BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002D22

Length=554
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009789786.1|  PREDICTED: CASP-like protein 2B1                   244   2e-78   Nicotiana sylvestris
ref|XP_009778293.1|  PREDICTED: CASP-like protein 2B1                   244   3e-78   Nicotiana sylvestris
ref|XP_009592222.1|  PREDICTED: CASP-like protein 2B1                   243   5e-78   Nicotiana tomentosiformis
emb|CDP04507.1|  unnamed protein product                                240   1e-76   Coffea canephora [robusta coffee]
ref|XP_002522908.1|  conserved hypothetical protein                     239   1e-76   Ricinus communis
ref|XP_006467305.1|  PREDICTED: CASP-like protein POPTRDRAFT_8189...    238   4e-76   Citrus sinensis [apfelsine]
ref|XP_009627397.1|  PREDICTED: CASP-like protein 2B1                   238   7e-76   Nicotiana tomentosiformis
ref|XP_004250287.1|  PREDICTED: CASP-like protein 2B1                   237   1e-75   Solanum lycopersicum
ref|XP_006352330.1|  PREDICTED: CASP-like protein RCOM_0864260-like     236   3e-75   Solanum tuberosum [potatoes]
ref|XP_006365844.1|  PREDICTED: CASP-like protein GSVIVT000135020...    236   3e-75   Solanum tuberosum [potatoes]
ref|XP_011095935.1|  PREDICTED: CASP-like protein 2B1                   236   4e-75   Sesamum indicum [beniseed]
sp|A7R385.1|CSPLC_VITVI  RecName: Full=CASP-like protein 2B1; Sho...    236   5e-75   Vitis vinifera
ref|XP_004239817.1|  PREDICTED: CASP-like protein 2B1                   235   1e-74   Solanum lycopersicum
ref|XP_006449900.1|  hypothetical protein CICLE_v10016754mg             233   3e-74   Citrus clementina [clementine]
ref|XP_002307903.1|  integral membrane family protein                   233   7e-74   Populus trichocarpa [western balsam poplar]
ref|XP_008227444.1|  PREDICTED: CASP-like protein RCOM_0864260          233   9e-74   Prunus mume [ume]
ref|XP_011086255.1|  PREDICTED: CASP-like protein 2B1                   232   1e-73   Sesamum indicum [beniseed]
ref|XP_011004511.1|  PREDICTED: CASP-like protein 2B2                   231   3e-73   Populus euphratica
ref|XP_007212067.1|  hypothetical protein PRUPE_ppa011591mg             231   5e-73   Prunus persica
ref|XP_008370988.1|  PREDICTED: CASP-like protein RCOM_0864260          230   6e-73   Malus domestica [apple tree]
gb|KDP29302.1|  hypothetical protein JCGZ_19405                         230   7e-73   Jatropha curcas
gb|AGE09573.1|  UPF-like protein                                        228   6e-72   Eucalyptus cladocalyx
ref|XP_009346047.1|  PREDICTED: CASP-like protein RCOM_0864260          226   3e-71   Pyrus x bretschneideri [bai li]
ref|XP_010052948.1|  PREDICTED: CASP-like protein 2B1                   226   4e-71   Eucalyptus grandis [rose gum]
ref|XP_008384165.1|  PREDICTED: CASP-like protein RCOM_0864260 is...    226   5e-71   
ref|XP_002323133.1|  hypothetical protein POPTR_0016s01010g             225   5e-71   Populus trichocarpa [western balsam poplar]
ref|XP_007026314.1|  CASP-like protein POPTRDRAFT_818956 isoform 1      225   7e-71   
gb|KJB67396.1|  hypothetical protein B456_010G188700                    225   7e-71   Gossypium raimondii
gb|KJB69167.1|  hypothetical protein B456_011G008900                    223   5e-70   Gossypium raimondii
gb|EYU27670.1|  hypothetical protein MIMGU_mgv1a013955mg                222   1e-69   Erythranthe guttata [common monkey flower]
gb|KHG12114.1|  CASP-like protein                                       222   7e-69   Gossypium arboreum [tree cotton]
ref|XP_003534893.1|  PREDICTED: CASP-like protein GSVIVT000135020...    218   3e-68   Glycine max [soybeans]
gb|EYU33843.1|  hypothetical protein MIMGU_mgv1a024377mg                218   4e-68   Erythranthe guttata [common monkey flower]
ref|XP_003547283.1|  PREDICTED: CASP-like protein RCOM_0864260-like     218   5e-68   Glycine max [soybeans]
gb|KHN40811.1|  CASP-like protein                                       217   1e-67   Glycine soja [wild soybean]
ref|XP_004486332.1|  PREDICTED: CASP-like protein POPTRDRAFT_5759...    214   1e-66   Cicer arietinum [garbanzo]
ref|XP_010087633.1|  hypothetical protein L484_010584                   214   2e-66   Morus notabilis
ref|XP_010270196.1|  PREDICTED: CASP-like protein 2B1                   213   3e-66   Nelumbo nucifera [Indian lotus]
ref|XP_010540841.1|  PREDICTED: CASP-like protein 2B1                   212   7e-66   Tarenaya hassleriana [spider flower]
ref|XP_003594276.1|  hypothetical protein MTR_2g026530                  211   2e-65   Medicago truncatula
gb|KHN32948.1|  CASP-like protein                                       209   1e-64   Glycine soja [wild soybean]
ref|XP_010647129.1|  PREDICTED: CASP-like protein 2B1                   208   2e-64   
ref|XP_010252724.1|  PREDICTED: CASP-like protein 2B1                   207   7e-64   
ref|XP_003549509.1|  PREDICTED: CASP-like protein RCOM_0864260-like     207   8e-64   Glycine max [soybeans]
ref|XP_003529670.1|  PREDICTED: CASP-like protein RCOM_0864260-like     207   1e-63   Glycine max [soybeans]
gb|EPS67628.1|  hypothetical protein M569_07146                         204   7e-63   Genlisea aurea
gb|KJB67397.1|  hypothetical protein B456_010G188700                    202   8e-63   Gossypium raimondii
ref|XP_007154032.1|  hypothetical protein PHAVU_003G085300g             202   6e-62   Phaseolus vulgaris [French bean]
ref|XP_008463603.1|  PREDICTED: CASP-like protein RCOM_0864260          198   2e-60   Cucumis melo [Oriental melon]
ref|XP_008384166.1|  PREDICTED: CASP-like protein GSVIVT000135020...    196   4e-60   
ref|XP_011040245.1|  PREDICTED: CASP-like protein 2B1                   197   5e-60   Populus euphratica
ref|XP_006410744.1|  hypothetical protein EUTSA_v10017259mg             196   2e-59   Eutrema salsugineum [saltwater cress]
ref|XP_009133041.1|  PREDICTED: CASP-like protein 1                     195   4e-59   Brassica rapa
ref|XP_004139530.1|  PREDICTED: CASP-like protein GSVIVT000135020...    195   5e-59   Cucumis sativus [cucumbers]
emb|CDY69773.1|  BnaAnng31470D                                          190   3e-57   Brassica napus [oilseed rape]
ref|XP_010909399.1|  PREDICTED: CASP-like protein 2B1                   189   6e-57   Elaeis guineensis
gb|KFK36471.1|  hypothetical protein AALP_AA4G129000                    189   6e-57   Arabis alpina [alpine rockcress]
ref|XP_010686644.1|  PREDICTED: CASP-like protein 2B1                   189   9e-57   Beta vulgaris subsp. vulgaris [field beet]
gb|ACU18779.1|  unknown                                                 186   1e-56   Glycine max [soybeans]
ref|NP_565822.1|  CASP-like protein                                     188   1e-56   Arabidopsis thaliana [mouse-ear cress]
gb|AAM66995.1|  unknown                                                 188   1e-56   Arabidopsis thaliana [mouse-ear cress]
emb|CDX79621.1|  BnaC03g19570D                                          184   4e-55   
ref|XP_004293384.1|  PREDICTED: CASP-like protein 2B1                   182   3e-54   Fragaria vesca subsp. vesca
ref|XP_002879572.1|  integral membrane family protein                   182   4e-54   
ref|XP_006295017.1|  hypothetical protein CARUB_v10024089mg             182   5e-54   
ref|XP_009374906.1|  PREDICTED: LOW QUALITY PROTEIN: CASP-like pr...    179   1e-53   Pyrus x bretschneideri [bai li]
ref|XP_009414753.1|  PREDICTED: CASP-like protein 2B1                   180   2e-53   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009407837.1|  PREDICTED: CASP-like protein 2B1                   179   7e-53   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009124526.1|  PREDICTED: CASP-like protein ARALYDRAFT_915107     178   2e-52   Brassica rapa
ref|XP_010907052.1|  PREDICTED: CASP-like protein 2B1                   176   6e-52   Elaeis guineensis
ref|XP_009141516.1|  PREDICTED: CASP-like protein 1                     176   9e-52   Brassica rapa
ref|XP_006849031.1|  hypothetical protein AMTR_s00028p00153320          176   1e-51   Amborella trichopoda
gb|KFK26539.1|  hypothetical protein AALP_AA8G262200                    175   2e-51   Arabis alpina [alpine rockcress]
emb|CDY71930.1|  BnaCnng75140D                                          174   5e-51   Brassica napus [oilseed rape]
gb|KEH36968.1|  CASP POPTRDRAFT-like protein                            172   2e-50   Medicago truncatula
ref|XP_008800613.1|  PREDICTED: CASP-like protein GSVIVT00013502001     172   3e-50   Phoenix dactylifera
emb|CDY34471.1|  BnaC01g21620D                                          171   6e-50   Brassica napus [oilseed rape]
emb|CDY40441.1|  BnaA04g20760D                                          171   7e-50   Brassica napus [oilseed rape]
ref|XP_009136766.1|  PREDICTED: CASP-like protein ARALYDRAFT_915107     171   2e-49   Brassica rapa
ref|XP_009145991.1|  PREDICTED: LOW QUALITY PROTEIN: CASP-like pr...    170   2e-49   
emb|CDX90524.1|  BnaA03g42570D                                          171   2e-49   
ref|XP_006414349.1|  hypothetical protein EUTSA_v10026264mg             169   5e-49   Eutrema salsugineum [saltwater cress]
emb|CDY32244.1|  BnaA01g17400D                                          167   3e-48   Brassica napus [oilseed rape]
ref|XP_007147633.1|  hypothetical protein PHAVU_006G141200g             161   2e-46   Phaseolus vulgaris [French bean]
emb|CDY09694.1|  BnaC07g33670D                                          161   8e-46   Brassica napus [oilseed rape]
ref|XP_010917254.1|  PREDICTED: CASP-like protein 2B1                   158   6e-45   Elaeis guineensis
ref|XP_002868133.1|  integral membrane family protein                   155   1e-43   Arabidopsis lyrata subsp. lyrata
emb|CAB10420.1|  LET1 like protein                                      162   3e-43   Arabidopsis thaliana [mouse-ear cress]
emb|CDY70521.1|  BnaCnng68730D                                          154   3e-43   Brassica napus [oilseed rape]
ref|NP_567497.1|  uncharacterized protein                               153   5e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008791870.1|  PREDICTED: CASP-like protein RCOM_0864260          151   3e-42   Phoenix dactylifera
ref|XP_010509564.1|  PREDICTED: CASP-like protein 2B2                   146   2e-40   Camelina sativa [gold-of-pleasure]
emb|CDY71889.1|  BnaAnng39180D                                          144   2e-39   Brassica napus [oilseed rape]
ref|XP_010505095.1|  PREDICTED: CASP-like protein 2B2                   142   1e-38   Camelina sativa [gold-of-pleasure]
ref|XP_010516779.1|  PREDICTED: CASP-like protein 2B2                   140   5e-38   Camelina sativa [gold-of-pleasure]
ref|XP_004985347.1|  PREDICTED: CASP-like protein Sb01g044070-like      139   2e-37   Setaria italica
ref|XP_002468338.1|  hypothetical protein SORBIDRAFT_01g044070          137   1e-36   Sorghum bicolor [broomcorn]
ref|XP_010440155.1|  PREDICTED: CASP-like protein 2B1                   134   7e-36   Camelina sativa [gold-of-pleasure]
dbj|BAK05801.1|  predicted protein                                      134   1e-35   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010434824.1|  PREDICTED: CASP-like protein 2B1                   132   4e-35   Camelina sativa [gold-of-pleasure]
ref|XP_010449792.1|  PREDICTED: CASP-like protein 2B1                   132   6e-35   Camelina sativa [gold-of-pleasure]
tpg|DAA43987.1|  TPA: hypothetical protein ZEAMMB73_493857              132   9e-35   
dbj|BAJ91438.1|  predicted protein                                      132   2e-34   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003558594.1|  PREDICTED: CASP-like protein 2U2                   131   3e-34   Brachypodium distachyon [annual false brome]
ref|XP_006284611.1|  hypothetical protein CARUB_v10005842mg             128   2e-33   Capsella rubella
ref|XP_007026315.1|  CASP-like protein POPTRDRAFT_818956 isoform 2      127   6e-33   
sp|B8LQF9.1|CSPL9_PICSI  RecName: Full=CASP-like protein 2BC2; Sh...    128   8e-33   Picea sitchensis
gb|EMT22476.1|  hypothetical protein F775_11012                         128   2e-32   
ref|XP_004163465.1|  PREDICTED: CASP-like protein RCOM_0864260-li...    120   1e-31   
dbj|BAJ98184.1|  predicted protein                                      115   9e-29   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK05387.1|  predicted protein                                      113   1e-27   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003575478.2|  PREDICTED: CASP-like protein 2B1                   109   5e-26   Brachypodium distachyon [annual false brome]
ref|XP_008777752.1|  PREDICTED: CASP-like protein GSVIVT00013502001     102   7e-25   
sp|Q10QH3.2|CSPLL_ORYSJ  RecName: Full=CASP-like protein Os03g019...  95.1    1e-20   Oryza sativa Japonica Group [Japonica rice]
sp|Q0IN16.2|CSPLE_ORYSJ  RecName: Full=CASP-like protein 2B1; Sho...  95.1    1e-20   Oryza sativa Japonica Group [Japonica rice]
sp|D5A8E6.1|CSPL4_PICSI  RecName: Full=CASP-like protein 2BC1; Sh...  90.5    1e-18   Picea sitchensis
ref|XP_002443261.1|  hypothetical protein SORBIDRAFT_08g016550        88.2    4e-18   Sorghum bicolor [broomcorn]
ref|NP_001159013.1|  membrane protein                                 83.6    2e-16   
ref|XP_004162507.1|  PREDICTED: CASP-like protein GSVIVT000135020...  79.0    3e-15   
ref|XP_004162506.1|  PREDICTED: CASP-like protein GSVIVT000135020...  79.0    3e-15   
ref|XP_004962893.1|  PREDICTED: CASP-like protein Sb08g016550-like    77.8    2e-14   Setaria italica
gb|EEC69375.1|  hypothetical protein OsI_38510                        75.9    4e-14   Oryza sativa Indica Group [Indian rice]
ref|NP_001066880.1|  Os12g0514300                                     76.3    5e-14   
gb|EEC69376.1|  hypothetical protein OsI_38511                        74.3    2e-13   Oryza sativa Indica Group [Indian rice]
ref|NP_001142330.1|  CASP-like protein 2U1                            74.3    3e-13   Zea mays [maize]
gb|ABF94455.1|  plant integral membrane protein TIGR01569 contain...  73.9    6e-13   Oryza sativa Japonica Group [Japonica rice]
sp|B9IM09.2|CSPLG_POPTR  RecName: Full=CASP-like protein 2C1; Sho...  70.1    1e-11   Populus trichocarpa [western balsam poplar]
ref|XP_008800283.1|  PREDICTED: CASP-like protein Os06g0656300        69.3    1e-11   Phoenix dactylifera
gb|KJB53802.1|  hypothetical protein B456_009G006000                  69.3    2e-11   Gossypium raimondii
gb|EPS70050.1|  hypothetical protein M569_04716                       67.4    4e-11   Genlisea aurea
ref|XP_010913647.1|  PREDICTED: CASP-like protein 2C1 isoform X1      68.2    4e-11   Elaeis guineensis
ref|XP_007014187.1|  CASP-like protein XL3                            68.2    4e-11   
ref|XP_010260176.1|  PREDICTED: CASP-like protein XL3                 67.4    9e-11   
ref|XP_006651131.1|  PREDICTED: CASP-like protein Os03g0196400-like   67.4    1e-10   
sp|Q5K4H9.1|CSPL2_GOSHI  RecName: Full=CASP-like protein XL3; Alt...  65.5    4e-10   Gossypium hirsutum [American cotton]
gb|KHF98180.1|  CASP-like protein XL3                                 65.1    4e-10   Gossypium arboreum [tree cotton]
sp|P0DH82.1|CSPL1_MARPO  RecName: Full=CASP-like protein 2U1; Sho...  65.1    7e-10   Marchantia polymorpha
gb|KDP36414.1|  hypothetical protein JCGZ_08683                       64.3    8e-10   Jatropha curcas
ref|XP_011043990.1|  PREDICTED: CASP-like protein 2C1                 63.9    1e-09   Populus euphratica
ref|XP_002273403.2|  PREDICTED: CASP-like protein 2C1                 63.5    2e-09   Vitis vinifera
ref|XP_010046989.1|  PREDICTED: CASP-like protein 2C1                 61.2    1e-08   Eucalyptus grandis [rose gum]
ref|XP_002325065.1|  hypothetical protein POPTR_0018s10260g           60.1    1e-08   
emb|CBI17818.3|  unnamed protein product                              61.6    1e-08   Vitis vinifera
ref|XP_010913648.1|  PREDICTED: CASP-like protein 2C1 isoform X2      60.5    1e-08   
gb|EYU42435.1|  hypothetical protein MIMGU_mgv1a014854mg              59.7    3e-08   Erythranthe guttata [common monkey flower]
ref|XP_011069901.1|  PREDICTED: CASP-like protein 2C1 isoform X2      58.5    8e-08   Sesamum indicum [beniseed]
ref|XP_010265455.1|  PREDICTED: CASP-like protein 2C1                 57.8    1e-07   Nelumbo nucifera [Indian lotus]
ref|XP_009396107.1|  PREDICTED: CASP-like protein 2C1                 57.8    2e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007223970.1|  hypothetical protein PRUPE_ppa014614mg           57.4    2e-07   
ref|XP_009396704.1|  PREDICTED: CASP-like protein 2C1                 56.2    6e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004149074.1|  PREDICTED: CASP-like protein POPTRDRAFT_5786...  56.2    7e-07   Cucumis sativus [cucumbers]
emb|CDY68034.1|  BnaCnng57380D                                        55.5    7e-07   Brassica napus [oilseed rape]
ref|XP_006845610.1|  hypothetical protein AMTR_s00019p00209400        55.5    1e-06   Amborella trichopoda
ref|XP_011069900.1|  PREDICTED: CASP-like protein 2C1 isoform X1      55.1    2e-06   Sesamum indicum [beniseed]
ref|XP_009798279.1|  PREDICTED: CASP-like protein 2C1                 54.7    3e-06   Nicotiana sylvestris
ref|XP_003553094.1|  PREDICTED: CASP-like protein 10-like             53.9    6e-06   Glycine max [soybeans]
emb|CDP02964.1|  unnamed protein product                              53.1    6e-06   Coffea canephora [robusta coffee]
ref|XP_003579514.1|  PREDICTED: CASP-like protein 2A1                 53.5    7e-06   Brachypodium distachyon [annual false brome]
dbj|BAJ84836.1|  predicted protein                                    53.5    8e-06   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ85571.1|  predicted protein                                    53.5    8e-06   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT22680.1|  hypothetical protein F775_30108                       53.5    8e-06   
ref|XP_002890211.1|  integral membrane family protein                 53.5    9e-06   
gb|AAL36294.1|  unknown protein                                       53.5    9e-06   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564017.1|  uncharacterized protein                             53.1    1e-05   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001237350.1|  CASP-like protein 2C1                            52.8    1e-05   Glycine max [soybeans]
gb|KHN22710.1|  CASP-like protein 3                                   52.8    1e-05   Glycine soja [wild soybean]
ref|XP_010327104.1|  PREDICTED: CASP-like protein 2A1                 52.4    2e-05   Solanum lycopersicum
ref|XP_008223711.1|  PREDICTED: CASP-like protein POPTRDRAFT_578614   52.4    2e-05   Prunus mume [ume]
ref|XP_002533365.1|  conserved hypothetical protein                   50.4    3e-05   
ref|XP_006304211.1|  hypothetical protein CARUB_v10010315mg           52.0    3e-05   Capsella rubella
ref|XP_010062716.1|  PREDICTED: CASP-like protein 2A1                 52.0    3e-05   
ref|XP_002991776.1|  hypothetical protein SELMODRAFT_272229           52.0    3e-05   Selaginella moellendorffii
ref|XP_010433586.1|  PREDICTED: CASP-like protein 2C1                 51.2    3e-05   Camelina sativa [gold-of-pleasure]
gb|KCW69848.1|  hypothetical protein EUGRSUZ_F03189                   52.0    4e-05   Eucalyptus grandis [rose gum]
ref|XP_004494327.1|  PREDICTED: CASP-like protein VIT_07s0104g013...  51.6    4e-05   Cicer arietinum [garbanzo]
ref|XP_010448363.1|  PREDICTED: CASP-like protein 2C1                 51.2    4e-05   Camelina sativa [gold-of-pleasure]
emb|CDX96785.1|  BnaA08g23280D                                        51.6    4e-05   
ref|XP_002869651.1|  predicted protein                                50.8    5e-05   Arabidopsis lyrata subsp. lyrata
gb|KFK43914.1|  hypothetical protein AALP_AA1G190800                  51.6    5e-05   Arabis alpina [alpine rockcress]
ref|XP_010438829.1|  PREDICTED: CASP-like protein 2C1                 50.8    5e-05   Camelina sativa [gold-of-pleasure]
ref|XP_002989705.1|  hypothetical protein SELMODRAFT_272089           51.2    5e-05   Selaginella moellendorffii
ref|XP_002317605.1|  integral membrane family protein                 51.2    5e-05   Populus trichocarpa [western balsam poplar]
emb|CDX94411.1|  BnaC01g17730D                                        50.8    6e-05   
ref|XP_009341031.1|  PREDICTED: CASP-like protein POPTRDRAFT_578614   50.8    6e-05   Pyrus x bretschneideri [bai li]
ref|XP_007146967.1|  hypothetical protein PHAVU_006G085600g           50.4    6e-05   Phaseolus vulgaris [French bean]
gb|KDP24708.1|  hypothetical protein JCGZ_25699                       50.8    6e-05   Jatropha curcas
ref|XP_009611405.1|  PREDICTED: CASP-like protein 2C1                 51.6    7e-05   Nicotiana tomentosiformis
ref|XP_009783950.1|  PREDICTED: CASP-like protein 2A1                 50.8    7e-05   Nicotiana sylvestris
ref|XP_008451819.1|  PREDICTED: CASP-like protein F16                 50.8    7e-05   Cucumis melo [Oriental melon]
emb|CDX81811.1|  BnaC08g37900D                                        50.8    8e-05   
gb|AFK47158.1|  unknown                                               50.8    8e-05   Lotus japonicus
ref|XP_004242688.1|  PREDICTED: CASP-like protein 2C1                 50.8    9e-05   Solanum lycopersicum
gb|KJB12801.1|  hypothetical protein B456_002G037500                  50.8    9e-05   Gossypium raimondii
emb|CDY48478.1|  BnaC05g13380D                                        50.4    1e-04   Brassica napus [oilseed rape]
ref|XP_009117714.1|  PREDICTED: CASP-like protein At1g17200           50.4    1e-04   Brassica rapa
gb|KHN08760.1|  CASP-like protein 10                                  50.4    1e-04   Glycine soja [wild soybean]
ref|XP_010498065.1|  PREDICTED: CASP-like protein 2A1                 50.4    1e-04   
ref|XP_002276206.1|  PREDICTED: CASP-like protein 1E2                 50.4    1e-04   Vitis vinifera
ref|XP_010459293.1|  PREDICTED: CASP-like protein 2A1                 50.8    1e-04   Camelina sativa [gold-of-pleasure]
ref|XP_007154779.1|  hypothetical protein PHAVU_003G147200g           50.1    1e-04   Phaseolus vulgaris [French bean]
ref|XP_009139582.1|  PREDICTED: CASP-like protein ARALYDRAFT_657503   49.7    1e-04   Brassica rapa
ref|XP_009380719.1|  PREDICTED: CASP-like protein Os04g0281900        50.8    1e-04   
ref|XP_006366193.1|  PREDICTED: CASP-like protein VIT_11s0052g011...  50.1    1e-04   Solanum tuberosum [potatoes]
ref|XP_010540119.1|  PREDICTED: CASP-like protein 2A1                 50.1    1e-04   Tarenaya hassleriana [spider flower]
ref|XP_010476864.1|  PREDICTED: CASP-like protein 2A1                 50.1    2e-04   Camelina sativa [gold-of-pleasure]
ref|XP_003610149.1|  hypothetical protein MTR_4g128520                49.7    2e-04   
gb|KHG06274.1|  CASP-like protein F16                                 50.1    2e-04   Gossypium arboreum [tree cotton]
gb|KJB12800.1|  hypothetical protein B456_002G037500                  50.1    2e-04   Gossypium raimondii
ref|XP_006360011.1|  PREDICTED: CASP-like protein VIT_01s0010g018...  49.7    2e-04   Solanum tuberosum [potatoes]
ref|XP_006289591.1|  hypothetical protein CARUB_v10003142mg           49.3    2e-04   Capsella rubella
ref|XP_011030770.1|  PREDICTED: CASP-like protein 2A1                 49.7    2e-04   Populus euphratica
emb|CDY21755.1|  BnaA09g45060D                                        49.7    2e-04   Brassica napus [oilseed rape]
emb|CAN64184.1|  hypothetical protein VITISV_022648                   50.1    3e-04   Vitis vinifera
ref|XP_006282730.1|  hypothetical protein CARUB_v10005865mg           48.9    3e-04   Capsella rubella
ref|XP_010666392.1|  PREDICTED: CASP-like protein Ni6                 48.9    3e-04   Beta vulgaris subsp. vulgaris [field beet]
gb|EAY84708.1|  hypothetical protein OsI_06078                        48.9    4e-04   Oryza sativa Indica Group [Indian rice]
ref|NP_001046070.1|  Os02g0177700                                     48.9    4e-04   
sp|Q6YW53.1|CSPL9_ORYSJ  RecName: Full=CASP-like protein 2D1; Sho...  48.9    4e-04   Oryza sativa Japonica Group [Japonica rice]
sp|A2X2I0.1|CSPL9_ORYSI  RecName: Full=CASP-like protein 2D1; Sho...  48.9    4e-04   Oryza sativa Indica Group [Indian rice]
emb|CDY26265.1|  BnaA06g11520D                                        48.9    4e-04   Brassica napus [oilseed rape]
sp|Q8W4Z5.1|CSPL1_GOSHI  RecName: Full=CASP-like protein F16; Alt...  48.9    4e-04   Gossypium hirsutum [American cotton]
ref|XP_010531897.1|  PREDICTED: CASP-like protein 2A1                 48.9    5e-04   Tarenaya hassleriana [spider flower]
ref|XP_009149166.1|  PREDICTED: CASP-like protein At1g17200 isofo...  48.5    5e-04   Brassica rapa
ref|XP_004975109.1|  PREDICTED: CASP-like protein 6-like              48.5    6e-04   Setaria italica
gb|KCW69847.1|  hypothetical protein EUGRSUZ_F03189                   48.5    6e-04   Eucalyptus grandis [rose gum]
ref|XP_002300480.2|  hypothetical protein POPTR_0001s42730g           48.5    7e-04   Populus trichocarpa [western balsam poplar]
ref|XP_004147759.1|  PREDICTED: CASP-like protein F16-like            48.1    7e-04   Cucumis sativus [cucumbers]
sp|P0DI24.1|CSPL3_PTEAA  RecName: Full=CASP-like protein 2U1; Sho...  48.1    7e-04   Pteridium aquilinum subsp. aquilinum
emb|CDX83921.1|  BnaC08g17240D                                        48.1    8e-04   
emb|CDO98909.1|  unnamed protein product                              48.1    8e-04   Coffea canephora [robusta coffee]
ref|XP_006416730.1|  hypothetical protein EUTSA_v10008792mg           48.1    8e-04   Eutrema salsugineum [saltwater cress]
ref|XP_009790738.1|  PREDICTED: CASP-like protein 2A1                 48.1    9e-04   Nicotiana sylvestris
ref|NP_001174676.1|  Os06g0231050                                     47.8    9e-04   
ref|XP_009602689.1|  PREDICTED: CASP-like protein 2A1                 48.1    0.001   Nicotiana tomentosiformis



