP+++  K
Sbjct  136  NLRHVCLQTGTKHYLGPFDNLGK  158



>gb|AHZ44504.1| putative progesterone 5 beta-reductase [Cochlearia officinalis]
Length=389

 Score =   233 bits (595),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 106/143 (74%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            ++ED+    Y+SVALI+GVTGIVGNSLAEILPL+DTPGGPWKVYGVARRPRPSWN+DHPI
Sbjct  16   IDEDEPIQTYESVALIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPSWNSDHPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            +YIQCD+ ++EDA+SKLS LTDVTHVFYVTWT R  E +NCEANG MLRNV+ A++P  P
Sbjct  76   DYIQCDVSDAEDARSKLSPLTDVTHVFYVTWTKRESETENCEANGSMLRNVLRAVVPHAP  135

Query  445  NLQHICLQTGRKHYIGPWESYLK  513
            NL H+CLQTG KHYIGP+E+  K
Sbjct  136  NLVHVCLQTGTKHYIGPFENIGK  158



>gb|AAU88205.1| progesterone 5-beta-reductase [Digitalis thapsi]
Length=389

 Score =   233 bits (594),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 126/143 (88%), Gaps = 0/143 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            LEEDDAPPK+ SVALIVGVTGI+GNSLAEILPLADTPGGPWKVYGVARR RP+W+  +PI
Sbjct  16   LEEDDAPPKHSSVALIVGVTGIIGNSLAEILPLADTPGGPWKVYGVARRTRPAWHEGNPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
             YIQCDI + +D+ +KLS L DVTHVFYVTW NR+ E +NCEAN KM RNV++A+IP+CP
Sbjct  76   NYIQCDISDPDDSLAKLSPLADVTHVFYVTWANRSTEPENCEANSKMFRNVLDAVIPNCP  135

Query  445  NLQHICLQTGRKHYIGPWESYLK  513
            NL+HI LQTGRKHY+GP+ESY K
Sbjct  136  NLKHISLQTGRKHYMGPFESYGK  158



>ref|XP_010111562.1| hypothetical protein L484_011348 [Morus notabilis]
 gb|EXC31269.1| hypothetical protein L484_011348 [Morus notabilis]
Length=389

 Score =   233 bits (594),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 106/143 (74%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
             EE++AP  YQSV L+VGVTGIVGNSLAEILPL+DTPGGPWKVYGV RRPRP+WNADHPI
Sbjct  16   FEENEAPISYQSVGLVVGVTGIVGNSLAEILPLSDTPGGPWKVYGVGRRPRPNWNADHPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            EYIQCDI + ED  +KLS LTDVTH+FYVTW NR  E +NCE NG M  NV+ A+IP+ P
Sbjct  76   EYIQCDISDPEDTNTKLSTLTDVTHIFYVTWANRATEVENCEVNGAMFHNVLRALIPNAP  135

Query  445  NLQHICLQTGRKHYIGPWESYLK  513
            NL HICLQTG KHYIGP+ES+ K
Sbjct  136  NLSHICLQTGTKHYIGPFESFGK  158



>ref|XP_004152001.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Cucumis 
sativus]
 ref|XP_004163586.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Cucumis 
sativus]
 gb|KGN58303.1| hypothetical protein Csa_3G610790 [Cucumis sativus]
Length=394

 Score =   233 bits (594),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
             EED+ P  ++SVAL++GVTGIVGNSLAEILPL+DTPGGPWKVYGVARRPRP+WNADHPI
Sbjct  16   FEEDEPPRSFESVALVIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPAWNADHPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            EYIQCD+ + +DA++KLS L DVTH+FYVTWTNRT E +NCEAN KMLRNV+ ++IP+ P
Sbjct  76   EYIQCDVSDPQDAETKLSQLADVTHLFYVTWTNRTTEIENCEANVKMLRNVLRSVIPNAP  135

Query  445  NLQHICLQTGRKHYIGPWESYL  510
            NL+HICLQTG KHY+G +ES +
Sbjct  136  NLRHICLQTGTKHYVGSFESII  157



>gb|AIW09146.1| progesterone 5-beta-reductase 4 [Catharanthus roseus]
Length=390

 Score =   233 bits (594),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
              ED+AP  +QSVALIVGVTGIVGNSLAEILPL+DTPGGPWKVYGVARRPRP+WNADHP+
Sbjct  16   FNEDEAPKNFQSVALIVGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPAWNADHPV  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            EYIQCD+ NS++ Q+K+S LTDVTH+F+ TW NR  E Q CE NG M +NVVNA++P+ P
Sbjct  76   EYIQCDVYNSDETQAKISPLTDVTHIFWTTWANRPTEAQCCEVNGTMFQNVVNALLPNAP  135

Query  445  NLQHICLQTGRKHYIGPWESYLK  513
            NL HIC+QTG KHYIGP+E++ K
Sbjct  136  NLSHICIQTGHKHYIGPFEAFGK  158



>ref|XP_006284965.1| hypothetical protein CARUB_v10006268mg [Capsella rubella]
 gb|EOA17863.1| hypothetical protein CARUB_v10006268mg [Capsella rubella]
Length=388

 Score =   233 bits (593),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 103/138 (75%), Positives = 123/138 (89%), Gaps = 0/138 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            L+ED+    Y+SVALI+GVTGIVGNSLAEILPL+DTPGGPWKVYGVARRPRP+WNADHPI
Sbjct  16   LDEDEPTQSYESVALIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPNWNADHPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            +YIQCD+ ++E+ +SK+S LTDVTHVFYVTWTNR  E +NCEANG MLRNV+ AI+P  P
Sbjct  76   DYIQCDVSDAEETRSKISTLTDVTHVFYVTWTNRESESENCEANGAMLRNVLRAIVPHAP  135

Query  445  NLQHICLQTGRKHYIGPW  498
            NL+H+CLQTG KHY+GP+
Sbjct  136  NLRHVCLQTGTKHYVGPF  153



>emb|CAA68126.1| unnamed protein product [Arabidopsis thaliana]
Length=386

 Score =   233 bits (593),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 104/138 (75%), Positives = 122/138 (88%), Gaps = 0/138 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            L+ED+    ++SVALI+GVT IVGNSLAEILPL+DTPGGPWKVYGVARRPRP+WNADHPI
Sbjct  16   LDEDEPSQSFESVALIIGVTAIVGNSLAEILPLSDTPGGPWKVYGVARRPRPTWNADHPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            +YIQCD+ ++ED +SKLS LTDVTHVFYVTWTNR  E +NCEANG MLRNV+ AIIP  P
Sbjct  76   DYIQCDVSDAEDTRSKLSPLTDVTHVFYVTWTNRESESENCEANGSMLRNVLQAIIPYAP  135

Query  445  NLQHICLQTGRKHYIGPW  498
            NL+H+CLQTG KHY+GP+
Sbjct  136  NLRHVCLQTGTKHYLGPF  153



>gb|AAU88203.1| progesterone 5-beta-reductase [Digitalis purpurea subsp. heywoodii]
Length=389

 Score =   233 bits (593),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            LEEDDAPPK+ SVALIVGVTGI+GNSLAEILPLADTPGGPWKVYGVARR RP+W+ D+PI
Sbjct  16   LEEDDAPPKHSSVALIVGVTGIIGNSLAEILPLADTPGGPWKVYGVARRTRPAWHEDNPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
             YIQCDI + +D+ +KLS LTDVTHVFYVT  NR+ E +NCEAN KM RNV++A+IP+CP
Sbjct  76   NYIQCDISDPDDSLAKLSPLTDVTHVFYVTCANRSTEPENCEANSKMFRNVLDAVIPNCP  135

Query  445  NLQHICLQTGRKHYIGPWESYLK  513
            NL+HI LQTGRKHY+GP+ESY K
Sbjct  136  NLKHISLQTGRKHYMGPFESYGK  158



>gb|AGM16376.1| putative progesterone 5-beta-reductase [Cakile maritima]
Length=389

 Score =   232 bits (592),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 102/138 (74%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
             ++D+    Y+SVALI+GVTGIVGNSLAEILPL+DTPGGPWKVYGVARRPRP+WNADHPI
Sbjct  16   FDDDEPTQSYESVALIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPAWNADHPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            +YIQCD+ +++D +SKLS LTDVTHVFYVTWTNR+ E +NCEANG MLRNV+ A++P+ P
Sbjct  76   DYIQCDVSDADDVRSKLSPLTDVTHVFYVTWTNRSSESENCEANGNMLRNVLRAVVPNAP  135

Query  445  NLQHICLQTGRKHYIGPW  498
            NL+H+CLQTG KHYIGP+
Sbjct  136  NLRHVCLQTGTKHYIGPF  153



>gb|AEX31541.1| putative steroid 5beta-reductase [Armoracia rusticana]
Length=388

 Score =   232 bits (592),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            L+ED+    Y+SVALI+GVTGIVGNSLAEILPL+DTPGGPWKVYGVARRPRPSWNADHPI
Sbjct  16   LDEDEPTQTYESVALIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPSWNADHPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            +YIQCD+ +++DA+SKLS LTDVTHVFYVTWT+R  E  NCEANG MLRNV+ AI+P  P
Sbjct  76   DYIQCDVSDADDARSKLSPLTDVTHVFYVTWTSRESEHDNCEANGSMLRNVLQAIVPHAP  135

Query  445  NLQHICLQTGRKHYIGPWES  504
            +L+H+CLQTG KHYIGP+++
Sbjct  136  DLRHVCLQTGTKHYIGPFDN  155



>gb|AHI88614.1| putative progesterone 5-beta-reductase [Hesperis matronalis]
Length=388

 Score =   232 bits (592),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            LEED+    Y+SVALI+GVTGIVGNSLAEILPL+DTPGGPWKVYGVARRPRPSWNADHPI
Sbjct  16   LEEDEPTQSYESVALIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPSWNADHPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            +YIQCDI ++E A+SKLS L DVTHVFY TWTNR  E  NCEANG MLRNV+ AI+P  P
Sbjct  76   DYIQCDISDAEGARSKLSPLADVTHVFYATWTNRPSERDNCEANGSMLRNVLRAIVPHAP  135

Query  445  NLQHICLQTGRKHYIGPWESYLK  513
            NL+HICLQTG KHY+GP+++  K
Sbjct  136  NLRHICLQTGTKHYLGPFDNLGK  158



>gb|ADG46028.1| putative progesterone 5-beta-reductase [Calotropis procera]
Length=387

 Score =   232 bits (592),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 121/138 (88%), Gaps = 0/138 (0%)
 Frame = +1

Query  100  APPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPIEYIQC  279
            A  K+QSV LI+GVTGIVGNSLAEILPL+DTPGGPWKVYGVARRPRP+WNADHPIEY+QC
Sbjct  21   ALTKFQSVGLIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPAWNADHPIEYVQC  80

Query  280  DILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCPNLQHI  459
            DI N ED + KLS LTDVTHVFYVTW N++ E +NCE NGKML+NV++A+IP+CP LQHI
Sbjct  81   DIANREDTEEKLSKLTDVTHVFYVTWANKSNEIENCEVNGKMLKNVLDALIPNCPKLQHI  140

Query  460  CLQTGRKHYIGPWESYLK  513
            CLQTG KHY GP+E + K
Sbjct  141  CLQTGGKHYCGPFELFGK  158



>ref|XP_008220298.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like isoform 
X1 [Prunus mume]
 ref|XP_008220299.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like isoform 
X2 [Prunus mume]
 ref|XP_008220300.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like isoform 
X3 [Prunus mume]
Length=391

 Score =   232 bits (591),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 129/143 (90%), Gaps = 0/143 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
             +ED+AP   +SV L++GVTGIVGNSLAEILP++DTPGGPWKVYGVARRPRP+WNADHP+
Sbjct  16   FDEDEAPRSPESVGLVIGVTGIVGNSLAEILPISDTPGGPWKVYGVARRPRPNWNADHPV  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            EYIQCDI +++DA++KLS L+DVTH+FYVTWTNR+ E ++CEANG M RNV+N++IP+ P
Sbjct  76   EYIQCDISDADDAKAKLSPLSDVTHIFYVTWTNRSTEAESCEANGAMFRNVLNSVIPNAP  135

Query  445  NLQHICLQTGRKHYIGPWESYLK  513
            NL+H+CLQTG KHY+GP+E++ K
Sbjct  136  NLRHVCLQTGAKHYVGPFEAFGK  158



>emb|CDY03474.1| BnaC01g16080D [Brassica napus]
Length=389

 Score =   232 bits (591),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 125/138 (91%), Gaps = 1/138 (1%)
 Frame = +1

Query  91   EDDAPPK-YQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPIE  267
            +DD P + Y+SVALI+GVTGIVGNSLAEILPL+DTPGGPWKVYGVARRPRPSWNADHPI+
Sbjct  17   DDDEPTQTYESVALIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPSWNADHPID  76

Query  268  YIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCPN  447
            YIQCD+ + +D +SKLS LTDVTHVFYVTWTNR+ E +NCEANG MLRNV+ A++P+ PN
Sbjct  77   YIQCDVSDPDDVRSKLSPLTDVTHVFYVTWTNRSSEGENCEANGSMLRNVLRAVVPNAPN  136

Query  448  LQHICLQTGRKHYIGPWE  501
            L+H+CLQTG KHYIGP++
Sbjct  137  LRHVCLQTGTKHYIGPFK  154



>gb|AGL96526.1| putative progesterone 5-beta-reductase, partial [Brassica rapa 
subsp. pekinensis]
Length=390

 Score =   231 bits (590),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 102/140 (73%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
             +ED+    Y+SVALI+GVTGIVGNSLAEILPL+DTPGGPWKVYGVARRPRP+WNADHPI
Sbjct  16   FDEDEPTQTYESVALIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPTWNADHPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            +YIQCD+ + EDA+SKLS L DVTHVFYVTWTNR+ E  NC+ NG MLRNV+ A++P+ P
Sbjct  76   DYIQCDVSDEEDARSKLSSLKDVTHVFYVTWTNRSSEVDNCKVNGSMLRNVLRAVVPNAP  135

Query  445  NLQHICLQTGRKHYIGPWES  504
            NL+H+CLQTG KHY+GP++S
Sbjct  136  NLRHVCLQTGTKHYLGPFDS  155



>ref|XP_010059860.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase [Eucalyptus 
grandis]
 gb|KCW66304.1| hypothetical protein EUGRSUZ_F00129 [Eucalyptus grandis]
Length=392

 Score =   231 bits (590),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            ++E++AP  +QSV LI+GVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRP+WNADHPI
Sbjct  16   IDEEEAPKGFQSVGLILGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPAWNADHPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            EYIQCD+ +  DAQ+KLS LTDVTHVFYVTW N + E++NC  NG M RN + A++P+ P
Sbjct  76   EYIQCDLADEADAQAKLSPLTDVTHVFYVTWANLSSEEENCRVNGAMFRNALQALVPNAP  135

Query  445  NLQHICLQTGRKHYIGPWESYLK  513
            NL+H+CLQTG KHY+GP+E+Y K
Sbjct  136  NLRHVCLQTGTKHYLGPFEAYGK  158



>emb|CDY08911.1| BnaC08g11410D [Brassica napus]
Length=390

 Score =   231 bits (590),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 102/140 (73%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
             +ED+    Y+SVALI+GVTGIVGNSLAEILPL+DTPGGPWKVYGVARRPRP+WNADHPI
Sbjct  16   FDEDEPTQTYESVALIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPTWNADHPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            +YIQCD+ + EDA+SKLS L DVTHVFYVTWTNR+ E +NC+ NG MLRNV+ A++P+ P
Sbjct  76   DYIQCDVSDEEDARSKLSPLRDVTHVFYVTWTNRSVESENCKVNGSMLRNVLRAVVPNAP  135

Query  445  NLQHICLQTGRKHYIGPWES  504
            NL+H+CLQTG KHY+GP++S
Sbjct  136  NLRHVCLQTGTKHYLGPFDS  155



>gb|ADG56542.1| progesterone 5-beta-reductase [Erysimum capitatum var. purshii]
Length=389

 Score =   231 bits (590),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 122/138 (88%), Gaps = 0/138 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            L++D+    Y+SVALI+GVTGIVGNSLAEILPL+DTPGGPWKVYGVARRP PSWNADHPI
Sbjct  16   LDDDEPSQSYESVALIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPVPSWNADHPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            +YIQCD+ N+E+A+SKLS LTDVTHVFYVTWT R  E +NCEANG MLRNV+ AI+P  P
Sbjct  76   DYIQCDVSNAEEARSKLSPLTDVTHVFYVTWTKRESESENCEANGSMLRNVLQAIVPHAP  135

Query  445  NLQHICLQTGRKHYIGPW  498
            NL+HICLQTG KHY+GP+
Sbjct  136  NLRHICLQTGTKHYLGPF  153



>gb|ADG56539.1| progesterone 5-beta-reductase [Hoya carnosa]
Length=387

 Score =   231 bits (589),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 105/139 (76%), Positives = 123/139 (88%), Gaps = 0/139 (0%)
 Frame = +1

Query  97   DAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPIEYIQ  276
            +AP KYQSVALI+GVTGIVG+SLAEILPL+DTPGGPWKVYGVARRPRP+WNAD PIEY+Q
Sbjct  20   EAPSKYQSVALIIGVTGIVGSSLAEILPLSDTPGGPWKVYGVARRPRPAWNADCPIEYVQ  79

Query  277  CDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCPNLQH  456
            CDI N ED +SKLS LTDVTHVFYVTW +++ E +NCE NGKM +N ++A+IP+CPNLQH
Sbjct  80   CDIGNREDTESKLSKLTDVTHVFYVTWASKSNEIENCEVNGKMFKNALDALIPNCPNLQH  139

Query  457  ICLQTGRKHYIGPWESYLK  513
            ICLQTG KHY GP+E + K
Sbjct  140  ICLQTGGKHYAGPFELWGK  158



>gb|AFZ42259.1| putative progesterone 5-beta-reductase [Aethionema grandiflorum]
Length=388

 Score =   231 bits (589),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 123/142 (87%), Gaps = 2/142 (1%)
 Frame = +1

Query  94   DDAPP--KYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPIE  267
            DD  P   YQSVALI+GVTGIVGNSLAEILPL+DTPGGPWKVYGVARRPRP+WN DHPIE
Sbjct  17   DDYEPTQSYQSVALIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPNWNTDHPIE  76

Query  268  YIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCPN  447
            YIQCDI N+E+A+SKLS LTDVTHVFYVTWT R+ E +NCEANG MLRNV+ A+IP   N
Sbjct  77   YIQCDISNAEEARSKLSPLTDVTHVFYVTWTQRSTELENCEANGSMLRNVLQAVIPHASN  136

Query  448  LQHICLQTGRKHYIGPWESYLK  513
            LQH+CLQTG KHY+GP+++  K
Sbjct  137  LQHVCLQTGTKHYVGPFDNLGK  158



>gb|AEO36947.1| progesterone 5beta-reductase [Erysimum caboverdeanum]
Length=390

 Score =   231 bits (589),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 122/138 (88%), Gaps = 0/138 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            L++D+    Y+SVALI+GVTGIVGNSLAEILPL+DTPGGPWKVYGVARRPRPSWNADHPI
Sbjct  16   LDDDEPSQSYESVALIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPSWNADHPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            +YIQCD+ N+E+A+SKLS LTDV HVFYVTWT R  E +NCEANG MLRNV+ AI+P  P
Sbjct  76   DYIQCDVSNAEEARSKLSPLTDVIHVFYVTWTKRESECENCEANGSMLRNVLQAIVPHAP  135

Query  445  NLQHICLQTGRKHYIGPW  498
            NL+HICLQTG KHY+GP+
Sbjct  136  NLRHICLQTGTKHYVGPF  153



>gb|ADG56538.1| progesterone 5-beta-reductase [Asclepias curassavica]
Length=387

 Score =   230 bits (587),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 103/138 (75%), Positives = 120/138 (87%), Gaps = 0/138 (0%)
 Frame = +1

Query  100  APPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPIEYIQC  279
            A  K+QSV L++GVTGIVGNSLAEILPL+DTPGGPWKVYGVARRPRP+WNADHPIEY+QC
Sbjct  21   ALTKFQSVGLVIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPAWNADHPIEYVQC  80

Query  280  DILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCPNLQHI  459
            DI N ED + KLS LTDVTHVFYVTW N++ E +NCE NGKML+NV++ +IP+CP LQH+
Sbjct  81   DIANREDTEEKLSKLTDVTHVFYVTWANKSNEIENCEVNGKMLKNVLDVLIPNCPKLQHV  140

Query  460  CLQTGRKHYIGPWESYLK  513
            CLQTG KHY GP+E Y K
Sbjct  141  CLQTGGKHYCGPFELYGK  158



>ref|XP_009137807.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase [Brassica 
rapa]
 emb|CDY34267.1| BnaA01g13700D [Brassica napus]
Length=390

 Score =   230 bits (587),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 124/138 (90%), Gaps = 1/138 (1%)
 Frame = +1

Query  91   EDDAPPK-YQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPIE  267
            +DD P + Y+SVALI+GVTGIVGNSLAEILPL+DTPGGPWKVYGVARRPRPSWNADHPI+
Sbjct  17   DDDEPTQTYESVALIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPSWNADHPID  76

Query  268  YIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCPN  447
            YIQCD+ + +D +SKLS LTDVTHVFYVTWTNR+ E +NCEANG MLRNV+ A++P  PN
Sbjct  77   YIQCDVSDPDDVRSKLSPLTDVTHVFYVTWTNRSTERENCEANGTMLRNVLRAVVPHAPN  136

Query  448  LQHICLQTGRKHYIGPWE  501
            L+H+CLQTG KHYIGP++
Sbjct  137  LRHVCLQTGTKHYIGPFK  154



>ref|XP_009109253.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase [Brassica 
rapa]
 emb|CDY24831.1| BnaA08g14790D [Brassica napus]
Length=390

 Score =   230 bits (587),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 102/140 (73%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
             +ED+    Y+SVALI+GVTGIVGNSLAEILPL+DTPGGPWKVYGVARRPRP+WNADHPI
Sbjct  16   FDEDEPTQTYESVALIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPTWNADHPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            +YIQCD+ + EDA+SKLS L DVTHVFYVTWTNR+ E  NC+ NG MLRNV+ A++P+ P
Sbjct  76   DYIQCDVSDEEDARSKLSPLKDVTHVFYVTWTNRSSEVDNCKVNGSMLRNVLRAVVPNAP  135

Query  445  NLQHICLQTGRKHYIGPWES  504
            NL+H+CLQTG KHY+GP++S
Sbjct  136  NLRHVCLQTGTKHYLGPFDS  155



>gb|AHZ44508.1| putative progesterone 5 beta-reductase [Stellaria media]
Length=390

 Score =   230 bits (587),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = +1

Query  88   EEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPIE  267
            E+DD P  YQSV LIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRP WN DHPI+
Sbjct  18   EDDDEPQSYQSVGLIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPEWNTDHPIQ  77

Query  268  YIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCPN  447
            YIQCD+ + +DA SKLS LTDVTH+FYVTWT ++ E +NC AN  MLRNV+ A+IP+ PN
Sbjct  78   YIQCDVSDPDDALSKLSPLTDVTHIFYVTWTTKSSEIENCRANVSMLRNVLQAVIPNAPN  137

Query  448  LQHICLQTGRKHYIGPWESYLK  513
            +QH+CLQTG KHY+GP++S+ K
Sbjct  138  IQHVCLQTGAKHYVGPFDSFGK  159



>ref|XP_004299763.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Fragaria 
vesca subsp. vesca]
Length=390

 Score =   230 bits (587),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            L ED+ P   QSV L++GVTGIVGNSLAEILPL+DTPGGPWKVYGVARRPRP+WNADHP+
Sbjct  16   LVEDEGPRTPQSVGLVIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPNWNADHPV  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            EYIQCD+ +++DA+ KLS LTDVTH+FYVTWTNR+ E +NCEAN  MLRNV+ ++IP+ P
Sbjct  76   EYIQCDVSDADDAKGKLSPLTDVTHIFYVTWTNRSTEAENCEANAAMLRNVLGSVIPNAP  135

Query  445  NLQHICLQTGRKHYIGPWESYLK  513
            NL+HICLQTG KHYIG +ES+ K
Sbjct  136  NLKHICLQTGAKHYIGSFESWGK  158



>gb|ADG56546.1| progesterone 5-beta-reductase [Gomphocarpus fruticosus]
Length=388

 Score =   230 bits (586),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 103/138 (75%), Positives = 120/138 (87%), Gaps = 0/138 (0%)
 Frame = +1

Query  100  APPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPIEYIQC  279
            A  K+QSV LI+GVTGIVGNSLAEILPL+DTPGGPWKVYGVARRPRP+WNADHPIEY+QC
Sbjct  22   ALTKFQSVGLIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPAWNADHPIEYVQC  81

Query  280  DILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCPNLQHI  459
            DI N ED + KLS LTDVTHVFYVTW N++ E +NCE NGKML+NV++ ++P+CP LQH+
Sbjct  82   DIANREDTEEKLSKLTDVTHVFYVTWANKSNEIENCEVNGKMLKNVLDVLVPNCPKLQHV  141

Query  460  CLQTGRKHYIGPWESYLK  513
            CLQTG KHY GP+E Y K
Sbjct  142  CLQTGGKHYCGPFELYGK  159



>gb|EYU37597.1| hypothetical protein MIMGU_mgv11b006498mg [Erythranthe guttata]
Length=391

 Score =   230 bits (586),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            +EED+ P K++ VALIVGVTGIVGNSLAEILP +DTPGGPWK+YGVARRPRP+WNAD+P+
Sbjct  16   IEEDEPPQKHEGVALIVGVTGIVGNSLAEILPHSDTPGGPWKIYGVARRPRPTWNADNPV  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
             YIQCDI + ED + KLS LTD+THVFYVTW N++ E +NCE NGKML+N+++A+IP+ P
Sbjct  76   NYIQCDISDPEDTRVKLSPLTDITHVFYVTWANKSTEAENCEVNGKMLQNLLDAVIPNSP  135

Query  445  NLQHICLQTGRKHYIGPWESYLK  513
            NL+HICLQTGRKHYIGP+ES+ K
Sbjct  136  NLKHICLQTGRKHYIGPFESFGK  158



>gb|ABA77557.1| progesterone 5-beta-reductase [Digitalis ciliata]
Length=389

 Score =   229 bits (585),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 107/143 (75%), Positives = 126/143 (88%), Gaps = 0/143 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            LEED AP K+ SVAL+VGVTGI+GNSLAEILPLADTPGGPWKVYGVARR RP+ + D+PI
Sbjct  16   LEEDGAPTKHSSVALLVGVTGIIGNSLAEILPLADTPGGPWKVYGVARRTRPARHEDNPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
             YIQCDI + +D+Q+KLS LTDVTHVFYVTW NR+ E +NCEAN KM RNV++A+IP+CP
Sbjct  76   NYIQCDISDPDDSQAKLSPLTDVTHVFYVTWANRSTEQENCEANSKMFRNVLDAVIPNCP  135

Query  445  NLQHICLQTGRKHYIGPWESYLK  513
            NL+HI LQTGRKHY+GP+ESY K
Sbjct  136  NLKHISLQTGRKHYMGPFESYGK  158



>ref|XP_004289734.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Fragaria 
vesca subsp. vesca]
Length=389

 Score =   229 bits (585),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 103/140 (74%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = +1

Query  94   DDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPIEYI  273
            DD PPKYQSVAL++GVTGIVGNSLAEILPL DTPGGPWKVYGVARRP+P WNADH I+YI
Sbjct  19   DDEPPKYQSVALVLGVTGIVGNSLAEILPLPDTPGGPWKVYGVARRPQPQWNADHHIQYI  78

Query  274  QCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCPNLQ  453
            QCD+ +SE  +++LS LTDVTH+FYVTW ++  E +NCEANGKML NV+NA+IP+ PNLQ
Sbjct  79   QCDLSDSEQTETELSQLTDVTHIFYVTWASKPSEAENCEANGKMLSNVLNAVIPNAPNLQ  138

Query  454  HICLQTGRKHYIGPWESYLK  513
            HIC+QTGRK Y+GP+E + K
Sbjct  139  HICMQTGRKQYVGPFEMFGK  158



>gb|KJB58604.1| hypothetical protein B456_009G217600 [Gossypium raimondii]
Length=391

 Score =   229 bits (585),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 102/139 (73%), Positives = 122/139 (88%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
             EED+AP   +SV LI+GVTGIVGNSLAEILPL+DTPGGPWKVYGVARRPRP+WNA+HPI
Sbjct  16   FEEDEAPKSLKSVGLIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPNWNANHPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            +YIQCD+ +  D +SKLS LTDVTH+FYV+WTNRT E +NCE NG MLRNV+ ++IP+ P
Sbjct  76   QYIQCDVSDPNDTESKLSQLTDVTHIFYVSWTNRTSEAENCEINGSMLRNVLRSVIPNAP  135

Query  445  NLQHICLQTGRKHYIGPWE  501
            NL+HICLQTG KHY+GP+E
Sbjct  136  NLRHICLQTGVKHYLGPFE  154



>gb|AHZ44509.1| putative progesterone 5 beta-reductase [Thlaspi arvense]
Length=389

 Score =   229 bits (584),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
             +ED+    Y+SVALI+GVTGIVGNSLAEILPL+DTPGGPWKVYGVAR PRPSWNADHPI
Sbjct  16   FDEDEPTQSYESVALIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARHPRPSWNADHPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            +YIQCD+ ++ED++SKLS LTDVTHVFYVTWTN + E   CEANG MLRNV+ AI+P+ P
Sbjct  76   DYIQCDVSDAEDSRSKLSPLTDVTHVFYVTWTNGSSERDICEANGSMLRNVLRAIVPNAP  135

Query  445  NLQHICLQTGRKHYIGPWESYLK  513
            NL+H+CLQTG KHYIGP++S  K
Sbjct  136  NLRHVCLQTGTKHYIGPFDSLEK  158



>gb|EPS65468.1| progesterone 5-beta-reductase [Genlisea aurea]
Length=390

 Score =   229 bits (584),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            L+EDDAPPK+QSVALI+GVTGIVGNSLAEILPL+DTPGGPWKVYGVARRPRP WN D+PI
Sbjct  16   LDEDDAPPKHQSVALIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPPWNEDNPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
             YIQCD+ + ED Q+KLS L+DVTH+FY TW N++ E +NCE N +M +NV++ IIPS P
Sbjct  76   TYIQCDVSDPEDTQAKLSPLSDVTHLFYATWANKSTEAENCEINSRMFQNVLDCIIPSSP  135

Query  445  NLQHICLQTGRKHYIGPWESYLK  513
            +L+HICL TGRKHYIGP+ES+ K
Sbjct  136  SLKHICLVTGRKHYIGPFESFGK  158



>gb|AFN22088.1| putative progesterone 5-beta-reductase [Draba aizoides]
Length=389

 Score =   229 bits (584),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
             E+D+    ++SVALI+GVTGIVGNSLAEILPL+DTPGGPWKVYGVARRPRPSWNADHPI
Sbjct  16   FEDDEPSQSFESVALIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPSWNADHPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            +YIQCD+ +++D +SKLS LTDVTHVFYVTWT+   E +NCEANG MLRNV+ A++P+  
Sbjct  76   DYIQCDVSDADDTKSKLSALTDVTHVFYVTWTSGDSESENCEANGTMLRNVLRAVVPNAA  135

Query  445  NLQHICLQTGRKHYIGPWESYL  510
            NL+H+CLQTG KHY+GP+++++
Sbjct  136  NLRHVCLQTGTKHYLGPFDTFV  157



>gb|AGT29341.1| putative progesterone 5-beta reductase [Cardamine pratensis]
Length=388

 Score =   229 bits (584),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 122/140 (87%), Gaps = 2/140 (1%)
 Frame = +1

Query  94   DDAPP--KYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPIE  267
            DD  P   Y+SVALIVGVTGIVGNSLAEILPL+DTPGGPWKVYGVARRPRPSWNADHPI+
Sbjct  17   DDYEPTQSYESVALIVGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPSWNADHPID  76

Query  268  YIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCPN  447
            YIQCD+ N +DA+SKLS LTDVTHVFYVTWT+R  E  NCEANG MLRNV+ AI+P  PN
Sbjct  77   YIQCDVSNEDDARSKLSPLTDVTHVFYVTWTSRESEHDNCEANGSMLRNVLRAIVPHAPN  136

Query  448  LQHICLQTGRKHYIGPWESY  507
            L+H+CLQT  KHYIGP++++
Sbjct  137  LRHVCLQTRTKHYIGPFDNH  156



>gb|EYU37596.1| hypothetical protein MIMGU_mgv1a007982mg [Erythranthe guttata]
Length=389

 Score =   229 bits (584),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            ++ED+   K+Q+VALI+GVTGIVGNSLAEILPL+DTPGGPWKVYGVARRPRP+WN D+PI
Sbjct  16   IDEDEPQQKHQAVALIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPTWNDDNPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
             YI+CDI + +D Q+KLS LTD+THVFYVTW NR+ E +NCE+NGKML+NV++ +IP+ P
Sbjct  76   NYIRCDISDPDDIQAKLSPLTDITHVFYVTWANRSTEVENCESNGKMLKNVLDVVIPNSP  135

Query  445  NLQHICLQTGRKHYIGPWESYLK  513
            NL+HICLQTGRKHYIGP+ESY K
Sbjct  136  NLKHICLQTGRKHYIGPFESYGK  158



>gb|AJE29749.1| putative progesterone 5-beta-reductase [Cucurbita pepo]
Length=393

 Score =   229 bits (583),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
             EED+ P  ++SVAL++GVTGIVGNSLAEILPL+DTPGGPWKVYGVARRPRP+WNADH I
Sbjct  16   FEEDEQPRSFESVALVIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPNWNADHLI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            EYIQCD+ + EDA++KLS LTDVTHVFYVTWTN   E +NCE NGKMLRNV+ ++IP+ P
Sbjct  76   EYIQCDVSDLEDAEAKLSKLTDVTHVFYVTWTNLPTEIENCEVNGKMLRNVLRSVIPNAP  135

Query  445  NLQHICLQTGRKHYIGPWESYL  510
            NL+HICLQTG KHYIG +E+ +
Sbjct  136  NLRHICLQTGTKHYIGSFENII  157



>ref|XP_008356369.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Malus 
domestica]
Length=391

 Score =   229 bits (583),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 102/139 (73%), Positives = 120/139 (86%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
             + +D PPKYQSVAL++GVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRP+WNADHP+
Sbjct  16   FDPNDVPPKYQSVALVLGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPAWNADHPV  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            EYIQCD+ +     S+LS LTDVTHVFYVTW ++  E +NCE NG M RN+++A+I + P
Sbjct  76   EYIQCDLSDPHQTHSQLSQLTDVTHVFYVTWASKPTEAENCEVNGNMFRNLLDAVISNAP  135

Query  445  NLQHICLQTGRKHYIGPWE  501
            NLQHICLQTGRKHYIGP+E
Sbjct  136  NLQHICLQTGRKHYIGPFE  154



>ref|XP_008447374.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase [Cucumis 
melo]
Length=393

 Score =   229 bits (583),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
             EED+ P  ++SVAL++GVTGIVGNSLAEILPL+DTPGGPWKVYGVARRPRP WNADHPI
Sbjct  16   FEEDEPPRSFESVALVIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPVWNADHPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            EYIQCD+ + +DA++KLS L DVTH+FYVTWTNRT E  NCEAN +MLRNV+ ++IP+ P
Sbjct  76   EYIQCDVSDPQDAETKLSQLADVTHLFYVTWTNRTIEIDNCEANVEMLRNVLRSVIPNAP  135

Query  445  NLQHICLQTGRKHYIGPWESYL  510
            NL+HICLQTG KHY+G +ES +
Sbjct  136  NLRHICLQTGTKHYVGSFESVI  157



>ref|XP_008393755.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Malus 
domestica]
Length=390

 Score =   228 bits (582),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
             +E++ P   QSV L++GVTGIVGNSLAEILPL+DTPGGPWKVYGVARRPRP+WNADHP+
Sbjct  16   FDEEEPPRXPQSVGLVIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPNWNADHPV  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            EYIQCDI + +DA++KLS LTDVTH+FYVTWTNR+ E +NCEAN  MLRNV+N++IP+ P
Sbjct  76   EYIQCDISDPDDAKTKLSPLTDVTHIFYVTWTNRSTEAENCEANAVMLRNVLNSVIPNAP  135

Query  445  NLQHICLQTGRKHYIGPWESYLK  513
             LQH+CLQTG KHY+GP+E + K
Sbjct  136  KLQHVCLQTGAKHYVGPFELFGK  158



>ref|XP_006847874.1| hypothetical protein AMTR_s00029p00093020 [Amborella trichopoda]
 gb|ERN09455.1| hypothetical protein AMTR_s00029p00093020 [Amborella trichopoda]
Length=389

 Score =   228 bits (582),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 102/139 (73%), Positives = 121/139 (87%), Gaps = 0/139 (0%)
 Frame = +1

Query  88   EEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPIE  267
            +ED+ P KYQSVAL+VGVTGIVGNSLAEILPL+DTPGGPWKVYGV RRP P W+ DHPIE
Sbjct  17   DEDEGPVKYQSVALVVGVTGIVGNSLAEILPLSDTPGGPWKVYGVGRRPCPKWSEDHPIE  76

Query  268  YIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCPN  447
            YIQCDILN E+  +KLS LTD+THVFYVTW +R  E +NC+ NG M RNV++A++P+ PN
Sbjct  77   YIQCDILNLEETTAKLSPLTDITHVFYVTWADRISEAENCDVNGHMFRNVLDALLPNAPN  136

Query  448  LQHICLQTGRKHYIGPWES  504
            LQHICLQTGRKHY+GP+E+
Sbjct  137  LQHICLQTGRKHYLGPFEA  155



>ref|XP_003638459.1| Progesterone 5-beta-reductase [Medicago truncatula]
 gb|KEH35787.1| 3-oxo-delta(4,5)-steroid 5-beta-reductase-like protein [Medicago 
truncatula]
Length=390

 Score =   228 bits (582),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 102/139 (73%), Positives = 121/139 (87%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
             +ED+APP +QSV LI+GVTGIVGNSLAEILPLADTPGG WKVYGVARRPRPSWNADHPI
Sbjct  16   FDEDEAPPTFQSVGLIIGVTGIVGNSLAEILPLADTPGGRWKVYGVARRPRPSWNADHPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            EYIQCDI +  + Q+KLSVLTDVTH+FYV+W+NR  E +NCE N  MLRNV+ A+IP+ P
Sbjct  76   EYIQCDITDPNETQTKLSVLTDVTHIFYVSWSNRPSEAENCEVNSAMLRNVLTAVIPNAP  135

Query  445  NLQHICLQTGRKHYIGPWE  501
            NL+H+ LQTG KHY+GP++
Sbjct  136  NLRHVSLQTGGKHYLGPFD  154



>ref|XP_007136738.1| hypothetical protein PHAVU_009G070100g [Phaseolus vulgaris]
 gb|ESW08732.1| hypothetical protein PHAVU_009G070100g [Phaseolus vulgaris]
Length=295

 Score =   225 bits (573),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
             EED+ P  ++SV L++GVTGIVGNSLAEILPL DTPGGPWKVYGVARRPRPSWNADHPI
Sbjct  16   FEEDEPPRSFESVGLVIGVTGIVGNSLAEILPLHDTPGGPWKVYGVARRPRPSWNADHPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            EY+QCD+ +  DA+SKLSVLTDVTHVF+V+WTNR  E +NCE NG ML+NV+ A+IP+ P
Sbjct  76   EYVQCDVSDPADAESKLSVLTDVTHVFFVSWTNRPTEAENCEVNGAMLQNVLRAVIPNAP  135

Query  445  NLQHICLQTGRKHYIGPWESYLK  513
            NL+H+ LQTG KHY+G +ES  K
Sbjct  136  NLRHVSLQTGTKHYLGSFESIGK  158



>gb|KDO81569.1| hypothetical protein CISIN_1g0159921mg, partial [Citrus sinensis]
Length=384

 Score =   228 bits (580),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
             EED+    YQSVALIVGVTGIVGNSLAEILPL DTPGGPWKVYGVARRP+P+WNADH +
Sbjct  3    FEEDEPARSYQSVALIVGVTGIVGNSLAEILPLPDTPGGPWKVYGVARRPKPNWNADHLV  62

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            EY+QCD+ + E+ Q+KLS LTDVTH+FYVTWTNR+ E +NC+ NG M RNV+ A+IP+ P
Sbjct  63   EYVQCDVSDPEETQAKLSQLTDVTHIFYVTWTNRSTEAENCKINGSMFRNVLRAVIPNAP  122

Query  445  NLQHICLQTGRKHYIGPWESYLK  513
            NL+H+CLQTG KHY+GP+E++ K
Sbjct  123  NLRHVCLQTGTKHYLGPFEAFGK  145



>gb|AFZ41789.1| putative progesterone 5-beta-reductase [Raphanus sativus]
Length=390

 Score =   228 bits (580),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = +1

Query  88   EEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPIE  267
            +ED+    Y+SVALI+GVTGIVGNSLAEILPL+DTPGGPWKVYGVARRPRP+WNADHPI+
Sbjct  17   DEDEPTQTYESVALIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPTWNADHPID  76

Query  268  YIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCPN  447
            YIQCD+ + EDA+SKLS L DVTHVFYVTW+NR+ E  NC+ NG MLRNV+ A++P+ PN
Sbjct  77   YIQCDVSDEEDARSKLSPLRDVTHVFYVTWSNRSSEVDNCKVNGSMLRNVLRAVVPNAPN  136

Query  448  LQHICLQTGRKHYIGPWESYLK  513
            L+H+CLQTG KHY+GP++S  K
Sbjct  137  LRHVCLQTGTKHYLGPFDSLGK  158



>ref|XP_011088173.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Sesamum 
indicum]
Length=373

 Score =   227 bits (579),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 122/133 (92%), Gaps = 0/133 (0%)
 Frame = +1

Query  115  QSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPIEYIQCDILNS  294
            +SVALI+GVTG+VGNSLAEILPL+DTPGGPWKVYGVARRPRPSW+ D+PI YIQCD+LN 
Sbjct  9    ESVALIIGVTGLVGNSLAEILPLSDTPGGPWKVYGVARRPRPSWSDDYPINYIQCDVLNR  68

Query  295  EDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCPNLQHICLQTG  474
            +D Q+KLS LTD THVFY TWTNR  E +NCEANG+ML+NV++A+IP+CPNL+HIC+QTG
Sbjct  69   DDTQAKLSTLTDNTHVFYATWTNRPTEAENCEANGRMLQNVLDAVIPNCPNLKHICMQTG  128