>ref|XP_009789786.1| PREDICTED: CASP-like protein 2B1 [Nicotiana sylvestris]
Length=201

 Score =   244 bits (623),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 130/156 (83%), Positives = 150/156 (96%), Gaps = 0/156 (0%)
 Frame = +2

Query  86   MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIF  265
            MSYLG+GVSPGNVP++H SNLKV+DKRVRLAELI RC+ICGLA++ AVLIGTDSQVR IF
Sbjct  1    MSYLGIGVSPGNVPIHHRSNLKVIDKRVRLAELILRCLICGLAVLAAVLIGTDSQVRVIF  60

Query  266  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  445
            SI+KKAKFTDMK+LVFLVIANGLAAAYSLVQ++RC +SMIRGSVLFNKPLAWAIFSGDQL
Sbjct  61   SIQKKAKFTDMKSLVFLVIANGLAAAYSLVQVIRCILSMIRGSVLFNKPLAWAIFSGDQL  120

Query  446  MaylslgavaaaaqsavyaKIGQSELQWMRICNMYG  553
            MAYL+L AVAAAAQSAV++K+GQ+ELQWM++C+MYG
Sbjct  121  MAYLTLAAVAAAAQSAVFSKLGQTELQWMKLCDMYG  156



>ref|XP_009778293.1| PREDICTED: CASP-like protein 2B1 [Nicotiana sylvestris]
Length=202

 Score =   244 bits (622),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 132/156 (85%), Positives = 149/156 (96%), Gaps = 0/156 (0%)
 Frame = +2

Query  86   MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIF  265
            MSYLG+GVSPGNVPVYHG+NLKV+D+RVR+ EL+ RCVICGLAI+GAVLIGTDSQV+ IF
Sbjct  1    MSYLGIGVSPGNVPVYHGNNLKVIDRRVRVTELVLRCVICGLAILGAVLIGTDSQVKVIF  60

Query  266  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  445
            SI K AKFTDMKALVFLVIANGLAAAYSLVQ++RC +SMIRGSVLFNKPLAWAIFSGDQL
Sbjct  61   SIEKIAKFTDMKALVFLVIANGLAAAYSLVQVLRCILSMIRGSVLFNKPLAWAIFSGDQL  120

Query  446  MaylslgavaaaaqsavyaKIGQSELQWMRICNMYG  553
            MAYL+L AVAAAAQSAV+AK+GQ+ELQWM+IC+MYG
Sbjct  121  MAYLTLVAVAAAAQSAVFAKLGQTELQWMKICDMYG  156



>ref|XP_009592222.1| PREDICTED: CASP-like protein 2B1 [Nicotiana tomentosiformis]
Length=201

 Score =   243 bits (621),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 130/156 (83%), Positives = 150/156 (96%), Gaps = 0/156 (0%)
 Frame = +2

Query  86   MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIF  265
            MSYLG+GVSPGNVP++H SNLKV+DKRVRLAELI RC+ICGLA++ AVLIGTDSQVR IF
Sbjct  1    MSYLGIGVSPGNVPIHHRSNLKVIDKRVRLAELILRCLICGLAVLAAVLIGTDSQVRVIF  60

Query  266  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  445
            SI+KKAKFTDMK+LVFLVIANGLAAAYSLVQ++RC +SMIRGSVLFNKPLAWAIFSGDQL
Sbjct  61   SIQKKAKFTDMKSLVFLVIANGLAAAYSLVQVIRCILSMIRGSVLFNKPLAWAIFSGDQL  120

Query  446  MaylslgavaaaaqsavyaKIGQSELQWMRICNMYG  553
            MAYL+L AVAAAAQSAV++K+GQ+ELQWM++C+MYG
Sbjct  121  MAYLNLAAVAAAAQSAVFSKLGQTELQWMKLCDMYG  156



>emb|CDP04507.1| unnamed protein product [Coffea canephora]
Length=202

 Score =   240 bits (612),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 128/156 (82%), Positives = 148/156 (95%), Gaps = 0/156 (0%)
 Frame = +2

Query  86   MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIF  265
            MSYLGVGVSPGNVPVYHGSNLKVVD+RVR+AEL+ RC+ICGLA++ AVLIGTD+QV+EIF
Sbjct  1    MSYLGVGVSPGNVPVYHGSNLKVVDRRVRIAELVLRCLICGLAVLAAVLIGTDTQVKEIF  60

Query  266  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  445
            +I+K+AKFT+MKALVFLVI  G+AAAYS VQ++RC  SMIRG+VLFNKPLAWAIFSGDQL
Sbjct  61   TIKKEAKFTEMKALVFLVITTGIAAAYSFVQVLRCITSMIRGNVLFNKPLAWAIFSGDQL  120

Query  446  MaylslgavaaaaqsavyaKIGQSELQWMRICNMYG  553
            MAYLSL AVAAAAQSAV+AK+GQ+ELQWM+ICNMYG
Sbjct  121  MAYLSLAAVAAAAQSAVFAKLGQTELQWMKICNMYG  156



>ref|XP_002522908.1| conserved hypothetical protein [Ricinus communis]
 sp|B9SA89.1|CSPLB_RICCO RecName: Full=CASP-like protein 2B1; Short=RcCASPL2B1 [Ricinus 
communis]
 gb|EEF39508.1| conserved hypothetical protein [Ricinus communis]
Length=202

 Score =   239 bits (611),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 127/156 (81%), Positives = 147/156 (94%), Gaps = 0/156 (0%)
 Frame = +2

Query  86   MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIF  265
            MSYLGVGVSPGNVPVYHGSNLKV+DKRVRLAEL+ RC+ICGL ++ AVL+GTD+QV+EIF
Sbjct  1    MSYLGVGVSPGNVPVYHGSNLKVIDKRVRLAELVLRCLICGLGVLAAVLVGTDTQVKEIF  60

Query  266  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  445
            SI+KKA+FTDMKALVFLVIANG+AAAYSL+Q VRC V M+RGS LF+KPLAWAIFSGDQ+
Sbjct  61   SIQKKARFTDMKALVFLVIANGIAAAYSLLQGVRCVVGMVRGSALFSKPLAWAIFSGDQM  120

Query  446  MaylslgavaaaaqsavyaKIGQSELQWMRICNMYG  553
            MAYL++ AVAAAAQSAV+AK+GQ ELQWM+ICNMYG
Sbjct  121  MAYLTVAAVAAAAQSAVFAKLGQPELQWMKICNMYG  156



>ref|XP_006467305.1| PREDICTED: CASP-like protein POPTRDRAFT_818956-like [Citrus sinensis]
 gb|KDO78497.1| hypothetical protein CISIN_1g028855mg [Citrus sinensis]
 gb|KDO78498.1| hypothetical protein CISIN_1g028855mg [Citrus sinensis]
Length=202

 Score =   238 bits (608),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 125/156 (80%), Positives = 148/156 (95%), Gaps = 0/156 (0%)
 Frame = +2

Query  86   MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIF  265
            MSYLGVGVSPGNVPVYHG+ +KVVD+R+RL EL+ RCVICGL ++ AVL+GTD+QVREIF
Sbjct  1    MSYLGVGVSPGNVPVYHGTVMKVVDRRIRLVELVLRCVICGLGVLAAVLVGTDTQVREIF  60

Query  266  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  445
            SI+KKAKFTDMKALVFLV+ANG+AAAYSLVQ VRC+V+M++GSVLFNKPLAWAIFSGDQ+
Sbjct  61   SIQKKAKFTDMKALVFLVVANGIAAAYSLVQGVRCTVAMLKGSVLFNKPLAWAIFSGDQM  120

Query  446  MaylslgavaaaaqsavyaKIGQSELQWMRICNMYG  553
            MAYL++ AVAAAAQSAV+AK+GQ ELQW++ICNMYG
Sbjct  121  MAYLTVAAVAAAAQSAVFAKLGQPELQWLKICNMYG  156



>ref|XP_009627397.1| PREDICTED: CASP-like protein 2B1 [Nicotiana tomentosiformis]
Length=202

 Score =   238 bits (607),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 131/156 (84%), Positives = 148/156 (95%), Gaps = 0/156 (0%)
 Frame = +2

Query  86   MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIF  265
            MSYLG+GVSPGNVPVYHG+N KV+D+RVR+ EL+ RCVICGLAI+GAVLIGTDSQV+ IF
Sbjct  1    MSYLGIGVSPGNVPVYHGNNSKVIDRRVRVTELVLRCVICGLAILGAVLIGTDSQVKVIF  60

Query  266  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  445
            SI K AKFTDMKALVFLVIANGLAAAYSLVQ++RC +SMIRGSVLFNKPLAWAIFSGDQL
Sbjct  61   SIEKIAKFTDMKALVFLVIANGLAAAYSLVQVLRCILSMIRGSVLFNKPLAWAIFSGDQL  120

Query  446  MaylslgavaaaaqsavyaKIGQSELQWMRICNMYG  553
            MAYL+L A+AAAAQSAV+AK+GQ+ELQWM+ICNMYG
Sbjct  121  MAYLTLAALAAAAQSAVFAKLGQTELQWMKICNMYG  156



>ref|XP_004250287.1| PREDICTED: CASP-like protein 2B1 [Solanum lycopersicum]
Length=201

 Score =   237 bits (605),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 128/156 (82%), Positives = 146/156 (94%), Gaps = 0/156 (0%)
 Frame = +2

Query  86   MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIF  265
            M+YLG+GVSPGNVPVYHG+NLKV+D+RVR+ EL+ RCVI GLAIVG +LIGTD QV+ IF
Sbjct  1    MNYLGIGVSPGNVPVYHGNNLKVIDRRVRVTELVLRCVIFGLAIVGVILIGTDKQVKVIF  60

Query  266  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  445
            SI K AKFTDMKALVFLVIANGLAAAYSLVQ++RC +SMIRG+VLFNKPLAWAIFSGDQL
Sbjct  61   SIEKIAKFTDMKALVFLVIANGLAAAYSLVQVLRCILSMIRGTVLFNKPLAWAIFSGDQL  120

Query  446  MaylslgavaaaaqsavyaKIGQSELQWMRICNMYG  553
            MAYL+L AVAAAAQSAV+AK+GQ+ELQWM+ICNMYG
Sbjct  121  MAYLTLTAVAAAAQSAVFAKLGQAELQWMKICNMYG  156



>ref|XP_006352330.1| PREDICTED: CASP-like protein RCOM_0864260-like [Solanum tuberosum]
Length=201

 Score =   236 bits (602),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 126/156 (81%), Positives = 146/156 (94%), Gaps = 0/156 (0%)
 Frame = +2

Query  86   MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIF  265
            M+YLG+GVSPGNVPVYHG+NLKV+D+RVR+ EL+ RC+I GLAI+GA+LIGTD Q + IF
Sbjct  1    MNYLGIGVSPGNVPVYHGNNLKVIDRRVRVTELVLRCIIFGLAILGAILIGTDKQAKVIF  60

Query  266  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  445
            SI K AKFTDMKALVFLVIANGLAAAYSLVQ++RC +SMIRG+VLFNKPLAWAIFSGDQL
Sbjct  61   SIEKIAKFTDMKALVFLVIANGLAAAYSLVQVLRCILSMIRGTVLFNKPLAWAIFSGDQL  120

Query  446  MaylslgavaaaaqsavyaKIGQSELQWMRICNMYG  553
            MAYL+L AVAAAAQSAV+AK+GQ+ELQWM+ICNMYG
Sbjct  121  MAYLTLTAVAAAAQSAVFAKLGQTELQWMKICNMYG  156



>ref|XP_006365844.1| PREDICTED: CASP-like protein GSVIVT00013502001-like [Solanum 
tuberosum]
Length=201

 Score =   236 bits (602),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 127/156 (81%), Positives = 143/156 (92%), Gaps = 0/156 (0%)
 Frame = +2

Query  86   MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIF  265
            MSYLG+GVSPGNVPV+HGSNLKV+DKRVR+ ELI RC+I GLAI+GAVLIGTDSQV+ IF
Sbjct  1    MSYLGIGVSPGNVPVHHGSNLKVIDKRVRIIELILRCLILGLAIIGAVLIGTDSQVKVIF  60

Query  266  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  445
            SI+K+AKFTDMK LVFLVIANGLAAAYSL+Q++RC  SMIRGSVLFNKPLAW IFSGDQL
Sbjct  61   SIKKEAKFTDMKVLVFLVIANGLAAAYSLIQVLRCIFSMIRGSVLFNKPLAWVIFSGDQL  120

Query  446  MaylslgavaaaaqsavyaKIGQSELQWMRICNMYG  553
            MAYLSL AVAAAAQS V +K GQ ELQWM++CN+YG
Sbjct  121  MAYLSLAAVAAAAQSGVISKFGQPELQWMKVCNLYG  156



>ref|XP_011095935.1| PREDICTED: CASP-like protein 2B1 [Sesamum indicum]
Length=202

 Score =   236 bits (601),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 127/155 (82%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = +2

Query  86   MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIF  265
            MSYLGVGVSPGNVPVYHGSN+KV+D+RV++AEL+ RCVIC LAI+ AVLIGTD+QVREIF
Sbjct  1    MSYLGVGVSPGNVPVYHGSNVKVIDRRVKVAELVLRCVICVLAILAAVLIGTDTQVREIF  60

Query  266  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  445
            +IRKKAKFTDMKALVFLVIANGLAAAYSLVQ++RC +SMIRG+VLF+KPLAWAIFSGDQ+
Sbjct  61   TIRKKAKFTDMKALVFLVIANGLAAAYSLVQVLRCVLSMIRGTVLFSKPLAWAIFSGDQV  120

Query  446  MaylslgavaaaaqsavyaKIGQSELQWMRICNMY  550
            MAYLSL AVAA+AQSAV+AK+GQ ELQWM+ C +Y
Sbjct  121  MAYLSLSAVAASAQSAVFAKLGQPELQWMKTCTLY  155



>sp|A7R385.1|CSPLC_VITVI RecName: Full=CASP-like protein 2B1; Short=VvCASPL2B1 [Vitis 
vinifera]
Length=202

 Score =   236 bits (601),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 125/156 (80%), Positives = 146/156 (94%), Gaps = 0/156 (0%)
 Frame = +2

Query  86   MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIF  265
            MSYLGVGVSPGNVPVYHG+NLKVVD+RVRLAEL+ RCVICGL I+ AVL+GTD+QV+ IF
Sbjct  1    MSYLGVGVSPGNVPVYHGTNLKVVDRRVRLAELVLRCVICGLGILAAVLVGTDTQVKVIF  60

Query  266  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  445
            +I+KKAKFTDMKALVFLVIANG+AAAYSL+Q +RC VSM+RGSVLF+KPLAWAIFSGDQ+
Sbjct  61   TIQKKAKFTDMKALVFLVIANGIAAAYSLIQGLRCVVSMVRGSVLFSKPLAWAIFSGDQV  120

Query  446  MaylslgavaaaaqsavyaKIGQSELQWMRICNMYG  553
            +AYL+L AVAAAAQS+V+ + GQ ELQWM+ICNMYG
Sbjct  121  IAYLTLAAVAAAAQSSVFGEFGQPELQWMKICNMYG  156



>ref|XP_004239817.1| PREDICTED: CASP-like protein 2B1 [Solanum lycopersicum]
Length=201

 Score =   235 bits (599),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 126/156 (81%), Positives = 143/156 (92%), Gaps = 0/156 (0%)
 Frame = +2

Query  86   MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIF  265
            MSYLG+GVSPGNVPV+HGSNLKV+DKRVR+ E+I RC+I GLAI+GAVLIGTDSQV+ IF
Sbjct  1    MSYLGIGVSPGNVPVHHGSNLKVIDKRVRIIEVILRCLILGLAIIGAVLIGTDSQVKVIF  60

Query  266  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  445
            SI+K+AKFTDMK LVFLVIANGLAAAYSL+Q++RC  SMIRGSVLFNKPLAW IFSGDQL
Sbjct  61   SIKKEAKFTDMKVLVFLVIANGLAAAYSLIQVLRCIFSMIRGSVLFNKPLAWVIFSGDQL  120

Query  446  MaylslgavaaaaqsavyaKIGQSELQWMRICNMYG  553
            MAYLSL AVAAAAQS V +K GQ ELQWM++CN+YG
Sbjct  121  MAYLSLAAVAAAAQSGVISKFGQPELQWMKVCNLYG  156



>ref|XP_006449900.1| hypothetical protein CICLE_v10016754mg [Citrus clementina]
 gb|ESR63140.1| hypothetical protein CICLE_v10016754mg [Citrus clementina]
Length=202

 Score =   233 bits (595),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 124/156 (79%), Positives = 146/156 (94%), Gaps = 0/156 (0%)
 Frame = +2

Query  86   MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIF  265
            MSYLGVGVSPGNVPVY G+ +KVVD+R+RL EL+ RCVICGL  + AVL+GTD+QVREIF
Sbjct  1    MSYLGVGVSPGNVPVYRGTVMKVVDRRIRLVELVLRCVICGLGALAAVLVGTDTQVREIF  60

Query  266  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  445
            SI+KKAKFTDMKALVFLV+ANG+AAAYSLVQ VRC+V+M++GSVLFNKPLAWAIFSGDQ+
Sbjct  61   SIQKKAKFTDMKALVFLVVANGIAAAYSLVQGVRCTVAMLKGSVLFNKPLAWAIFSGDQM  120

Query  446  MaylslgavaaaaqsavyaKIGQSELQWMRICNMYG  553
            MAYL++ AVAAAAQSAV+AK+GQ ELQW++ICNMYG
Sbjct  121  MAYLTVAAVAAAAQSAVFAKLGQPELQWLKICNMYG  156



>ref|XP_002307903.1| integral membrane family protein [Populus trichocarpa]
 sp|B9HD38.1|CSPLE_POPTR RecName: Full=CASP-like protein 2B2; Short=PtCASPL2B2 [Populus 
trichocarpa]
 gb|EEE91426.1| integral membrane family protein [Populus trichocarpa]
Length=202

 Score =   233 bits (593),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 122/156 (78%), Positives = 143/156 (92%), Gaps = 0/156 (0%)
 Frame = +2

Query  86   MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIF  265
            MSYLGVGVSPGNVPVYHG NLKV+D+RVRLAEL+ RCVIC L ++ AVL+GTD+QV+EIF
Sbjct  1    MSYLGVGVSPGNVPVYHGMNLKVIDRRVRLAELVLRCVICALGVLAAVLVGTDTQVKEIF  60

Query  266  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  445
            SI+KKA+FTDMKALVFLV+ANG+AAAYSLVQ VRC V M++GSVLF+KPLAW IFSGDQ+
Sbjct  61   SIQKKARFTDMKALVFLVVANGIAAAYSLVQGVRCVVGMVKGSVLFSKPLAWVIFSGDQM  120

Query  446  MaylslgavaaaaqsavyaKIGQSELQWMRICNMYG  553
            MAYL+L AVAAA QSA +AK+GQ +LQWM+ICNMYG
Sbjct  121  MAYLTLSAVAAAVQSASFAKLGQPDLQWMKICNMYG  156



>ref|XP_008227444.1| PREDICTED: CASP-like protein RCOM_0864260 [Prunus mume]
Length=204