Query  475  RKHYIGPWESYLK  513
            RKHY+GP+E++ K
Sbjct  129  RKHYVGPFEAFGK  141



>gb|AGN74845.1| putative enone 5-beta-reductase [Lepidium sativum]
Length=392

 Score =   228 bits (580),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 102/140 (73%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            +++D+    Y+SVALI+GVTGIVGNSLAEILPL+DTPGGPWKVYGVARRPRP+WNADHPI
Sbjct  16   IDDDEPSQSYESVALIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPTWNADHPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            +YIQCD+ ++EDA+SKLS LTDVTHVFYVTWTNR  E +N EANG MLRNV+ AI+P   
Sbjct  76   DYIQCDVSDAEDARSKLSPLTDVTHVFYVTWTNRESESKNVEANGSMLRNVLQAIVPHAR  135

Query  445  NLQHICLQTGRKHYIGPWES  504
            NL+H+CLQTG KHY+GP+++
Sbjct  136  NLRHVCLQTGTKHYLGPFDN  155



>gb|AHZ44505.1| putative progesterone 5 beta-reductase [Erophila verna]
Length=387

 Score =   227 bits (579),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 100/140 (71%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            LE+D+    ++SVALI+GVTGIVGNSLAEILPL+DTPGGPWKVYGVARRPRPSWNADHPI
Sbjct  16   LEDDEPSQSFESVALIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPSWNADHPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            EYIQCD+ ++ED +SKLSVL+DVTHVFYVTWT    E +NCEANG ML+NV+ +++P   
Sbjct  76   EYIQCDVSDAEDCKSKLSVLSDVTHVFYVTWTKGASEKENCEANGNMLKNVLRSVVPYAV  135

Query  445  NLQHICLQTGRKHYIGPWES  504
            NL+H+CLQTG KHY+GP+++
Sbjct  136  NLRHVCLQTGTKHYVGPFDN  155



>ref|XP_009360382.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Pyrus 
x bretschneideri]
Length=390

 Score =   227 bits (579),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
             +E++ P   QSV L++GVTGIVGNSLAEILPL+DTPGGPWKVYGVARRPRP+WNADHP+
Sbjct  16   FDEEEPPRTPQSVGLVIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPNWNADHPV  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            EYIQCDI + +DA++KLS +TDVTH+FYVTWTNR+ E +NCEAN  MLRNV+N++IP+ P
Sbjct  76   EYIQCDISDPDDAKTKLSPITDVTHIFYVTWTNRSTEAENCEANAVMLRNVLNSVIPNAP  135

Query  445  NLQHICLQTGRKHYIGPWESYLK  513
             LQH+CLQTG KHY+GP+E + K
Sbjct  136  KLQHVCLQTGAKHYVGPFELFGK  158



>ref|XP_008393756.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Malus 
domestica]
Length=390

 Score =   227 bits (579),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = +1

Query  88   EEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPIE  267
            +ED+ P   +SV L++GVTGIVGNSLAEILPL+DTPGGPWKVYGVARRPRP+W+ADHPIE
Sbjct  17   DEDEQPRAPESVGLVIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPNWSADHPIE  76

Query  268  YIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCPN  447
            Y+QCD+ + EDA++KLS LTDVTH+FYVTW NR+ E +NCE NG MLRNV+ ++IP+ PN
Sbjct  77   YVQCDVSDPEDAKTKLSPLTDVTHIFYVTWANRSTEVENCEVNGNMLRNVLESVIPNAPN  136

Query  448  LQHICLQTGRKHYIGPWESYLK  513
            L+HICLQTG KHY+GP+ES+ K
Sbjct  137  LRHICLQTGGKHYLGPFESFGK  158



>gb|KDO81568.1| hypothetical protein CISIN_1g0159921mg [Citrus sinensis]
Length=396

 Score =   227 bits (579),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
             EED+    YQSVALIVGVTGIVGNSLAEILPL DTPGGPWKVYGVARRP+P+WNADH +
Sbjct  15   FEEDEPARSYQSVALIVGVTGIVGNSLAEILPLPDTPGGPWKVYGVARRPKPNWNADHLV  74

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            EY+QCD+ + E+ Q+KLS LTDVTH+FYVTWTNR+ E +NC+ NG M RNV+ A+IP+ P
Sbjct  75   EYVQCDVSDPEETQAKLSQLTDVTHIFYVTWTNRSTEAENCKINGSMFRNVLRAVIPNAP  134

Query  445  NLQHICLQTGRKHYIGPWESYLK  513
            NL+H+CLQTG KHY+GP+E++ K
Sbjct  135  NLRHVCLQTGTKHYLGPFEAFGK  157



>ref|XP_008360976.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Malus 
domestica]
Length=390

 Score =   227 bits (579),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = +1

Query  88   EEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPIE  267
            +ED+ P   +SV L++GVTGIVGNSLAEILPL+DTPGGPWKVYGVARRPRP+W+ADHPIE
Sbjct  17   DEDEQPRAPESVGLVIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPNWSADHPIE  76

Query  268  YIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCPN  447
            Y+QCD+ + EDA++KLS LTDVTH+FYVTW NR+ E +NCE NG MLRNV+ ++IP+ PN
Sbjct  77   YVQCDVSDPEDAKTKLSPLTDVTHIFYVTWANRSTEVENCEVNGNMLRNVLESVIPNAPN  136

Query  448  LQHICLQTGRKHYIGPWESYLK  513
            L+HICLQTG KHY+GP+ES+ K
Sbjct  137  LRHICLQTGGKHYLGPFESFGK  158



>gb|KDO81567.1| hypothetical protein CISIN_1g0159921mg [Citrus sinensis]
Length=397

 Score =   227 bits (579),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
             EED+    YQSVALIVGVTGIVGNSLAEILPL DTPGGPWKVYGVARRP+P+WNADH +
Sbjct  16   FEEDEPARSYQSVALIVGVTGIVGNSLAEILPLPDTPGGPWKVYGVARRPKPNWNADHLV  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            EY+QCD+ + E+ Q+KLS LTDVTH+FYVTWTNR+ E +NC+ NG M RNV+ A+IP+ P
Sbjct  76   EYVQCDVSDPEETQAKLSQLTDVTHIFYVTWTNRSTEAENCKINGSMFRNVLRAVIPNAP  135

Query  445  NLQHICLQTGRKHYIGPWESYLK  513
            NL+H+CLQTG KHY+GP+E++ K
Sbjct  136  NLRHVCLQTGTKHYLGPFEAFGK  158



>ref|XP_010277137.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Nelumbo 
nucifera]
Length=390

 Score =   227 bits (578),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 105/142 (74%), Positives = 121/142 (85%), Gaps = 0/142 (0%)
 Frame = +1

Query  88   EEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPIE  267
            +ED  PPK+QSV L++GVTGIVGNSLAEILPL DTPGGPWKVYGVARRPRPSW+ D+PIE
Sbjct  17   DEDVGPPKHQSVGLVIGVTGIVGNSLAEILPLNDTPGGPWKVYGVARRPRPSWHVDYPIE  76

Query  268  YIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCPN  447
            YIQCD+ + ++  +KLS LTDVTH+FYVTWTNR  E  NCE NG MLRNV+ A+IP+ PN
Sbjct  77   YIQCDVSDPDETLAKLSPLTDVTHLFYVTWTNRQSESANCEINGAMLRNVLRAVIPNAPN  136

Query  448  LQHICLQTGRKHYIGPWESYLK  513
            LQHICLQTGRKHYIG +ES  K
Sbjct  137  LQHICLQTGRKHYIGSFESLGK  158



>ref|XP_006433602.1| hypothetical protein CICLE_v10001370mg [Citrus clementina]
 gb|ESR46842.1| hypothetical protein CICLE_v10001370mg [Citrus clementina]
Length=400

 Score =   227 bits (579),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
             EED+    YQSVALIVGVTGIVGNSLAEILPL DTPGGPWKVYGVARRP+P+WNADH +
Sbjct  16   FEEDEPARSYQSVALIVGVTGIVGNSLAEILPLPDTPGGPWKVYGVARRPKPNWNADHLV  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            EY+QCD+ + E+ Q+KLS LTDVTH+FYVTWTNR+ E +NC+ NG M RNV+ A+IP+ P
Sbjct  76   EYVQCDVSDPEETQAKLSQLTDVTHIFYVTWTNRSTEAENCKINGSMFRNVLRAVIPNAP  135

Query  445  NLQHICLQTGRKHYIGPWESYLK  513
            NL+H+CLQTG KHY+GP+E++ K
Sbjct  136  NLRHVCLQTGTKHYLGPFEAFGK  158



>ref|XP_003598452.1| Progesterone 5-beta-reductase [Medicago truncatula]
 gb|AES68703.1| 3-oxo-delta(4,5)-steroid 5-beta-reductase-like protein [Medicago 
truncatula]
Length=390

 Score =   226 bits (576),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            L+ED+AP  +Q+VAL+VGVTGIVGNSLAEILPLADTPGG WKVYGVARRPRPSWNADHP+
Sbjct  16   LDEDEAPRSFQNVALVVGVTGIVGNSLAEILPLADTPGGRWKVYGVARRPRPSWNADHPV  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            EYIQCDI +  DA +KLSVLTDVTHVFYV W +R  E +NCE NG ML+N + A+IP+ P
Sbjct  76   EYIQCDITDPNDATTKLSVLTDVTHVFYVCWASRPTEAENCEINGTMLKNALTAVIPNAP  135

Query  445  NLQHICLQTGRKHYIGPWESYLK  513
            NL+H+ +QTG KHY+GP+ES+ K
Sbjct  136  NLRHVSIQTGGKHYVGPFESFGK  158



>ref|XP_009360365.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Pyrus 
x bretschneideri]
 ref|XP_009360373.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Pyrus 
x bretschneideri]
Length=390

 Score =   226 bits (576),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = +1

Query  88   EEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPIE  267
            +ED+ P   +SV L++GVTGIVGNSLAEILPL+DTPGGPWKVYGVARRPRP+W+ADHPIE
Sbjct  17   DEDEQPRAPESVGLVIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPNWSADHPIE  76

Query  268  YIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCPN  447
            YIQCD+ + +DA++KLS LTDVTHVFYVTW++R+ E +NCE NG MLRNV+ ++IP+ PN
Sbjct  77   YIQCDVSDPDDAKTKLSPLTDVTHVFYVTWSSRSTEVENCEVNGNMLRNVLESVIPNAPN  136

Query  448  LQHICLQTGRKHYIGPWESYLK  513
            L+HICLQTG KHY+GP+ES+ K
Sbjct  137  LRHICLQTGGKHYLGPFESFGK  158



>ref|XP_007136737.1| hypothetical protein PHAVU_009G070100g [Phaseolus vulgaris]
 gb|ESW08731.1| hypothetical protein PHAVU_009G070100g [Phaseolus vulgaris]
Length=389

 Score =   226 bits (575),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
             EED+ P  ++SV L++GVTGIVGNSLAEILPL DTPGGPWKVYGVARRPRPSWNADHPI
Sbjct  16   FEEDEPPRSFESVGLVIGVTGIVGNSLAEILPLHDTPGGPWKVYGVARRPRPSWNADHPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            EY+QCD+ +  DA+SKLSVLTDVTHVF+V+WTNR  E +NCE NG ML+NV+ A+IP+ P
Sbjct  76   EYVQCDVSDPADAESKLSVLTDVTHVFFVSWTNRPTEAENCEVNGAMLQNVLRAVIPNAP  135

Query  445  NLQHICLQTGRKHYIGPWESYLK  513
            NL+H+ LQTG KHY+G +ES  K
Sbjct  136  NLRHVSLQTGTKHYLGSFESIGK  158



>gb|AFW16644.1| putative progesterone 5beta-reductase [Passiflora incarnata]
Length=389

 Score =   226 bits (575),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 121/142 (85%), Gaps = 0/142 (0%)
 Frame = +1

Query  88   EEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPIE  267
            E++D P  ++SVAL+VGVTGIVGNSLAEILPLADTPGGPWKVYGVARRP+P WNADHP+E
Sbjct  16   EQNDGPRSFESVALVVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPQPDWNADHPVE  75

Query  268  YIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCPN  447
            YIQCDI +S D Q+KLS L DVTH+FYVTW NR+ E +NC  N  MLRN++ A+IP+ PN
Sbjct  76   YIQCDIADSNDVQTKLSKLVDVTHIFYVTWANRSSEAENCRVNSLMLRNLLEALIPNAPN  135

Query  448  LQHICLQTGRKHYIGPWESYLK  513
            L+HICLQTG KHY+GP+E  L+
Sbjct  136  LRHICLQTGTKHYVGPFELVLQ  157



>ref|XP_010521424.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Tarenaya 
hassleriana]
Length=389

 Score =   225 bits (573),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 102/139 (73%), Positives = 121/139 (87%), Gaps = 1/139 (1%)
 Frame = +1

Query  85   LEEDDAPPK-YQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHP  261
            LEED+ PP+ YQSV LI+GVTGIVGNSLAEILPL+DTPGGPWKVYGVARRP+PSWNADHP
Sbjct  16   LEEDEPPPRSYQSVGLIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPQPSWNADHP  75

Query  262  IEYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSC  441
            I+YIQCD+ +++D + KLS LTDVTH+F+V WTNR  E +NCE N  MLRNV+ AI+P  
Sbjct  76   IDYIQCDVSDTDDVRCKLSPLTDVTHIFFVAWTNRGSEPENCETNAGMLRNVLRAIVPHA  135

Query  442  PNLQHICLQTGRKHYIGPW  498
            PNL+H+CLQTG KHYIGP+
Sbjct  136  PNLRHVCLQTGAKHYIGPF  154



>ref|XP_008377976.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Malus 
domestica]
 ref|XP_008347607.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Malus 
domestica]
Length=390

 Score =   225 bits (573),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
             EED+     QSV L++GVTGIVGNSLAEILPL+DTPGGPWKVYGVARRPRP+WNADH +
Sbjct  16   FEEDEHLRGPQSVGLVIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPNWNADHLV  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            EYIQCDI + +DA++KLS LTDVTH+FYVTWTNR+ E +NCE NG MLRNV++++IP+ P
Sbjct  76   EYIQCDISDPDDAKAKLSPLTDVTHIFYVTWTNRSTEAENCEVNGNMLRNVLDSVIPNAP  135

Query  445  NLQHICLQTGRKHYIGPWESYLK  513
             L HICLQTG KHY+GP+ES+ K
Sbjct  136  KLSHICLQTGAKHYVGPFESFGK  158



>ref|XP_003636813.1| Progesterone 5-beta-reductase [Medicago truncatula]
 ref|XP_003638462.1| Progesterone 5-beta-reductase [Medicago truncatula]
 gb|KEH35786.1| 3-oxo-delta(4,5)-steroid 5-beta-reductase-like protein [Medicago 
truncatula]
 gb|AIW09150.1| progesterone 5-beta-reductase 2 [Medicago truncatula]
Length=390

 Score =   225 bits (573),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            L+ED+AP  +Q+VAL+VGVTGIVGNSLAEILPLADTPGG WKVYGVARR RPSWNADHP+
Sbjct  16   LDEDEAPRSFQNVALVVGVTGIVGNSLAEILPLADTPGGRWKVYGVARRSRPSWNADHPV  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            EYIQCDI +  DA +KLSVLTDVTHVFYV W +R  E +NCE NG ML+NV+ A+IP+ P
Sbjct  76   EYIQCDITDPNDATTKLSVLTDVTHVFYVCWASRPTEAENCEINGAMLKNVLTAVIPNAP  135

Query  445  NLQHICLQTGRKHYIGPWESYLK  513
            NL+H+ +QTG KHY+GP+ES+ K
Sbjct  136  NLRHVSIQTGGKHYVGPFESFGK  158



>ref|XP_003525919.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Glycine 
max]
Length=388

 Score =   224 bits (572),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 99/139 (71%), Positives = 120/139 (86%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
             EE++ P  +QSV L++GVTGIVGNSLAEILPLADTP GPWKVYGVARRPRP WNADHP+
Sbjct  16   FEEEEPPRSFQSVGLVIGVTGIVGNSLAEILPLADTPAGPWKVYGVARRPRPPWNADHPV  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            EYIQCD+ +  DA++KLS LTDVTHVF+V+WTNR+ E +NCE NG ML+NV+ A+IP+ P
Sbjct  76   EYIQCDVSDPADAEAKLSALTDVTHVFFVSWTNRSTEAENCEVNGAMLQNVLRAVIPNAP  135

Query  445  NLQHICLQTGRKHYIGPWE  501
            NL+H+ LQTG KHYIGP+E
Sbjct  136  NLRHVSLQTGGKHYIGPFE  154



>ref|XP_006374844.1| hypothetical protein POPTR_0014s01970g [Populus trichocarpa]
 gb|ERP52641.1| hypothetical protein POPTR_0014s01970g [Populus trichocarpa]
Length=390

 Score =   224 bits (571),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 121/142 (85%), Gaps = 0/142 (0%)
 Frame = +1

Query  88   EEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPIE  267
            EED+AP  YQSVALI+GVTGIVGNSLAEILPL+DTPGGPWKVYGVARR RP+WN DHP+E
Sbjct  17   EEDEAPRGYQSVALILGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRSRPNWNEDHPVE  76

Query  268  YIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCPN  447
            YIQCDI ++ + QSKLS L DVTH+FYVTW ++  E++NCE NG M RNV+ A+IP+ PN
Sbjct  77   YIQCDISDTAETQSKLSKLADVTHIFYVTWASKPTEEENCEINGLMFRNVLQAVIPNAPN  136

Query  448  LQHICLQTGRKHYIGPWESYLK  513
            L+H+CLQTG K Y+GP+E Y K
Sbjct  137  LRHVCLQTGGKQYVGPFELYGK  158



>gb|ABK95134.1| unknown [Populus trichocarpa]
Length=390

 Score =   224 bits (571),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 121/142 (85%), Gaps = 0/142 (0%)
 Frame = +1

Query  88   EEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPIE  267
            EED+AP  YQSVALI+GVTGIVGNSLAEILPL+DTPGGPWKVYGVARR RP+WN DHP+E
Sbjct  17   EEDEAPRGYQSVALILGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRSRPNWNEDHPVE  76

Query  268  YIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCPN  447
            YIQCDI ++ + QSKLS L DVTH+FYVTW ++  E++NCE NG M RNV+ A+IP+ PN
Sbjct  77   YIQCDISDTAETQSKLSKLADVTHIFYVTWASKPTEEENCEINGLMFRNVLQAVIPNAPN  136

Query  448  LQHICLQTGRKHYIGPWESYLK  513
            L+H+CLQTG K Y+GP+E Y K
Sbjct  137  LRHVCLQTGGKQYVGPFELYGK  158



>gb|ABK96780.1| unknown [Populus trichocarpa x Populus deltoides]
Length=390

 Score =   224 bits (571),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 121/142 (85%), Gaps = 0/142 (0%)
 Frame = +1

Query  88   EEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPIE  267
            EED+AP  YQSVALI+GVTGIVGNSLAEILPL+DTPGGPWKVYGVARR RP+WN DHP+E
Sbjct  17   EEDEAPRGYQSVALILGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRSRPNWNEDHPVE  76

Query  268  YIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCPN  447
            YIQCDI N+ + QSKLS L DVTH+FYVTW ++  E++NCE NG M RNV+ A+IP+ PN
Sbjct  77   YIQCDISNTAETQSKLSKLADVTHIFYVTWASKPTEEENCEINGLMFRNVLQAVIPNAPN  136

Query  448  LQHICLQTGRKHYIGPWESYLK  513
            L+H+CLQTG K Y+GP++ Y K
Sbjct  137  LRHVCLQTGGKQYVGPFDLYGK  158



>ref|XP_010530504.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Tarenaya 
hassleriana]
Length=388

 Score =   224 bits (570),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 99/135 (73%), Positives = 117/135 (87%), Gaps = 0/135 (0%)
 Frame = +1

Query  91   EDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPIEY  270
            ED+ P  Y+SV LI+GVTG+VGNSLAEILPL+DTPGGPWKVYGVARRPRPSWN DHP+EY
Sbjct  18   EDEHPRSYESVGLIIGVTGMVGNSLAEILPLSDTPGGPWKVYGVARRPRPSWNTDHPVEY  77

Query  271  IQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCPNL  450
            IQCD+ ++ DAQSKLS LTDVTH+F+VTWTNR  E ++C++N  MLRNV+ AI+P  PNL
Sbjct  78   IQCDVSDAIDAQSKLSPLTDVTHIFFVTWTNRRSESESCDSNAAMLRNVLRAIVPHAPNL  137

Query  451  QHICLQTGRKHYIGP  495
            QH+CLQTG KHYI P
Sbjct  138  QHVCLQTGTKHYIAP  152



>gb|ADG46027.1| putative progesterone 5-beta-reductase [Coffea arabica]
 gb|ADG56541.1| progesterone 5-beta-reductase [Plantago major]
Length=389

 Score =   224 bits (570),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 102/138 (74%), Positives = 122/138 (88%), Gaps = 0/138 (0%)
 Frame = +1

Query  88   EEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPIE  267
            +ED+A PK+ SVALIVGVTGIVGNSLAEILPLADTP GPWKVYGVARRPRP+WN D+PI 
Sbjct  17   DEDEALPKHSSVALIVGVTGIVGNSLAEILPLADTPSGPWKVYGVARRPRPAWNEDNPIN  76