 Score =   233 bits (593),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = +2

Query  86   MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIF  265
            MSYLGVGVSPGNVPVYH +NLKV+D+RVR+AEL+ RCVICGL ++ A L+GTD+QV+EIF
Sbjct  1    MSYLGVGVSPGNVPVYHSTNLKVIDRRVRVAELVLRCVICGLGVIAAALVGTDTQVKEIF  60

Query  266  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  445
            +I+KKAKFTDMKALVFLVIANG+ AAYSLVQ++RC VSM+RG+VLF+KP+AW IFSGDQ+
Sbjct  61   TIQKKAKFTDMKALVFLVIANGIIAAYSLVQVLRCVVSMVRGNVLFSKPIAWIIFSGDQV  120

Query  446  MaylslgavaaaaqsavyaKIGQSELQWMRICNMY  550
            MAY+S+ AV AAAQSAV+AK+GQSELQWM+ICNMY
Sbjct  121  MAYVSVAAVGAAAQSAVFAKLGQSELQWMKICNMY  155



>ref|XP_011086255.1| PREDICTED: CASP-like protein 2B1 [Sesamum indicum]
Length=202

 Score =   232 bits (591),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 129/155 (83%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = +2

Query  86   MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIF  265
            MSYLGVGVSPGNVPVYHGSNLK VD+RVR+AEL+ R  I GLAI+ A+LIGTD+QV+EIF
Sbjct  1    MSYLGVGVSPGNVPVYHGSNLKAVDRRVRVAELVLRGFISGLAILSALLIGTDTQVKEIF  60

Query  266  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  445
            SI+KKAKFTDMKALVFLVIANGLAAAYSLVQL+RC +SMIRGSVLFNKPLAWAIFSGDQ+
Sbjct  61   SIQKKAKFTDMKALVFLVIANGLAAAYSLVQLLRCILSMIRGSVLFNKPLAWAIFSGDQV  120

Query  446  MaylslgavaaaaqsavyaKIGQSELQWMRICNMY  550
            MAYL L AVAAAAQSA  AK+GQ ELQWM+IC+MY
Sbjct  121  MAYLMLAAVAAAAQSAALAKLGQPELQWMKICDMY  155



>ref|XP_011004511.1| PREDICTED: CASP-like protein 2B2 [Populus euphratica]
Length=202

 Score =   231 bits (589),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 121/156 (78%), Positives = 143/156 (92%), Gaps = 0/156 (0%)
 Frame = +2

Query  86   MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIF  265
            MSYLGVGVSPGNVPVYHG+NLKV+D+RVRLAEL+ RCVIC L ++ AVL+GTD+QV+EIF
Sbjct  1    MSYLGVGVSPGNVPVYHGTNLKVIDRRVRLAELVLRCVICCLGVLAAVLVGTDTQVKEIF  60

Query  266  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  445
            SI KKA+FTDMKALVFLV+ANG+AAAYSLVQ VRC V M++GSVLF+KP+AW IFSGDQ+
Sbjct  61   SIEKKARFTDMKALVFLVVANGIAAAYSLVQGVRCVVGMVKGSVLFSKPVAWVIFSGDQM  120

Query  446  MaylslgavaaaaqsavyaKIGQSELQWMRICNMYG  553
            MAYL+L AVAAA QSA +AK+GQ +LQWM+ICNMYG
Sbjct  121  MAYLTLSAVAAAVQSASFAKLGQPDLQWMKICNMYG  156



>ref|XP_007212067.1| hypothetical protein PRUPE_ppa011591mg [Prunus persica]
 gb|EMJ13266.1| hypothetical protein PRUPE_ppa011591mg [Prunus persica]
Length=204

 Score =   231 bits (588),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = +2

Query  86   MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIF  265
            MSYLGVGVSPGNVPVYH +NLKV+D+RVR+AEL+ RCVICGL ++ A L+GTD+QV+EIF
Sbjct  1    MSYLGVGVSPGNVPVYHSTNLKVIDRRVRVAELVLRCVICGLGVIAAALVGTDTQVKEIF  60

Query  266  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  445
            +I+KKAKFTDMKALVFLVIA+G+ AAYSLVQ++RC VSM+RG+VLF+KP+AW IFSGDQ+
Sbjct  61   TIQKKAKFTDMKALVFLVIAHGIIAAYSLVQVLRCVVSMVRGNVLFSKPIAWIIFSGDQV  120

Query  446  MaylslgavaaaaqsavyaKIGQSELQWMRICNMY  550
            MAY+S+ AV AAAQSAV+AK+GQSELQWM+ICNMY
Sbjct  121  MAYVSVAAVGAAAQSAVFAKLGQSELQWMKICNMY  155



>ref|XP_008370988.1| PREDICTED: CASP-like protein RCOM_0864260 [Malus domestica]
Length=202

 Score =   230 bits (587),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = +2

Query  86   MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIF  265
            MSYLGVGVSPGNVPVYHG+NLKV+D+RVR+AEL+ RCVICGL +V A L+GTD+Q++EIF
Sbjct  1    MSYLGVGVSPGNVPVYHGTNLKVIDRRVRVAELVLRCVICGLGVVAAALVGTDTQIKEIF  60

Query  266  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  445
            +++KKAKFTDMKALVFLV+ANG+ AAYSLVQ++RC VSM+RG+VLF+KP+AW IFSGDQ+
Sbjct  61   TVQKKAKFTDMKALVFLVVANGIVAAYSLVQVMRCVVSMVRGNVLFSKPIAWIIFSGDQV  120

Query  446  MaylslgavaaaaqsavyaKIGQSELQWMRICNMY  550
            MAY+S+ AV AAAQSAV+AK+GQ ELQWM+ICNMY
Sbjct  121  MAYVSVAAVGAAAQSAVFAKLGQPELQWMKICNMY  155



>gb|KDP29302.1| hypothetical protein JCGZ_19405 [Jatropha curcas]
Length=202

 Score =   230 bits (587),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 122/156 (78%), Positives = 143/156 (92%), Gaps = 0/156 (0%)
 Frame = +2

Query  86   MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIF  265
            MSYLGVGVSPGNV VYHG+N+KV+D+RVRLAEL+ RCV CGL ++ AVL+ TD+QV+EIF
Sbjct  1    MSYLGVGVSPGNVAVYHGTNVKVIDRRVRLAELVLRCVTCGLGVLAAVLVATDTQVKEIF  60

Query  266  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  445
            SI+KKA++TDMKALVFLVIANG+ AAYSLVQ VRC V MIRGSVLFNKPLAWAIFSGDQ+
Sbjct  61   SIQKKARYTDMKALVFLVIANGIVAAYSLVQGVRCVVGMIRGSVLFNKPLAWAIFSGDQV  120

Query  446  MaylslgavaaaaqsavyaKIGQSELQWMRICNMYG  553
            MAYL++ AVAAAAQSA +AK+GQ ELQWM+IC+MYG
Sbjct  121  MAYLTVAAVAAAAQSAAFAKLGQPELQWMKICDMYG  156



>gb|AGE09573.1| UPF-like protein [Eucalyptus cladocalyx]
Length=203

 Score =   228 bits (580),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 121/155 (78%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = +2

Query  86   MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIF  265
            MSYLGVGVSPGNVPVYH ++LKVVD+RVRLAEL+ R VICGL ++ AVL+GTD+QVREIF
Sbjct  1    MSYLGVGVSPGNVPVYHETSLKVVDRRVRLAELVLRFVICGLGVLTAVLVGTDTQVREIF  60

Query  266  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  445
            +I+KKAKFTDMKALVFLVI NG+AA+YSL+Q +RC VSM+RGSVLF+KPLAWAIFSGDQ+
Sbjct  61   TIQKKAKFTDMKALVFLVIVNGIAASYSLIQALRCVVSMVRGSVLFSKPLAWAIFSGDQV  120

Query  446  MaylslgavaaaaqsavyaKIGQSELQWMRICNMY  550
            MAY++L AVAA+AQSAV AK+GQ ELQWM+IC MY
Sbjct  121  MAYVTLAAVAASAQSAVIAKLGQPELQWMKICGMY  155



>ref|XP_009346047.1| PREDICTED: CASP-like protein RCOM_0864260 [Pyrus x bretschneideri]
Length=202

 Score =   226 bits (575),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = +2

Query  86   MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIF  265
            MSYLGVGVSPG VPVYH +NLKV+D+RVR+AEL+ RCVICGL +V A L+GTD+Q++EIF
Sbjct  1    MSYLGVGVSPGKVPVYHSTNLKVIDRRVRVAELVLRCVICGLGVVAAALVGTDTQIKEIF  60

Query  266  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  445
            +++KKAKFTDMKALVFLV+ANG+ AAYSLVQ++RC VSM+RG+VLF+KP+AW IFSGDQ+
Sbjct  61   TVQKKAKFTDMKALVFLVVANGIVAAYSLVQVMRCVVSMVRGNVLFSKPIAWIIFSGDQV  120

Query  446  MaylslgavaaaaqsavyaKIGQSELQWMRICNMY  550
            MAY+S+ AV AAAQSAV+AK+GQ ELQWM+ICNMY
Sbjct  121  MAYVSVAAVGAAAQSAVFAKLGQPELQWMKICNMY  155



>ref|XP_010052948.1| PREDICTED: CASP-like protein 2B1 [Eucalyptus grandis]
 gb|KCW77100.1| hypothetical protein EUGRSUZ_D01440 [Eucalyptus grandis]
Length=203

 Score =   226 bits (575),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = +2

Query  86   MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIF  265
            MSYLGVGVSPGNVPVYH ++LKVVD+RVRLAEL+ R VICGL ++ AVL+GTD+QVREIF
Sbjct  1    MSYLGVGVSPGNVPVYHETSLKVVDRRVRLAELVLRFVICGLGVLAAVLVGTDTQVREIF  60

Query  266  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  445
            +I+KKAKFTDMKALVFLVIANG+AA+YS++Q +RC VSM+RGSVLF+KPLAW IFSGDQ+
Sbjct  61   TIQKKAKFTDMKALVFLVIANGIAASYSMIQALRCVVSMVRGSVLFSKPLAWVIFSGDQV  120

Query  446  MaylslgavaaaaqsavyaKIGQSELQWMRICNMY  550
            MAY++L AVAAAAQSAV AK+GQ ELQWM++C MY
Sbjct  121  MAYVTLAAVAAAAQSAVIAKLGQPELQWMKVCGMY  155



>ref|XP_008384165.1| PREDICTED: CASP-like protein RCOM_0864260 isoform X1 [Malus domestica]
Length=204

 Score =   226 bits (575),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 113/155 (73%), Positives = 139/155 (90%), Gaps = 0/155 (0%)
 Frame = +2

Query  86   MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIF  265
            MSYL VGVSPGNVPVYH +NLKV D+R+R+AEL+ RC+ICGL +V A L+GTD+QV+EIF
Sbjct  1    MSYLAVGVSPGNVPVYHSTNLKVNDRRLRVAELVLRCLICGLGVVAAALVGTDTQVKEIF  60

Query  266  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  445
            +++KKAKFTDMKALVFLV+ANG+ +AYSLVQ+VRC VSM+RG+VLF+KP+AW IFSGDQ+
Sbjct  61   TVQKKAKFTDMKALVFLVVANGIVSAYSLVQVVRCVVSMVRGNVLFSKPIAWIIFSGDQV  120

Query  446  MaylslgavaaaaqsavyaKIGQSELQWMRICNMY  550
            MAY+ + AV AA QSAV AK+GQ ELQWM+ICNMY
Sbjct  121  MAYVCVAAVGAATQSAVLAKLGQPELQWMKICNMY  155



>ref|XP_002323133.1| hypothetical protein POPTR_0016s01010g [Populus trichocarpa]
 sp|B9IH36.1|CSPLJ_POPTR RecName: Full=CASP-like protein 2B1; Short=PtCASPL2B1 [Populus 
trichocarpa]
 gb|EEF04894.1| hypothetical protein POPTR_0016s01010g [Populus trichocarpa]
Length=202

 Score =   225 bits (574),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 119/156 (76%), Positives = 142/156 (91%), Gaps = 0/156 (0%)
 Frame = +2

Query  86   MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIF  265
            MSYLGVGVSPGNVPVYHG+N KV+D+RVRLAEL+ RCVIC L ++ AVL+GTD+QV+EIF
Sbjct  1    MSYLGVGVSPGNVPVYHGTNSKVIDRRVRLAELVLRCVICCLGVLAAVLVGTDTQVKEIF  60

Query  266  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  445
            SI+KKA+FTDMKALVFLV ANG+AAAYS VQ VRC V M++GSVLF+KPLAW IFSGDQ+
Sbjct  61   SIQKKARFTDMKALVFLVAANGIAAAYSFVQGVRCVVGMVKGSVLFSKPLAWVIFSGDQM  120

Query  446  MaylslgavaaaaqsavyaKIGQSELQWMRICNMYG  553
            MAYL++ AVAAAAQS+V+AK+GQ +LQWM+IC MYG
Sbjct  121  MAYLTMSAVAAAAQSSVFAKLGQPDLQWMKICTMYG  156



>ref|XP_007026314.1| CASP-like protein POPTRDRAFT_818956 isoform 1 [Theobroma cacao]
 gb|EOY28936.1| CASP-like protein POPTRDRAFT_818956 isoform 1 [Theobroma cacao]
Length=202

 Score =   225 bits (573),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 115/156 (74%), Positives = 144/156 (92%), Gaps = 0/156 (0%)
 Frame = +2

Query  86   MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIF  265
            M+YLGVGVSPGNVPVYH +NLKV+D+RVR+AEL+ RCVIC L+++ AVL+ TD+QV+EIF
Sbjct  1    MNYLGVGVSPGNVPVYHATNLKVIDRRVRVAELVLRCVICVLSVLAAVLVATDTQVKEIF  60

Query  266  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  445
            SI+KKA+FTDMKALVFLV+ANG+AAAYSL+Q VRC V+M+RGSVLF+KP AWAIFSGDQ 
Sbjct  61   SIQKKARFTDMKALVFLVVANGVAAAYSLIQGVRCVVAMVRGSVLFSKPFAWAIFSGDQA  120

Query  446  MaylslgavaaaaqsavyaKIGQSELQWMRICNMYG  553
            +AYL++ AV AAAQSAV+ K+GQ+ELQW++IC+MYG
Sbjct  121  LAYLTVAAVGAAAQSAVFGKLGQTELQWLKICSMYG  156



>gb|KJB67396.1| hypothetical protein B456_010G188700 [Gossypium raimondii]
Length=202

 Score =   225 bits (573),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 117/156 (75%), Positives = 144/156 (92%), Gaps = 0/156 (0%)
 Frame = +2

Query  86   MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIF  265
            MSYLGVGVSPGNVPVYHG+NLKV+D+RVR+AEL+ RC+ICGL+++ AVL+GTD+Q++EIF
Sbjct  1    MSYLGVGVSPGNVPVYHGTNLKVIDRRVRVAELVLRCLICGLSVLAAVLVGTDTQIKEIF  60

Query  266  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  445
            +I+KKA+FTDMKALVFLV ANG+ AAYSLVQ VRC V M+RGSVLF+KPLA+AIFSGDQ 
Sbjct  61   TIQKKARFTDMKALVFLVAANGITAAYSLVQGVRCVVGMVRGSVLFSKPLAFAIFSGDQA  120

Query  446  MaylslgavaaaaqsavyaKIGQSELQWMRICNMYG  553
            +AYL++ AV AAAQSA +AK+GQ++LQWM ICNMYG
Sbjct  121  LAYLNVAAVGAAAQSAAFAKLGQTKLQWMVICNMYG  156



>gb|KJB69167.1| hypothetical protein B456_011G008900 [Gossypium raimondii]
Length=202

 Score =   223 bits (568),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 116/156 (74%), Positives = 144/156 (92%), Gaps = 0/156 (0%)
 Frame = +2

Query  86   MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIF  265
            M+YLGVG+SPGNVPVYHG+N  V+++RVR+AEL+ RC+IC L+++ A L+GTDSQV+EIF
Sbjct  1    MNYLGVGISPGNVPVYHGTNPMVIERRVRIAELLLRCLICVLSVLTAFLVGTDSQVKEIF  60

Query  266  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  445
            SI+KKA+FTDMKALVFLV+ANG+AAAYSLVQ+VRC VSM++GSVL NKPLAW IFSGDQ 
Sbjct  61   SIQKKARFTDMKALVFLVVANGVAAAYSLVQVVRCVVSMVKGSVLVNKPLAWTIFSGDQA  120

Query  446  MaylslgavaaaaqsavyaKIGQSELQWMRICNMYG  553
            MAYL++ AV AAAQSAV+AK+GQ+ELQWM+ICN+YG
Sbjct  121  MAYLNVAAVGAAAQSAVFAKLGQTELQWMKICNLYG  156



>gb|EYU27670.1| hypothetical protein MIMGU_mgv1a013955mg [Erythranthe guttata]
 gb|EYU27671.1| hypothetical protein MIMGU_mgv1a013955mg [Erythranthe guttata]
 gb|EYU27672.1| hypothetical protein MIMGU_mgv1a013955mg [Erythranthe guttata]
 gb|EYU27673.1| hypothetical protein MIMGU_mgv1a013955mg [Erythranthe guttata]
Length=205

 Score =   222 bits (566),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = +2

Query  119  NVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDM  298
            NVPVYHGSNLKV+D RVRLAELI RCVICGLAI+ AVLIGTD+QVREIF+IRKKAKFTDM
Sbjct  15   NVPVYHGSNLKVLDMRVRLAELILRCVICGLAILSAVLIGTDTQVREIFTIRKKAKFTDM  74

Query  299  KALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaa  478
            KALVFLVIANGLAAAYSLVQ++RC +SMIRG+VLFNKPLAW IFSGDQL+AYL+L AVAA
Sbjct  75   KALVFLVIANGLAAAYSLVQILRCVLSMIRGTVLFNKPLAWVIFSGDQLIAYLTLAAVAA  134

Query  479  aaqsavyaKIGQSELQWMRICNMYG  553
            AAQSAV+AK+GQ ELQWM+ C++YG
Sbjct  135  AAQSAVFAKLGQMELQWMKTCDLYG  159



>gb|KHG12114.1| CASP-like protein [Gossypium arboreum]
Length=269

 Score =   222 bits (566),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 117/156 (75%), Positives = 142/156 (91%), Gaps = 0/156 (0%)
 Frame = +2

Query  86   MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIF  265
            MSYLGVGVSPGNVPVYHG+NLKV+D+RVR+AEL+ RC+ICGL+++ AVL+GTD+Q++EIF
Sbjct  1    MSYLGVGVSPGNVPVYHGTNLKVIDRRVRVAELVLRCLICGLSVLAAVLVGTDTQIKEIF  60

Query  266  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  445
            +I+K+A+FTDMKALVFLV ANG+ AAYSLVQ VRC V M RGSVLF+KPLA AIFSGDQ 
Sbjct  61   TIQKRARFTDMKALVFLVAANGITAAYSLVQGVRCVVGMGRGSVLFSKPLALAIFSGDQA  120

Query  446  MaylslgavaaaaqsavyaKIGQSELQWMRICNMYG  553
            +AYL+L AV AAAQSA +AK+GQ++LQWM ICNMYG
Sbjct  121  LAYLNLAAVGAAAQSAAFAKLGQTKLQWMVICNMYG  156



>ref|XP_003534893.1| PREDICTED: CASP-like protein GSVIVT00013502001-like isoform 1 
[Glycine max]
Length=203

 Score =   218 bits (556),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 107/155 (69%), Positives = 135/155 (87%), Gaps = 0/155 (0%)
 Frame = +2

Query  89   SYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFS  268
            SYLGVGVSPGNVPVYH +N+ V+D+R+++ EL+ RCVI GL ++ AVL+GTDSQV+E FS
Sbjct  3    SYLGVGVSPGNVPVYHSTNVNVLDRRIKITELVLRCVILGLGVLAAVLVGTDSQVKEFFS  62

Query  269  IRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLM  448
             +K+AKFTDMK+LVFLV+ANGLA+ YSL+Q +RC +SMIRG VLF+KPLAWAIFSGDQ+M
Sbjct  63   FQKEAKFTDMKSLVFLVVANGLASGYSLIQGLRCIISMIRGRVLFSKPLAWAIFSGDQVM  122

Query  449  aylslgavaaaaqsavyaKIGQSELQWMRICNMYG  553
            AY+++  V AA QS V A++GQ ELQWM+ICNMYG
Sbjct  123  AYVTVATVVAAGQSGVIARVGQPELQWMKICNMYG  157



>gb|EYU33843.1| hypothetical protein MIMGU_mgv1a024377mg [Erythranthe guttata]
Length=203

 Score =   218 bits (555),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 119/157 (76%), Positives = 142/157 (90%), Gaps = 1/157 (1%)
 Frame = +2

Query  86   MSYLGVGVSPGNVPVYH-GSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREI  262
            MSYLGVGVSPGNV VYH GSNLKV+DKRVRL E++ RC+ICGLA++ A+LIGTD QV+EI
Sbjct  1    MSYLGVGVSPGNVAVYHHGSNLKVIDKRVRLTEVVLRCLICGLALLSALLIGTDVQVKEI  60

Query  263  FSIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQ  442
            F+I+KKA+FT+MKALVFLV+ANG+ AAYSL Q++RC +SMIRG VLFNKP AWAIF+GDQ
Sbjct  61   FTIQKKAQFTNMKALVFLVVANGITAAYSLAQVLRCVLSMIRGRVLFNKPFAWAIFAGDQ  120

Query  443  LMaylslgavaaaaqsavyaKIGQSELQWMRICNMYG  553
            +MAYL+L AVAAAAQSAV AK+GQ+ LQWM ICN+YG
Sbjct  121  VMAYLTLAAVAAAAQSAVLAKLGQTALQWMSICNIYG  157



>ref|XP_003547283.1| PREDICTED: CASP-like protein RCOM_0864260-like [Glycine max]
Length=202

 Score =   218 bits (554),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 107/155 (69%), Positives = 138/155 (89%), Gaps = 0/155 (0%)
 Frame = +2

Query  89   SYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFS  268
            SYLGVGVSPGNVPVYH +N+KV+D+++++ EL+ RCVI GL ++ AVL+GTDS+V+E FS
Sbjct  3    SYLGVGVSPGNVPVYHSTNVKVLDRKIKITELVLRCVILGLGVLAAVLVGTDSEVKEFFS  62

Query  269  IRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLM  448
             +K+AKFTDMK+LVFLV+ANGLAA YSL+Q +RC +SMIRG VLF+KPLAWAIFSGDQ+M
Sbjct  63   FQKEAKFTDMKSLVFLVVANGLAAGYSLIQGLRCILSMIRGRVLFSKPLAWAIFSGDQVM  122

Query  449  aylslgavaaaaqsavyaKIGQSELQWMRICNMYG  553
            AY+++ A+AAA QS + A++GQ ELQWM+ICNMYG
Sbjct  123  AYVTVVALAAAGQSGMIARVGQPELQWMKICNMYG  157



>gb|KHN40811.1| CASP-like protein [Glycine soja]
Length=203

 Score =   217 bits (552),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/155 (68%), Positives = 135/155 (87%), Gaps = 0/155 (0%)
 Frame = +2

Query  89   SYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFS  268
            SYLGVGVSPGNVPVYH +N+ V+D+R+++ EL+ RCVI GL ++ AVL+GTDS+V+E FS
Sbjct  3    SYLGVGVSPGNVPVYHSTNVNVLDRRIKITELVLRCVILGLGVLAAVLVGTDSEVKEFFS  62

Query  269  IRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLM  448
             +K+AKFTDMK+LVFLV+ANGLA+ YSL+Q +RC +SMIRG VLF+KPLAWAIFSGDQ+M
Sbjct  63   FQKEAKFTDMKSLVFLVVANGLASGYSLIQGLRCIISMIRGRVLFSKPLAWAIFSGDQVM  122

Query  449  aylslgavaaaaqsavyaKIGQSELQWMRICNMYG  553
            AY+++  V AA QS V A++GQ ELQWM+ICNMYG
Sbjct  123  AYVTVATVVAAGQSGVIARVGQPELQWMKICNMYG  157



>ref|XP_004486332.1| PREDICTED: CASP-like protein POPTRDRAFT_575900-like [Cicer arietinum]
Length=201

 Score =   214 bits (545),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 116/156 (74%), Positives = 138/156 (88%), Gaps = 0/156 (0%)
 Frame = +2

Query  86   MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIF  265
            MSYLGVGVSPGNVPVYH SN+KV+D+R+R+ EL+ RCVI  LA++   L+ TDSQVR  F
Sbjct  1    MSYLGVGVSPGNVPVYHSSNMKVLDRRIRITELVLRCVILCLALLAVFLVVTDSQVRVFF  60

Query  266  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  445
            +I KKAKFTDMKALVFLV+ANGLAA YSL+Q VRC VSMI GSVLF+KPLAWAIFSGDQ+
Sbjct  61   TIEKKAKFTDMKALVFLVVANGLAAGYSLIQGVRCVVSMINGSVLFSKPLAWAIFSGDQV  120

Query  446  MaylslgavaaaaqsavyaKIGQSELQWMRICNMYG  553
            MAY+++ AVAAAAQSAV+AK+GQ ELQW++IC+MYG
Sbjct  121  MAYITVSAVAAAAQSAVFAKLGQPELQWIKICDMYG  156



>ref|XP_010087633.1| hypothetical protein L484_010584 [Morus notabilis]
 gb|EXB29526.1| hypothetical protein L484_010584 [Morus notabilis]
Length=202

 Score =   214 bits (544),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 138/155 (89%), Gaps = 0/155 (0%)
 Frame = +2

Query  86   MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIF  265
            MSYLGVGVSPGNVPVYH ++ +VVD+RVR+AEL+ RC+I  L IV  VL+ TD+QV+EIF
Sbjct  1    MSYLGVGVSPGNVPVYHMTDSRVVDRRVRMAELVLRCLISVLGIVACVLVATDTQVKEIF  60

Query  266  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  445
            SI+KKAKFTDMKALVFL  ANG+ AAYSLVQ +RC VSM+RG+V+F+KPLAW IFSGDQ+
Sbjct  61   SIQKKAKFTDMKALVFLATANGIVAAYSLVQALRCVVSMVRGNVIFSKPLAWVIFSGDQV  120

Query  446  MaylslgavaaaaqsavyaKIGQSELQWMRICNMY  550
            MAY+++ AV AAAQ+AV+AK+GQ+ELQWM+ICNMY
Sbjct  121  MAYVTVAAVGAAAQAAVFAKLGQAELQWMKICNMY  155



>ref|XP_010270196.1| PREDICTED: CASP-like protein 2B1 [Nelumbo nucifera]
Length=204

 Score =   213 bits (542),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 109/152 (72%), Positives = 137/152 (90%), Gaps = 1/152 (1%)
 Frame = +2

Query  98   GVGVSPGNVPVYHGSNLK-VVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIR  274
            GVGVSPGNVPVYHG NLK ++D+RVRLAE++ RC+ICGL ++ AVLIG+D+QVRE F+IR
Sbjct  6    GVGVSPGNVPVYHGDNLKAMIDRRVRLAEMVLRCLICGLGVLAAVLIGSDTQVREFFTIR  65

Query  275  KKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMay  454
            KKAKFTDMKALV LV+ANG+AA YSL+Q +RC +SMI+GSVLFNKPLAWAIFSGDQ+MAY
Sbjct  66   KKAKFTDMKALVLLVVANGIAAGYSLIQGLRCGLSMIKGSVLFNKPLAWAIFSGDQVMAY  125

Query  455  lslgavaaaaqsavyaKIGQSELQWMRICNMY  550
            L + ++AAAAQS+V A++GQ E QWM++C++Y
Sbjct  126  LLMASLAAAAQSSVIARLGQPEFQWMKVCSLY  157



>ref|XP_010540841.1| PREDICTED: CASP-like protein 2B1 [Tarenaya hassleriana]
Length=196

 Score =   212 bits (540),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 111/156 (71%), Positives = 140/156 (90%), Gaps = 4/156 (3%)
 Frame = +2

Query  86   MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIF  265
            MSYLGVG+SP    VYHG+N+K +D+RV+L ELI RC +CGL +V A+L+GTD+QV+EIF
Sbjct  1    MSYLGVGISP----VYHGANMKSIDRRVKLTELILRCSVCGLGLVAALLVGTDTQVKEIF  56

Query  266  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  445
            +I+KKA+FTDMKALVFLV ANG+AAAYSLVQ++RC+V M++GSVLF+KPLAWAIFSGDQ 
Sbjct  57   TIQKKARFTDMKALVFLVSANGVAAAYSLVQVIRCAVGMVKGSVLFSKPLAWAIFSGDQA  116

Query  446  MaylslgavaaaaqsavyaKIGQSELQWMRICNMYG  553
            +AYL + A+AAAAQSA +AK+G+SELQWM+ICNMYG
Sbjct  117  IAYLCVAAIAAAAQSAAFAKLGESELQWMKICNMYG  152



>ref|XP_003594276.1| hypothetical protein MTR_2g026530 [Medicago truncatula]
 gb|AES64527.1| CASP POPTRDRAFT-like protein [Medicago truncatula]
 gb|AFK47998.1| unknown [Medicago truncatula]
Length=201

 Score =   211 bits (537),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 137/156 (88%), Gaps = 0/156 (0%)
 Frame = +2

Query  86   MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIF  265
            MSYLGVGVSPG VPVYH +N+KV+D+RVR+ EL+ R V  GL ++  VLI TDSQVRE F
Sbjct  1    MSYLGVGVSPGTVPVYHSTNMKVLDRRVRITELVLRFVNLGLGVLAVVLIVTDSQVREFF  60

Query  266  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  445
            +I+KKAKFTDMKALVFLV+AN +AA YSL+Q +RC VSMI+GSVLFNKPLAWAIFS DQ+
Sbjct  61   TIQKKAKFTDMKALVFLVVANAIAAGYSLIQGLRCVVSMIKGSVLFNKPLAWAIFSCDQV  120

Query  446  MaylslgavaaaaqsavyaKIGQSELQWMRICNMYG  553
            MAY+++ AV+AAAQSAV+AK+GQ +LQWM+ICNMYG
Sbjct  121  MAYITVAAVSAAAQSAVFAKMGQEQLQWMKICNMYG  156



>gb|KHN32948.1| CASP-like protein [Glycine soja]
Length=204

 Score =   209 bits (532),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 100/157 (64%), Positives = 129/157 (82%), Gaps = 2/157 (1%)
 Frame = +2

Query  89   SYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFS  268
            SYLGVGVSPGNVPVYH +N+KV+D+++++ EL+ RCVI GL ++ AVL+GTDS+V+E FS
Sbjct  3    SYLGVGVSPGNVPVYHSTNVKVLDRKIKITELVLRCVILGLGVLAAVLVGTDSEVKEFFS  62

Query  269  IRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQ--  442
             +K+AKFTDMK+LVFLV+ANGLAA YSL+Q +RC +SMIRG VLF+KPLAWAIFSGDQ  
Sbjct  63   FQKEAKFTDMKSLVFLVVANGLAAGYSLIQGLRCILSMIRGRVLFSKPLAWAIFSGDQVY  122

Query  443  LMaylslgavaaaaqsavyaKIGQSELQWMRICNMYG  553
             +   +   +    QS + A++GQ ELQWM+ICNMYG
Sbjct  123  FIYIKNTAYLLFFWQSGMIARVGQPELQWMKICNMYG  159



>ref|XP_010647129.1| PREDICTED: CASP-like protein 2B1 [Vitis vinifera]
Length=189

 Score =   208 bits (529),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 99/120 (83%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = +2

Query  86   MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIF  265
            M+YLGVGVSPGNVPVYHG+NLKVVD+RVRLAEL+ RCVICGL I+ AVL+GTD+QV+ IF
Sbjct  1    MNYLGVGVSPGNVPVYHGTNLKVVDRRVRLAELVLRCVICGLGILAAVLVGTDTQVKVIF  60

Query  266  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  445
            +I+KKAKFTDMKALVFLVIANG+AAAYSL+Q +RC VSM+RGSVLF+KPLAWAIFSGDQL
Sbjct  61   TIQKKAKFTDMKALVFLVIANGIAAAYSLIQGLRCVVSMVRGSVLFSKPLAWAIFSGDQL  120



>ref|XP_010252724.1| PREDICTED: CASP-like protein 2B1 [Nelumbo nucifera]
Length=203

 Score =   207 bits (527),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 105/150 (70%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = +2

Query  101  VGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKK  280
            V VSPGNVPVYH +NL+V+D+RV++AE++ RC+ICGL I+ AVL+G+D+QVREIF+IRKK
Sbjct  7    VTVSPGNVPVYHKNNLEVIDRRVKVAEVVLRCMICGLGILAAVLVGSDTQVREIFTIRKK  66

Query  281  AKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMayls  460
            AKFTDMKALVFL+IANG+AA YS +Q +RC VS+IRGS+L NKPLAWAIFSGDQ+MAY+ 
Sbjct  67   AKFTDMKALVFLLIANGIAAGYSFIQSLRCVVSVIRGSLLVNKPLAWAIFSGDQVMAYVL  126

Query  461  lgavaaaaqsavyaKIGQSELQWMRICNMY  550
            + A AAAAQS+V A++GQ E QWM++CN+Y
Sbjct  127  MAAFAAAAQSSVIAEMGQPEWQWMKVCNLY  156



>ref|XP_003549509.1| PREDICTED: CASP-like protein RCOM_0864260-like [Glycine max]
 gb|KHN03533.1| CASP-like protein [Glycine soja]
Length=201

 Score =   207 bits (526),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 108/156 (69%), Positives = 132/156 (85%), Gaps = 0/156 (0%)
 Frame = +2

Query  86   MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIF  265
            MSYLG+GVSPG VPVYHG+ LKV+D+RVR+ EL+ RCV  GL +V  VL+ TDSQV+E F
Sbjct  1    MSYLGLGVSPGTVPVYHGTKLKVLDRRVRITELVLRCVSLGLGVVAIVLVVTDSQVKEFF  60

Query  266  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  445
            S +KKAKFTDMKALVFLV+ANGL   YSL+Q +RC VSM+RG+VLF+KPLAW IFSGDQ+
Sbjct  61   SFQKKAKFTDMKALVFLVVANGLTVGYSLIQGLRCVVSMVRGNVLFSKPLAWLIFSGDQV  120

Query  446  MaylslgavaaaaqsavyaKIGQSELQWMRICNMYG  553
            MAY+++ AVAAA QS V  + GQ+ELQWM++CNMYG
Sbjct  121  MAYVTVAAVAAALQSGVLGRTGQAELQWMKVCNMYG  156



>ref|XP_003529670.1| PREDICTED: CASP-like protein RCOM_0864260-like [Glycine max]
 gb|KHN42278.1| CASP-like protein [Glycine soja]
Length=201

 Score =   207 bits (526),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 108/156 (69%), Positives = 129/156 (83%), Gaps = 0/156 (0%)
 Frame = +2

Query  86   MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIF  265
            MSYLG+GVSPG VPVYHG+ LKV+D+RVR+ EL+ RCV  GL  V  VL+ TDSQV+E F
Sbjct  1    MSYLGLGVSPGTVPVYHGTKLKVLDRRVRITELVLRCVSLGLGAVAIVLVVTDSQVKEFF  60

Query  266  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  445
            S +KKAKFTDMKALVFLV+ANGL   YSL+Q +RC VSMIRG+VLFNKP AW IFSGDQ+
Sbjct  61   SFQKKAKFTDMKALVFLVVANGLTVGYSLIQGLRCVVSMIRGNVLFNKPFAWLIFSGDQV  120

Query  446  MaylslgavaaaaqsavyaKIGQSELQWMRICNMYG  553
            MAY+++ AV AA QS V  + GQ+ELQWM++CNMYG
Sbjct  121  MAYVTVAAVVAALQSGVLGRTGQAELQWMKVCNMYG  156



>gb|EPS67628.1| hypothetical protein M569_07146 [Genlisea aurea]
Length=205

 Score =   204 bits (520),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 110/158 (70%), Positives = 136/158 (86%), Gaps = 3/158 (2%)
 Frame = +2

Query  86   MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIF  265
            MSYL VGVSPGNVPV HG+NL+ VD+++RL EL+ RCVI G+AIV  VLI TD+QV+EIF
Sbjct  1    MSYLSVGVSPGNVPVSHGNNLREVDRKIRLVELVLRCVIFGVAIVSTVLIATDTQVKEIF  60

Query  266  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQ-  442
            SIRK+A+FTDMK L+F+V+ N LAA YSLVQLVRC VSMI+GSVLF+KPLAWAIFSGDQ 
Sbjct  61   SIRKRARFTDMKVLIFMVVVNVLAAGYSLVQLVRCGVSMIKGSVLFSKPLAWAIFSGDQN  120

Query  443  --LMaylslgavaaaaqsavyaKIGQSELQWMRICNMY  550
              ++AYL L AVAA+ QSA+YA+ G+++LQWM+ CN+Y
Sbjct  121  VEILAYLMLSAVAASLQSAIYAQYGEADLQWMKTCNLY  158



>gb|KJB67397.1| hypothetical protein B456_010G188700 [Gossypium raimondii]
Length=132

 Score =   202 bits (513),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 92/119 (77%), Positives = 112/119 (94%), Gaps = 0/119 (0%)
 Frame = +2

Query  86   MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIF  265
            MSYLGVGVSPGNVPVYHG+NLKV+D+RVR+AEL+ RC+ICGL+++ AVL+GTD+Q++EIF
Sbjct  1    MSYLGVGVSPGNVPVYHGTNLKVIDRRVRVAELVLRCLICGLSVLAAVLVGTDTQIKEIF  60

Query  266  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQ  442
            +I+KKA+FTDMKALVFLV ANG+ AAYSLVQ VRC V M+RGSVLF+KPLA+AIFSGDQ
Sbjct  61   TIQKKARFTDMKALVFLVAANGITAAYSLVQGVRCVVGMVRGSVLFSKPLAFAIFSGDQ  119



>ref|XP_007154032.1| hypothetical protein PHAVU_003G085300g [Phaseolus vulgaris]
 gb|ESW26026.1| hypothetical protein PHAVU_003G085300g [Phaseolus vulgaris]
Length=201

 Score =   202 bits (514),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 106/156 (68%), Positives = 131/156 (84%), Gaps = 0/156 (0%)
 Frame = +2

Query  86   MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIF  265
            MSYLG+GVSPG VPVYHG+ LKV+D+RVR+AE++ R V  G+ ++  VL+ TDSQV+E F
Sbjct  1    MSYLGLGVSPGTVPVYHGTKLKVLDRRVRIAEMVLRGVSLGIGVLAIVLVVTDSQVKEFF  60

Query  266  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  445
            S +KKAKFTDMKALVFLVIANGL   YSL+Q +RC VSM+RG+VL +KPLAW IFSGDQ+
Sbjct  61   SFQKKAKFTDMKALVFLVIANGLTVGYSLIQGLRCVVSMVRGNVLLSKPLAWLIFSGDQV  120

Query  446  MaylslgavaaaaqsavyaKIGQSELQWMRICNMYG  553
            MAYLS+ AVAAA QS +  + GQ+ELQWM++CNMYG
Sbjct  121  MAYLSVAAVAAALQSGMIGRAGQAELQWMKVCNMYG  156



>ref|XP_008463603.1| PREDICTED: CASP-like protein RCOM_0864260 [Cucumis melo]
 ref|XP_008463604.1| PREDICTED: CASP-like protein RCOM_0864260 [Cucumis melo]
Length=202

 Score =   198 bits (504),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 138/155 (89%), Gaps = 0/155 (0%)
 Frame = +2

Query  86   MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIF  265
            MSY G+G+SPGNVPVYHGSNLKV DKRVR+ EL+ R VICGL ++ AVL+GTD++VR IF
Sbjct  1    MSYAGIGISPGNVPVYHGSNLKVFDKRVRVVELVLRFVICGLGVLAAVLVGTDTEVRTIF  60

Query  266  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  445
            +IRK+AKFTDMKALVFLV+AN +AAAYSLVQ +RC V M+RG VLF+KPLAW IFSGDQ+
Sbjct  61   AIRKRAKFTDMKALVFLVVANAVAAAYSLVQGLRCVVCMLRGKVLFSKPLAWIIFSGDQI  120

Query  446  MaylslgavaaaaqsavyaKIGQSELQWMRICNMY  550
            MAY+++ AVA+AAQSAV+ K+GQ ELQWM+IC++Y
Sbjct  121  MAYVTVAAVASAAQSAVFGKLGQPELQWMKICDLY  155



>ref|XP_008384166.1| PREDICTED: CASP-like protein GSVIVT00013502001 isoform X2 [Malus 
domestica]
Length=161

 Score =   196 bits (499),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 88/120 (73%), Positives = 110/120 (92%), Gaps = 0/120 (0%)
 Frame = +2

Query  86   MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIF  265
            MSYL VGVSPGNVPVYH +NLKV D+R+R+AEL+ RC+ICGL +V A L+GTD+QV+EIF
Sbjct  1    MSYLAVGVSPGNVPVYHSTNLKVNDRRLRVAELVLRCLICGLGVVAAALVGTDTQVKEIF  60

Query  266  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  445
            +++KKAKFTDMKALVFLV+ANG+ +AYSLVQ+VRC VSM+RG+VLF+KP+AW IFSGDQ+
Sbjct  61   TVQKKAKFTDMKALVFLVVANGIVSAYSLVQVVRCVVSMVRGNVLFSKPIAWIIFSGDQI  120



>ref|XP_011040245.1| PREDICTED: CASP-like protein 2B1, partial [Populus euphratica]
Length=187

 Score =   197 bits (500),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 105/141 (74%), Positives = 126/141 (89%), Gaps = 0/141 (0%)
 Frame = +2

Query  131  YHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALV  310
            YHG+NLKV+D+RVRLAEL+ RCVIC L ++ AVL+GTD+QV+EIFSI KKA+FTDMKALV
Sbjct  1    YHGTNLKVIDRRVRLAELVLRCVICCLGVLAAVLVGTDTQVKEIFSIEKKARFTDMKALV  60

Query  311  FLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqs  490
            FLV ANG+AAAYSLVQ VRC V M++GSVLF+KPLAW IFSGDQ+MAYL++ AVAAAAQS
Sbjct  61   FLVAANGIAAAYSLVQGVRCVVGMVKGSVLFSKPLAWVIFSGDQMMAYLTMSAVAAAAQS  120

Query  491  avyaKIGQSELQWMRICNMYG  553
            A +AK+GQ +LQWM+ C MYG
Sbjct  121  AAFAKLGQPDLQWMKTCTMYG  141



>ref|XP_006410744.1| hypothetical protein EUTSA_v10017259mg [Eutrema salsugineum]
 sp|E4MWF4.1|CSPL1_THEHA RecName: Full=CASP-like protein 2B1; Short=ThCASPL2B1 [Eutrema 
halophilum]
 dbj|BAJ33937.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ52197.1| hypothetical protein EUTSA_v10017259mg [Eutrema salsugineum]
Length=199

 Score =   196 bits (497),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 104/156 (67%), Positives = 134/156 (86%), Gaps = 3/156 (2%)
 Frame = +2

Query  86   MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIF  265
            MSYLGVG+SP NV    G+ +K++D++VRL ELI RC +C LA+V A+LI TD+QV+EIF
Sbjct  1    MSYLGVGLSPVNVA---GTKMKLMDRKVRLTELILRCSVCALALVAAILIATDTQVKEIF  57

Query  266  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  445
            +I+KKAK+TDMKALVFLV+ NG+AAAYSL+ +VRC V M++GSVLF+KPLAWAIFSGDQ 
Sbjct  58   TIQKKAKYTDMKALVFLVVVNGIAAAYSLLHMVRCVVGMMKGSVLFSKPLAWAIFSGDQA  117

Query  446  MaylslgavaaaaqsavyaKIGQSELQWMRICNMYG  553
            +AYL++  VAAAAQSA +AK+G+ ELQWM+IC +YG
Sbjct  118  IAYLTVAGVAAAAQSAAFAKLGEPELQWMKICTIYG  153



>ref|XP_009133041.1| PREDICTED: CASP-like protein 1 [Brassica rapa]
Length=199

 Score =   195 bits (495),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 103/156 (66%), Positives = 133/156 (85%), Gaps = 3/156 (2%)
 Frame = +2

Query  86   MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIF  265
            MSYLGVGVSPGNV    G+ +K+ D++VRL ELI RC++C LA++ A+L+ TD+QV+E+F
Sbjct  1    MSYLGVGVSPGNVA---GAPMKLNDRKVRLTELILRCLVCALALISAILVATDTQVKEVF  57

Query  266  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  445
            +I+KKAK+TDMKALV LV+ NG+AAAYSLV  VRC V M++GSVLF+KPLAWAIFSGDQ 
Sbjct  58   TIQKKAKYTDMKALVLLVVVNGIAAAYSLVHGVRCVVGMMKGSVLFSKPLAWAIFSGDQA  117

Query  446  MaylslgavaaaaqsavyaKIGQSELQWMRICNMYG  553
            +AYL++ +V AAAQSA +AK+G+ ELQWM+IC MYG
Sbjct  118  VAYLTVASVGAAAQSAAFAKLGEPELQWMKICTMYG  153



>ref|XP_004139530.1| PREDICTED: CASP-like protein GSVIVT00013502001-like [Cucumis 
sativus]
 gb|KGN65030.1| hypothetical protein Csa_1G181430 [Cucumis sativus]
Length=202

 Score =   195 bits (495),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 109/155 (70%), Positives = 137/155 (88%), Gaps = 0/155 (0%)
 Frame = +2

Query  86   MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIF  265
            MSY G+G+SPGNVPVYHGSNLKV DKRVR+ EL+ R +ICGL ++ AVL+GTD++V+ IF
Sbjct  1    MSYAGIGISPGNVPVYHGSNLKVFDKRVRVVELVLRFLICGLGVLAAVLVGTDTEVKTIF  60

Query  266  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  445
            +IRK+A FTDMKALVFLV+AN +AAAYSLVQ +RC V M+RG VLF+KPLAW IFSGDQ+
Sbjct  61   TIRKRATFTDMKALVFLVVANAVAAAYSLVQGLRCVVCMVRGKVLFSKPLAWIIFSGDQI  120

Query  446  MaylslgavaaaaqsavyaKIGQSELQWMRICNMY  550
            MAY+++ AVA+AAQSAV+ K+GQ ELQWM+IC++Y
Sbjct  121  MAYVTVAAVASAAQSAVFGKLGQPELQWMKICDLY  155



>emb|CDY69773.1| BnaAnng31470D [Brassica napus]
Length=200

 Score =   190 bits (483),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 103/157 (66%), Positives = 133/157 (85%), Gaps = 4/157 (3%)
 Frame = +2

Query  86   MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIF  265
            MSYLGVGVSPGNV    G+ +K+ D++VRL ELI RC++C LA++ A+L+ TD+QV+E+F
Sbjct  1    MSYLGVGVSPGNVA---GAPMKLNDRKVRLTELILRCLVCALALISAILVATDTQVKEVF  57

Query  266  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGD-Q  442
            +I+KKAK+TDMKALV LV+ NG+AAAYSLV  VRC V M++GSVLF+KPLAWAIFSGD Q
Sbjct  58   TIQKKAKYTDMKALVLLVVVNGIAAAYSLVHGVRCVVGMMKGSVLFSKPLAWAIFSGDQQ  117

Query  443  LMaylslgavaaaaqsavyaKIGQSELQWMRICNMYG  553
             +AYL++ +V AAAQSA +AK+G+ ELQWM+IC MYG
Sbjct  118  AVAYLTVASVGAAAQSAAFAKLGEPELQWMKICTMYG  154