Query  268  YIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCPN  447
            YI+CDI + +D Q KLS LTD+THVFYVTW NR+ E + CEANGKML+NV++ +IP+CP+
Sbjct  77   YIRCDISDPKDTQEKLSPLTDITHVFYVTWANRSTEVERCEANGKMLKNVLDVVIPNCPD  136

Query  448  LQHICLQTGRKHYIGPWE  501
            L+HI LQTGRKHY+GP+E
Sbjct  137  LKHISLQTGRKHYVGPFE  154



>ref|XP_008236416.1| PREDICTED: LOW QUALITY PROTEIN: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like 
[Prunus mume]
Length=395

 Score =   224 bits (570),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 119/143 (83%), Gaps = 0/143 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
             + +DAP KYQSVAL+ GVTGIVGNSLAEILPL DTPGGPWKVYGVARR RP WNADH I
Sbjct  16   FDPNDAPAKYQSVALVAGVTGIVGNSLAEILPLPDTPGGPWKVYGVARRARPEWNADHHI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            EYIQCD+ +     S+LS LTDVTHVFYVTW ++  E +NCEANG M RN+++A+IP+ P
Sbjct  76   EYIQCDLSDPHQTHSELSQLTDVTHVFYVTWASKPTEAENCEANGNMFRNLLDAVIPNAP  135

Query  445  NLQHICLQTGRKHYIGPWESYLK  513
            NLQHICLQTGRKHYIGP+E + K
Sbjct  136  NLQHICLQTGRKHYIGPFEMWGK  158



>ref|XP_011092523.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Sesamum 
indicum]
Length=389

 Score =   223 bits (569),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
             EEDD    YQSVALI+GVTGIVG+SLAEILPLADTPGG WKVYGVARRPRP+WN D+ +
Sbjct  16   FEEDDTAVTYQSVALIIGVTGIVGSSLAEILPLADTPGGRWKVYGVARRPRPNWNDDNRV  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
             YI+CDI + +D ++KLS LTD+TH+FYVTW N+  E +NC+ NGKML+NV++A+IP+CP
Sbjct  76   NYIRCDISDPDDTRAKLSTLTDITHLFYVTWANKPTEAENCQVNGKMLKNVLDAVIPNCP  135

Query  445  NLQHICLQTGRKHYIGPWESYLK  513
             L+HICLQTGRKHY+GP+ESY K
Sbjct  136  RLKHICLQTGRKHYMGPFESYGK  158



>ref|XP_011029002.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Populus 
euphratica]
Length=390

 Score =   223 bits (569),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 120/142 (85%), Gaps = 0/142 (0%)
 Frame = +1

Query  88   EEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPIE  267
            EED+AP  YQSVALI+GVTGIVGNSLAEILPL+DTPGGPWKVYG ARR RP+WN DHP+E
Sbjct  17   EEDEAPRGYQSVALILGVTGIVGNSLAEILPLSDTPGGPWKVYGAARRSRPNWNVDHPVE  76

Query  268  YIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCPN  447
            YIQCDI ++ + QSKLS L DVTH+FYVTW ++  E++NCE NG M RNV+ A+IP+ PN
Sbjct  77   YIQCDISDTAETQSKLSKLADVTHIFYVTWASKPTEEENCEINGLMFRNVLQAVIPNAPN  136

Query  448  LQHICLQTGRKHYIGPWESYLK  513
            L+H+CLQTG K Y+GP+E Y K
Sbjct  137  LRHVCLQTGGKQYVGPFELYGK  158



>gb|AFK42748.1| unknown [Medicago truncatula]
Length=390

 Score =   223 bits (569),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            L+ED+AP  +Q+VAL+VGVTGIVGNSLAEILPLADTPGG WKVYGVARR RPSWNADHP+
Sbjct  16   LDEDEAPRSFQNVALVVGVTGIVGNSLAEILPLADTPGGRWKVYGVARRSRPSWNADHPV  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            EYIQCDI +  D  +KLSVLTDVTHVFYV W +R  E +NCE NG ML+NV+ A+IP+ P
Sbjct  76   EYIQCDITDPNDTTTKLSVLTDVTHVFYVCWASRPTEAENCEINGAMLKNVLTAVIPNAP  135

Query  445  NLQHICLQTGRKHYIGPWESYLK  513
            NL+H+ +QTG KHY+GP+ES+ K
Sbjct  136  NLRHVSIQTGGKHYVGPFESFGK  158



>ref|XP_011017140.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Populus 
euphratica]
Length=390

 Score =   223 bits (568),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 121/142 (85%), Gaps = 0/142 (0%)
 Frame = +1

Query  88   EEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPIE  267
            EED+A   YQSVALI+GVTGIVGNSLAEILPL+DTPGGPWKVYGVARR RPSWN DHP+E
Sbjct  17   EEDEASRGYQSVALILGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRSRPSWNEDHPVE  76

Query  268  YIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCPN  447
            YIQCDI ++ + QSKLS LTDVTH+FYVTW +++ E++NCE NG M RNV+ A+IP+  N
Sbjct  77   YIQCDISSTVETQSKLSKLTDVTHIFYVTWASKSTEEENCEINGLMFRNVLQAVIPNAAN  136

Query  448  LQHICLQTGRKHYIGPWESYLK  513
            L+H+CLQTG K Y+GP+E + K
Sbjct  137  LRHVCLQTGAKQYVGPFELFGK  158



>ref|XP_006367946.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Solanum 
tuberosum]
Length=388

 Score =   223 bits (568),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            +EEDD P K QSV LI+GVTGIVGNSLAEILP  DTPGGPWKVYGVARRPRPSWN ++PI
Sbjct  16   VEEDDVPKKCQSVGLIIGVTGIVGNSLAEILPGTDTPGGPWKVYGVARRPRPSWNVNYPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            EYIQCDI + E+ QSKL++LTDVTHVFYVTW  R  E +NCE NGKM +NV++AIIP+CP
Sbjct  76   EYIQCDISSPEETQSKLTLLTDVTHVFYVTWAIRPTELENCEINGKMFQNVLDAIIPNCP  135

Query  445  NLQHICLQTGRKHYIGPWESYLK  513
            NL HICLQTG KHY G +E + K
Sbjct  136  NLSHICLQTGLKHYHGSFELFEK  158



>ref|XP_007201077.1| hypothetical protein PRUPE_ppa006872mg [Prunus persica]
 gb|EMJ02276.1| hypothetical protein PRUPE_ppa006872mg [Prunus persica]
Length=392

 Score =   223 bits (568),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 118/139 (85%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
             + +DAPPKYQSVAL+ GVTGIVGNSLA+ILPL DTPGGPWKVYGVARR RP WNADHPI
Sbjct  16   FDPNDAPPKYQSVALVAGVTGIVGNSLADILPLPDTPGGPWKVYGVARRARPDWNADHPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            EYIQCD+ +     S+LS LTDVTH+FYVTW ++  E +NCEANG M RN+++A+IP+ P
Sbjct  76   EYIQCDLSDPHQTHSELSQLTDVTHIFYVTWASKPTEAENCEANGNMFRNLLDAVIPNAP  135

Query  445  NLQHICLQTGRKHYIGPWE  501
            NLQHICLQTGRKHY+G +E
Sbjct  136  NLQHICLQTGRKHYVGSFE  154



>ref|XP_011016706.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Populus 
euphratica]
Length=390

 Score =   223 bits (568),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 100/138 (72%), Positives = 120/138 (87%), Gaps = 0/138 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            +E+D+A   YQSVALI+GVTGIVGNSLAEILPL+DTPGGPWKVYGVARR RP+WN DHP+
Sbjct  16   IEDDEASRGYQSVALILGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRSRPNWNEDHPV  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            EYIQCDI N+ + QSKLS LTDVTHVFYVTW +++ E++NCE NG MLRNV+ A+IP+  
Sbjct  76   EYIQCDISNTAETQSKLSKLTDVTHVFYVTWASKSTEEENCEINGLMLRNVLQAVIPNAS  135

Query  445  NLQHICLQTGRKHYIGPW  498
            NL+H+CLQTG KHY GP+
Sbjct  136  NLRHVCLQTGGKHYAGPF  153



>ref|XP_006433107.1| hypothetical protein CICLE_v10001388mg [Citrus clementina]
 gb|ESR46347.1| hypothetical protein CICLE_v10001388mg [Citrus clementina]
Length=397

 Score =   223 bits (567),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 100/146 (68%), Positives = 122/146 (84%), Gaps = 3/146 (2%)
 Frame = +1

Query  85   LEEDDAPPK---YQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNAD  255
             EE++ PP+   YQ V L++GVTGIVGNSLAEILP  DTPGGPWKVYGVARRPRP WNAD
Sbjct  16   FEENERPPQPQDYQHVGLLIGVTGIVGNSLAEILPRQDTPGGPWKVYGVARRPRPDWNAD  75

Query  256  HPIEYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIP  435
            HPIEYIQCD+ + +D Q+KL+ LTDVTH+FYVTW +R  E +NCE NG MLRNV+ ++IP
Sbjct  76   HPIEYIQCDVSDEDDTQAKLTKLTDVTHIFYVTWASRPTEAENCEVNGAMLRNVLRSVIP  135

Query  436  SCPNLQHICLQTGRKHYIGPWESYLK  513
            + PNL+H+CLQTG KHY+GP+ES+ K
Sbjct  136  NAPNLRHVCLQTGAKHYVGPFESFGK  161



>ref|XP_009354120.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Pyrus 
x bretschneideri]
Length=390

 Score =   223 bits (567),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            L+ED+     QSV L++GVTGIVGNSLAEILPL+DTPGGPWKVYGVARRPRP+WNADH +
Sbjct  16   LDEDEHLRGPQSVGLVIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPNWNADHLV  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            EYIQCDI + +DA++ LS LTDVTH+FYVTWTNR+ E +NCE NG MLRNV++++IP+ P
Sbjct  76   EYIQCDISDPDDAKANLSPLTDVTHIFYVTWTNRSTEAENCEVNGNMLRNVLDSVIPNAP  135

Query  445  NLQHICLQTGRKHYIGPWESYLK  513
             L HICLQTG KHY+GP+ES+ K
Sbjct  136  KLSHICLQTGAKHYVGPFESFGK  158



>ref|XP_003638458.1| Progesterone 5-beta-reductase [Medicago truncatula]
 gb|KEH35788.1| 3-oxo-delta(4,5)-steroid 5-beta-reductase-like protein [Medicago 
truncatula]
 gb|AIW09149.1| progesterone 5-beta-reductase 1 [Medicago truncatula]
Length=389

 Score =   223 bits (567),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 102/138 (74%), Positives = 119/138 (86%), Gaps = 0/138 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            L+ED+AP  +Q+VAL+VGVTGIVGNSLAEILPLADTPGG WKVYGVARRPRPSWNADHPI
Sbjct  16   LDEDEAPQSFQNVALVVGVTGIVGNSLAEILPLADTPGGRWKVYGVARRPRPSWNADHPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            EYIQ DI NS D Q+K S+LTDVTH+FYV+WT+R  E+ NCE NG ML NV+ A+IP+ P
Sbjct  76   EYIQRDITNSNDTQTKFSILTDVTHIFYVSWTSRPTEEDNCEVNGVMLLNVLRAVIPNAP  135

Query  445  NLQHICLQTGRKHYIGPW  498
            NL H+ LQTG KHY+GP+
Sbjct  136  NLCHVSLQTGGKHYLGPF  153



>pdb|2V6F|A Chain A, Structure Of Progesterone 5beta-Reductase From Digitalis 
Lanata
 pdb|2V6G|A Chain A, Structure Of Progesterone 5beta-reductase From Digitalis 
Lanata In Complex With Nadp
Length=364

 Score =   222 bits (565),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 101/133 (76%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = +1

Query  115  QSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPIEYIQCDILNS  294
             SVALIVGVTGI+GNSLAEILPLADTPGGPWKVYGVARR RP+W+ D+PI Y+QCDI + 
Sbjct  1    SSVALIVGVTGIIGNSLAEILPLADTPGGPWKVYGVARRTRPAWHEDNPINYVQCDISDP  60

Query  295  EDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCPNLQHICLQTG  474
            +D+Q+KLS LTDVTHVFYVTW NR+ E +NCEAN KM RNV++A+IP+CPNL+HI LQTG
Sbjct  61   DDSQAKLSPLTDVTHVFYVTWANRSTEQENCEANSKMFRNVLDAVIPNCPNLKHISLQTG  120

Query  475  RKHYIGPWESYLK  513
            RKHY+GP+ESY K
Sbjct  121  RKHYMGPFESYGK  133



>gb|AIW09145.1| progesterone 5-beta-reductase 3 [Catharanthus roseus]
Length=394

 Score =   222 bits (566),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 103/138 (75%), Positives = 120/138 (87%), Gaps = 2/138 (1%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            L+ DD PPK+QSV LI+GVTG+VGNSLAEILPL+DTPGGPWKVYGVARR RP+W+ADHPI
Sbjct  19   LQVDDGPPKHQSVGLILGVTGLVGNSLAEILPLSDTPGGPWKVYGVARRSRPTWHADHPI  78

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTW--TNRTREDQNCEANGKMLRNVVNAIIPS  438
            EYIQCD+ N E+ +SKLS LTDVTH+FYVT    N+  + +NC+ANGKM RNV+NAIIP+
Sbjct  79   EYIQCDLSNPEETESKLSNLTDVTHIFYVTCVTANKYTDAENCDANGKMFRNVLNAIIPN  138

Query  439  CPNLQHICLQTGRKHYIG  492
            CPNLQHICLQTG KHY G
Sbjct  139  CPNLQHICLQTGLKHYFG  156



>gb|KJB29426.1| hypothetical protein B456_005G100200 [Gossypium raimondii]
Length=394

 Score =   221 bits (564),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 119/139 (86%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            LEED+ P  +QSVAL+VGVTGIVGNSLAEILPL+DTPGGPWKVYGVARRPRP W+A+H I
Sbjct  16   LEEDETPKSFQSVALVVGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPHWHAEHRI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            EYIQCD+ + +D +SKLS LTDVTH+FYV+W NRT E  NCE NG MLRNV++ +I + P
Sbjct  76   EYIQCDVSDPKDTESKLSQLTDVTHIFYVSWVNRTTETDNCEINGSMLRNVLHTLILNAP  135

Query  445  NLQHICLQTGRKHYIGPWE  501
            NL+HICLQTG KHY+G +E
Sbjct  136  NLRHICLQTGAKHYVGSFE  154



>ref|XP_002272271.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Vitis 
vinifera]
Length=389

 Score =   221 bits (564),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 103/144 (72%), Positives = 120/144 (83%), Gaps = 1/144 (1%)
 Frame = +1

Query  85   LEEDDA-PPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHP  261
            L+ED+A P  YQ V LIVGVTGIVGNSLAEILPL DTPGGPWKVYGVARRP+P+WNAD+ 
Sbjct  16   LQEDEAHPTNYQGVGLIVGVTGIVGNSLAEILPLRDTPGGPWKVYGVARRPQPAWNADNC  75

Query  262  IEYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSC  441
            +EYIQCD+ + E+  SKLS LTDVTH+FYVTW N   E +NC  NG M RNV++A+IP+ 
Sbjct  76   VEYIQCDVFDPEETSSKLSKLTDVTHIFYVTWANMGSEAENCRVNGDMFRNVLSAVIPNA  135

Query  442  PNLQHICLQTGRKHYIGPWESYLK  513
            PNLQHICLQTGRKHYIGP+E+  K
Sbjct  136  PNLQHICLQTGRKHYIGPFEALGK  159



>ref|XP_006472269.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Citrus 
sinensis]
Length=397

 Score =   221 bits (564),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
             EED+    YQSV LIVGVTGIVGNSLAEILPL DTPGGPWKVYGVARRP+P+WNADH +
Sbjct  16   FEEDEPARSYQSVGLIVGVTGIVGNSLAEILPLHDTPGGPWKVYGVARRPKPNWNADHLV  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            EY+QCD+ + E+ Q+ LS L DVTH+FYVTWTNR+ E +NC+ NG M RNV+ A+IP+ P
Sbjct  76   EYVQCDVSDPEETQAMLSQLIDVTHIFYVTWTNRSTEAENCKINGSMFRNVLRAVIPNAP  135

Query  445  NLQHICLQTGRKHYIGPWESYLK  513
            NL+H+CLQTG KHY+GP+E++ K
Sbjct  136  NLRHVCLQTGTKHYLGPFEAFGK  158



>gb|AFK45113.1| unknown [Medicago truncatula]
Length=390

 Score =   221 bits (563),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            L+ED+AP  +Q+VAL+VGVTGIVGNSLAEILPLADTPGG WKVYGVARR RPSWNADHP+
Sbjct  16   LDEDEAPRSFQNVALVVGVTGIVGNSLAEILPLADTPGGRWKVYGVARRSRPSWNADHPV  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            EYIQCDI +  DA +KLSVLTDVTHVF V W +R  E +NCE NG ML+NV+ A+IP+ P
Sbjct  76   EYIQCDITDPNDATTKLSVLTDVTHVFCVCWASRPTEAENCEINGAMLKNVLTAVIPNAP  135

Query  445  NLQHICLQTGRKHYIGPWESYLK  513
            NL+H+ +QTG KHY+GP+ES+ K
Sbjct  136  NLRHVSIQTGGKHYVGPFESFGK  158



>ref|XP_006387422.1| hypothetical protein POPTR_1058s00200g [Populus trichocarpa]
 gb|ERP46336.1| hypothetical protein POPTR_1058s00200g [Populus trichocarpa]
Length=391

 Score =   221 bits (563),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 99/137 (72%), Positives = 118/137 (86%), Gaps = 0/137 (0%)
 Frame = +1

Query  88   EEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPIE  267
            E+D+A   YQSVALI+GVTGIVGNSLAEILPL+DTPGGPWKVYGVARR RP+WN DHP+E
Sbjct  17   EDDEASRGYQSVALILGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRSRPNWNEDHPVE  76

Query  268  YIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCPN  447
            YIQCDI N+ + QSKLS LTDVTHVFYVTW +++ E++NCE NG M RNV+ A+IP+  N
Sbjct  77   YIQCDISNTAETQSKLSKLTDVTHVFYVTWASKSTEEENCEINGLMFRNVLQAVIPNASN  136

Query  448  LQHICLQTGRKHYIGPW  498
            L+H+CLQTG KHY GP+
Sbjct  137  LRHVCLQTGGKHYAGPF  153



>gb|AHZ44507.1| putative progesterone 5 beta-reductase [Isatis tinctoria]
Length=390

 Score =   221 bits (562),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 101/140 (72%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
             ++D+    Y+SVALI+GVTGIVGNSLAEILPL+DTPGGPWKVYGVARRPRP+WNADHPI
Sbjct  16   FDDDEPTQSYESVALIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPTWNADHPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            +YIQCD+ + +D +SKLS LTDVTHVFYVTW NR+ E  NCEANG MLRNV+ A++P+ P
Sbjct  76   DYIQCDVSDDDDVRSKLSTLTDVTHVFYVTWANRSSESDNCEANGSMLRNVLRAVVPNAP  135

Query  445  NLQHICLQTGRKHYIGPWES  504
            NL+H+CLQTG KHYIGP+++
Sbjct  136  NLRHVCLQTGTKHYIGPFDA  155



>ref|XP_007018551.1| NAD(P)-binding Rossmann-fold superfamily protein [Theobroma cacao]
 gb|EOY15776.1| NAD(P)-binding Rossmann-fold superfamily protein [Theobroma cacao]
Length=389

 Score =   220 bits (560),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 120/139 (86%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
             EE +AP  +QSV L+VGVTGIVGNSLAEILPL DTPGGPWKVYGVARRPRP+W+ DHPI
Sbjct  16   FEEGEAPISFQSVGLVVGVTGIVGNSLAEILPLTDTPGGPWKVYGVARRPRPNWSMDHPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            EYIQCDI + +D +SKLS LTDVT++FYV+W NR+ E +NCE NG MLRNV+ ++IP+ P
Sbjct  76   EYIQCDISDPKDTESKLSPLTDVTYIFYVSWINRSSEAENCEINGSMLRNVLRSVIPNAP  135

Query  445  NLQHICLQTGRKHYIGPWE  501
            NL+H+CLQTG K+Y+GP+E
Sbjct  136  NLRHVCLQTGTKNYLGPFE  154



>ref|XP_003636810.1| Progesterone 5-beta-reductase [Medicago truncatula]
Length=809

 Score =   229 bits (583),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 102/139 (73%), Positives = 121/139 (87%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
             +ED+APP +QSV LI+GVTGIVGNSLAEILPLADTPGG WKVYGVARRPRPSWNADHPI
Sbjct  16   FDEDEAPPTFQSVGLIIGVTGIVGNSLAEILPLADTPGGRWKVYGVARRPRPSWNADHPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            EYIQCDI +  + Q+KLSVLTDVTH+FYV+W+NR  E +NCE N  MLRNV+ A+IP+ P
Sbjct  76   EYIQCDITDPNETQTKLSVLTDVTHIFYVSWSNRPSEAENCEVNSAMLRNVLTAVIPNAP  135