>ref|XP_010909399.1| PREDICTED: CASP-like protein 2B1 [Elaeis guineensis]
Length=202

 Score =   189 bits (481),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 129/152 (85%), Gaps = 1/152 (1%)
 Frame = +2

Query  101  VGVSPGNVPVYHGS-NLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRK  277
            VGV PGNVPVY+G  +LK V++RV++AE++ R VI GL ++GA L+ +D+QVREIFS+ K
Sbjct  5    VGVRPGNVPVYYGGGHLKAVERRVKVAEVVLRWVIFGLGVLGAALVSSDTQVREIFSLEK  64

Query  278  KAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMayl  457
            KAKFTDMKALVFLVIANG+AA YSL+Q VRC VSMI+G+VLFNK  AW IFS DQ+MAY+
Sbjct  65   KAKFTDMKALVFLVIANGIAAGYSLIQGVRCVVSMIKGTVLFNKAWAWVIFSCDQVMAYV  124

Query  458  slgavaaaaqsavyaKIGQSELQWMRICNMYG  553
            +L AV AAAQSAV  + GQSELQWM+ICN+YG
Sbjct  125  TLAAVGAAAQSAVLGEFGQSELQWMKICNLYG  156



>gb|KFK36471.1| hypothetical protein AALP_AA4G129000 [Arabis alpina]
Length=199

 Score =   189 bits (480),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 101/156 (65%), Positives = 132/156 (85%), Gaps = 3/156 (2%)
 Frame = +2

Query  86   MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIF  265
            MS++GVGVSPGN   + G+ +K+ D++VRL EL+ RC +C LA++ A+LI TD QVREIF
Sbjct  1    MSFVGVGVSPGN---FTGTKVKLFDRKVRLTELVLRCSVCVLALISAILIATDVQVREIF  57

Query  266  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  445
            +I+KKAK+TDMKALV LV+ NG+AAAYSLVQ+VRC V +++G+VLF+KPLAWAIF GDQ 
Sbjct  58   TIQKKAKYTDMKALVLLVVVNGIAAAYSLVQVVRCVVGLMKGNVLFSKPLAWAIFFGDQA  117

Query  446  MaylslgavaaaaqsavyaKIGQSELQWMRICNMYG  553
            +AYL +  +AAAAQSA +AK+G+ ELQWM+ICNMYG
Sbjct  118  VAYLCVAGIAAAAQSAAFAKLGEPELQWMKICNMYG  153



>ref|XP_010686644.1| PREDICTED: CASP-like protein 2B1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010686645.1| PREDICTED: CASP-like protein 2B1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010686646.1| PREDICTED: CASP-like protein 2B1 [Beta vulgaris subsp. vulgaris]
Length=203

 Score =   189 bits (480),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 105/157 (67%), Positives = 130/157 (83%), Gaps = 1/157 (1%)
 Frame = +2

Query  86   MSYLGVGVSPGNVPVYHGS-NLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREI  262
            MS+ G+G+SPGNV V+HGS N K V+++V++AEL+ R +I GL ++ A LIG DS+V+ I
Sbjct  1    MSFGGIGISPGNVAVHHGSYNAKAVERKVKIAELVLRVLILGLGVLAAALIGFDSEVKVI  60

Query  263  FSIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQ  442
            FSI KKAKFTDMKALVFLVI +G+ AAYSLVQ+VRC + MIRGSVLF+KPLAW IFSGDQ
Sbjct  61   FSITKKAKFTDMKALVFLVIVDGIVAAYSLVQVVRCIMGMIRGSVLFSKPLAWIIFSGDQ  120

Query  443  LMaylslgavaaaaqsavyaKIGQSELQWMRICNMYG  553
             MAYL+L AVAAAA+S+V  K GQ ELQWM+ C+ YG
Sbjct  121  AMAYLTLAAVAAAAESSVIGKFGQPELQWMKTCDFYG  157



>gb|ACU18779.1| unknown [Glycine max]
Length=131

 Score =   186 bits (473),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = +2

Query  89   SYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFS  268
            SYLGVGVSPGNVPVYH +N+ V+D+R+++ EL+ RCVI GL ++ AVL+GTDSQV+E FS
Sbjct  3    SYLGVGVSPGNVPVYHSTNVNVLDRRIKITELVLRCVILGLGVLAAVLVGTDSQVKEFFS  62

Query  269  IRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQ  442
             +K+AKFTDMK+LVFLV+ANGLA+ YSL+Q +RC +SMIRG VLF+KPLAWAIFSGDQ
Sbjct  63   FQKEAKFTDMKSLVFLVVANGLASGYSLIQGLRCIISMIRGRVLFSKPLAWAIFSGDQ  120



>ref|NP_565822.1| CASP-like protein [Arabidopsis thaliana]
 sp|Q8L924.2|CSPL7_ARATH RecName: Full=CASP-like protein 2B2; Short=AtCASPL2B2 [Arabidopsis 
thaliana]
 gb|AAL58928.1|AF462840_1 unknown protein [Arabidopsis thaliana]
 gb|AAD15439.2| expressed protein [Arabidopsis thaliana]
 gb|AAM70533.1| At2g35760/T20F21.5 [Arabidopsis thaliana]
 gb|AEC09157.1| CASP-like protein [Arabidopsis thaliana]
Length=201

 Score =   188 bits (478),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 105/156 (67%), Positives = 129/156 (83%), Gaps = 1/156 (1%)
 Frame = +2

Query  86   MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIF  265
            MSYLGVGVSPGNV     + +K++D++VR+ ELI RC++C LA+V A+LI TD QVREIF
Sbjct  1    MSYLGVGVSPGNVS-GSTTKMKLIDRKVRVTELILRCLVCVLALVAAILIATDVQVREIF  59

Query  266  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  445
             I+KKAKFTDMKALV LV+ NG+AA YSLVQ VRC V +++G VLF+KPLAWAIF GDQ 
Sbjct  60   MIQKKAKFTDMKALVLLVVVNGIAAGYSLVQAVRCVVGLMKGRVLFSKPLAWAIFFGDQA  119

Query  446  MaylslgavaaaaqsavyaKIGQSELQWMRICNMYG  553
            +AYL +  VAAAAQSA +AK+G+ ELQWM+ICNMYG
Sbjct  120  VAYLCVAGVAAAAQSAAFAKLGEPELQWMKICNMYG  155



>gb|AAM66995.1| unknown [Arabidopsis thaliana]
Length=201

 Score =   188 bits (478),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 104/156 (67%), Positives = 129/156 (83%), Gaps = 1/156 (1%)
 Frame = +2

Query  86   MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIF  265
            MSYLGVGVSPGNV     + +K++D++VR+ ELI RC++C L++V A+LI TD QVREIF
Sbjct  1    MSYLGVGVSPGNV-TETSTKMKLIDRKVRVTELILRCLVCVLSLVSAILIATDVQVREIF  59

Query  266  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  445
             I+KKAKFTDMKALV LV+ NG+AA YSLVQ VRC V +++G VLF+KPLAWAIF GDQ 
Sbjct  60   MIQKKAKFTDMKALVLLVVVNGIAAGYSLVQAVRCVVGLMKGRVLFSKPLAWAIFFGDQA  119

Query  446  MaylslgavaaaaqsavyaKIGQSELQWMRICNMYG  553
            +AYL +  VAAAAQSA +AK+G+ ELQWM+ICNMYG
Sbjct  120  VAYLCVAGVAAAAQSAAFAKLGEPELQWMKICNMYG  155



>emb|CDX79621.1| BnaC03g19570D [Brassica napus]
Length=200

 Score =   184 bits (468),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 102/157 (65%), Positives = 129/157 (82%), Gaps = 4/157 (3%)
 Frame = +2

Query  86   MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIF  265
            MSYLGVGVSPGNV    G+  K+ + +VRL ELI RC +C LA++ A+L+ TD+QV+E+F
Sbjct  1    MSYLGVGVSPGNVA---GAPTKLNEGKVRLTELILRCFVCALALISAILVATDTQVKEVF  57

Query  266  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGD-Q  442
            +I+KKAK+TDMKALV LV+ NG+AAAYSLV  VRC V M++GSVLF+KPLAWAIFSGD Q
Sbjct  58   TIQKKAKYTDMKALVLLVVVNGIAAAYSLVHGVRCVVGMMKGSVLFSKPLAWAIFSGDQQ  117

Query  443  LMaylslgavaaaaqsavyaKIGQSELQWMRICNMYG  553
             +AYL++ +V AAAQSA +AK+G  ELQWM+IC MYG
Sbjct  118  AVAYLTVASVGAAAQSAAFAKLGNPELQWMKICTMYG  154



>ref|XP_004293384.1| PREDICTED: CASP-like protein 2B1 [Fragaria vesca subsp. vesca]
Length=205

 Score =   182 bits (463),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 109/158 (69%), Positives = 134/158 (85%), Gaps = 3/158 (2%)
 Frame = +2

Query  86   MSYLGVGVSPGNVPVYHGS---NLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVR  256
            MSYLGVGVSPGNV V H S   NLKV+D+RV++AEL+ R +ICGL +  A+L+ TD+QV+
Sbjct  1    MSYLGVGVSPGNVAVSHSSSTTNLKVIDRRVKVAELVLRFLICGLGLAAALLVATDTQVK  60

Query  257  EIFSIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSG  436
            EIF ++KKAKFTDMKALVFLVI NG+AAAYSL+Q +RC VSMI+G VLF+KPLAW IFS 
Sbjct  61   EIFMVKKKAKFTDMKALVFLVIVNGIAAAYSLLQALRCVVSMIKGIVLFSKPLAWMIFSA  120

Query  437  DQLMaylslgavaaaaqsavyaKIGQSELQWMRICNMY  550
            DQ++AY+++  V AAAQSA  AK+GQSELQWM+ICNMY
Sbjct  121  DQVVAYVAVAEVGAAAQSAALAKLGQSELQWMKICNMY  158



>ref|XP_002879572.1| integral membrane family protein [Arabidopsis lyrata subsp. lyrata]
 sp|D7LIK3.1|CSPL3_ARALL RecName: Full=CASP-like protein 2B2; Short=AlCASPL2B2 [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH55831.1| integral membrane family protein [Arabidopsis lyrata subsp. lyrata]
Length=201

 Score =   182 bits (462),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 101/156 (65%), Positives = 128/156 (82%), Gaps = 1/156 (1%)
 Frame = +2

Query  86   MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIF  265
            MSYLGVGVSPGNV     + +K++D++VR+ ELI R ++C  A+V A+L+ TD QVREIF
Sbjct  1    MSYLGVGVSPGNV-TGSSTKMKLIDRKVRVTELILRSLVCAFALVAAILVATDVQVREIF  59

Query  266  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  445
            +I+KKAKFTDMKALVFLV+ NG+AA YSLVQ V C V +++GSVL ++PLAWAIF GDQ 
Sbjct  60   TIQKKAKFTDMKALVFLVVINGIAAGYSLVQAVCCLVGLMKGSVLLSEPLAWAIFFGDQA  119

Query  446  MaylslgavaaaaqsavyaKIGQSELQWMRICNMYG  553
            +AYL +  VAAAAQSA +AK+GQ ELQWM+IC+MYG
Sbjct  120  VAYLCVAGVAAAAQSAAFAKLGQPELQWMKICDMYG  155



>ref|XP_006295017.1| hypothetical protein CARUB_v10024089mg [Capsella rubella]
 ref|XP_006295018.1| hypothetical protein CARUB_v10024089mg [Capsella rubella]
 gb|EOA27915.1| hypothetical protein CARUB_v10024089mg [Capsella rubella]
 gb|EOA27916.1| hypothetical protein CARUB_v10024089mg [Capsella rubella]
Length=200

 Score =   182 bits (461),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 97/155 (63%), Positives = 127/155 (82%), Gaps = 0/155 (0%)
 Frame = +2

Query  86   MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIF  265
            MSY+GVG+SP NV     + +K++D++VR+AELI RC +C LA+V A+LI TD QVREIF
Sbjct  1    MSYIGVGISPRNVAGTGSTKMKLIDRKVRVAELILRCSVCALALVAAILIVTDVQVREIF  60

Query  266  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  445
             I+KKAK+T+MKALVF+V+ NG+AA YSLVQ VRC V +++G VL +KPLAWAIFSGDQ 
Sbjct  61   MIKKKAKYTNMKALVFMVVVNGIAAGYSLVQAVRCVVGLMKGDVLLSKPLAWAIFSGDQA  120

Query  446  MaylslgavaaaaqsavyaKIGQSELQWMRICNMY  550
            ++YL +  VAAAAQSA +AK+G+ +LQWM+IC MY
Sbjct  121  VSYLCVAGVAAAAQSAAFAKLGEPDLQWMKICGMY  155



>ref|XP_009374906.1| PREDICTED: LOW QUALITY PROTEIN: CASP-like protein RCOM_0864260 
[Pyrus x bretschneideri]
Length=168

 Score =   179 bits (455),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 97/155 (63%), Positives = 125/155 (81%), Gaps = 2/155 (1%)
 Frame = +2

Query  86   MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIF  265
            MSYL VG SPGNVPVYH +NLKV D++VR+AEL+ RC+ICGL +V A L+GTD++V+EIF
Sbjct  1    MSYLAVGASPGNVPVYHSTNLKVNDRKVRVAELVLRCLICGLGVVAAALVGTDTEVKEIF  60

Query  266  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  445
            +++KK KF DMKALVFLV+ANG+ AA SLVQ++RC VSM+RG+VL +   +  I   + +
Sbjct  61   TVQKKXKFIDMKALVFLVVANGMVAACSLVQVIRCVVSMVRGNVLGS--FSLGIRQSESV  118

Query  446  MaylslgavaaaaqsavyaKIGQSELQWMRICNMY  550
            M  + + AV AAAQSAV AK+GQ ELQWM+ICNMY
Sbjct  119  MVCVCVAAVGAAAQSAVLAKLGQPELQWMKICNMY  153



>ref|XP_009414753.1| PREDICTED: CASP-like protein 2B1 [Musa acuminata subsp. malaccensis]
Length=202

 Score =   180 bits (457),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 95/151 (63%), Positives = 127/151 (84%), Gaps = 1/151 (1%)
 Frame = +2

Query  101  VGVSPGNVPVYHGS-NLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRK  277
            VGVSPG VPVY+G   L  V++R+++AE++ RC+ C   ++ AVL+G+D+QVRE FS+ K
Sbjct  5    VGVSPGTVPVYYGGGKLMAVERRMKVAEVVLRCLSCAFGVIAAVLVGSDTQVREFFSVEK  64

Query  278  KAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMayl  457
            KAKFTDMKALVFLV+ANG+AA YSL+ +VR  VSM++GSVLFNK LAWAIFS DQ++AYL
Sbjct  65   KAKFTDMKALVFLVVANGIAAGYSLLMVVRSVVSMMKGSVLFNKALAWAIFSCDQVVAYL  124

Query  458  slgavaaaaqsavyaKIGQSELQWMRICNMY  550
            +L AV+AAAQ+A  ++ GQ+ELQWM++CN+Y
Sbjct  125  TLAAVSAAAQAAELSQFGQTELQWMKVCNLY  155



>ref|XP_009407837.1| PREDICTED: CASP-like protein 2B1 [Musa acuminata subsp. malaccensis]
Length=202

 Score =   179 bits (454),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 94/152 (62%), Positives = 123/152 (81%), Gaps = 1/152 (1%)
 Frame = +2

Query  101  VGVSPGNVPVYHGS-NLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRK  277
            VG+SPGNVPVY+G   L+ V +R+ +AE++ RC ICGL ++ A LIG+ +QVRE FS+ K
Sbjct  5    VGMSPGNVPVYYGGGKLRAVGRRMEVAEVVLRCAICGLGVLAAALIGSATQVREFFSVEK  64

Query  278  KAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMayl  457
            KA+FTDMKALVFLV+ANG+AA YSLVQ VRC VS+I+G VL  K LAWAIFS DQ +AY+
Sbjct  65   KARFTDMKALVFLVVANGIAAGYSLVQGVRCVVSIIKGGVLLKKALAWAIFSCDQALAYV  124

Query  458  slgavaaaaqsavyaKIGQSELQWMRICNMYG  553
            +  A+AAAA++A   + GQ+ELQWM++CN+YG
Sbjct  125  ASAAIAAAAEAAELGQSGQAELQWMKLCNLYG  156



>ref|XP_009124526.1| PREDICTED: CASP-like protein ARALYDRAFT_915107 [Brassica rapa]
Length=204

 Score =   178 bits (451),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/155 (57%), Positives = 124/155 (80%), Gaps = 0/155 (0%)
 Frame = +2

Query  86   MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIF  265
            MSYLG+G+SPGNV  YHG  +K++D+R+RL E++ RC +   A++  +L+ TD+QV+ IF
Sbjct  1    MSYLGIGISPGNVASYHGGKMKLIDQRLRLTEVLLRCSVSVFALLALILMVTDTQVKRIF  60

Query  266  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  445
             + K+AK+TDMK+LVFLV+ANG+AAAYS +Q VRC    ++GSVLF+KPLAWAIFS DQ 
Sbjct  61   VVEKRAKYTDMKSLVFLVVANGIAAAYSSLQSVRCVAGSMKGSVLFSKPLAWAIFSVDQA  120

Query  446  MaylslgavaaaaqsavyaKIGQSELQWMRICNMY  550
            MAY+S+ A+AAA++S V    G+ +LQWM++CNMY
Sbjct  121  MAYMSVAAIAAASESGVIGIRGEEKLQWMKVCNMY  155



>ref|XP_010907052.1| PREDICTED: CASP-like protein 2B1 [Elaeis guineensis]
Length=200

 Score =   176 bits (447),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 100/152 (66%), Positives = 128/152 (84%), Gaps = 1/152 (1%)
 Frame = +2

Query  98   GVGVSPGNVPVYHGS-NLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIR  274
            G+GVSPGNVPVY+G  +LK V++RV++AE++ R VI GL ++ A L+ +D+QV  IFS+ 
Sbjct  4    GIGVSPGNVPVYYGGGHLKAVERRVKVAEVVLRWVIFGLGVLAAALVASDTQVTNIFSLE  63

Query  275  KKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMay  454
            KKAKFTDMKALVFLVIAN +AA YSL+Q +RC+VSMI+GSVLF+K LA  IFS DQ+MAY
Sbjct  64   KKAKFTDMKALVFLVIANAIAAGYSLIQGLRCAVSMIKGSVLFDKALALVIFSCDQVMAY  123

Query  455  lslgavaaaaqsavyaKIGQSELQWMRICNMY  550
            ++L AVAAAAQSAV  + GQSELQWM++CN+Y
Sbjct  124  VTLAAVAAAAQSAVLGEFGQSELQWMKLCNLY  155



>ref|XP_009141516.1| PREDICTED: CASP-like protein 1 [Brassica rapa]
Length=184

 Score =   176 bits (445),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 93/136 (68%), Positives = 119/136 (88%), Gaps = 0/136 (0%)
 Frame = +2

Query  146  LKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIA  325
            +K+ +++VRL ELI RC++C LA+V A+LI TD+QVREIF+I+KKAK+TDMKALVFLV+ 
Sbjct  1    MKINERKVRLTELILRCLVCALALVAAILIVTDTQVREIFTIQKKAKYTDMKALVFLVVV  60

Query  326  NGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyaK  505
            NG+AAAYSLV + RC V M++GSVLF+KPLAWAIFSGDQ +AYL++  +AAAAQSA +AK
Sbjct  61   NGIAAAYSLVHVARCVVGMMKGSVLFSKPLAWAIFSGDQAIAYLTVAGLAAAAQSAAFAK  120

Query  506  IGQSELQWMRICNMYG  553
            +GQ ELQWM+IC MYG
Sbjct  121  LGQPELQWMKICTMYG  136



>ref|XP_006849031.1| hypothetical protein AMTR_s00028p00153320 [Amborella trichopoda]
 gb|ERN10612.1| hypothetical protein AMTR_s00028p00153320 [Amborella trichopoda]
Length=198

 Score =   176 bits (446),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 108/156 (69%), Positives = 134/156 (86%), Gaps = 0/156 (0%)
 Frame = +2

Query  86   MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIF  265
            MS +GVG+SPG+VPVYH S L+VVD+RVR+AE++ RCVI GL ++ AVL+GTD+Q R+IF
Sbjct  1    MSGVGVGMSPGSVPVYHSSKLRVVDRRVRVAEVVLRCVISGLGLLAAVLVGTDTQTRQIF  60

Query  266  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  445
            SI+KKAKFTDMKAL+FLVI NG+ A+YSLVQ +RC+VSM++GSVLFNK LAWAIFS DQ+
Sbjct  61   SIQKKAKFTDMKALMFLVIINGIVASYSLVQGLRCAVSMLKGSVLFNKSLAWAIFSCDQV  120

Query  446  MaylslgavaaaaqsavyaKIGQSELQWMRICNMYG  553
            MAY SL A AAA QSA  A+ GQ ++QWM+ICN YG
Sbjct  121  MAYASLAAAAAATQSAAIAEKGQQDVQWMKICNFYG  156



>gb|KFK26539.1| hypothetical protein AALP_AA8G262200 [Arabis alpina]
Length=195

 Score =   175 bits (444),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 94/149 (63%), Positives = 123/149 (83%), Gaps = 0/149 (0%)
 Frame = +2

Query  107  VSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAK  286
            +SPGNV VYHGS +KV+D+RVRL EL+ RC I  L+++  +L+ TDSQV++IF+I KKAK
Sbjct  1    MSPGNVAVYHGSKMKVIDRRVRLTELLLRCSISCLSLLALILVVTDSQVKQIFTIEKKAK  60

Query  287  FTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslg  466
            +T+MKALVFLV ANG+AA YSL+Q VRC V  ++GSVL +KPLAWAIFS DQ +AY+S+ 
Sbjct  61   YTEMKALVFLVAANGIAAVYSLLQSVRCYVGSVKGSVLCSKPLAWAIFSADQAIAYISVA  120

Query  467  avaaaaqsavyaKIGQSELQWMRICNMYG  553
            A+AAAA+S V A  G+ ELQWM++CNM+G
Sbjct  121  AIAAAAESGVIAMKGEDELQWMKLCNMFG  149



>emb|CDY71930.1| BnaCnng75140D [Brassica napus]
Length=185

 Score =   174 bits (440),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 120/137 (88%), Gaps = 1/137 (1%)
 Frame = +2

Query  146  LKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIA  325
            +K+ +++VRLAELI RC++C LA+V AVLI TD+QVREIF+I+KKAK+TDMKALVFLV+ 
Sbjct  1    MKLNERKVRLAELILRCLVCALALVAAVLIVTDTQVREIFTIQKKAKYTDMKALVFLVVV  60

Query  326  NGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGD-QLMaylslgavaaaaqsavya  502
            NG+AAAYSLV  VRC V M++GSVLF+KPLAWAIFSGD Q +AYL++  +AAAAQSA +A
Sbjct  61   NGMAAAYSLVHAVRCVVGMMKGSVLFSKPLAWAIFSGDQQAIAYLTVAGLAAAAQSAAFA  120

Query  503  KIGQSELQWMRICNMYG  553
            K+GQ ELQWM+IC MYG
Sbjct  121  KLGQPELQWMKICTMYG  137



>gb|KEH36968.1| CASP POPTRDRAFT-like protein [Medicago truncatula]
Length=181

 Score =   172 bits (436),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 96/136 (71%), Positives = 119/136 (88%), Gaps = 0/136 (0%)
 Frame = +2

Query  146  LKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIA  325
            +KV+D+RVR+ EL+ R V  GL ++  VLI TDSQVRE F+I+KKAKFTDMKALVFLV+A
Sbjct  1    MKVLDRRVRITELVLRFVNLGLGVLAVVLIVTDSQVREFFTIQKKAKFTDMKALVFLVVA  60

Query  326  NGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyaK  505
            N +AA YSL+Q +RC VSMI+GSVLFNKPLAWAIFS DQ+MAY+++ AV+AAAQSAV+AK
Sbjct  61   NAIAAGYSLIQGLRCVVSMIKGSVLFNKPLAWAIFSCDQVMAYITVAAVSAAAQSAVFAK  120

Query  506  IGQSELQWMRICNMYG  553
            +GQ +LQWM+ICNMYG
Sbjct  121  MGQEQLQWMKICNMYG  136



>ref|XP_008800613.1| PREDICTED: CASP-like protein GSVIVT00013502001 [Phoenix dactylifera]
Length=201

 Score =   172 bits (436),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 97/152 (64%), Positives = 129/152 (85%), Gaps = 1/152 (1%)
 Frame = +2

Query  98   GVGVSPGNVPVYHGS-NLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIR  274
            GVGVSPGNVPVY+G  +LK V++R+++AE++ R VI GL ++ A L+ +D+QV+ IFS++
Sbjct  4    GVGVSPGNVPVYYGGGHLKAVERRMKVAEVVLRWVIFGLGVLAAALVASDTQVKNIFSVQ  63

Query  275  KKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMay  454
            KKAKFTD+KALVFLVIA+ +AA YSL+Q +RC V+MI+G+VLFNK LA  IFS DQ+MAY
Sbjct  64   KKAKFTDIKALVFLVIADAIAAGYSLIQGLRCVVNMIKGNVLFNKALALVIFSCDQVMAY  123

Query  455  lslgavaaaaqsavyaKIGQSELQWMRICNMY  550
            ++L AVAAAAQSAV  + GQSELQWM++CN+Y
Sbjct  124  VTLAAVAAAAQSAVLGEFGQSELQWMKLCNLY  155



>emb|CDY34471.1| BnaC01g21620D [Brassica napus]
Length=206

 Score =   171 bits (434),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 93/157 (59%), Positives = 121/157 (77%), Gaps = 1/157 (1%)
 Frame = +2

Query  86   MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIF  265
            MSYLGVG+SPGNV VYHG  +KVVD+R+RL EL+ RC +  LA +G +LI TD+QV++IF
Sbjct  1    MSYLGVGISPGNVAVYHGGKMKVVDRRLRLTELLLRCSVTALAFLGLILIVTDTQVKKIF  60

Query  266  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  445
            +I K+AK+T+MK+LVFLV+ANG+AA YSL+Q VRC +  ++GSVLF+K LAWAIFSGDQ 
Sbjct  61   TIEKRAKYTNMKSLVFLVVANGIAAVYSLLQSVRCVMGSMKGSVLFSKSLAWAIFSGDQQ  120

Query  446  MaylslgavaaaaqsavyaKI-GQSELQWMRICNMYG  553
                   A  AAA  +    I G+ ELQWM++CNM+G
Sbjct  121  AMAYMSVAAIAAASESGVIGIRGEEELQWMKVCNMFG  157



>emb|CDY40441.1| BnaA04g20760D [Brassica napus]
Length=185

 Score =   171 bits (432),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 93/137 (68%), Positives = 119/137 (87%), Gaps = 1/137 (1%)
 Frame = +2

Query  146  LKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIA  325
            +K+ +++VRL ELI RC++C LA+V A+LI TD+QVREIF+I+KKAK+TDMKALVFLV+ 
Sbjct  1    MKINERKVRLTELILRCLVCALALVSAILIVTDTQVREIFTIQKKAKYTDMKALVFLVVV  60

Query  326  NGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGD-QLMaylslgavaaaaqsavya  502
            NG+AAAYSLV + RC V M++GSVLF+KPLAWAIFSGD Q +AYL++  +AAAAQSA +A
Sbjct  61   NGIAAAYSLVHVARCVVGMMKGSVLFSKPLAWAIFSGDQQAIAYLTVAGLAAAAQSAAFA  120

Query  503  KIGQSELQWMRICNMYG  553
            K+GQ ELQWM+IC MYG
Sbjct  121  KLGQPELQWMKICTMYG  137



>ref|XP_009136766.1| PREDICTED: CASP-like protein ARALYDRAFT_915107 [Brassica rapa]
Length=207

 Score =   171 bits (432),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 92/156 (59%), Positives = 125/156 (80%), Gaps = 0/156 (0%)
 Frame = +2

Query  86   MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIF  265
            MSY GVG SPGNV V HG  +K++D+R++L EL+ RC    LA++  +LI T++QV++IF
Sbjct  1    MSYSGVGSSPGNVAVSHGGKMKLIDRRLKLTELLLRCSATALALLALILIVTNTQVKQIF  60

Query  266  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  445
            +I K+AK+TDMKALVFLV+ANG+AAAYSL+Q VRC V  ++GSVLFNK LAWAIF  DQ 
Sbjct  61   TIEKRAKYTDMKALVFLVVANGIAAAYSLLQSVRCVVGSVKGSVLFNKSLAWAIFLSDQA  120

Query  446  MaylslgavaaaaqsavyaKIGQSELQWMRICNMYG  553
            +AY+S+ A+AA+A+S +    G+ ELQWM++CNM+G
Sbjct  121  VAYMSVAAIAASAESGLIGIRGEDELQWMKVCNMFG  156



>ref|XP_009145991.1| PREDICTED: LOW QUALITY PROTEIN: CASP-like protein ARALYDRAFT_915107 
[Brassica rapa]
Length=203

 Score =   170 bits (431),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 94/156 (60%), Positives = 128/156 (82%), Gaps = 0/156 (0%)
 Frame = +2

Query  86   MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIF  265
            MSYLGVG+SPGNV VYHG  +K++D+R+RL EL+ RC +  LA +G +LI TD+QV++IF
Sbjct  1    MSYLGVGISPGNVAVYHGGKMKLIDRRLRLTELLLRCSVTALAFLGLILIVTDTQVKQIF  60

Query  266  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  445
            ++ K+AK+T+MK+LVFLV+ANG+AA YSL+Q VRC +  ++G VL NK LAWAIFSGDQ 
Sbjct  61   TVEKRAKYTNMKSLVFLVVANGIAAVYSLLQSVRCVMGSMKGDVLLNKSLAWAIFSGDQA  120

Query  446  MaylslgavaaaaqsavyaKIGQSELQWMRICNMYG  553
            MAY+S+ A+AAA++S V    G+ ELQWM++CNM+G
Sbjct  121  MAYMSVAAIAAASESGVIGIRGEEELQWMKVCNMFG  156



>emb|CDX90524.1| BnaA03g42570D [Brassica napus]
Length=208

 Score =   171 bits (432),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 88/157 (56%), Positives = 117/157 (75%), Gaps = 1/157 (1%)
 Frame = +2

Query  86   MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIF  265
            MSY GVG SPGNV V HG  +K++D++++L EL+ RC    LA++  +LI T++QV++IF
Sbjct  1    MSYSGVGSSPGNVAVSHGGKMKLIDRKLKLTELLLRCSATALALLALILIVTNTQVKQIF  60

Query  266  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  445
            +I K+AK+TDMKALVFLV+ANG+AAAYSL+Q VRC V  ++GSVLFNKPLAWAIF  DQ 
Sbjct  61   TIEKRAKYTDMKALVFLVVANGIAAAYSLLQSVRCVVGSMKGSVLFNKPLAWAIFLSDQQ  120

Query  446  MaylslgavaaaaqsavyaKI-GQSELQWMRICNMYG  553
                   A  AA+  +    I G+ ELQWM++CNM+G
Sbjct  121  AVAYMSVAAIAASAESGLIGIRGEDELQWMKVCNMFG  157



>ref|XP_006414349.1| hypothetical protein EUTSA_v10026264mg [Eutrema salsugineum]
 gb|ESQ55802.1| hypothetical protein EUTSA_v10026264mg [Eutrema salsugineum]
Length=205

 Score =   169 bits (428),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 92/156 (59%), Positives = 127/156 (81%), Gaps = 0/156 (0%)
 Frame = +2

Query  86   MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIF  265
            MSYLGVG++PGNV VYHG  +K++D+R+RL EL+ RC +    ++  +L+ TD+QV+ IF
Sbjct  1    MSYLGVGITPGNVAVYHGGKMKLIDRRLRLTELLLRCSVTVFTLLALILVVTDTQVKHIF  60

Query  266  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  445
            +I ++AK+TDMKALVFLV+ANG+AA YSL+  VRC V  ++GSVLF+KPLAWAIFSGDQ 
Sbjct  61   TIERRAKYTDMKALVFLVVANGIAAVYSLLHSVRCLVGSMKGSVLFSKPLAWAIFSGDQA  120

Query  446  MaylslgavaaaaqsavyaKIGQSELQWMRICNMYG  553
            MAY+ + A+AAAA+S +  + G+ +LQWM++CNMYG
Sbjct  121  MAYMCVAAIAAAAESGLIGREGEEKLQWMKLCNMYG  156



>emb|CDY32244.1| BnaA01g17400D [Brassica napus]
Length=205

 Score =   167 bits (423),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 94/156 (60%), Positives = 126/156 (81%), Gaps = 0/156 (0%)
 Frame = +2

Query  86   MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIF  265
            MSYLGVG+SP NV VYHG  +K++D+R+RL EL+ RC +  LA +G +LI TD+QV++IF
Sbjct  1    MSYLGVGISPRNVAVYHGGKMKLIDRRLRLTELLLRCSVTALAFLGLILIVTDTQVKQIF  60

Query  266  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  445
            +I K+AK+T+MK+LVFLV+ANG+AA YSL+Q VRC +  ++G VL NK LAWAIFSGDQ 
Sbjct  61   TIEKRAKYTNMKSLVFLVVANGIAAVYSLLQSVRCVMGSMKGDVLLNKSLAWAIFSGDQA  120

Query  446  MaylslgavaaaaqsavyaKIGQSELQWMRICNMYG  553
            MAY+S+ A+AAA++S V    G  ELQWM++CNM+G
Sbjct  121  MAYMSVAAIAAASESGVIGIRGDEELQWMKVCNMFG  156



>ref|XP_007147633.1| hypothetical protein PHAVU_006G141200g [Phaseolus vulgaris]
 gb|ESW19627.1| hypothetical protein PHAVU_006G141200g [Phaseolus vulgaris]
Length=179

 Score =   161 bits (408),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 86/132 (65%), Positives = 110/132 (83%), Gaps = 0/132 (0%)
 Frame = +2

Query  158  DKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLA  337
            D+R+R+ EL+ RCVI GL ++ AVL+GTDSQV+E FSI+K AKFTDMKALVFLV+ANGLA
Sbjct  3    DRRIRITELVLRCVILGLGVLAAVLVGTDSQVKEFFSIQKTAKFTDMKALVFLVVANGLA  62

Query  338  AAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyaKIGQS  517
            A +SL+Q + C + ++RG  L +KPLAW IFSGDQ+MAY+++ AVAAA QS + AK+GQ 
Sbjct  63   AGFSLLQGLHCIICVVRGRTLLSKPLAWVIFSGDQVMAYVTVAAVAAAGQSGMLAKVGQP  122

Query  518  ELQWMRICNMYG  553
            ELQWM +CNMYG
Sbjct  123  ELQWMELCNMYG  134



>emb|CDY09694.1| BnaC07g33670D [Brassica napus]
Length=206

 Score =   161 bits (407),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 84/157 (54%), Positives = 114/157 (73%), Gaps = 1/157 (1%)
 Frame = +2

Query  86   MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIF  265
            MSY GVG SPGNV V HG  +K++D++++L E++ RC    LA++  +LI TD+QV++IF
Sbjct  1    MSYSGVGSSPGNVAVSHGGKMKLIDRKLKLTEVLLRCSATALALLALILIVTDTQVKKIF  60

Query  266  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  445
            +I K+AK+TDMKALVFLV+ANG+ AAYSL+Q VRC V  ++GSVL NK LAWAIF  DQ 
Sbjct  61   TIEKRAKYTDMKALVFLVVANGITAAYSLLQSVRCVVGSMKGSVLLNKSLAWAIFLSDQQ  120

Query  446  MaylslgavaaaaqsavyaKI-GQSELQWMRICNMYG  553
                   A  AA+  +    I G+ +LQWM++CNM+G
Sbjct  121  AMAYMSVAAIAASAESGLIGIRGEEKLQWMKVCNMFG  157



>ref|XP_010917254.1| PREDICTED: CASP-like protein 2B1 [Elaeis guineensis]
Length=196

 Score =   158 bits (400),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 87/150 (58%), Positives = 117/150 (78%), Gaps = 1/150 (1%)
 Frame = +2

Query  104  GVSPGNVPVYH-GSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKK  280
            GV P NVPV+H       ++ R+R+ E+  RCV+CGLA++ A L+GTD+QV++I  + +K
Sbjct  6    GVCPWNVPVHHRNGRWNALEGRLRVGEVALRCVVCGLAVLVAALVGTDTQVKKIVFVERK  65

Query  281  AKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMayls  460
            AKFTDMKA VFLVI NG+AA YSL+Q +RC V++IRG+VL NKP+AW IFS DQ+MAY+S
Sbjct  66   AKFTDMKASVFLVIFNGIAACYSLIQGLRCVVTLIRGNVLLNKPVAWLIFSCDQVMAYVS  125

Query  461  lgavaaaaqsavyaKIGQSELQWMRICNMY  550
            + AVAA  QS + A+ GQ ELQWM++C+MY
Sbjct  126  VAAVAATTQSGLLAEFGQPELQWMKLCDMY  155



>ref|XP_002868133.1| integral membrane family protein [Arabidopsis lyrata subsp. lyrata]
 sp|D7M9V1.1|CSPL7_ARALL RecName: Full=CASP-like protein 2B1; Short=AlCASPL2B1 [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH44392.1| integral membrane family protein [Arabidopsis lyrata subsp. lyrata]
Length=182

 Score =   155 bits (391),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 80/136 (59%), Positives = 111/136 (82%), Gaps = 0/136 (0%)
 Frame = +2

Query  146  LKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIA  325
            +K++D+R+RL EL+ RC I   A++  +L+ TD++V+ IF+I+K AK+TDMKA+VFLV+A
Sbjct  1    MKLIDRRMRLTELLLRCSISVFALLALILVVTDTEVKLIFTIKKTAKYTDMKAVVFLVVA  60

Query  326  NGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyaK  505
            NG+AA YSL+Q VRC V  ++G VLF+KPLAWA FSGDQ MAYL++ A+AA A+S V A+
Sbjct  61   NGIAAVYSLLQSVRCVVGTMKGRVLFSKPLAWAFFSGDQAMAYLNVAAIAATAESGVIAR  120

Query  506  IGQSELQWMRICNMYG  553
             G+ +LQWMR+CNMYG
Sbjct  121  EGEEDLQWMRVCNMYG  136



>emb|CAB10420.1| LET1 like protein [Arabidopsis thaliana]
 emb|CAB78686.1| LET1 like protein [Arabidopsis thaliana]
Length=578

 Score =   162 bits (410),  Expect = 3e-43, Method: Composition-based stats.
 Identities = 84/153 (55%), Positives = 117/153 (76%), Gaps = 4/153 (3%)
 Frame = +2

Query  95   LGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIR  274
            LG  + PG     + S +K++D+R+RL EL+ RC I   A++  +L+ TD++V+ IF+I+
Sbjct  111  LGAEICPGG----YRSKMKLIDRRMRLTELLLRCSISVFALLALILVVTDTEVKLIFTIK  166

Query  275  KKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMay  454
            K AK+TDMKA+VFLV+ANG+AA YSL+Q VRC V  ++G VLF+KPLAWA FSGDQ MAY
Sbjct  167  KTAKYTDMKAVVFLVVANGIAAVYSLLQSVRCVVGTMKGKVLFSKPLAWAFFSGDQAMAY  226

Query  455  lslgavaaaaqsavyaKIGQSELQWMRICNMYG  553
            L++ A+AA A+S V A+ G+ +LQWMR+C MYG
Sbjct  227  LNVAAIAATAESGVIAREGEEDLQWMRVCTMYG  259



>emb|CDY70521.1| BnaCnng68730D, partial [Brassica napus]
Length=189

 Score =   154 bits (388),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 80/140 (57%), Positives = 112/140 (80%), Gaps = 0/140 (0%)
 Frame = +2

Query  131  YHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALV  310
            YHG  +K++D+R+RL E++ RC +   A++  +L+ TD+QV+ IF + K+AK+TDMK+LV
Sbjct  1    YHGGKIKLIDQRLRLTEVLLRCSVSVFALLALILMVTDTQVKRIFVVEKRAKYTDMKSLV  60

Query  311  FLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqs  490
            FLV+ANG+AAAYS +Q VRC    ++GSVLF+KPLAWAIFSGDQ MAY+S+ A+AAAA+S
Sbjct  61   FLVVANGIAAAYSSLQSVRCVAGSMKGSVLFSKPLAWAIFSGDQAMAYMSVAAIAAAAES  120

Query  491  avyaKIGQSELQWMRICNMY  550
             V    G+ +LQWM++CNMY
Sbjct  121  GVIGIRGEEKLQWMKVCNMY  140



>ref|NP_567497.1| uncharacterized protein [Arabidopsis thaliana]
 sp|Q8L9B5.1|CSPLP_ARATH RecName: Full=CASP-like protein 2B1; Short=AtCASPL2B1 [Arabidopsis 
thaliana]
 gb|AAM66067.1| unknown [Arabidopsis thaliana]
 gb|AAO41974.1| unknown protein [Arabidopsis thaliana]
 gb|AAP04067.1| unknown protein [Arabidopsis thaliana]
 gb|AEE83749.1| uncharacterized protein AT4G16442 [Arabidopsis thaliana]
Length=182

 Score =   153 bits (386),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 110/136 (81%), Gaps = 0/136 (0%)
 Frame = +2

Query  146  LKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIA  325
            +K++D+R+RL EL+ RC I   A++  +L+ TD++V+ IF+I+K AK+TDMKA+VFLV+A
Sbjct  1    MKLIDRRMRLTELLLRCSISVFALLALILVVTDTEVKLIFTIKKTAKYTDMKAVVFLVVA  60

Query  326  NGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyaK  505
            NG+AA YSL+Q VRC V  ++G VLF+KPLAWA FSGDQ MAYL++ A+AA A+S V A+
Sbjct  61   NGIAAVYSLLQSVRCVVGTMKGKVLFSKPLAWAFFSGDQAMAYLNVAAIAATAESGVIAR  120

Query  506  IGQSELQWMRICNMYG  553
             G+ +LQWMR+C MYG
Sbjct  121  EGEEDLQWMRVCTMYG  136



>ref|XP_008791870.1| PREDICTED: CASP-like protein RCOM_0864260 [Phoenix dactylifera]
Length=188

 Score =   151 bits (382),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 85/147 (58%), Positives = 114/147 (78%), Gaps = 2/147 (1%)
 Frame = +2

Query  110  SPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKF  289
            +P NVPV  G   K V++++R+ E+  RCVICGLA++ A L+GTD+Q R I  + +KAKF
Sbjct  3    NPWNVPV--GGRWKAVERKLRVGEVALRCVICGLAVLVAALVGTDTQTRRIVYLERKAKF  60

Query  290  TDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslga  469
            TDMKA VFLVI NG+AA YSL+Q +RC V++ +GSVL NKP AW IF  DQ+MAY+S+ A
Sbjct  61   TDMKASVFLVIFNGIAACYSLIQGLRCIVNVTKGSVLLNKPFAWLIFLCDQVMAYVSVAA  120

Query  470  vaaaaqsavyaKIGQSELQWMRICNMY  550
            VAA+AQS + A+ GQ ELQWM++C++Y
Sbjct  121  VAASAQSGLLAQFGQPELQWMKLCDLY  147



>ref|XP_010509564.1| PREDICTED: CASP-like protein 2B2 [Camelina sativa]
Length=182

 Score =   146 bits (369),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 85/136 (63%), Positives = 116/136 (85%), Gaps = 0/136 (0%)
 Frame = +2

Query  146  LKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIA  325
            +K++D++VR+AELI RC +  LA++ A+LI TD QV+EIF I+KKAKFT+MKALVF+V+ 
Sbjct  1    MKLIDRKVRVAELILRCSVFALALLAAILIVTDVQVKEIFMIKKKAKFTNMKALVFMVVV  60

Query  326  NGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyaK  505
            NG+AA YSL+Q VRC V +++G+VL +KPLAWAIFSGDQ++AYL +   AAAAQSA +AK
Sbjct  61   NGIAAGYSLLQAVRCVVGLMKGNVLLSKPLAWAIFSGDQVVAYLCVAGTAAAAQSAAFAK  120

Query  506  IGQSELQWMRICNMYG  553
            +G+ ELQWM++C+MYG
Sbjct  121  LGEPELQWMKVCDMYG  136



>emb|CDY71889.1| BnaAnng39180D [Brassica napus]
Length=184

 Score =   144 bits (362),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 75/136 (55%), Positives = 108/136 (79%), Gaps = 0/136 (0%)
 Frame = +2

Query  146  LKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIA  325
            +K++D+R+RL E++ RC +   A++  +L+ TD+QV+ IF + K+AK+TDMK+LVFLV+A
Sbjct  1    MKLIDQRLRLTEVLLRCSVSVFALLALILMVTDTQVKRIFVVEKRAKYTDMKSLVFLVVA  60

Query  326  NGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyaK  505
            NG+AAAYS +Q VRC    ++GSVLF+KPLAWAIFS DQ MAY+S+ A+AAA++S V   
Sbjct  61   NGIAAAYSSLQSVRCVAGSMKGSVLFSKPLAWAIFSVDQAMAYMSVAAIAAASESGVIGI  120

Query  506  IGQSELQWMRICNMYG  553
             G+ +LQWM++CNMY 
Sbjct  121  RGEEKLQWMKVCNMYS  136



>ref|XP_010505095.1| PREDICTED: CASP-like protein 2B2 [Camelina sativa]
Length=182

 Score =   142 bits (357),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 114/136 (84%), Gaps = 0/136 (0%)
 Frame = +2

Query  146  LKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIA  325
            +K++D++VR+AELI RC +  LA++ A+LI TD QV+EIF I+K+AKFT+MKALVF+V+ 
Sbjct  1    MKLIDRKVRVAELILRCSVFALALLAAILIVTDVQVKEIFMIKKEAKFTNMKALVFMVVV  60

Query  326  NGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyaK  505
            NG+AA YSL+Q VRC V +++G+VL +KPLAW IFSGDQ++AYL +   AAAAQSA +AK
Sbjct  61   NGIAAGYSLLQAVRCVVGLMKGNVLLSKPLAWTIFSGDQVVAYLCVAGTAAAAQSAAFAK  120

Query  506  IGQSELQWMRICNMYG  553
            +G  ELQWM++C+MYG
Sbjct  121  LGVPELQWMKVCDMYG  136



>ref|XP_010516779.1| PREDICTED: CASP-like protein 2B2 [Camelina sativa]
Length=182

 Score =   140 bits (353),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 84/136 (62%), Positives = 114/136 (84%), Gaps = 0/136 (0%)
 Frame = +2

Query  146  LKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIA  325
            +K++D++VR AELI RC +  LA++ A+LI TD QV+EIF I+KKAKFT+MKALVF+V+ 
Sbjct  1    MKLIDRKVRAAELILRCSVFALALLAAILIVTDVQVKEIFMIKKKAKFTNMKALVFMVVV  60

Query  326  NGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyaK  505
            NG+AA YSL+Q VRC V +++G+VL +KPLA AIFSGDQ++AYL +   AAAAQSA +AK
Sbjct  61   NGIAAGYSLLQAVRCVVCLMKGNVLLSKPLAGAIFSGDQVVAYLCVAGTAAAAQSAAFAK  120

Query  506  IGQSELQWMRICNMYG  553
            +G+ ELQWM++C+MYG
Sbjct  121  LGEPELQWMKVCDMYG  136



>ref|XP_004985347.1| PREDICTED: CASP-like protein Sb01g044070-like [Setaria italica]
Length=208