Query  445  NLQHICLQTGRKHYIGPWE  501
            NL+H+ LQTG KHY+GP++
Sbjct  136  NLRHVSLQTGGKHYLGPFD  154


 Score =   222 bits (566),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 102/138 (74%), Positives = 119/138 (86%), Gaps = 0/138 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            L+ED+AP  +Q+VAL+VGVTGIVGNSLAEILPLADTPGG WKVYGVARRPRPSWNADHPI
Sbjct  436  LDEDEAPQSFQNVALVVGVTGIVGNSLAEILPLADTPGGRWKVYGVARRPRPSWNADHPI  495

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            EYIQ DI NS D Q+K S+LTDVTH+FYV+WT+R  E+ NCE NG ML NV+ A+IP+ P
Sbjct  496  EYIQRDITNSNDTQTKFSILTDVTHIFYVSWTSRPTEEDNCEVNGVMLLNVLRAVIPNAP  555

Query  445  NLQHICLQTGRKHYIGPW  498
            NL H+ LQTG KHY+GP+
Sbjct  556  NLCHVSLQTGGKHYLGPF  573



>gb|AAO63776.1| unknown [Populus tremuloides]
Length=391

 Score =   219 bits (558),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 98/137 (72%), Positives = 118/137 (86%), Gaps = 0/137 (0%)
 Frame = +1

Query  88   EEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPIE  267
            E+D+A   Y SVALI+GVTGIVGNSLAEILPL+DTPGGPWKVYGVARRPRP+WN DHP+E
Sbjct  17   EDDEASRGYPSVALILGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPNWNEDHPVE  76

Query  268  YIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCPN  447
            YIQCDI N+ + QSKLS LTDVTHVFYVTW +++ E++NCE NG M RNV+ A+IP+  N
Sbjct  77   YIQCDISNTAETQSKLSKLTDVTHVFYVTWASKSTEEENCEINGLMFRNVLQAVIPNAAN  136

Query  448  LQHICLQTGRKHYIGPW  498
            L+H+CLQTG K Y+GP+
Sbjct  137  LRHVCLQTGGKQYVGPF  153



>ref|XP_006433101.1| hypothetical protein CICLE_v10001374mg [Citrus clementina]
 gb|ESR46341.1| hypothetical protein CICLE_v10001374mg [Citrus clementina]
Length=399

 Score =   219 bits (558),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 97/134 (72%), Positives = 115/134 (86%), Gaps = 0/134 (0%)
 Frame = +1

Query  112  YQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPIEYIQCDILN  291
            YQ V L++GVTGIVGNSLAEILP  DTPGGPWKVYGVARRPRP WNADHPIEYIQCD+ +
Sbjct  30   YQHVGLVIGVTGIVGNSLAEILPRQDTPGGPWKVYGVARRPRPDWNADHPIEYIQCDVSD  89

Query  292  SEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCPNLQHICLQT  471
             +D Q+KLS LTDVTH+FYVTW +R  E +NCE NG MLRNV+ ++IP+ PNL+H+CLQT
Sbjct  90   QDDTQAKLSKLTDVTHIFYVTWASRPTEAENCEVNGAMLRNVLRSVIPNAPNLRHVCLQT  149

Query  472  GRKHYIGPWESYLK  513
            G KHY+GP+ES+ K
Sbjct  150  GGKHYVGPFESFGK  163



>ref|XP_006471790.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like isoform 
X1 [Citrus sinensis]
 ref|XP_006471791.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like isoform 
X2 [Citrus sinensis]
Length=397

 Score =   219 bits (558),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 99/146 (68%), Positives = 120/146 (82%), Gaps = 3/146 (2%)
 Frame = +1

Query  85   LEEDDAPPK---YQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNAD  255
             EE++ PP+   YQ V L++GVTGIVGNSLAEILP  DTPGGPWKVYGVARRPRP WN D
Sbjct  16   FEENERPPQPQDYQHVGLLIGVTGIVGNSLAEILPRQDTPGGPWKVYGVARRPRPDWNTD  75

Query  256  HPIEYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIP  435
            HPIEYIQCD+ + +D Q+KL+ LTDVTH+FYVTW +R  E +NCE NG MLRNV+ ++IP
Sbjct  76   HPIEYIQCDVSDEDDTQAKLTKLTDVTHIFYVTWASRPTEAENCEVNGAMLRNVLRSVIP  135

Query  436  SCPNLQHICLQTGRKHYIGPWESYLK  513
            + PNL+H+CLQTG KHY+GP ES+ K
Sbjct  136  NAPNLRHVCLQTGAKHYLGPSESFGK  161



>ref|XP_006433105.1| hypothetical protein CICLE_v10001393mg [Citrus clementina]
 gb|ESR46345.1| hypothetical protein CICLE_v10001393mg [Citrus clementina]
Length=397

 Score =   219 bits (558),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 98/146 (67%), Positives = 119/146 (82%), Gaps = 3/146 (2%)
 Frame = +1

Query  85   LEEDDAPPK---YQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNAD  255
             EED+ PP+   YQ V L++G+TGIVGNSLAEILP  DTPGGPWKVYG ARRPRP WN D
Sbjct  16   FEEDERPPQPQDYQHVGLVIGITGIVGNSLAEILPRQDTPGGPWKVYGAARRPRPDWNTD  75

Query  256  HPIEYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIP  435
            HPIEYIQCD+ + +D Q+KL+ LTDVTH+FYVTW +R  E +NCE NG MLRNV+ ++IP
Sbjct  76   HPIEYIQCDVSDQDDTQAKLTKLTDVTHIFYVTWASRPTEAENCEVNGTMLRNVLRSVIP  135

Query  436  SCPNLQHICLQTGRKHYIGPWESYLK  513
            + PNL+H+CLQTG KHY+GP ES+ K
Sbjct  136  NAPNLRHVCLQTGAKHYLGPSESFGK  161



>ref|XP_006471792.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like isoform 
X3 [Citrus sinensis]
Length=396

 Score =   219 bits (558),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 99/146 (68%), Positives = 120/146 (82%), Gaps = 3/146 (2%)
 Frame = +1

Query  85   LEEDDAPPK---YQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNAD  255
             EE++ PP+   YQ V L++GVTGIVGNSLAEILP  DTPGGPWKVYGVARRPRP WN D
Sbjct  15   FEENERPPQPQDYQHVGLLIGVTGIVGNSLAEILPRQDTPGGPWKVYGVARRPRPDWNTD  74

Query  256  HPIEYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIP  435
            HPIEYIQCD+ + +D Q+KL+ LTDVTH+FYVTW +R  E +NCE NG MLRNV+ ++IP
Sbjct  75   HPIEYIQCDVSDEDDTQAKLTKLTDVTHIFYVTWASRPTEAENCEVNGAMLRNVLRSVIP  134

Query  436  SCPNLQHICLQTGRKHYIGPWESYLK  513
            + PNL+H+CLQTG KHY+GP ES+ K
Sbjct  135  NAPNLRHVCLQTGAKHYLGPSESFGK  160



>ref|XP_006432526.1| hypothetical protein CICLE_v10001422mg [Citrus clementina]
 ref|XP_006471281.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like isoform 
X1 [Citrus sinensis]
 ref|XP_006471282.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like isoform 
X2 [Citrus sinensis]
 gb|ESR45766.1| hypothetical protein CICLE_v10001422mg [Citrus clementina]
Length=393

 Score =   218 bits (555),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 99/139 (71%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            L+ED  P  YQ V LI+GVTGIVGNSLAEILP +DTPGGPWKVYGVARRPRP WNA+HPI
Sbjct  17   LDEDKRPRDYQLVGLILGVTGIVGNSLAEILPRSDTPGGPWKVYGVARRPRPDWNANHPI  76

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            EYIQCDI + E+ Q+KLS LTDVTH+FYVTW +R  E +NC+ NG M RNV+ +IIP+ P
Sbjct  77   EYIQCDISDQEETQAKLSKLTDVTHIFYVTWASRPTEVENCQINGSMFRNVLRSIIPNAP  136

Query  445  NLQHICLQTGRKHYIGPWE  501
            NL+HICLQTG KHY+GP++
Sbjct  137  NLRHICLQTGGKHYLGPFD  155



>ref|XP_006374846.1| hypothetical protein POPTR_0014s01980g [Populus trichocarpa]
 gb|ERP52643.1| hypothetical protein POPTR_0014s01980g [Populus trichocarpa]
Length=358

 Score =   217 bits (552),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 99/138 (72%), Positives = 116/138 (84%), Gaps = 0/138 (0%)
 Frame = +1

Query  88   EEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPIE  267
            E  DA   +QSVAL+VGVTGIVGNSLAEILPL+DTPGGPWKVYGVARRPRP+WN DHP+E
Sbjct  17   ENGDASRGHQSVALVVGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPNWNLDHPVE  76

Query  268  YIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCPN  447
            YIQCDI N+ D Q+KL+ LTDVTH+FYVTW  R  E +N EAN  M RNV+ A+IP+ PN
Sbjct  77   YIQCDISNTADTQAKLAQLTDVTHIFYVTWALRFTEAENIEANNLMFRNVLQAVIPNAPN  136

Query  448  LQHICLQTGRKHYIGPWE  501
            L+H+CLQTG KHY+GP+E
Sbjct  137  LKHVCLQTGLKHYVGPFE  154



>ref|XP_006374845.1| hypothetical protein POPTR_0014s01980g [Populus trichocarpa]
 gb|ERP52642.1| hypothetical protein POPTR_0014s01980g [Populus trichocarpa]
Length=357

 Score =   217 bits (552),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 99/138 (72%), Positives = 116/138 (84%), Gaps = 0/138 (0%)
 Frame = +1

Query  88   EEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPIE  267
            E  DA   +QSVAL+VGVTGIVGNSLAEILPL+DTPGGPWKVYGVARRPRP+WN DHP+E
Sbjct  16   ENGDASRGHQSVALVVGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPNWNLDHPVE  75

Query  268  YIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCPN  447
            YIQCDI N+ D Q+KL+ LTDVTH+FYVTW  R  E +N EAN  M RNV+ A+IP+ PN
Sbjct  76   YIQCDISNTADTQAKLAQLTDVTHIFYVTWALRFTEAENIEANNLMFRNVLQAVIPNAPN  135

Query  448  LQHICLQTGRKHYIGPWE  501
            L+H+CLQTG KHY+GP+E
Sbjct  136  LKHVCLQTGLKHYVGPFE  153



>ref|XP_006432524.1| hypothetical protein CICLE_v10001422mg [Citrus clementina]
 ref|XP_006432525.1| hypothetical protein CICLE_v10001422mg [Citrus clementina]
 ref|XP_006471283.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like isoform 
X3 [Citrus sinensis]
 gb|ESR45764.1| hypothetical protein CICLE_v10001422mg [Citrus clementina]
 gb|ESR45765.1| hypothetical protein CICLE_v10001422mg [Citrus clementina]
Length=392

 Score =   218 bits (555),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 99/139 (71%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            L+ED  P  YQ V LI+GVTGIVGNSLAEILP +DTPGGPWKVYGVARRPRP WNA+HPI
Sbjct  16   LDEDKRPRDYQLVGLILGVTGIVGNSLAEILPRSDTPGGPWKVYGVARRPRPDWNANHPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            EYIQCDI + E+ Q+KLS LTDVTH+FYVTW +R  E +NC+ NG M RNV+ +IIP+ P
Sbjct  76   EYIQCDISDQEETQAKLSKLTDVTHIFYVTWASRPTEVENCQINGSMFRNVLRSIIPNAP  135

Query  445  NLQHICLQTGRKHYIGPWE  501
            NL+HICLQTG KHY+GP++
Sbjct  136  NLRHICLQTGGKHYLGPFD  154



>ref|XP_004501803.1| PREDICTED: uncharacterized protein LOC101510608 [Cicer arietinum]
Length=805

 Score =   226 bits (575),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 105/139 (76%), Positives = 119/139 (86%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            LEED+AP  Y SV LIVGVTGIVGNSLAEILPL DTPGG WKVYGVARRPRPSWNADHPI
Sbjct  432  LEEDEAPRIYHSVGLIVGVTGIVGNSLAEILPLPDTPGGRWKVYGVARRPRPSWNADHPI  491

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            EYIQCDI +  + QSKLSVLTDVTH+FYV+WT R  E +NCE NG MLRNV+ A+IP+ P
Sbjct  492  EYIQCDITDPNETQSKLSVLTDVTHIFYVSWTKRPTEAENCEVNGAMLRNVLRAVIPNAP  551

Query  445  NLQHICLQTGRKHYIGPWE  501
            NL+H+ LQTG KHY+GP++
Sbjct  552  NLRHVSLQTGGKHYVGPFD  570


 Score =   222 bits (566),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            L+E++ P  +Q+VAL++GVTGIVGNSLAEILPLADTPGG WKVYGVARRPRP+WN DHP+
Sbjct  16   LDEEEEPRSFQNVALVIGVTGIVGNSLAEILPLADTPGGRWKVYGVARRPRPAWNEDHPV  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            EYIQCDI +S DA+SKLSVLTDVTH+FYV W +R  E +NCE NG ML+NV+ A+IP+ P
Sbjct  76   EYIQCDITDSNDAESKLSVLTDVTHIFYVCWASRPTEAENCEINGTMLKNVLRAVIPNAP  135

Query  445  NLQHICLQTGRKHYIGPWESYLK  513
            NL+H+ LQTG KHY+G +ES+ K
Sbjct  136  NLRHVSLQTGGKHYVGSFESFGK  158



>ref|XP_007223050.1| hypothetical protein PRUPE_ppa006944mg [Prunus persica]
 gb|EMJ24249.1| hypothetical protein PRUPE_ppa006944mg [Prunus persica]
Length=389

 Score =   217 bits (553),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 120/142 (85%), Gaps = 0/142 (0%)
 Frame = +1

Query  88   EEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPIE  267
            ++ +AP  ++SV L++GVTG+VGNSLAEILPL DTPGGPWKVYGVARRPRP W+ DH +E
Sbjct  19   DDHEAPRSFKSVGLVIGVTGLVGNSLAEILPLHDTPGGPWKVYGVARRPRPDWSVDHTVE  78

Query  268  YIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCPN  447
            YIQCDI +  DAQ+KLS LTDVTH+FYVTWT+R+ E  NCEANG +LRNV++++IP+ PN
Sbjct  79   YIQCDISDPIDAQTKLSQLTDVTHIFYVTWTSRSTEADNCEANGALLRNVLSSVIPNAPN  138

Query  448  LQHICLQTGRKHYIGPWESYLK  513
            L H+CLQTG KHY GP E+Y K
Sbjct  139  LSHVCLQTGTKHYDGPLEAYGK  160



>ref|XP_002518657.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF43582.1| conserved hypothetical protein [Ricinus communis]
Length=391

 Score =   217 bits (553),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 114/143 (80%), Gaps = 0/143 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            +E+DD  PKYQSVALI+GVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRP W ADH I
Sbjct  16   VEDDDPQPKYQSVALIIGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPIWQADHLI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            EYIQCD+ N E    KLS L D TH+F+V W +   E +NC  NG MLRNV+ A+IP+  
Sbjct  76   EYIQCDVSNEEQTLEKLSTLKDTTHIFFVAWASEPTEAENCIVNGTMLRNVLRAVIPNAE  135

Query  445  NLQHICLQTGRKHYIGPWESYLK  513
            NLQH+CLQTGRKHY+G +ES  K
Sbjct  136  NLQHVCLQTGRKHYVGSFESIWK  158



>gb|AFZ41790.1| putative progesterone 5-beta-reductase [Spinacia oleracea]
Length=398

 Score =   217 bits (553),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 101/134 (75%), Positives = 115/134 (86%), Gaps = 0/134 (0%)
 Frame = +1

Query  112  YQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPIEYIQCDILN  291
            YQSVALIVGVTGIVGNSLAEILPL+DTPGGPWK+YGVARRPRP WN+DHPIEYIQCDI +
Sbjct  30   YQSVALIVGVTGIVGNSLAEILPLSDTPGGPWKIYGVARRPRPDWNSDHPIEYIQCDISD  89

Query  292  SEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCPNLQHICLQT  471
              DA SKLS LTD+T++FYV W NR  E +N E N KM RNV+N+ IP+ PNL+HICLQT
Sbjct  90   ENDAVSKLSPLTDITNIFYVCWGNRDSEAENRELNSKMFRNVLNSTIPNSPNLKHICLQT  149

Query  472  GRKHYIGPWESYLK  513
            G KHYIGP+ES+ K
Sbjct  150  GMKHYIGPFESWGK  163



>ref|XP_006432522.1| hypothetical protein CICLE_v100016291mg, partial [Citrus clementina]
 gb|ESR45762.1| hypothetical protein CICLE_v100016291mg, partial [Citrus clementina]
Length=231

 Score =   212 bits (539),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 96/139 (69%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            LEED  P  YQ+V L+VGVTGIVGNSLAEILP  DTPGGPWKV+GVARRPRP+WNA +PI
Sbjct  16   LEEDARPQDYQNVGLVVGVTGIVGNSLAEILPRPDTPGGPWKVHGVARRPRPNWNARYPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            +YIQCDI + +D Q+KLS LTDVTH+FYVTW +R  E +NC+ NG M RNV+ ++IP+ P
Sbjct  76   DYIQCDISDRDDTQAKLSKLTDVTHIFYVTWASRPTEAENCKINGAMFRNVLRSVIPNAP  135

Query  445  NLQHICLQTGRKHYIGPWE  501
            N++HICLQTG KHY+GP+E
Sbjct  136  NVRHICLQTGGKHYVGPFE  154



>ref|XP_006471787.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Citrus 
sinensis]
Length=399

 Score =   216 bits (551),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 95/134 (71%), Positives = 114/134 (85%), Gaps = 0/134 (0%)
 Frame = +1

Query  112  YQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPIEYIQCDILN  291
            YQ V L++GVTGIVGNSLAEILP  DTPGGPWKVYGVARRPRP WN DHPIEYIQCD+ +
Sbjct  30   YQHVGLVIGVTGIVGNSLAEILPRQDTPGGPWKVYGVARRPRPDWNTDHPIEYIQCDVSD  89

Query  292  SEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCPNLQHICLQT  471
             +D Q+KL+ LTDVTH+FYVTW +R  E +NCE NG MLRNV+ ++IP+ PNL+H+CLQT
Sbjct  90   QDDTQAKLTKLTDVTHIFYVTWASRPTEAENCEVNGAMLRNVLRSVIPNAPNLRHVCLQT  149

Query  472  GRKHYIGPWESYLK  513
            G KHY+GP+ES+ K
Sbjct  150  GGKHYVGPFESFGK  163



>ref|XP_009360311.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like isoform 
X1 [Pyrus x bretschneideri]
Length=389

 Score =   216 bits (549),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 114/129 (88%), Gaps = 0/129 (0%)
 Frame = +1

Query  115  QSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPIEYIQCDILNS  294
            QSV L++GVTGIVGNSLAEILPL DTPGGPWKVYGVARRPRP+W+ADHP++YIQCDI + 
Sbjct  25   QSVGLVIGVTGIVGNSLAEILPLHDTPGGPWKVYGVARRPRPNWSADHPVDYIQCDISDP  84

Query  295  EDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCPNLQHICLQTG  474
            ED Q+KLS LTDVTH+FYVTWT+R  E +NCEANG M RNV++ +IP+ PNL+HI LQTG
Sbjct  85   EDVQTKLSGLTDVTHIFYVTWTSRATELENCEANGAMFRNVLSVVIPAAPNLRHISLQTG  144

Query  475  RKHYIGPWE  501
             KHYIGP+E
Sbjct  145  TKHYIGPFE  153



>ref|XP_009360316.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like isoform 
X2 [Pyrus x bretschneideri]
Length=388

 Score =   216 bits (549),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 114/129 (88%), Gaps = 0/129 (0%)
 Frame = +1

Query  115  QSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPIEYIQCDILNS  294
            QSV L++GVTGIVGNSLAEILPL DTPGGPWKVYGVARRPRP+W+ADHP++YIQCDI + 
Sbjct  24   QSVGLVIGVTGIVGNSLAEILPLHDTPGGPWKVYGVARRPRPNWSADHPVDYIQCDISDP  83

Query  295  EDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCPNLQHICLQTG  474
            ED Q+KLS LTDVTH+FYVTWT+R  E +NCEANG M RNV++ +IP+ PNL+HI LQTG
Sbjct  84   EDVQTKLSGLTDVTHIFYVTWTSRATELENCEANGAMFRNVLSVVIPAAPNLRHISLQTG  143

Query  475  RKHYIGPWE  501
             KHYIGP+E
Sbjct  144  TKHYIGPFE  152



>ref|XP_006386483.1| hypothetical protein POPTR_0002s12150g [Populus trichocarpa]
 gb|ERP64280.1| hypothetical protein POPTR_0002s12150g [Populus trichocarpa]
Length=390

 Score =   216 bits (549),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 99/137 (72%), Positives = 117/137 (85%), Gaps = 1/137 (1%)
 Frame = +1

Query  88   EEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPIE  267
            EED+A   YQSVALI+GVTGIVGNSLAEILPL+DTPGGPWKVYGVARR RP+WN DHP+E
Sbjct  17   EEDEASRGYQSVALILGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRSRPNWNEDHPVE  76

Query  268  YIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCPN  447
            YIQCDI N+ + QSKLS LTDVTHVFYVTW +++ E++NCE NG M RNV+ A+IP+  N
Sbjct  77   YIQCDISNTAETQSKLSKLTDVTHVFYVTWASKSTEEENCEINGLMFRNVLQAVIPNAAN  136