 Score =   139 bits (350),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 83/153 (54%), Positives = 115/153 (75%), Gaps = 4/153 (3%)
 Frame = +2

Query  104  GVSPGNVPV-YHGSNLKV---VDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSI  271
            GVSPGNVPV Y+G   +V   +++RVR AEL  RC  CGLA++ A L+G D Q R  FS+
Sbjct  13   GVSPGNVPVCYYGPAGRVPAALERRVRAAELFLRCATCGLAVLAAALLGADRQTRIFFSM  72

Query  272  RKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMa  451
             K+A+++DM++LVFLVIANG+AA YSL+Q  RC VS++ G VL +KP+AWAIFS DQ+MA
Sbjct  73   EKEARYSDMQSLVFLVIANGMAACYSLLQGARCMVSILTGGVLISKPMAWAIFSCDQVMA  132

Query  452  ylslgavaaaaqsavyaKIGQSELQWMRICNMY  550
            Y ++ AVA A ++A+  K G ++ QWM+ C++Y
Sbjct  133  YFTISAVAVAMEAAMIGKYGNTQFQWMKTCHLY  165



>ref|XP_002468338.1| hypothetical protein SORBIDRAFT_01g044070 [Sorghum bicolor]
 sp|C5WUP3.1|CSPL4_SORBI RecName: Full=CASP-like protein 2U2; Short=SbCASPL2U2 [Sorghum 
bicolor]
 gb|EER95336.1| hypothetical protein SORBIDRAFT_01g044070 [Sorghum bicolor]
Length=208

 Score =   137 bits (346),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 86/153 (56%), Positives = 113/153 (74%), Gaps = 4/153 (3%)
 Frame = +2

Query  104  GVSPGNVPV-YHGSNLKV---VDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSI  271
            GVSPGNVPV Y+G+  +V   +++RVR AEL  RC  CGLA++ A L+G D Q R IFS+
Sbjct  13   GVSPGNVPVCYYGAAGRVPAALERRVRAAELFMRCAACGLAVLAAALLGADRQTRTIFSV  72

Query  272  RKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMa  451
             K A+FTDM++LVFLVIANG+AA YSL+Q  RC VS++ G VL N+P+AWAIFS DQ+MA
Sbjct  73   EKTARFTDMQSLVFLVIANGMAACYSLLQGARCLVSILTGGVLINRPMAWAIFSCDQVMA  132

Query  452  ylslgavaaaaqsavyaKIGQSELQWMRICNMY  550
            Y ++ AVA A ++A+  K G  + QWM  C+ Y
Sbjct  133  YFTITAVAVAMEAAMIGKYGSLQFQWMNTCHFY  165



>ref|XP_010440155.1| PREDICTED: CASP-like protein 2B1 [Camelina sativa]
Length=182

 Score =   134 bits (338),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 114/136 (84%), Gaps = 0/136 (0%)
 Frame = +2

Query  146  LKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIA  325
            +K++D+R+RL EL+ R  I  LA++G +LI TDS+V+ IF+I+K AK++DMK++VFLV+A
Sbjct  1    MKLIDRRLRLTELLLRISISVLALLGLILIVTDSEVKLIFTIKKTAKYSDMKSVVFLVVA  60

Query  326  NGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyaK  505
            NG+AA YSL+Q VRC V  ++G+VLF+KPLAW IFSGDQ+MAYLS+ A+AA A+S + A+
Sbjct  61   NGIAAVYSLLQSVRCVVGTMKGTVLFSKPLAWTIFSGDQVMAYLSVAAIAATAESGMIAR  120

Query  506  IGQSELQWMRICNMYG  553
             G+ +LQW+++CNMYG
Sbjct  121  EGEEDLQWIKVCNMYG  136



>dbj|BAK05801.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=206

 Score =   134 bits (338),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 115/155 (74%), Gaps = 4/155 (3%)
 Frame = +2

Query  98   GVGVSPGNVPV-YHGSNLKV---VDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIF  265
            G GVSPGNVPV Y+G+  +V   +++RVR AE++ RC  C LA++ A L+G D Q R  F
Sbjct  8    GDGVSPGNVPVCYYGAGGRVSASLERRVRAAEVLLRCAACALAVLAAALLGADRQSRTFF  67

Query  266  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  445
            SI+K A++TDM++LV LVIA+G+ A YSL+Q  RC VS++RG +L ++PLAWAIFS DQ+
Sbjct  68   SIQKVARYTDMQSLVILVIASGMVACYSLLQGARCLVSIVRGGILLSRPLAWAIFSCDQV  127

Query  446  MaylslgavaaaaqsavyaKIGQSELQWMRICNMY  550
            MAY  +GAVA A ++A+  K G+ E QWM+ C +Y
Sbjct  128  MAYEIIGAVAVAMEAALLGKTGEVEFQWMKTCELY  162



>ref|XP_010434824.1| PREDICTED: CASP-like protein 2B1 [Camelina sativa]
Length=182

 Score =   132 bits (333),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 113/136 (83%), Gaps = 0/136 (0%)
 Frame = +2

Query  146  LKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIA  325
            +K++D+R+RL EL+ R  I  LA++G +LI TDS+V+ IF+I+K AK++DMK++VFLV+A
Sbjct  1    MKLIDRRLRLTELLLRISISVLALLGLILIVTDSEVKLIFTIKKTAKYSDMKSVVFLVVA  60

Query  326  NGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyaK  505
            NG+AA YSL+Q VRC V  ++G+VLF+KPLAW IFS DQ+MAYLS+ A+AA A+S + A+
Sbjct  61   NGIAAVYSLLQSVRCVVGTMKGTVLFSKPLAWTIFSADQVMAYLSVAAIAATAESGMIAR  120

Query  506  IGQSELQWMRICNMYG  553
             G+ +LQW+++CNMYG
Sbjct  121  EGEEDLQWIKVCNMYG  136



>ref|XP_010449792.1| PREDICTED: CASP-like protein 2B1 [Camelina sativa]
Length=182

 Score =   132 bits (332),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 69/115 (60%), Positives = 98/115 (85%), Gaps = 0/115 (0%)
 Frame = +2

Query  209  LAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIR  388
            L+++  +LI TDS+V+ IF+I+KKAK++DMK++VFLV+ANG+AA YSL+Q VRC V  ++
Sbjct  22   LSLLALILIVTDSEVKLIFTIKKKAKYSDMKSVVFLVVANGIAAVYSLLQSVRCVVGTMK  81

Query  389  GSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyaKIGQSELQWMRICNMYG  553
            G+VLF+KPLAW IFSGDQ MAYLS+ A+AA A+S + A+ G+ +LQW+++CNMYG
Sbjct  82   GTVLFSKPLAWTIFSGDQAMAYLSVAAIAATAESGMIAREGEEDLQWIKVCNMYG  136



>tpg|DAA43987.1| TPA: hypothetical protein ZEAMMB73_493857 [Zea mays]
Length=206

 Score =   132 bits (332),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 114/154 (74%), Gaps = 5/154 (3%)
 Frame = +2

Query  104  GVSPGNVPV-YHGSNLKV---VDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSI  271
            GVSPGNVPV Y+G+  +V   +++RVR AEL  RC  CGLA++ A L+G D Q R  FS+
Sbjct  10   GVSPGNVPVCYYGAAGRVPAALERRVRAAELFMRCAACGLAVLAAALLGADRQTRTFFSV  69

Query  272  RKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIR-GSVLFNKPLAWAIFSGDQLM  448
             K A+FTDM++LVFLVIANG+AA YSL+Q  RC VS++  G VL N+P+AWAIFS DQ+M
Sbjct  70   EKAARFTDMQSLVFLVIANGMAACYSLLQGGRCLVSILTGGGVLINRPMAWAIFSCDQVM  129

Query  449  aylslgavaaaaqsavyaKIGQSELQWMRICNMY  550
            AY ++ AVA A ++A+  K G  + QWM+ C++Y
Sbjct  130  AYFTISAVAVAMEAAMIGKYGSQQFQWMKTCHLY  163



>dbj|BAJ91438.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=206

 Score =   132 bits (331),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 114/152 (75%), Gaps = 4/152 (3%)
 Frame = +2

Query  107  VSPGNVPV-YHGSNLKV---VDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIR  274
            VSPGNVPV Y+G+  +V   +++RVR AE++ RC  C LA++ A L+G D Q R  FSI+
Sbjct  11   VSPGNVPVCYYGAGGRVSASLERRVRAAEVLLRCAACALAVLAAALLGADRQSRTFFSIQ  70

Query  275  KKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMay  454
            K A++TDM++LV LVIA+G+ A YSL+Q  RC VS++RG +L ++PLAWAIFS DQ+MAY
Sbjct  71   KVARYTDMQSLVILVIASGMVACYSLLQGARCLVSIVRGGILLSRPLAWAIFSCDQVMAY  130

Query  455  lslgavaaaaqsavyaKIGQSELQWMRICNMY  550
            + +GAVA A ++A+  K G+ E QWM+ C +Y
Sbjct  131  VIIGAVAVAMEAALLGKTGEVEFQWMKTCELY  162



>ref|XP_003558594.1| PREDICTED: CASP-like protein 2U2 [Brachypodium distachyon]
Length=209

 Score =   131 bits (330),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 82/152 (54%), Positives = 114/152 (75%), Gaps = 4/152 (3%)
 Frame = +2

Query  107  VSPGNVPV-YHGSNLKV---VDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIR  274
            VSPGNVPV Y+G   +V   +++RVR AE+  RC  CGLA++ A L+G D Q R  FSI+
Sbjct  15   VSPGNVPVCYYGPGGRVSASLERRVRAAEVFLRCAACGLAVLAAALLGADRQSRTFFSIQ  74

Query  275  KKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMay  454
            K A++TDM++LV LVIA+G+ A YSL+Q  RC +S++RG +L ++PLAWAIFS DQ+MAY
Sbjct  75   KVARYTDMQSLVILVIASGMVACYSLIQGARCLLSIVRGGILLSRPLAWAIFSCDQVMAY  134

Query  455  lslgavaaaaqsavyaKIGQSELQWMRICNMY  550
            + +GAVA A ++A+  K GQ E QWM+ C++Y
Sbjct  135  IIIGAVAVAMEAALIGKYGQVEFQWMKTCHLY  166



>ref|XP_006284611.1| hypothetical protein CARUB_v10005842mg [Capsella rubella]
 gb|EOA17509.1| hypothetical protein CARUB_v10005842mg [Capsella rubella]
Length=182

 Score =   128 bits (321),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 95/115 (83%), Gaps = 0/115 (0%)
 Frame = +2

Query  209  LAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIR  388
            L+++  +LI TDS+V+ IF+I+K AK+TDMK++VFLV+ANG+A  YSL+Q VRC V  ++
Sbjct  22   LSLLALILIVTDSEVKLIFTIKKAAKYTDMKSVVFLVVANGIATVYSLLQSVRCVVGKMK  81

Query  389  GSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyaKIGQSELQWMRICNMYG  553
            G+VLF+KPLAW IFSGDQ +AYLS+ A+A  A+S + A+ G+ +LQW+++CNMYG
Sbjct  82   GTVLFSKPLAWTIFSGDQALAYLSVAAIATTAESGMIAREGEEDLQWIKVCNMYG  136



>ref|XP_007026315.1| CASP-like protein POPTRDRAFT_818956 isoform 2, partial [Theobroma 
cacao]
 gb|EOY28937.1| CASP-like protein POPTRDRAFT_818956 isoform 2, partial [Theobroma 
cacao]
Length=209

 Score =   127 bits (320),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = +2

Query  86   MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIF  265
            M+YLGVGVSPGNVPVYH +NLKV+D+RVR+AEL+ RCVIC L+++ AVL+ TD+QV+EIF
Sbjct  1    MNYLGVGVSPGNVPVYHATNLKVIDRRVRVAELVLRCVICVLSVLAAVLVATDTQVKEIF  60

Query  266  SIRKKAKFTDMKALVF  313
            SI+KKA+FTDMKALVF
Sbjct  61   SIQKKARFTDMKALVF  76



>sp|B8LQF9.1|CSPL9_PICSI RecName: Full=CASP-like protein 2BC2; Short=PsCASPL2BC2 [Picea 
sitchensis]
 gb|ABR17889.1| unknown [Picea sitchensis]
Length=238

 Score =   128 bits (322),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 100/132 (76%), Gaps = 0/132 (0%)
 Frame = +2

Query  155  VDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGL  334
            V+KR+++ E+I R  +  LA+V AV +GTD+Q R IF+I KKAK++DMKALVFLV+ NG+
Sbjct  63   VEKRLKIGEVILRFAMIALALVAAVRVGTDTQTRTIFTIEKKAKYSDMKALVFLVVMNGI  122

Query  335  AAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyaKIGQ  514
             A+YSL+Q +RC +S+   S L +KPLAW IF+ DQ MAY SL A AAAA+SA  A+ GQ
Sbjct  123  VASYSLLQGLRCVLSIYTQSPLTSKPLAWLIFALDQTMAYFSLAAAAAAAESAYLAERGQ  182

Query  515  SELQWMRICNMY  550
            +E QWM++C  Y
Sbjct  183  TEFQWMKVCIFY  194



>gb|EMT22476.1| hypothetical protein F775_11012 [Aegilops tauschii]
Length=306

 Score =   128 bits (322),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 71/136 (52%), Positives = 98/136 (72%), Gaps = 3/136 (2%)
 Frame = +2

Query  155  VDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGL  334
             ++++++ EL+ RC++ G   V A L+ TDSQ R  FS+ ++AK+TDMKALV LV ANG 
Sbjct  67   AERKMKVWELVLRCLVGGFGAVAAALVVTDSQTRTFFSLERRAKYTDMKALVLLVAANGA  126

Query  335  AAAYSLVQLVRCSVSMIRGS---VLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyaK  505
            A  YSL+Q  RC+V+M RG    V+ ++ LAW++FSGDQL+AY  L A AAA QS++  K
Sbjct  127  AVGYSLLQAARCAVAMARGGGALVMSSRALAWSVFSGDQLLAYAMLAATAAALQSSLLGK  186

Query  506  IGQSELQWMRICNMYG  553
            +GQ ELQWM IC +YG
Sbjct  187  LGQPELQWMGICGLYG  202



>ref|XP_004163465.1| PREDICTED: CASP-like protein RCOM_0864260-like isoform 3 [Cucumis 
sativus]
Length=75

 Score =   120 bits (302),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 53/75 (71%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = +2

Query  86   MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIF  265
            MSY G+G+SPGNVPVYHGSNLKV DKRVR+ EL+ R +ICGL ++ AVL+GTD++V+ IF
Sbjct  1    MSYAGIGISPGNVPVYHGSNLKVFDKRVRVVELVLRFLICGLGVLAAVLVGTDTEVKTIF  60

Query  266  SIRKKAKFTDMKALV  310
            +IRK+A FTDMKALV
Sbjct  61   TIRKRATFTDMKALV  75



>dbj|BAJ98184.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=155

 Score =   115 bits (288),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 90/118 (76%), Gaps = 4/118 (3%)
 Frame = +2

Query  107  VSPGNVPV-YHGSNLKV---VDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIR  274
            VSPGNVPV Y+G+  +V   +++RVR AE++ RC  C LA++ A L+G D Q R  FSI+
Sbjct  11   VSPGNVPVCYYGAGGRVSASLERRVRAAEVLLRCAACALAVLAAALLGADRQSRTFFSIQ  70

Query  275  KKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLM  448
            K A++TDM++LV LVIA+G+ A YSL+Q  RC VS++RG +L ++PLAWAIFS DQ+M
Sbjct  71   KVARYTDMQSLVILVIASGMVACYSLLQGARCLVSIVRGGILLSRPLAWAIFSCDQVM  128



>dbj|BAK05387.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=191

 Score =   113 bits (283),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 70/136 (51%), Positives = 100/136 (74%), Gaps = 3/136 (2%)
 Frame = +2

Query  155  VDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGL  334
            +++++++ EL+ RC++ G   V A L+ TDSQ R  FS+ ++AK+TDMKALV LV ANG 
Sbjct  5    LERKMKVWELVLRCLVGGFGAVAAALVVTDSQTRTFFSLERRAKYTDMKALVLLVAANGA  64

Query  335  AAAYSLVQLVRCSVSMIRGS---VLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyaK  505
            A  YSL+Q  RC+++M RG    V+ ++ LAW++FSGDQL+AY  L A AAA QS++  K
Sbjct  65   AVVYSLLQAARCAMAMARGGGALVMSSRALAWSVFSGDQLLAYAMLAATAAALQSSLLGK  124

Query  506  IGQSELQWMRICNMYG  553
            +GQ ELQWM IC++YG
Sbjct  125  LGQPELQWMGICSLYG  140



>ref|XP_003575478.2| PREDICTED: CASP-like protein 2B1 [Brachypodium distachyon]
Length=197

 Score =   109 bits (272),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 97/134 (72%), Gaps = 2/134 (1%)
 Frame = +2

Query  158  DKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLA  337
            +++ +L EL  RC+IC L  + A L+ TDSQ R  FS+ KKA++TDMKALV LV ANG A
Sbjct  10   ERKAKLWELALRCLICLLGTLAAALVATDSQTRTFFSLEKKARYTDMKALVLLVAANGAA  69

Query  338  AAYSLVQLVRCSVSMIR--GSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyaKIG  511
            AAYSL+Q  RC+VS+ R       +K +AW++FSGDQL+AY +L A AAAAQ++   K G
Sbjct  70   AAYSLLQAFRCAVSIARGGSGSSSSKVVAWSVFSGDQLLAYATLAATAAAAQASAIGKKG  129

Query  512  QSELQWMRICNMYG  553
            Q ELQWM IC++YG
Sbjct  130  QPELQWMGICDLYG  143



>ref|XP_008777752.1| PREDICTED: CASP-like protein GSVIVT00013502001, partial [Phoenix 
dactylifera]
Length=71

 Score =   102 bits (255),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 50/69 (72%), Positives = 59/69 (86%), Gaps = 0/69 (0%)
 Frame = +2

Query  224  AVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLF  403
            A L+G+D+QVR+ FS+ KKAKFTDMKALVFLVI+NG+AA YSL+  VR  VSMI+ SVLF
Sbjct  3    AALVGSDTQVRKFFSLEKKAKFTDMKALVFLVISNGIAAGYSLIPGVRSVVSMIKESVLF  62

Query  404  NKPLAWAIF  430
            NK LAWAIF
Sbjct  63   NKALAWAIF  71



>sp|Q10QH3.2|CSPLL_ORYSJ RecName: Full=CASP-like protein Os03g0196400 [Oryza sativa Japonica 
Group]
 gb|EEC74684.1| hypothetical protein OsI_10377 [Oryza sativa Indica Group]
 gb|EEE58500.1| hypothetical protein OsJ_09768 [Oryza sativa Japonica Group]
Length=195

 Score = 95.1 bits (235),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 71/156 (46%), Positives = 98/156 (63%), Gaps = 27/156 (17%)
 Frame = +2

Query  95   LGVGVSPGNVPV-YHGSNLKV---VDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREI  262
            +G GVSPGNVPV Y+G   +V   +++R R AE++ RC  CGLA++ A L+G D Q R  
Sbjct  9    VGDGVSPGNVPVCYYGPGGRVPSSLERRARAAEVLLRCAACGLAVLAAALLGADRQTRVF  68

Query  263  FSIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQ  442
            FSI+K A++TDM++LV LVIANG+AA YSL+Q  RC V            +A+ + S   
Sbjct  69   FSIQKVARYTDMQSLVLLVIANGMAACYSLIQCARCLV------------MAYIVIS---  113

Query  443  LMaylslgavaaaaqsavyaKIGQSELQWMRICNMY  550
                    AVAAA ++A+  K GQ E QWM+ C++Y
Sbjct  114  --------AVAAAMEAALIGKYGQPEFQWMKTCHLY  141



>sp|Q0IN16.2|CSPLE_ORYSJ RecName: Full=CASP-like protein 2B1; Short=OsCASPL2B1 [Oryza 
sativa Japonica Group]
 gb|ABA99118.2| plant integral membrane protein TIGR01569 containing protein, 
expressed [Oryza sativa Japonica Group]
Length=198

 Score = 95.1 bits (235),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 68/135 (50%), Positives = 92/135 (68%), Gaps = 2/135 (1%)
 Frame = +2

Query  155  VDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGL  334
            ++++ ++AE+  RC +C LA + A L+GT SQ R  FS+ KKA+FTDMKALV LV A+G 
Sbjct  7    LERKAKVAEVALRCAVCALAALAAALVGTGSQTRTFFSLEKKARFTDMKALVLLVAAHGA  66

Query  335  AAAYSLVQLVRCSVSMI--RGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyaKI  508
            AA YSL+QL RC+ +     GS      +AW++FS DQ +AY  + A AAA QS+V  K 
Sbjct  67   AAVYSLLQLARCAAAAAWKGGSNGGAAVVAWSVFSCDQAVAYALMAATAAALQSSVVGKR  126

Query  509  GQSELQWMRICNMYG  553
            GQ ELQWM +C +YG
Sbjct  127  GQPELQWMPVCGLYG  141



>sp|D5A8E6.1|CSPL4_PICSI RecName: Full=CASP-like protein 2BC1; Short=PsCASPL2BC1 [Picea 
sitchensis]
 gb|ADE75815.1| unknown [Picea sitchensis]
Length=226

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 54/133 (41%), Positives = 85/133 (64%), Gaps = 1/133 (1%)
 Frame = +2

Query  155  VDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFS-IRKKAKFTDMKALVFLVIANG  331
             D+++R+ E+I R  +   A+V A+++GT S  R++   IR  A FT +K L FLVI +G
Sbjct  29   TDRKLRITEVILRFAVVIFALVSAIMVGTASGTRDLGGGIRIHAHFTLLKTLPFLVIVDG  88

Query  332  LAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyaKIG  511
            + A YSL+Q +RC +S+    +L NK LAW IF  DQ +AY+   A A+ A++A  ++ G
Sbjct  89   ILAVYSLLQGLRCFLSLYMRHILLNKALAWTIFCCDQALAYVIFAAAASTAETAYISEQG  148

Query  512  QSELQWMRICNMY  550
              ELQW+++C  +
Sbjct  149  LDELQWIKVCMFF  161



>ref|XP_002443261.1| hypothetical protein SORBIDRAFT_08g016550 [Sorghum bicolor]
 sp|C5YP66.1|CSPLJ_SORBI RecName: Full=CASP-like protein 2U1; Short=SbCASPL2U1 [Sorghum 
bicolor]
 gb|EES17099.1| hypothetical protein SORBIDRAFT_08g016550 [Sorghum bicolor]
Length=193

 Score = 88.2 bits (217),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 67/139 (48%), Positives = 92/139 (66%), Gaps = 6/139 (4%)
 Frame = +2

Query  155  VDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGL  334
             +++V++AE+  R ++CGL  + A L+ TD+Q R  FS++KKA +TDMKA+VFLV A  +
Sbjct  13   AERKVKVAEVALRALLCGLGALAAALVATDTQTRTFFSLQKKASYTDMKAMVFLVDAAAV  72

Query  335  AAAYSLVQL-VRCS-----VSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsav  496
            AA YSL+QL  RC       S         + L+W +FS DQ +AY+ L AVAAA Q++V
Sbjct  73   AAGYSLLQLAARCCGGGAMSSGRGDGGGRGRALSWCVFSCDQALAYVLLAAVAAALQASV  132

Query  497  yaKIGQSELQWMRICNMYG  553
             AK GQ ELQWM IC +YG
Sbjct  133  VAKRGQPELQWMGICALYG  151



>ref|NP_001159013.1| membrane protein [Zea mays]
 sp|B6TGJ8.1|CSPL8_MAIZE RecName: Full=CASP-like protein 2U1; Short=ZmCASPL2U1 [Zea mays]
 gb|ACG36231.1| membrane protein [Zea mays]
Length=190

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 66/139 (47%), Positives = 92/139 (66%), Gaps = 10/139 (7%)
 Frame = +2