Query  448  LQHICLQTGRKHYIGPW  498
            L+H+CLQTG  HY GP+
Sbjct  137  LRHVCLQTGL-HYAGPF  152



>ref|XP_011022580.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Populus 
euphratica]
Length=389

 Score =   216 bits (549),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 119/142 (84%), Gaps = 0/142 (0%)
 Frame = +1

Query  88   EEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPIE  267
            +ED+A    QSVALIVGVTGIVGNSLAEILPL+DTPGGPWKV+GVARR RP+WN DHP+E
Sbjct  15   KEDEATRGCQSVALIVGVTGIVGNSLAEILPLSDTPGGPWKVHGVARRSRPNWNEDHPVE  74

Query  268  YIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCPN  447
            YIQCDI ++   QSKLS LTDVTH+FYVTW ++  E +NCE NG M RNV+ A+IP+ PN
Sbjct  75   YIQCDIADTAQTQSKLSKLTDVTHIFYVTWASKDTEVENCEINGLMFRNVLQAVIPNAPN  134

Query  448  LQHICLQTGRKHYIGPWESYLK  513
            L+H+CLQTG KHY+GP++ + K
Sbjct  135  LRHVCLQTGGKHYLGPFQLFGK  156



>ref|XP_004248770.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Solanum 
lycopersicum]
Length=385

 Score =   215 bits (547),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 101/139 (73%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = +1

Query  97   DAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPIEYIQ  276
            D    +QSVALI+GVTGIVGNSLA ILP ADTPGGPWKVYGVARRPRP WN + PIEYIQ
Sbjct  17   DEDENFQSVALIIGVTGIVGNSLAAILPCADTPGGPWKVYGVARRPRPPWNVNDPIEYIQ  76

Query  277  CDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCPNLQH  456
            CDI N E+ QS+L++LTD+THVFYVTW NR  E +NCE NGKML+NV++AIIP+CPNL H
Sbjct  77   CDISNREETQSRLTLLTDITHVFYVTWANRPTEVENCEINGKMLQNVLDAIIPNCPNLCH  136

Query  457  ICLQTGRKHYIGPWESYLK  513
            ICLQTG KHY G +E + K
Sbjct  137  ICLQTGLKHYHGSFELFGK  155



>ref|XP_006432523.1| hypothetical protein CICLE_v10001412mg [Citrus clementina]
 ref|XP_006471284.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like isoform 
X1 [Citrus sinensis]
 gb|ESR45763.1| hypothetical protein CICLE_v10001412mg [Citrus clementina]
Length=394

 Score =   215 bits (547),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 98/140 (70%), Positives = 118/140 (84%), Gaps = 1/140 (1%)
 Frame = +1

Query  85   LEEDDAPPK-YQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHP  261
            LEED   P+ YQ+V LI+GVTGIVGNSLAEI+P +DTPGGPWKVYGVARRPRP WNA+ P
Sbjct  16   LEEDKQRPQDYQNVGLILGVTGIVGNSLAEIMPRSDTPGGPWKVYGVARRPRPDWNANRP  75

Query  262  IEYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSC  441
            IEYIQCDI + E+ Q+KLS LTDVTH+FYVTW +R  E +NC+ NG M RNV+ ++IP+ 
Sbjct  76   IEYIQCDISDQEETQAKLSKLTDVTHIFYVTWASRPTEAENCQINGAMFRNVLRSVIPNA  135

Query  442  PNLQHICLQTGRKHYIGPWE  501
            PNL+HICLQTG KHY+GP+E
Sbjct  136  PNLRHICLQTGGKHYVGPFE  155



>ref|XP_006471285.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like isoform 
X2 [Citrus sinensis]
Length=393

 Score =   215 bits (547),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 98/140 (70%), Positives = 118/140 (84%), Gaps = 1/140 (1%)
 Frame = +1

Query  85   LEEDDAPPK-YQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHP  261
            LEED   P+ YQ+V LI+GVTGIVGNSLAEI+P +DTPGGPWKVYGVARRPRP WNA+ P
Sbjct  15   LEEDKQRPQDYQNVGLILGVTGIVGNSLAEIMPRSDTPGGPWKVYGVARRPRPDWNANRP  74

Query  262  IEYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSC  441
            IEYIQCDI + E+ Q+KLS LTDVTH+FYVTW +R  E +NC+ NG M RNV+ ++IP+ 
Sbjct  75   IEYIQCDISDQEETQAKLSKLTDVTHIFYVTWASRPTEAENCQINGAMFRNVLRSVIPNA  134

Query  442  PNLQHICLQTGRKHYIGPWE  501
            PNL+HICLQTG KHY+GP+E
Sbjct  135  PNLRHICLQTGGKHYVGPFE  154



>ref|XP_011069776.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Sesamum 
indicum]
Length=387

 Score =   214 bits (546),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 122/142 (86%), Gaps = 3/142 (2%)
 Frame = +1

Query  88   EEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPIE  267
            EE+  P   Q+VALIVGVTGIVGNSLAEILP+++TPGGPWKVYGVARRPRPSWNADHP++
Sbjct  17   EENSGP---QNVALIVGVTGIVGNSLAEILPVSETPGGPWKVYGVARRPRPSWNADHPVQ  73

Query  268  YIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCPN  447
            YIQCD+ +++  Q+KLS LTDVTH+F+VTW NR  E + C+ NG M +NV++AI+P+CPN
Sbjct  74   YIQCDVSDAKQTQAKLSPLTDVTHIFWVTWGNRPTESECCDLNGAMFQNVLDAIMPNCPN  133

Query  448  LQHICLQTGRKHYIGPWESYLK  513
            L HIC+QTG KHYIGP+E++ K
Sbjct  134  LTHICVQTGHKHYIGPFEAFGK  155



>ref|XP_002304533.1| hypothetical protein POPTR_0003s13440g [Populus trichocarpa]
 gb|ABK95799.1| unknown [Populus trichocarpa]
 gb|EEE79512.1| hypothetical protein POPTR_0003s13440g [Populus trichocarpa]
Length=389

 Score =   214 bits (546),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 97/138 (70%), Positives = 117/138 (85%), Gaps = 0/138 (0%)
 Frame = +1

Query  88   EEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPIE  267
            +ED+A    QSVALI+GVTGIVGNSLAEILPL+DTPGGPWKV+GVARR RP+WN DHP+E
Sbjct  15   KEDEATRGCQSVALIIGVTGIVGNSLAEILPLSDTPGGPWKVHGVARRSRPNWNQDHPVE  74

Query  268  YIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCPN  447
            YIQCDI ++   QSKLS LTDVTH+FYVTW ++  E +NCE NG M RNV+ A+IP+ PN
Sbjct  75   YIQCDIADTAQTQSKLSKLTDVTHIFYVTWASKDTEVENCEINGLMFRNVLQAVIPNAPN  134

Query  448  LQHICLQTGRKHYIGPWE  501
            L+H+CLQTG KHY+GP+E
Sbjct  135  LRHVCLQTGGKHYLGPFE  152



>ref|XP_006495338.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like, partial 
[Citrus sinensis]
Length=231

 Score =   209 bits (531),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 115/139 (83%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            LEED     YQ+V L+VGVTGIVGNSLAEILP  DTPGGPWK+YGVARRPRP+WNA +PI
Sbjct  16   LEEDARLQDYQNVGLVVGVTGIVGNSLAEILPRPDTPGGPWKIYGVARRPRPNWNAKYPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            +YIQCD+ + +D Q+KLS L DVTH+FYVTW +R  E +NC+ NG M RNV+ ++IP+ P
Sbjct  76   DYIQCDVSDPDDTQAKLSKLADVTHIFYVTWASRPTEAENCQINGAMFRNVLRSVIPNAP  135

Query  445  NLQHICLQTGRKHYIGPWE  501
            NL+HICLQTG KHY+GP+E
Sbjct  136  NLRHICLQTGGKHYVGPFE  154



>ref|XP_007222999.1| hypothetical protein PRUPE_ppa006780mg [Prunus persica]
 gb|EMJ24198.1| hypothetical protein PRUPE_ppa006780mg [Prunus persica]
Length=395

 Score =   214 bits (544),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 95/134 (71%), Positives = 113/134 (84%), Gaps = 0/134 (0%)
 Frame = +1

Query  100  APPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPIEYIQC  279
            AP  YQSVAL++G+TGIVGNSLAEILPL DTPGGPWKVYGVARR RP W+ DHP++YIQC
Sbjct  23   APEGYQSVALVIGLTGIVGNSLAEILPLHDTPGGPWKVYGVARRARPDWSVDHPVDYIQC  82

Query  280  DILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCPNLQHI  459
            DI + ED Q+KLS LTDVTH+FYVTWT+R  E +NCEANG M RN++  +IP  PNL+H+
Sbjct  83   DISDPEDTQAKLSELTDVTHIFYVTWTSRANEIENCEANGAMFRNLLRVVIPVAPNLRHV  142

Query  460  CLQTGRKHYIGPWE  501
             LQTG KHY+GP+E
Sbjct  143  SLQTGTKHYLGPFE  156



>ref|XP_004300685.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Fragaria 
vesca subsp. vesca]
Length=391

 Score =   213 bits (543),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 118/141 (84%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   EDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPIEY  270
            ED  P    SV L++GVTGIVGNSLAEILPL DTPGGPWKVYGVARRPRP+WNADHP++Y
Sbjct  19   EDAGPRTPVSVGLVIGVTGIVGNSLAEILPLPDTPGGPWKVYGVARRPRPNWNADHPVDY  78

Query  271  IQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCPNL  450
            +QCD+    D ++KL+ LTDVTH+FYVTWT++  E +NCEAN  MLRNV+NA+IP+ PNL
Sbjct  79   VQCDVSKPNDVKAKLAPLTDVTHIFYVTWTSKATESENCEANAAMLRNVLNAMIPNAPNL  138

Query  451  QHICLQTGRKHYIGPWESYLK  513
            +HICLQTG  HY+GP++++ K
Sbjct  139  KHICLQTGGNHYLGPFDTWGK  159



>ref|XP_011028990.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Populus 
euphratica]
Length=390

 Score =   213 bits (543),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 115/138 (83%), Gaps = 0/138 (0%)
 Frame = +1

Query  88   EEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPIE  267
            E  D    +QSVAL+VGVTGIVGNSLAEILPL+DTPGGPWKVYGVARRPRP+WN DHP+E
Sbjct  17   ENGDTSRGHQSVALVVGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPNWNLDHPVE  76

Query  268  YIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCPN  447
            YIQCDI ++ + Q+KLS LTDVTH+FYVTW  R  E +N +AN  M RNV+ A+IP+ PN
Sbjct  77   YIQCDISDTAETQAKLSQLTDVTHIFYVTWALRFTEAENIQANNLMFRNVLQAVIPNAPN  136

Query  448  LQHICLQTGRKHYIGPWE  501
            L+H+CLQTG KHY+GP+E
Sbjct  137  LKHVCLQTGLKHYVGPFE  154



>ref|XP_006471280.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Citrus 
sinensis]
Length=393

 Score =   213 bits (543),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 96/139 (69%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            LEED  P  YQ+V L+VGVTGIVGNSLAEILP  DTPGGPWKV+GVARRPRP+WNA +PI
Sbjct  16   LEEDARPQDYQNVGLVVGVTGIVGNSLAEILPRPDTPGGPWKVHGVARRPRPNWNARYPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            +YIQCDI + +D Q+KLS LTDVTH+FYVTW +R  E +NC+ NG M RNV+ ++IP+ P
Sbjct  76   DYIQCDISDRDDTQAKLSKLTDVTHIFYVTWASRPTEAENCKINGAMFRNVLRSVIPNAP  135

Query  445  NLQHICLQTGRKHYIGPWE  501
            N++HICLQTG KHY+GP+E
Sbjct  136  NVRHICLQTGGKHYVGPFE  154



>ref|XP_008351978.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Malus 
domestica]
Length=392

 Score =   213 bits (542),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 93/133 (70%), Positives = 115/133 (86%), Gaps = 0/133 (0%)
 Frame = +1

Query  115  QSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPIEYIQCDILNS  294
            +SV L++G+TGIVGNSLAEILPL+DTPGGPWKVYGVARRPRP WNADH ++YIQCDI + 
Sbjct  28   KSVGLVIGITGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPHWNADHAVDYIQCDISDP  87

Query  295  EDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCPNLQHICLQTG  474
            +D Q KLS L+DVTH+FYVTWTNR+ E++NCEAN  MLRNV+  +I + PNL+H+CLQTG
Sbjct  88   DDTQKKLSKLSDVTHIFYVTWTNRSTENENCEANAAMLRNVLRIVISNAPNLRHVCLQTG  147

Query  475  RKHYIGPWESYLK  513
             K YIGP+E++ K
Sbjct  148  TKQYIGPFETFGK  160



>ref|XP_008367783.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Malus 
domestica]
Length=362

 Score =   212 bits (539),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 97/134 (72%), Positives = 115/134 (86%), Gaps = 0/134 (0%)
 Frame = +1

Query  112  YQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPIEYIQCDILN  291
            +QSVAL+VGVTGIVGNSL+EILPL DTPGGPWKVYGVARRPRP+WN DHP++YIQCD+ +
Sbjct  27   HQSVALVVGVTGIVGNSLSEILPLPDTPGGPWKVYGVARRPRPNWNVDHPVDYIQCDVSB  86

Query  292  SEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCPNLQHICLQT  471
            +ED + KLS LTDVTH+FYVTW +   E +NC+ANG MLRNV++AIIP  PNL H+ LQT
Sbjct  87   AEDTKIKLSQLTDVTHIFYVTWXSXATEVENCQANGAMLRNVLHAIIPVAPNLCHVSLQT  146

Query  472  GRKHYIGPWESYLK  513
            G KHYIGP+ES  K
Sbjct  147  GAKHYIGPFESIGK  160



>ref|XP_007223008.1| hypothetical protein PRUPE_ppa006816mg [Prunus persica]
 gb|EMJ24207.1| hypothetical protein PRUPE_ppa006816mg [Prunus persica]
Length=394

 Score =   212 bits (540),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 95/138 (69%), Positives = 115/138 (83%), Gaps = 0/138 (0%)
 Frame = +1

Query  100  APPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPIEYIQC  279
            AP   +SV L++GVTGIVGNSLAEILP  DTPGGPWKVYGVARRPRP WNADHP++YIQC
Sbjct  23   APQGQRSVGLVIGVTGIVGNSLAEILPRPDTPGGPWKVYGVARRPRPKWNADHPVDYIQC  82

Query  280  DILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCPNLQHI  459
            DI + ED ++KLS LTDVTH+FYV+W ++  E +NCEANG MLRNV+  +IP  PN++H+
Sbjct  83   DISDPEDTKAKLSKLTDVTHLFYVSWAHKATEVENCEANGAMLRNVLGVVIPVAPNIRHV  142

Query  460  CLQTGRKHYIGPWESYLK  513
             LQTG KHYIGP+ES+ K
Sbjct  143  SLQTGTKHYIGPFESFGK  160



>emb|CDP01226.1| unnamed protein product [Coffea canephora]
Length=370

 Score =   211 bits (538),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 116/138 (84%), Gaps = 0/138 (0%)
 Frame = +1

Query  100  APPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPIEYIQC  279
            A   +QSVAL+ GVTGI+GNSLAEILPL+DTPGGPWKVYGVARRPRPSW+ DHP++YIQC
Sbjct  19   ASKNFQSVALVAGVTGIIGNSLAEILPLSDTPGGPWKVYGVARRPRPSWSLDHPVQYIQC  78

Query  280  DILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCPNLQHI  459
            D+LN++DA++KLS LTD+TH+F+VTW NR  E +  + N  M  NV+NA++P+ PNL HI
Sbjct  79   DVLNADDARAKLSPLTDITHIFWVTWANRPSEAECIQVNDAMFLNVLNAVVPNAPNLTHI  138

Query  460  CLQTGRKHYIGPWESYLK  513
            CLQTG KHYIGP+ES  K
Sbjct  139  CLQTGHKHYIGPFESLGK  156



>ref|XP_006432505.1| hypothetical protein CICLE_v10001414mg [Citrus clementina]
 gb|ESR45745.1| hypothetical protein CICLE_v10001414mg [Citrus clementina]
Length=393

 Score =   212 bits (539),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            LEED     YQ+V L+VGVTGIVGNSLAEILP +DTPGGPWK+YGVARRPRP+WNA +PI
Sbjct  16   LEEDARLQDYQNVGLVVGVTGIVGNSLAEILPRSDTPGGPWKIYGVARRPRPNWNAKYPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            +YIQCD+ + +D Q+KLS L DVTH+FYVTW +R  E +NC+ NG M RNV+ ++IP+ P
Sbjct  76   DYIQCDVSDPDDTQAKLSKLADVTHIFYVTWASRPTEAENCQINGAMFRNVLRSVIPNAP  135

Query  445  NLQHICLQTGRKHYIGPWE  501
            NL+HICLQTG KHY+GP+E
Sbjct  136  NLRHICLQTGGKHYVGPFE  154



>gb|AFW16645.1| putative progesterone 5beta-reductase [Bupleurum falcatum]
Length=388

 Score =   212 bits (539),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 93/141 (66%), Positives = 118/141 (84%), Gaps = 0/141 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            +++++   KY+SVAL+VGVTGIVGNSLAEILP  DTPG PWKVYG+ARRPRP W+A+HP+
Sbjct  16   IDQENVELKYESVALVVGVTGIVGNSLAEILPRTDTPGSPWKVYGIARRPRPQWDANHPV  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            EYIQCDI N E+ +S+LS L DVTH+FYVTW +R  E +NCE N +M RN++N IIP+ P
Sbjct  76   EYIQCDISNPEETESRLSHLKDVTHLFYVTWASRPTEAENCEINSQMFRNLLNCIIPNAP  135

Query  445  NLQHICLQTGRKHYIGPWESY  507
             LQHICLQTG+KHY+G ++SY
Sbjct  136  KLQHICLQTGKKHYLGSFDSY  156



>ref|XP_006495229.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Citrus 
sinensis]
Length=393

 Score =   212 bits (539),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            LEED     YQ+V L+VGVTGIVGNSLAEILP +DTPGGPWK+YGVARRPRP+WNA +PI
Sbjct  16   LEEDARLQDYQNVGLVVGVTGIVGNSLAEILPRSDTPGGPWKIYGVARRPRPNWNAKYPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            +YIQCD+ + +D Q+KLS L DVTH+FYVTW +R  E +NC+ NG M RNV+ ++IP+ P
Sbjct  76   DYIQCDVSDPDDTQAKLSKLADVTHIFYVTWASRPTEAENCQINGAMFRNVLRSVIPNAP  135

Query  445  NLQHICLQTGRKHYIGPWE  501
            NL+HICLQTG KHY+GP+E
Sbjct  136  NLRHICLQTGGKHYVGPFE  154



>ref|XP_011017142.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like isoform 
X2 [Populus euphratica]
Length=389

 Score =   211 bits (538),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 115/138 (83%), Gaps = 0/138 (0%)
 Frame = +1

Query  88   EEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPIE  267
            E  +A   +QSVAL++GVTGIVGNSLAEILPL+DTPGGPWKVYGVARRPRP+WN DHP+E
Sbjct  16   ENGNAFRGHQSVALVIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPNWNLDHPVE  75

Query  268  YIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCPN  447
            YIQCDI N+ + Q+KLS LTDVTH+FYVTW  R  E +N EAN  M RNV+ A+IP+  N
Sbjct  76   YIQCDISNTAETQAKLSQLTDVTHIFYVTWALRFTEAENIEANNLMFRNVLQAVIPNALN  135

Query  448  LQHICLQTGRKHYIGPWE  501
            L+H+CLQTG KHY+GP+E
Sbjct  136  LKHVCLQTGLKHYVGPFE  153



>ref|XP_006374842.1| hypothetical protein POPTR_0014s01950g [Populus trichocarpa]
 gb|ERP52639.1| hypothetical protein POPTR_0014s01950g [Populus trichocarpa]
Length=391

 Score =   211 bits (538),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = +1

Query  88   EEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPIE  267
            ++D+A   Y+SVAL+VGVTGIVGNSLAEILPLADTPGGPWKVYGVAR  RP+WN D+P+E
Sbjct  18   DDDEASRDYKSVALVVGVTGIVGNSLAEILPLADTPGGPWKVYGVARGKRPNWNEDNPVE  77

Query  268  YIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCPN  447
            YIQCDI +    QSKLS+LTDVTH+FYVTW NR  E +NC+ NG M RNV+ A+I +  N
Sbjct  78   YIQCDISDRNQTQSKLSLLTDVTHIFYVTWANRETESENCKINGLMFRNVLEAVILNAHN  137

Query  448  LQHICLQTGRKHYIGPWESYLK  513
            L+HICLQTG KHY+GP++ + K
Sbjct  138  LRHICLQTGTKHYVGPFQFFGK  159



>ref|XP_011017141.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like isoform 
X1 [Populus euphratica]
Length=390

 Score =   211 bits (538),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 115/138 (83%), Gaps = 0/138 (0%)
 Frame = +1

Query  88   EEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPIE  267
            E  +A   +QSVAL++GVTGIVGNSLAEILPL+DTPGGPWKVYGVARRPRP+WN DHP+E
Sbjct  17   ENGNAFRGHQSVALVIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPNWNLDHPVE  76

Query  268  YIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCPN  447
            YIQCDI N+ + Q+KLS LTDVTH+FYVTW  R  E +N EAN  M RNV+ A+IP+  N
Sbjct  77   YIQCDISNTAETQAKLSQLTDVTHIFYVTWALRFTEAENIEANNLMFRNVLQAVIPNALN  136

Query  448  LQHICLQTGRKHYIGPWE  501
            L+H+CLQTG KHY+GP+E
Sbjct  137  LKHVCLQTGLKHYVGPFE  154



>ref|XP_006450012.1| hypothetical protein CICLE_v10013989mg [Citrus clementina]
 gb|ESR63252.1| hypothetical protein CICLE_v10013989mg [Citrus clementina]
Length=393

 Score =   211 bits (536),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 115/139 (83%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            LEED     YQ+V L+VGVTGIVGNSLAEILP  DTPGGPWK+YGVARRPRP+WNA +PI
Sbjct  16   LEEDARLQDYQNVGLVVGVTGIVGNSLAEILPRPDTPGGPWKIYGVARRPRPNWNAKYPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            +YIQCD+ + +D Q+KLS L DVTH+FYVTW +R  E +NC+ NG M RNV+ ++IP+ P
Sbjct  76   DYIQCDVSDPDDTQAKLSKLADVTHIFYVTWASRPTEAENCQINGAMFRNVLRSVIPNAP  135

Query  445  NLQHICLQTGRKHYIGPWE  501
            NL+HICLQTG KHY+GP+E
Sbjct  136  NLRHICLQTGGKHYVGPFE  154



>ref|XP_002302422.2| hypothetical protein POPTR_0002s12170g [Populus trichocarpa]
 gb|EEE81695.2| hypothetical protein POPTR_0002s12170g [Populus trichocarpa]
Length=390

 Score =   209 bits (532),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 95/138 (69%), Positives = 114/138 (83%), Gaps = 0/138 (0%)
 Frame = +1

Query  88   EEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPIE  267
            E  +A   + SVAL++GVTGIVGNSLAEILPL+DTPGGPWKVYGVARRPRP+WN DHP+E
Sbjct  17   ENGNAFRGHHSVALVIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPNWNLDHPVE  76

Query  268  YIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCPN  447
            YIQCDI N+ + Q+KLS LTDVTH+FYVTW  R  E +N EAN  M RNV+ A+IP+  N
Sbjct  77   YIQCDISNTAETQAKLSQLTDVTHIFYVTWALRFTEAENIEANNLMFRNVLQAVIPNALN  136

Query  448  LQHICLQTGRKHYIGPWE  501
            L+H+CLQTG KHY+GP+E
Sbjct  137  LKHVCLQTGLKHYVGPFE  154



>ref|XP_008220361.1| PREDICTED: uncharacterized protein LOC103320460 [Prunus mume]
Length=830

 Score =   216 bits (551),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 96/134 (72%), Positives = 114/134 (85%), Gaps = 0/134 (0%)
 Frame = +1

Query  100  APPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPIEYIQC  279
            AP  YQSVAL++GVTGIVGNSLAEILPL DTPGGPWKVYGVARRPRP W+ DHP++YIQC
Sbjct  23   APEGYQSVALVIGVTGIVGNSLAEILPLHDTPGGPWKVYGVARRPRPDWSVDHPVDYIQC  82

Query  280  DILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCPNLQHI  459
            DI + ED ++KLS LTDVTH+FYVTWT+R  E +NCEANG M RN++  +IP  PNL+H+
Sbjct  83   DISDPEDTKAKLSELTDVTHIFYVTWTSRANEIENCEANGAMFRNLLRVVIPVAPNLRHV  142

Query  460  CLQTGRKHYIGPWE  501
             LQTG KHY+GP+E
Sbjct  143  SLQTGTKHYLGPFE  156


 Score =   211 bits (537),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 95/138 (69%), Positives = 115/138 (83%), Gaps = 0/138 (0%)
 Frame = +1

Query  100  APPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPIEYIQC  279
            AP   +SV L++GVTGIVGNSLAEILP  DTPGGPWKVYGVARRPRP+WNADHP++YIQC
Sbjct  459  APQGQRSVGLVIGVTGIVGNSLAEILPRPDTPGGPWKVYGVARRPRPNWNADHPVDYIQC  518

Query  280  DILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCPNLQHI  459
            DI + ED ++KLS LTDVTH+FYV+W N+  E +NCEANG ML NV+  +IP  PN++H+
Sbjct  519  DISDPEDTKAKLSKLTDVTHIFYVSWANKASEVENCEANGAMLCNVLGVVIPVAPNIRHV  578

Query  460  CLQTGRKHYIGPWESYLK  513
             LQTG KHYIGP+ES+ K
Sbjct  579  SLQTGTKHYIGPFESFGK  596



>ref|XP_007042587.1| Progesterone 5-beta-reductase, putative isoform 2 [Theobroma 
cacao]
 gb|EOX98418.1| Progesterone 5-beta-reductase, putative isoform 2 [Theobroma 
cacao]
Length=390

 Score =   208 bits (530),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 92/143 (64%), Positives = 114/143 (80%), Gaps = 0/143 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            LEE D P KY+SVAL++G+TGIVG+SLAEILP +D PGGPWKVYGVARRPRP+W    PI
Sbjct  16   LEEHDKPSKYKSVALVIGITGIVGSSLAEILPFSDIPGGPWKVYGVARRPRPAWTNALPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            +YIQC+I N E+ Q KLS L DVTH+FYV W  ++ E +NC  NG MLRNV+ A+IP+ P
Sbjct  76   DYIQCNISNEEETQEKLSKLKDVTHIFYVAWAKKSSEAENCMVNGTMLRNVLKAVIPNAP  135

Query  445  NLQHICLQTGRKHYIGPWESYLK  513
             L+H+CLQTGR+HY GP++S  K
Sbjct  136  KLKHVCLQTGRRHYTGPFDSVGK  158



>gb|ABD33275.2| progesterone 5-beta-reductase, putative [Medicago truncatula]
Length=387

 Score =   208 bits (530),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 95/135 (70%), Positives = 111/135 (82%), Gaps = 0/135 (0%)
 Frame = +1

Query  97   DAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPIEYIQ  276
            +AP   Q+VALI+GVTGIVGNSLAEILPL DTP GPWKVYGVARRPRP WN D+P+ YIQ
Sbjct  18   EAPRNVQNVALIIGVTGIVGNSLAEILPLKDTPVGPWKVYGVARRPRPMWNVDNPVHYIQ  77

Query  277  CDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCPNLQH  456
            CD+ N  D + KLS LTDVTH+FYV+WT+R  E QNCE NG MLRNV+ A+IP+ PNL H
Sbjct  78   CDVSNQNDVELKLSPLTDVTHIFYVSWTSRPTEAQNCEVNGAMLRNVLQALIPNAPNLSH  137

Query  457  ICLQTGRKHYIGPWE  501
            + LQTG KHY+GP+E
Sbjct  138  VSLQTGAKHYVGPFE  152



>ref|XP_007042586.1| Progesterone 5-beta-reductase, putative isoform 1 [Theobroma 
cacao]
 gb|EOX98417.1| Progesterone 5-beta-reductase, putative isoform 1 [Theobroma 
cacao]
Length=407

 Score =   209 bits (531),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 91/140 (65%), Positives = 113/140 (81%), Gaps = 0/140 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            LEE D P KY+SVAL++G+TGIVG+SLAEILP +D PGGPWKVYGVARRPRP+W    PI
Sbjct  33   LEEHDKPSKYKSVALVIGITGIVGSSLAEILPFSDIPGGPWKVYGVARRPRPAWTNALPI  92

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            +YIQC+I N E+ Q KLS L DVTH+FYV W  ++ E +NC  NG MLRNV+ A+IP+ P
Sbjct  93   DYIQCNISNEEETQEKLSKLKDVTHIFYVAWAKKSSEAENCMVNGTMLRNVLKAVIPNAP  152

Query  445  NLQHICLQTGRKHYIGPWES  504
             L+H+CLQTGR+HY GP++S
Sbjct  153  KLKHVCLQTGRRHYTGPFDS  172



>ref|XP_006432520.1| hypothetical protein CICLE_v10003925mg [Citrus clementina]
 gb|ESR45760.1| hypothetical protein CICLE_v10003925mg [Citrus clementina]
Length=419

 Score =   209 bits (531),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 114/139 (82%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            LEE +    YQSV L+VGVTGIVGNSLAEILP  DTPGGPWKVYGVARRPRP+WNA +P+
Sbjct  24   LEEYEQTRDYQSVGLVVGVTGIVGNSLAEILPRPDTPGGPWKVYGVARRPRPNWNAAYPV  83

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            EY+QCD+ + ED Q+KLS LTDVTH+FYVTW  R  E +NC+ NG ML NV+ ++IP+ P
Sbjct  84   EYLQCDVSDQEDTQAKLSKLTDVTHIFYVTWDGRRTEAENCQINGAMLHNVLRSVIPNAP  143

Query  445  NLQHICLQTGRKHYIGPWE  501
            NL+HICLQTG K+Y+GP E
Sbjct  144  NLRHICLQTGGKYYMGPLE  162



>gb|AHC23071.1| putative progesterone 5beta-reductase, partial [Thymus x citriodorus]
Length=354

 Score =   206 bits (525),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 92/120 (77%), Positives = 110/120 (92%), Gaps = 0/120 (0%)
 Frame = +1

Query  145  GIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPIEYIQCDILNSEDAQSKLSVL  324
            GIVGNSLAEILPL+DTPGGPWKVYGVARRPRP+WN DHPI YI+CD+ +S DA+ KLS L
Sbjct  1    GIVGNSLAEILPLSDTPGGPWKVYGVARRPRPAWNEDHPITYIRCDVSDSGDAEEKLSPL  60

Query  325  TDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCPNLQHICLQTGRKHYIGPWES  504
            TDVT++FYVTWTN++ E +NCEANGKML+NV++A+IP+CPNL+HICL TGRKHY GP+ES
Sbjct  61   TDVTNIFYVTWTNKSTEAENCEANGKMLKNVLDALIPNCPNLKHICLLTGRKHYTGPFES  120



>ref|XP_004499012.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Cicer 
arietinum]
Length=389

 Score =   207 bits (527),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 93/137 (68%), Positives = 116/137 (85%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   DDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPIEYI  273
            ++AP  +++VALI+GVTGIVGNSLAEILPL DTPGGPWKVYGVARRPRP+WNA++P+ YI
Sbjct  19   EEAPQSFKNVALIIGVTGIVGNSLAEILPLNDTPGGPWKVYGVARRPRPTWNANNPVHYI  78

Query  274  QCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCPNLQ  453
            QCD+ N  D + KLS LTDVTH+FYV+WT+R  E QN + NG MLRNV+ A+IP+ PNL+
Sbjct  79   QCDVSNQNDVELKLSPLTDVTHIFYVSWTSRPTEAQNSDVNGSMLRNVLRALIPNAPNLR  138

Query  454  HICLQTGRKHYIGPWES  504
            HI LQTG KHY+G +E+
Sbjct  139  HISLQTGAKHYVGSFET  155



>ref|XP_003589112.1| hypothetical protein MTR_1g018610 [Medicago truncatula]
 gb|AES59363.1| 3-oxo-delta(4,5)-steroid 5-beta-reductase-like protein [Medicago 
truncatula]
Length=423

 Score =   208 bits (530),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 95/135 (70%), Positives = 111/135 (82%), Gaps = 0/135 (0%)
 Frame = +1

Query  97   DAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPIEYIQ  276
            +AP   Q+VALI+GVTGIVGNSLAEILPL DTP GPWKVYGVARRPRP WN D+P+ YIQ
Sbjct  54   EAPRNVQNVALIIGVTGIVGNSLAEILPLKDTPVGPWKVYGVARRPRPMWNVDNPVHYIQ  113

Query  277  CDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCPNLQH  456
            CD+ N  D + KLS LTDVTH+FYV+WT+R  E QNCE NG MLRNV+ A+IP+ PNL H
Sbjct  114  CDVSNQNDVELKLSPLTDVTHIFYVSWTSRPTEAQNCEVNGAMLRNVLQALIPNAPNLSH  173

Query  457  ICLQTGRKHYIGPWE  501
            + LQTG KHY+GP+E
Sbjct  174  VSLQTGAKHYVGPFE  188



>ref|XP_006420622.1| hypothetical protein CICLE_v10006945mg, partial [Citrus clementina]
 gb|ESR33862.1| hypothetical protein CICLE_v10006945mg, partial [Citrus clementina]
Length=385

 Score =   207 bits (527),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            L+E +     Q V LIVGVTGIVGNSLAEILP  +TPGGPWKVYGVARRPRP+WNADHPI
Sbjct  6    LDEGEPSRDNQHVGLIVGVTGIVGNSLAEILPQPNTPGGPWKVYGVARRPRPAWNADHPI  65

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            +YIQCD+ ++++ Q+KLS LTDVTH+FYVTW +R  E +NC  NG MLRNV+ +++P+ P
Sbjct  66   QYIQCDVSDADETQAKLSKLTDVTHIFYVTWASRPTELENCHVNGAMLRNVLRSVMPNAP  125

Query  445  NLQHICLQTGRKHYIGPWESYL  510
            NL+H+CLQTG KHY+GP++ ++
Sbjct  126  NLRHVCLQTGGKHYLGPFDYFV  147



>gb|AHI88616.2| progesterone 5-beta-reductase [Capsella bursa-pastoris]
Length=386

 Score =   207 bits (527),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 98/138 (71%), Positives = 115/138 (83%), Gaps = 6/138 (4%)
 Frame = +1

Query  85   LEEDDAPPK-YQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHP  261
            LEED+ PP+ YQSV LI+GVTGIVGNSLAEILPL+DTPGGPWKVYGVARRP+PSWNADHP
Sbjct  17   LEEDEPPPRSYQSVGLIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPQPSWNADHP  76

Query  262  IEYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSC  441
            I+YIQCD+ +++D + KLS LTDVTH+F+V WTNR  E +NCE N  MLRNV+ AI+P  
Sbjct  77   IDYIQCDVSDTDDVRCKLSPLTDVTHIFFVAWTNRGSEPENCETNAGMLRNVLRAIVPHA  136

Query  442  PNLQHICLQTGRKHYIGP  495
            PN     L+TG KHYIGP
Sbjct  137  PN-----LRTGGKHYIGP  149



>gb|AHC23070.1| putative progesterone 5beta-reductase, partial [Thymus x citriodorus]
Length=354

 Score =   206 bits (524),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 92/120 (77%), Positives = 110/120 (92%), Gaps = 0/120 (0%)
 Frame = +1

Query  145  GIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPIEYIQCDILNSEDAQSKLSVL  324
            GIVGNSLAEILPL+DTPGGPWKVYGVARRPRP+WN DHPI YI+CD+ +S DA+ KLS L
Sbjct  1    GIVGNSLAEILPLSDTPGGPWKVYGVARRPRPAWNEDHPITYIRCDVSDSVDAKEKLSPL  60

Query  325  TDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCPNLQHICLQTGRKHYIGPWES  504
            TDVT++FYVTWTN++ E +NCEANGKML+NV++A+IP+CPNL+HICL TGRKHY GP+ES
Sbjct  61   TDVTNIFYVTWTNKSTEAENCEANGKMLKNVLDALIPNCPNLKHICLLTGRKHYTGPFES  120



>gb|ABD93571.1| developmental process IMP [Solanum lycopersicum]
Length=167

 Score =   200 bits (508),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 91/112 (81%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +1

Query  178  PLADTPGGPWKVYGVARRPRPSWNADHPIEYIQCDILNSEDAQSKLSVLTDVTHVFYVTW  357
            PLAD PGGPWKVYGVARR RPSWNADHPIEY+QCDI N ED QSKLSVLTDVTHVFYVTW
Sbjct  4    PLADXPGGPWKVYGVARRARPSWNADHPIEYVQCDISNPEDTQSKLSVLTDVTHVFYVTW  63

Query  358  TNRTREDQNCEANGKMLRNVVNAIIPSCPNLQHICLQTGRKHYIGPWESYLK  513
             NR+ E +NCE NGKM RNV+N IIP+CPNL+HICLQTGRKHY+GP+E Y K
Sbjct  64   ANRSTEVENCEINGKMFRNVLNVIIPNCPNLRHICLQTGRKHYLGPFELYGK  115



>ref|XP_010556421.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like isoform 
X1 [Tarenaya hassleriana]
Length=384

 Score =   207 bits (526),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 92/136 (68%), Positives = 111/136 (82%), Gaps = 0/136 (0%)
 Frame = +1

Query  97   DAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPIEYIQ  276
            DA P Y+SV LI+GVTGIVGNSLA ILPL+DT GGPWKVYGVARRPRP W  D  I+YIQ
Sbjct  12   DAEPHYRSVGLIIGVTGIVGNSLAGILPLSDTSGGPWKVYGVARRPRPDWTTDQQIQYIQ  71

Query  277  CDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCPNLQH  456
            CD+ ++ D ++KLS LTDVTH+FYVTWTNR  E +NC AN  MLRNV+ A++P  PNL+H
Sbjct  72   CDVSDAIDVRTKLSPLTDVTHIFYVTWTNRETESENCSANAAMLRNVLRAVVPHAPNLRH  131

Query  457  ICLQTGRKHYIGPWES  504
            +CLQTG KHY GP+++
Sbjct  132  VCLQTGTKHYAGPFDN  147



>gb|AHC23069.1| putative progesterone 5beta-reductase, partial [Thymus x citriodorus]
Length=354

 Score =   206 bits (524),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 92/120 (77%), Positives = 110/120 (92%), Gaps = 0/120 (0%)
 Frame = +1

Query  145  GIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPIEYIQCDILNSEDAQSKLSVL  324
            GIVGNSLAEILPL+DTPGGPWKVYGVARRPRP+WN DHPI YI+CD+ +S DA+ KLS L
Sbjct  1    GIVGNSLAEILPLSDTPGGPWKVYGVARRPRPAWNEDHPITYIRCDVSDSVDAKEKLSPL  60

Query  325  TDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCPNLQHICLQTGRKHYIGPWES  504
            TDVT++FYVTWTN++ E +NCEANGKML+NV++A+IP+CPNL+HICL TGRKHY GP+ES
Sbjct  61   TDVTNIFYVTWTNKSTEAENCEANGKMLKNVLDALIPNCPNLKHICLLTGRKHYTGPFES  120



>ref|XP_010556422.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like isoform 
X2 [Tarenaya hassleriana]
Length=383

 Score =   207 bits (526),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 92/136 (68%), Positives = 111/136 (82%), Gaps = 0/136 (0%)
 Frame = +1

Query  97   DAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPIEYIQ  276
            DA P Y+SV LI+GVTGIVGNSLA ILPL+DT GGPWKVYGVARRPRP W  D  I+YIQ
Sbjct  11   DAEPHYRSVGLIIGVTGIVGNSLAGILPLSDTSGGPWKVYGVARRPRPDWTTDQQIQYIQ  70

Query  277  CDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCPNLQH  456
            CD+ ++ D ++KLS LTDVTH+FYVTWTNR  E +NC AN  MLRNV+ A++P  PNL+H
Sbjct  71   CDVSDAIDVRTKLSPLTDVTHIFYVTWTNRETESENCSANAAMLRNVLRAVVPHAPNLRH  130

Query  457  ICLQTGRKHYIGPWES  504
            +CLQTG KHY GP+++
Sbjct  131  VCLQTGTKHYAGPFDN  146



>ref|XP_007226426.1| hypothetical protein PRUPE_ppa023813mg, partial [Prunus persica]
 gb|EMJ27625.1| hypothetical protein PRUPE_ppa023813mg, partial [Prunus persica]
Length=379

 Score =   206 bits (525),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 115/142 (81%), Gaps = 0/142 (0%)
 Frame = +1

Query  88   EEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPIE  267
            E+ +AP   +SV L++GVTGIVGNSLA ILP +DTPGGPWKVYGVARRPRP WN+D+P+E
Sbjct  5    EDHEAPHTPKSVGLVIGVTGIVGNSLARILPQSDTPGGPWKVYGVARRPRPHWNSDYPME  64

Query  268  YIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCPN  447
            YIQCDI + +D  SKLS LTDVTH+FYVTW +R+ E QNCEAN  M+RNV+  +I + PN
Sbjct  65   YIQCDISDPKDTVSKLSRLTDVTHIFYVTWASRSTEPQNCEANAAMIRNVLRVVITNAPN  124

Query  448  LQHICLQTGRKHYIGPWESYLK  513
            L H+CLQTG +HY GP+ES  K
Sbjct  125  LCHVCLQTGTRHYFGPYESLGK  146



>ref|XP_010673631.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase [Beta vulgaris 
subsp. vulgaris]
Length=395

 Score =   205 bits (522),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 95/134 (71%), Positives = 112/134 (84%), Gaps = 0/134 (0%)
 Frame = +1

Query  112  YQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPIEYIQCDILN  291
            YQSVALIVGVTGIVGNSLAEILPL+DTPGGPWKVYGVARRPRP+WNA+HPIEYIQCDI +
Sbjct  29   YQSVALIVGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPNWNAEHPIEYIQCDISD  88

Query  292  SEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCPNLQHICLQT  471
             +D   KLS LTDVT++FYV W N   E +NC+ N  M +NV+NA++P+ PNL+HICLQT
Sbjct  89   KDDVVLKLSPLTDVTNIFYVCWANCVTEAENCKINSMMFQNVLNAVVPNAPNLKHICLQT  148

Query  472  GRKHYIGPWESYLK  513
            G KHY G +E + K
Sbjct  149  GMKHYTGAFEYWGK  162



>ref|XP_006471279.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Citrus 
sinensis]
Length=393

 Score =   203 bits (517),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 90/139 (65%), Positives = 114/139 (82%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            LEE + P  YQ+V L+VGVTGIVGN LAEILP +DTPGGPWKVYGVARRPRP W+A +PI
Sbjct  16   LEEYEQPWDYQNVGLVVGVTGIVGNCLAEILPRSDTPGGPWKVYGVARRPRPDWSAAYPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            EYIQCDI + ++ +SKLS LT++TH+FY+TW  R  + +NCE N  M RNV+ ++IP+ P
Sbjct  76   EYIQCDISDPDETRSKLSKLTNITHIFYMTWAGRPAQAENCEINSAMFRNVLRSVIPNAP  135

Query  445  NLQHICLQTGRKHYIGPWE  501
            NL+H+CLQTG KHY+GP+E
Sbjct  136  NLRHVCLQTGSKHYLGPFE  154



>ref|XP_006432519.1| hypothetical protein CICLE_v10001420mg [Citrus clementina]
 gb|ESR45759.1| hypothetical protein CICLE_v10001420mg [Citrus clementina]
Length=393

 Score =   203 bits (517),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 90/139 (65%), Positives = 114/139 (82%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            LEE + P  YQ+V L+VGVTGIVGN LAEILP +DTPGGPWKVYGVARRPRP W+A +PI
Sbjct  16   LEEYEQPWDYQNVGLVVGVTGIVGNCLAEILPRSDTPGGPWKVYGVARRPRPDWSAAYPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            EYIQCDI + ++ +SKLS LT++TH+FY+TW  R  + +NCE N  M RNV+ ++IP+ P
Sbjct  76   EYIQCDISDPDETRSKLSKLTNITHIFYMTWAGRPAQAENCEINSAMFRNVLRSVIPNAP  135

Query  445  NLQHICLQTGRKHYIGPWE  501
            NL+H+CLQTG KHY+GP+E
Sbjct  136  NLRHVCLQTGSKHYLGPFE  154



>gb|AHI88615.1| putative progesterone 5-beta-reductase [Cleome spinosa]
Length=390

 Score =   203 bits (516),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 92/127 (72%), Positives = 110/127 (87%), Gaps = 1/127 (1%)
 Frame = +1

Query  85   LEEDDAPPK-YQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHP  261
            LEED+ PP+ YQSV LI+GVTGIVGNSLAEILPL+DTPGGPWKVYGVARRP+PSWNADHP
Sbjct  17   LEEDEPPPRSYQSVGLIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPQPSWNADHP  76

Query  262  IEYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSC  441
            I+YIQCD+ +++D + KLS LTDVTH+F+V WTNR  E +NCE N  MLRNV+ AI+P  
Sbjct  77   IDYIQCDVSDTDDVRCKLSPLTDVTHIFFVAWTNRGSEPENCETNAGMLRNVLRAIVPHA  136

Query  442  PNLQHIC  462
            PNL+H+C
Sbjct  137  PNLRHVC  143



>ref|XP_006489807.1| PREDICTED: uncharacterized protein LOC102610524 [Citrus sinensis]
Length=826

 Score =   209 bits (533),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 93/143 (65%), Positives = 118/143 (83%), Gaps = 0/143 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            L+E +     Q V LIVGVTGIVGNSLAEILP  +TPGGPWKVYGVARRPRP+WNADHPI
Sbjct  447  LDEGEPSRDNQHVGLIVGVTGIVGNSLAEILPQPNTPGGPWKVYGVARRPRPAWNADHPI  506

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            +YIQCD+ ++++ Q+KLS LTDVTH+FYVTW +R  E +NC  NG MLRNV+ ++IP+ P
Sbjct  507  QYIQCDVSDADETQAKLSKLTDVTHIFYVTWASRPTELENCHVNGAMLRNVLRSVIPNAP  566

Query  445  NLQHICLQTGRKHYIGPWESYLK  513
            NL+H CLQTG KHY+GP++ +++
Sbjct  567  NLRHFCLQTGGKHYLGPFDYFVE  589



>ref|XP_006472268.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like isoform 
X2 [Citrus sinensis]
Length=389

 Score =   202 bits (514),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 113/139 (81%), Gaps = 4/139 (3%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            L EDD     ++V L++GVTGI+GNSLAEILP  DTPGGPWKVYGVARRPRP WNADHPI
Sbjct  15   LGEDDE----RNVGLVIGVTGILGNSLAEILPRPDTPGGPWKVYGVARRPRPHWNADHPI  70

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            EYIQCD+ + +  Q+KLS LTDVTH+FY TW +   E +NC+ NG MLRNV++++IPS P
Sbjct  71   EYIQCDVSDPQQTQTKLSQLTDVTHIFYTTWASSPTEVENCQINGAMLRNVLHSVIPSAP  130

Query  445  NLQHICLQTGRKHYIGPWE  501
            NL+HICL TG KHY+GP+E
Sbjct  131  NLRHICLVTGAKHYLGPFE  149



>ref|XP_006472267.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like isoform 
X1 [Citrus sinensis]
Length=390

 Score =   202 bits (513),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 113/139 (81%), Gaps = 4/139 (3%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            L EDD     ++V L++GVTGI+GNSLAEILP  DTPGGPWKVYGVARRPRP WNADHPI
Sbjct  16   LGEDDE----RNVGLVIGVTGILGNSLAEILPRPDTPGGPWKVYGVARRPRPHWNADHPI  71

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            EYIQCD+ + +  Q+KLS LTDVTH+FY TW +   E +NC+ NG MLRNV++++IPS P
Sbjct  72   EYIQCDVSDPQQTQTKLSQLTDVTHIFYTTWASSPTEVENCQINGAMLRNVLHSVIPSAP  131

Query  445  NLQHICLQTGRKHYIGPWE  501
            NL+HICL TG KHY+GP+E
Sbjct  132  NLRHICLVTGAKHYLGPFE  150



>ref|XP_006433601.1| hypothetical protein CICLE_v10001445mg [Citrus clementina]
 gb|ESR46841.1| hypothetical protein CICLE_v10001445mg [Citrus clementina]
Length=390

 Score =   202 bits (513),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 92/139 (66%), Positives = 113/139 (81%), Gaps = 4/139 (3%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            L EDD     ++V L++GVTGI+GNSLA+ILP  DTPGGPWK YGVARRPRP WNADHPI
Sbjct  16   LGEDDE----RNVGLVIGVTGILGNSLADILPRPDTPGGPWKAYGVARRPRPDWNADHPI  71

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            EYIQCD+ + E  Q+KLS LTDVTH+FY TW +R  E +NC+ NG MLRNV++++IP+ P
Sbjct  72   EYIQCDVSDPEQTQTKLSQLTDVTHIFYTTWASRPTEVENCQINGAMLRNVLHSVIPTAP  131

Query  445  NLQHICLQTGRKHYIGPWE  501
            NL+HICL TG KHY+GP+E
Sbjct  132  NLRHICLVTGAKHYLGPFE  150



>gb|ABK24388.1| unknown [Picea sitchensis]
Length=399

 Score =   201 bits (512),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 88/136 (65%), Positives = 112/136 (82%), Gaps = 0/136 (0%)
 Frame = +1

Query  97   DAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPIEYIQ  276
            + P K Q VAL++GVTGIVGN LAEILPL+DTPGGPWKVYGVARRP+P W+ D P+EY+Q
Sbjct  27   EKPEKQQGVALVIGVTGIVGNCLAEILPLSDTPGGPWKVYGVARRPKPDWSPDSPVEYVQ  86

Query  277  CDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCPNLQH  456
            CD+L+ E    K+S L DVTH+F+V W NR  E+QNCE NG+ML NV++A++P+  NLQH
Sbjct  87   CDVLDREHTLEKISPLKDVTHLFWVVWVNRETEEQNCEDNGRMLSNVLDALLPNAENLQH  146

Query  457  ICLQTGRKHYIGPWES  504
            ICLQTG KHY+GP+++
Sbjct  147  ICLQTGGKHYLGPFDA  162



>gb|KJB32255.1| hypothetical protein B456_005G233200 [Gossypium raimondii]
Length=393

 Score =   201 bits (511),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 91/143 (64%), Positives = 112/143 (78%), Gaps = 0/143 (0%)
 Frame = +1

Query  85   LEEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI  264
            +EE D   KY+SVAL++G+TGIVGNSLAEI+P +  PGGPWKVYGVAR+PRP+  +  PI
Sbjct  16   MEEHDKQSKYKSVALVIGITGIVGNSLAEIIPFSGIPGGPWKVYGVARQPRPASTSHLPI  75

Query  265  EYIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCP  444
            EYIQCD+L+ E+   KLS L DVTHVFYV W  R+ ED+NC  NG MLRNV+ A+IP+ P
Sbjct  76   EYIQCDVLDEEETYDKLSKLNDVTHVFYVAWDKRSTEDENCVINGTMLRNVLKAVIPNSP  135

Query  445  NLQHICLQTGRKHYIGPWESYLK  513
             L+HICLQTGR+HY GP + Y K
Sbjct  136  KLKHICLQTGRRHYTGPIDLYGK  158



>gb|ABD33273.2| VEP1 , putative [Medicago truncatula]
Length=407

 Score =   201 bits (511),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 92/139 (66%), Positives = 113/139 (81%), Gaps = 0/139 (0%)
 Frame = +1

Query  88   EEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPIE  267
            E  +AP  +Q+VALI+GVTGIVGNSLAEILPL DTPGGPWKVYGVARRP+P+WNAD  + 
Sbjct  35   EFKEAPGSFQNVALIIGVTGIVGNSLAEILPLDDTPGGPWKVYGVARRPQPTWNADKYVH  94

Query  268  YIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCPN  447
            YIQCD+ + +D + KLS LTDVTH+FYV+WT+   E QNCE NG MLRNV+ A+IP+  N
Sbjct  95   YIQCDVSDQKDVELKLSPLTDVTHIFYVSWTSMPTEAQNCEVNGSMLRNVLRALIPNTLN  154

Query  448  LQHICLQTGRKHYIGPWES  504
            L H+ LQTG KHY+G +E+
Sbjct  155  LCHVSLQTGTKHYLGSFET  173



>ref|XP_003589110.1| hypothetical protein MTR_1g018590 [Medicago truncatula]
Length=399

 Score =   201 bits (510),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 92/139 (66%), Positives = 113/139 (81%), Gaps = 0/139 (0%)
 Frame = +1

Query  88   EEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPIE  267
            E  +AP  +Q+VALI+GVTGIVGNSLAEILPL DTPGGPWKVYGVARRP+P+WNAD  + 
Sbjct  25   EFKEAPGSFQNVALIIGVTGIVGNSLAEILPLDDTPGGPWKVYGVARRPQPTWNADKYVH  84

Query  268  YIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCPN  447
            YIQCD+ + +D + KLS LTDVTH+FYV+WT+   E QNCE NG MLRNV+ A+IP+  N
Sbjct  85   YIQCDVSDQKDVELKLSPLTDVTHIFYVSWTSMPTEAQNCEVNGSMLRNVLRALIPNTLN  144

Query  448  LQHICLQTGRKHYIGPWES  504
            L H+ LQTG KHY+G +E+
Sbjct  145  LCHVSLQTGTKHYLGSFET  163



>gb|AES59361.2| 3-oxo-delta(4,5)-steroid 5-beta-reductase-like protein [Medicago 
truncatula]
Length=394

 Score =   200 bits (509),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 92/139 (66%), Positives = 113/139 (81%), Gaps = 0/139 (0%)
 Frame = +1

Query  88   EEDDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPIE  267
            E  +AP  +Q+VALI+GVTGIVGNSLAEILPL DTPGGPWKVYGVARRP+P+WNAD  + 
Sbjct  22   EFKEAPGSFQNVALIIGVTGIVGNSLAEILPLDDTPGGPWKVYGVARRPQPTWNADKYVH  81

Query  268  YIQCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCPN  447
            YIQCD+ + +D + KLS LTDVTH+FYV+WT+   E QNCE NG MLRNV+ A+IP+  N
Sbjct  82   YIQCDVSDQKDVELKLSPLTDVTHIFYVSWTSMPTEAQNCEVNGSMLRNVLRALIPNTLN  141

Query  448  LQHICLQTGRKHYIGPWES  504
            L H+ LQTG KHY+G +E+
Sbjct  142  LCHVSLQTGTKHYLGSFET  160



>gb|KHN21407.1| Hypothetical protein glysoja_042470 [Glycine soja]
Length=305

 Score =   197 bits (502),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 91/129 (71%), Positives = 109/129 (84%), Gaps = 0/129 (0%)
 Frame = +1

Query  115  QSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPIEYIQCDILNS  294
            QSVAL++GVTGIVGNSLA+ILPL++TPGGPWKVYGVARR +PSWNA + + YIQCDI + 
Sbjct  9    QSVALVLGVTGIVGNSLAQILPLSNTPGGPWKVYGVARRTQPSWNALNTVHYIQCDISDQ  68

Query  295  EDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCPNLQHICLQTG  474
             DA+SKLS LTDVTHVFYV W  R  E QNC+ NG MLRNV+ A+IP+ PNL+H+ LQTG
Sbjct  69   NDAESKLSSLTDVTHVFYVCWARRPTEAQNCQVNGAMLRNVLRAVIPNAPNLRHVSLQTG  128

Query  475  RKHYIGPWE  501
             KHY+GP+E
Sbjct  129  TKHYLGPFE  137



>ref|XP_006374843.1| hypothetical protein POPTR_0014s01960g [Populus trichocarpa]
 gb|ERP52640.1| hypothetical protein POPTR_0014s01960g [Populus trichocarpa]
Length=388

 Score =   199 bits (507),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 91/130 (70%), Positives = 112/130 (86%), Gaps = 0/130 (0%)
 Frame = +1

Query  118  SVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPIEYIQCDILNSE  297
            SVALIVGVTGIVGNSLAEILP +DTPGGPWKVYGVARRPRP+W+ + P+EYIQCDI +S 
Sbjct  24   SVALIVGVTGIVGNSLAEILPRSDTPGGPWKVYGVARRPRPNWHENCPVEYIQCDISDSA  83

Query  298  DAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCPNLQHICLQTGR  477
             A+SKLS LTDVTH+FYVTW +R+ E +NC+ NG M RN++ A++P   NL+H+CLQTG 
Sbjct  84   LAKSKLSHLTDVTHIFYVTWASRSNEAENCKINGLMFRNLLQAVVPIATNLRHVCLQTGT  143

Query  478  KHYIGPWESY  507
            K+YIGP+ES+
Sbjct  144  KNYIGPFESF  153



>ref|XP_006387765.1| hypothetical protein POPTR_0602s00210g [Populus trichocarpa]
 gb|ERP46679.1| hypothetical protein POPTR_0602s00210g [Populus trichocarpa]
Length=388

 Score =   199 bits (507),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 91/130 (70%), Positives = 112/130 (86%), Gaps = 0/130 (0%)
 Frame = +1

Query  118  SVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPIEYIQCDILNSE  297
            SVALIVGVTGIVGNSLAEILP +DTPGGPWKVYGVARRPRP+W+ + P+EYIQCDI +S 
Sbjct  24   SVALIVGVTGIVGNSLAEILPRSDTPGGPWKVYGVARRPRPNWHENCPVEYIQCDISDSA  83

Query  298  DAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCPNLQHICLQTGR  477
             A+SKLS LTDVTH+FYVTW +R+ E +NC+ NG M RN++ A++P   NL+H+CLQTG 
Sbjct  84   LAKSKLSHLTDVTHIFYVTWASRSNEAENCKINGLMFRNLLQAVVPIATNLRHVCLQTGT  143

Query  478  KHYIGPWESY  507
            K+YIGP+ES+
Sbjct  144  KNYIGPFESF  153



>gb|ABK96579.1| unknown [Populus trichocarpa x Populus deltoides]
Length=388

 Score =   199 bits (505),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 91/130 (70%), Positives = 111/130 (85%), Gaps = 0/130 (0%)
 Frame = +1

Query  118  SVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPIEYIQCDILNSE  297
            SVALIVGVTGIVGNSLAEILP +DTPGGPWKVYGVARRPRP+W+ + P+EYIQCDI +S 
Sbjct  24   SVALIVGVTGIVGNSLAEILPRSDTPGGPWKVYGVARRPRPNWHENCPVEYIQCDISDSA  83

Query  298  DAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCPNLQHICLQTGR  477
             A+SKLS LTDVTH+FYVTW +R+ E +NC+ NG M RN++ A++P   NL+H+ LQTG 
Sbjct  84   LAKSKLSHLTDVTHIFYVTWASRSNEAENCKINGLMFRNLLQAVVPIATNLRHVSLQTGT  143

Query  478  KHYIGPWESY  507
            KHYIGP+ES+
Sbjct  144  KHYIGPFESF  153



>gb|ABR16676.1| unknown [Picea sitchensis]
Length=399

 Score =   198 bits (504),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 87/137 (64%), Positives = 111/137 (81%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   DDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPIEYI  273
            +D   K Q VAL++GVTGIVGNSL EILPL+DTPGGPWK+YGVARRP+P W+ D  +EYI
Sbjct  26   EDKSEKQQGVALVIGVTGIVGNSLVEILPLSDTPGGPWKIYGVARRPKPDWSPDTSVEYI  85

Query  274  QCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCPNLQ  453
            QCD+L+ E    K+S L DVTH+F+V W NR  E+QNCE NG+ML NV++A++P+  NLQ
Sbjct  86   QCDVLDRELTLEKISPLKDVTHLFWVVWVNRETEEQNCEDNGRMLSNVLDALLPNAENLQ  145

Query  454  HICLQTGRKHYIGPWES  504
            HICLQTG KHY+GP+++
Sbjct  146  HICLQTGAKHYLGPFDA  162



>ref|XP_006387764.1| hypothetical protein POPTR_0602s00200g [Populus trichocarpa]
 gb|ERP46678.1| hypothetical protein POPTR_0602s00200g [Populus trichocarpa]
Length=446

 Score =   199 bits (506),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 91/130 (70%), Positives = 111/130 (85%), Gaps = 0/130 (0%)
 Frame = +1

Query  118  SVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPIEYIQCDILNSE  297
            SVALIVGVTGIVGNSLAEILP +DTPGGPWKVYGVARRPRP+W+ + P+EYIQCDI +S 
Sbjct  82   SVALIVGVTGIVGNSLAEILPRSDTPGGPWKVYGVARRPRPNWHENCPVEYIQCDISDSA  141

Query  298  DAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCPNLQHICLQTGR  477
             A+SKLS LTDVTH+FYVTW +R+ E +NC+ NG M RN++ A++P   NL+H+ LQTG 
Sbjct  142  LAKSKLSHLTDVTHIFYVTWASRSNEAENCKINGLMFRNLLQAVVPIATNLRHVSLQTGT  201

Query  478  KHYIGPWESY  507
            KHYIGP+ES+
Sbjct  202  KHYIGPFESF  211



>ref|XP_006432518.1| hypothetical protein CICLE_v10003867mg [Citrus clementina]
 gb|ESR45758.1| hypothetical protein CICLE_v10003867mg [Citrus clementina]
Length=344

 Score =   196 bits (499),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 109/129 (84%), Gaps = 0/129 (0%)
 Frame = +1

Query  115  QSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPIEYIQCDILNS  294
            ++V L++GVTGIVGNSLAEIL  +DTP GPWKVYGVAR PRP+WN D+P+EYIQCD+ + 
Sbjct  13   KNVGLVIGVTGIVGNSLAEILLRSDTPVGPWKVYGVARHPRPNWNDDYPVEYIQCDVSDQ  72

Query  295  EDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCPNLQHICLQTG  474
            ED Q+KLS LTD+TH+FYVTW +R  E +NC+ NG M  NV++++IP+ PNL+HICLQTG
Sbjct  73   EDTQAKLSKLTDITHIFYVTWASRRTEAENCQINGAMFHNVLSSVIPNAPNLRHICLQTG  132

Query  475  RKHYIGPWE  501
             KHY+GP+E
Sbjct  133  GKHYVGPFE  141



>gb|ABK24243.1| unknown [Picea sitchensis]
Length=399

 Score =   197 bits (502),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 86/137 (63%), Positives = 112/137 (82%), Gaps = 0/137 (0%)
 Frame = +1

Query  94   DDAPPKYQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPIEYI  273
            +D   K Q VAL++GVTGIVGNSL EILPL+DTPGGPWK+YGVARRP+P W+ D P+EYI
Sbjct  26   EDKSEKQQGVALVIGVTGIVGNSLVEILPLSDTPGGPWKIYGVARRPKPDWSPDTPVEYI  85

Query  274  QCDILNSEDAQSKLSVLTDVTHVFYVTWTNRTREDQNCEANGKMLRNVVNAIIPSCPNLQ  453
            QCD+L+ +    K+S L DVTH+F+V W +R  E+QNCE NG+ML NV++A++P+  NLQ
Sbjct  86   QCDVLDRKLTLEKISPLKDVTHLFWVVWVSRETEEQNCEDNGRMLSNVLDALLPNAENLQ  145

Query  454  HICLQTGRKHYIGPWES  504
            HICLQTG KHY+GP+++
Sbjct  146  HICLQTGAKHYLGPFDA  162



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 554939364720