Query  158  DKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLA  337
            +++V +AE+  R V+CGL  + A L+ TD+Q R  FS++KKA +TDMKA+V LV A   A
Sbjct  12   ERKVAVAEVALRAVLCGLGALAAALVATDTQTRTFFSLQKKATYTDMKAMVLLVAAAAAA  71

Query  338  AAYSLVQLVR--CSVSMIRGSVLFNKP-----LAWAIFSGDQLMaylslgavaaaaqsav  496
            A YSL+Q  R  C V+++R S+   +P     LAW +F+ DQ +AY  L AV AA Q++V
Sbjct  72   AGYSLLQAARCCCCVALLRTSI---RPRARLLLAWCVFACDQALAYALLAAVVAALQASV  128

Query  497  yaKIGQSELQWMRICNMYG  553
             AK G  +LQWM IC +YG
Sbjct  129  VAKQGLPQLQWMAICALYG  147



>ref|XP_004162507.1| PREDICTED: CASP-like protein GSVIVT00013502001-like isoform 2 
[Cucumis sativus]
Length=128

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = +2

Query  308  VFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaq  487
            +FLV+AN +AAAYSLVQ +RC V M+RG VLF+KPLAW IFSGDQ+MAY+++ AVA+AAQ
Sbjct  1    MFLVVANAVAAAYSLVQGLRCVVCMVRGKVLFSKPLAWIIFSGDQIMAYVTVAAVASAAQ  60

Query  488  savyaKIGQSELQWMRICNMY  550
            SAV+ K+GQ ELQWM+IC++Y
Sbjct  61   SAVFGKLGQPELQWMKICDLY  81



>ref|XP_004162506.1| PREDICTED: CASP-like protein GSVIVT00013502001-like isoform 1 
[Cucumis sativus]
Length=132

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +2

Query  311  FLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqs  490
            FLV+AN +AAAYSLVQ +RC V M+RG VLF+KPLAW IFSGDQ+MAY+++ AVA+AAQS
Sbjct  6    FLVVANAVAAAYSLVQGLRCVVCMVRGKVLFSKPLAWIIFSGDQIMAYVTVAAVASAAQS  65

Query  491  avyaKIGQSELQWMRICNMY  550
            AV+ K+GQ ELQWM+IC++Y
Sbjct  66   AVFGKLGQPELQWMKICDLY  85



>ref|XP_004962893.1| PREDICTED: CASP-like protein Sb08g016550-like [Setaria italica]
Length=200

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 68/138 (49%), Positives = 93/138 (67%), Gaps = 4/138 (3%)
 Frame = +2

Query  152  VVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANG  331
            V +++V++AE+  R ++C L+ + A L+ TDSQ R  FS +K+A F DMKA+V LV    
Sbjct  5    VAERKVKVAEVSLRALLCLLSALAAALVATDSQTRTFFSFQKRATFRDMKAMVLLVAVAA  64

Query  332  LAAAYSLVQLVRCSVSMIR----GSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavy  499
             AA YSL+Q+ RC V+  +    G  L ++ LAW +FS DQ +AY  L AVAAA Q++V 
Sbjct  65   AAAGYSLLQVARCCVTAAQRAGGGGTLTSRALAWCVFSCDQALAYAVLAAVAAALQASVI  124

Query  500  aKIGQSELQWMRICNMYG  553
            AK GQ ELQWM IC+MYG
Sbjct  125  AKRGQPELQWMGICSMYG  142



>gb|EEC69375.1| hypothetical protein OsI_38510 [Oryza sativa Indica Group]
Length=132

 Score = 75.9 bits (185),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 48/98 (49%), Positives = 67/98 (68%), Gaps = 2/98 (2%)
 Frame = +2

Query  155  VDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGL  334
            ++++ ++AE+  RC +C LA + A L+GT SQ R  FS+ KKA+FTDMKALV LV A+G 
Sbjct  7    LERKAKVAEVALRCAVCALAALAAALVGTGSQTRTFFSLEKKARFTDMKALVLLVAAHGA  66

Query  335  AAAYSLVQLVRCSVSMI--RGSVLFNKPLAWAIFSGDQ  442
            AA YSL+QL RC+ +     GS      +AW++FS DQ
Sbjct  67   AAVYSLLQLARCAAAAAWKGGSNGGAAVVAWSVFSCDQ  104



>ref|NP_001066880.1| Os12g0514300 [Oryza sativa Japonica Group]
 dbj|BAF29899.1| Os12g0514300 [Oryza sativa Japonica Group]
Length=157

 Score = 76.3 bits (186),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 48/98 (49%), Positives = 67/98 (68%), Gaps = 2/98 (2%)
 Frame = +2

Query  155  VDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGL  334
            ++++ ++AE+  RC +C LA + A L+GT SQ R  FS+ KKA+FTDMKALV LV A+G 
Sbjct  7    LERKAKVAEVALRCAVCALAALAAALVGTGSQTRTFFSLEKKARFTDMKALVLLVAAHGA  66

Query  335  AAAYSLVQLVRCSVSMI--RGSVLFNKPLAWAIFSGDQ  442
            AA YSL+QL RC+ +     GS      +AW++FS DQ
Sbjct  67   AAVYSLLQLARCAAAAAWKGGSNGGAAVVAWSVFSCDQ  104



>gb|EEC69376.1| hypothetical protein OsI_38511 [Oryza sativa Indica Group]
Length=143

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 48/98 (49%), Positives = 67/98 (68%), Gaps = 2/98 (2%)
 Frame = +2

Query  155  VDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGL  334
            ++++ ++AE+  RC +C LA + A L+GT SQ R  FS+ KKA+FTDMKALV LV A+G 
Sbjct  7    LERKAKVAEVALRCALCALAALAAALVGTGSQTRTFFSLEKKARFTDMKALVLLVAAHGA  66

Query  335  AAAYSLVQLVRCSVSMI--RGSVLFNKPLAWAIFSGDQ  442
            AA YSL+QL RC+ +     GS      +AW++FS DQ
Sbjct  67   AAVYSLLQLARCAAAAAWKGGSNGGAAVVAWSVFSCDQ  104



>ref|NP_001142330.1| CASP-like protein 2U1 [Zea mays]
 gb|ACF88205.1| unknown [Zea mays]
 gb|AFW56601.1| membrane protein 9 [Zea mays]
Length=186

 Score = 74.3 bits (181),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 67/140 (48%), Positives = 93/140 (66%), Gaps = 10/140 (7%)
 Frame = +2

Query  155  VDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGL  334
             +++V +AE+  R V+CGL  + A L+ TD+Q R  FS++KKA +TDMKA+V LV A   
Sbjct  11   AERKVAVAEVALRAVLCGLGALAAALVATDTQTRTFFSLQKKATYTDMKAMVLLVAAAAT  70

Query  335  AAAYSLVQLVR--CSVSMIRGSVLFNKP-----LAWAIFSGDQLMaylslgavaaaaqsa  493
            AA YSL+Q  R  C V+++R S+   +P     LAW +F+ DQ +AY  L AVAAA Q++
Sbjct  71   AAGYSLLQAARCCCCVALLRTSI---RPRARLLLAWCVFACDQALAYALLAAVAAALQAS  127

Query  494  vyaKIGQSELQWMRICNMYG  553
            V AK G  +LQWM IC +YG
Sbjct  128  VVAKQGLPQLQWMAICALYG  147



>gb|ABF94455.1| plant integral membrane protein TIGR01569 containing protein, 
expressed [Oryza sativa Japonica Group]
Length=238

 Score = 73.9 bits (180),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 71/199 (36%), Positives = 98/199 (49%), Gaps = 70/199 (35%)
 Frame = +2

Query  95   LGVGVSPGNVPV-YHGSNLKV---VDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREI  262
            +G GVSPGNVPV Y+G   +V   +++R R AE++ RC  CGLA++ A L+G D Q R  
Sbjct  9    VGDGVSPGNVPVCYYGPGGRVPSSLERRARAAEVLLRCAACGLAVLAAALLGADRQTRVF  68

Query  263  FSIRKKAKFTDMKALV-------------------------------------------F  313
            FSI+K A++TDM++LV                                            
Sbjct  69   FSIQKVARYTDMQSLVVNNGPSMQKYRGVFDGPKTSFYRKFLLRYFAYCDKIILLDIRRL  128

Query  314  LVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsa  493
            LVIANG+AA YSL+Q  RC V            +A+ + S           AVAAA ++A
Sbjct  129  LVIANGMAACYSLIQCARCLV------------MAYIVIS-----------AVAAAMEAA  165

Query  494  vyaKIGQSELQWMRICNMY  550
            +  K GQ E QWM+ C++Y
Sbjct  166  LIGKYGQPEFQWMKTCHLY  184



>sp|B9IM09.2|CSPLG_POPTR RecName: Full=CASP-like protein 2C1; Short=PtCASPL2C1 [Populus 
trichocarpa]
Length=181

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 51/129 (40%), Positives = 72/129 (56%), Gaps = 8/129 (6%)
 Frame = +2

Query  179  ELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAYSLVQ  358
            E I R +   L +  A L+G DSQ + +    K+  + D+ ALV LV  + +AAAY+L+Q
Sbjct  9    EAILRGIAILLLVSTACLVGLDSQTKFVIVYEKEVTYKDLHALVVLVYVDAVAAAYNLLQ  68

Query  359  LVRCSVSMI-----RGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyaKIGQSEL  523
            L RCSVS +     +GS    + L+WA F  DQL AY +  A +AA Q +V    G    
Sbjct  69   LCRCSVSALSKGNFKGSY---RYLSWACFVLDQLAAYTTFAAHSAALQHSVLGITGAKVF  125

Query  524  QWMRICNMY  550
            QWM+ CN +
Sbjct  126  QWMKWCNRF  134



>ref|XP_008800283.1| PREDICTED: CASP-like protein Os06g0656300 [Phoenix dactylifera]
Length=170

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 47/128 (37%), Positives = 72/128 (56%), Gaps = 2/128 (2%)
 Frame = +2

Query  176  AELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAYSLV  355
            AE + R +   LA + AVLIG D+Q + +F +R+KA   D++AL    I   +AA Y L+
Sbjct  9    AESLLRVLCLVLASMAAVLIGLDTQTKTVFFVRRKATVKDLEALWISTIITSIAAGYHLL  68

Query  356  QLVRC--SVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyaKIGQSELQW  529
            Q  RC     + +     NK +AWA F  DQ + Y++ G + A  Q+++ A  G   LQW
Sbjct  69   QFCRCLAFAWLTKNPCWSNKFMAWASFLLDQGVTYVTFGGILAGMQASMIAVTGMRALQW  128

Query  530  MRICNMYG  553
             ++CN+Y 
Sbjct  129  EKLCNIYA  136



>gb|KJB53802.1| hypothetical protein B456_009G006000 [Gossypium raimondii]
Length=177

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/133 (35%), Positives = 72/133 (54%), Gaps = 3/133 (2%)
 Frame = +2

Query  155  VDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGL  334
            ++  ++  E + R     + ++ A LIG DSQ + IF ++KKA F D++ALV L+    L
Sbjct  1    MELSIQKTEALIRLSTIVMLVLTACLIGLDSQTKVIFYVQKKASFNDLRALVGLLYITSL  60

Query  335  AAAYSLVQLVRCSVSMIRGSVLFNKP-LAWAIFSGDQLMaylslgavaaaaqsavyaKIG  511
            AAAY+L+QL  C  S  +G+ L +   LAW  +  DQ + Y       AA + +     G
Sbjct  61   AAAYNLLQL--CCSSFYKGTSLQSYAYLAWLRYILDQAVVYAVFAGNLAAMEHSFLVLTG  118

Query  512  QSELQWMRICNMY  550
            +   QW++ CN Y
Sbjct  119  EENFQWLKWCNKY  131



>gb|EPS70050.1| hypothetical protein M569_04716, partial [Genlisea aurea]
Length=118

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 57/80 (71%), Gaps = 4/80 (5%)
 Frame = +2

Query  311  FLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqs  490
            F+V  N L AAYS +QL R S    +GS + NKPLAW IFS DQ++AYL   AVAA+  S
Sbjct  1    FVVAVNVLGAAYSALQLARLS----KGSPVLNKPLAWTIFSSDQVLAYLMFSAVAASIPS  56

Query  491  avyaKIGQSELQWMRICNMY  550
            AVYA+ G+ +LQWM+ CN+Y
Sbjct  57   AVYAQYGEPQLQWMKTCNLY  76



>ref|XP_010913647.1| PREDICTED: CASP-like protein 2C1 isoform X1 [Elaeis guineensis]
Length=168

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 72/126 (57%), Gaps = 2/126 (2%)
 Frame = +2

Query  179  ELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAYSLVQ  358
            E + R     LA + A+LIG D+Q + +F +R+KA   D++AL    I   +AA Y L+Q
Sbjct  8    ESLLRVFCLVLASMAAILIGMDTQTKTVFFVRRKATVKDLEALWISTIITSVAAGYHLLQ  67

Query  359  LVRCSV--SMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyaKIGQSELQWM  532
              RC V   +++     NK +AWA F  DQ + Y++ G + AA Q++  A  G   LQW 
Sbjct  68   FCRCLVFAWLMKNPCWSNKFMAWASFLLDQGVTYVTFGGILAALQASTIAVTGIRALQWE  127

Query  533  RICNMY  550
            ++CN+Y
Sbjct  128  KLCNIY  133



>ref|XP_007014187.1| CASP-like protein XL3 [Theobroma cacao]
 gb|EOY31806.1| CASP-like protein XL3 [Theobroma cacao]
Length=181

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 63/116 (54%), Gaps = 2/116 (2%)
 Frame = +2

Query  209  LAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIR  388
            L ++ A L+G DSQ + IF + KKA F D++AL+ LV    LAAAY+LVQL   S S  R
Sbjct  19   LLVLTACLVGFDSQTKVIFYVEKKASFKDLRALIGLVYITSLAAAYNLVQLSCYSFSARR  78

Query  389  --GSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyaKIGQSELQWMRICNMY  550
               S    K LAW  +  DQ   Y+      AA + A+    G+   QWM+ CN Y
Sbjct  79   KGSSPQSYKYLAWLRYVLDQAAVYVVFAGNFAAFEHALLVVTGEQNFQWMKWCNKY  134



>ref|XP_010260176.1| PREDICTED: CASP-like protein XL3 [Nelumbo nucifera]
Length=181

 Score = 67.4 bits (163),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 69/127 (54%), Gaps = 3/127 (2%)
 Frame = +2

Query  179  ELIFRCVICGLAIVGAVLIGTDSQVREIF-SIRKKAKFTDMKALVFLVIANGLAAAYSLV  355
            E + R    GL ++ A L+GTD Q + +F S+ +KA   D+ ALV L+I   + A Y L+
Sbjct  9    EALLRLFTVGLLVLTACLVGTDKQTKTVFFSVERKATVKDLDALVILMIVETVVAFYHLL  68

Query  356  QLVRCSV--SMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyaKIGQSELQW  529
            QL +C           L     AW  F  DQ + Y+  GA  AAAQ++  +  G S+ QW
Sbjct  69   QLGKCFFFPRFKENKALPYSTQAWVFFFLDQTVTYIYFGATIAAAQASALSVTGASDFQW  128

Query  530  MRICNMY  550
            M++CN+Y
Sbjct  129  MKVCNIY  135



>ref|XP_006651131.1| PREDICTED: CASP-like protein Os03g0196400-like [Oryza brachyantha]
Length=209

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 58/147 (39%), Positives = 82/147 (56%), Gaps = 26/147 (18%)
 Frame = +2

Query  110  SPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKF  289
            +P N   +HG    V      +  ++ RC  CGLA++ A L+  D Q R  FSI+K A++
Sbjct  39   TPLNHTPFHG---PVRHFLAAVLVVLLRCAACGLAVLAAALLAADRQTRVFFSIQKVARY  95

Query  290  TDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslga  469
            TDM++LV LVIANG+AA YSL+Q  RC V            +A+ + S           A
Sbjct  96   TDMQSLVLLVIANGMAACYSLIQGARCLV------------MAYIVIS-----------A  132

Query  470  vaaaaqsavyaKIGQSELQWMRICNMY  550
            VAAA ++A+  K GQ E QWM+ C++Y
Sbjct  133  VAAAMEAALIGKYGQPEFQWMKTCHLY  159



>sp|Q5K4H9.1|CSPL2_GOSHI RecName: Full=CASP-like protein XL3; AltName: Full=CASP-like 
protein 2C1; Short=GhCASPL2C1 [Gossypium hirsutum]
 emb|CAE75666.1| putative membrane protein [Gossypium hirsutum]
Length=180

 Score = 65.5 bits (158),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 76/138 (55%), Gaps = 9/138 (7%)
 Frame = +2

Query  143  NLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVI  322
            +++ ++  +RL+ ++       + ++ A LIG DSQ + IF ++KKA F D++ALV L+ 
Sbjct  4    SIQKIEALIRLSTIV-------MLVLTACLIGLDSQTKVIFYVQKKASFKDLRALVGLLY  56

Query  323  ANGLAAAYSLVQLVRCSVSM-IRGSVLFNKP-LAWAIFSGDQLMaylslgavaaaaqsav  496
               LAAAY+L+QL   S S   +G+ L +   LAW  +  DQ + Y       AA + + 
Sbjct  57   ITSLAAAYNLLQLCCSSFSASYKGTSLQSYAYLAWLRYILDQAVVYAVFAGNLAALEHSF  116

Query  497  yaKIGQSELQWMRICNMY  550
                G+   QW++ CN Y
Sbjct  117  LVLTGEENFQWLKWCNKY  134



>gb|KHF98180.1| CASP-like protein XL3 [Gossypium arboreum]
Length=180

 Score = 65.1 bits (157),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 76/138 (55%), Gaps = 9/138 (7%)
 Frame = +2

Query  143  NLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVI  322
            +++ ++  +RL+ ++       + ++ A LIG DSQ + IF ++KKA F D++ALV L+ 
Sbjct  4    SIQKIEALIRLSTIV-------MLVLTACLIGLDSQTKVIFYVQKKASFKDLRALVGLLY  56

Query  323  ANGLAAAYSLVQLVRCSVSM-IRGSVLFNKP-LAWAIFSGDQLMaylslgavaaaaqsav  496
               LAAAY+L+QL   S S   +G+ L +   LAW  +  DQ + Y       AA + + 
Sbjct  57   ITSLAAAYNLLQLCCSSFSASYKGTSLQSYAYLAWLRYILDQAVVYAVFAGNLAALEHSF  116

Query  497  yaKIGQSELQWMRICNMY  550
                G+   QW++ CN Y
Sbjct  117  LVLTGEENFQWLKWCNKY  134



>sp|P0DH82.1|CSPL1_MARPO RecName: Full=CASP-like protein 2U1; Short=MpCASPL2U1 [Marchantia 
polymorpha]
Length=216

 Score = 65.1 bits (157),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 52/161 (32%), Positives = 82/161 (51%), Gaps = 10/161 (6%)
 Frame = +2

Query  83   TMSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREI  262
            T  Y+G   +PG VPV H  N   + +R+R A ++ R     L +   V + TD Q    
Sbjct  11   TNGYIG---TPGTVPVSHAGNDSGM-RRMRTASILMRLTAMALCVTALVTMVTDKQTHYF  66

Query  263  ----FSIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIF  430
                 +I K A++T++ AL   V  NG+ A YSL+Q +   V+  + S   +K   W  F
Sbjct  67   NFASTTIVKTAEYTNVLALKVFVYTNGVIAGYSLLQALWTIVA--KSSYSTSKARLWTTF  124

Query  431  SGDQLMaylslgavaaaaqsavyaKIGQSELQWMRICNMYG  553
              DQ + Y+ +G   AA + A  A+ G+S++ W + CN +G
Sbjct  125  FLDQFIVYVLIGVTGAATEVAYIAEKGESDVAWPKQCNNFG  165



>gb|KDP36414.1| hypothetical protein JCGZ_08683 [Jatropha curcas]
Length=178

 Score = 64.3 bits (155),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 70/114 (61%), Gaps = 1/114 (1%)
 Frame = +2

Query  209  LAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIR  388
            L ++ ++LIG DS+ + +  + KK    D+KAL+ LV  + +AAAY+L+QL RC  +  +
Sbjct  19   LLLMTSLLIGLDSETKSVVYMEKKVTCKDLKALLVLVYVDAVAAAYNLLQLSRCFKASYK  78

Query  389  GSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyaKIGQSELQWMRICNMY  550
                + + +AW+ F  DQ++ Y++  A AAA + +V   +G +  QWM+ CN +
Sbjct  79   SEASY-RSVAWSCFLLDQIVVYITFAATAAAIEHSVLVVVGANAFQWMKWCNRF  131



>ref|XP_011043990.1| PREDICTED: CASP-like protein 2C1 [Populus euphratica]
Length=181

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 47/129 (36%), Positives = 69/129 (53%), Gaps = 8/129 (6%)
 Frame = +2

Query  179  ELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAYSLVQ  358
            E I R +   L +  A L+G DSQ + +    K+  + D+ ALV LV  + +AAAY+L+Q
Sbjct  9    EAILRGIAILLLVSTACLVGLDSQTKFVIVYEKEVTYKDLHALVVLVHVDAVAAAYNLLQ  68

Query  359  LVRCSVSM-----IRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyaKIGQSEL  523
            L RCSVS      ++GS    + L+WA    DQL  Y +  A  AA + +V    G    
Sbjct  69   LCRCSVSAWGLGNLKGSY---RYLSWACCVLDQLAVYTTFAAHLAALEHSVLVLTGAKVF  125

Query  524  QWMRICNMY  550
            QW++ CN +
Sbjct  126  QWVKWCNKF  134



>ref|XP_002273403.2| PREDICTED: CASP-like protein 2C1 [Vitis vinifera]
 sp|A7Q6G6.1|CSPL9_VITVI RecName: Full=CASP-like protein 2C1; Short=VvCASPL2C1 [Vitis 
vinifera]
Length=206

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 57/161 (35%), Positives = 81/161 (50%), Gaps = 8/161 (5%)
 Frame = +2

Query  86   MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLA--ELIFRCVICGLAIVGAVLIGTDSQVRE  259
            MS LGVG  P  V  +    +      + LA  E   R     + ++ A L+G D+Q + 
Sbjct  1    MSVLGVG--PRTVTPHLRKGMMESSSGISLARAEAFLRLFAILVLVLTACLLGFDTQTKL  58

Query  260  IFS-IRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNK---PLAWAI  427
            +FS I+K A F D+ AL  +V  + +AA Y+L+QL R  +S      L N     L W  
Sbjct  59   LFSTIKKTATFRDLGALQVVVYVDSVAAGYNLLQLGRGFISAKLKGKLINVSYVTLPWVC  118

Query  428  FSGDQLMaylslgavaaaaqsavyaKIGQSELQWMRICNMY  550
            F  DQ   Y    A  AA Q+++ A  G+S LQWM++CN Y
Sbjct  119  FLLDQAAVYTVFSANTAALQASIIAVTGESSLQWMKVCNRY  159



>ref|XP_010046989.1| PREDICTED: CASP-like protein 2C1 [Eucalyptus grandis]
 gb|KCW78728.1| hypothetical protein EUGRSUZ_C00172 [Eucalyptus grandis]
 gb|KCW78729.1| hypothetical protein EUGRSUZ_C00172 [Eucalyptus grandis]
Length=184

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 46/130 (35%), Positives = 70/130 (54%), Gaps = 8/130 (6%)
 Frame = +2

Query  179  ELIFRCVICGLAIVGAVLIGTDSQVREI-FSIRKKAKFTDMKALVFLVIANGLAAAYSLV  355
            E+  R     L ++ A L+   +Q + I ++  +KA F D+ AL  LV  +G+ A Y+L+
Sbjct  9    EVFLRVCAILLLVLTACLVAMATQTKLIMYTYARKATFRDLNALPVLVYIDGVVAGYNLL  68

Query  356  QLVRCSVSM-----IRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyaKIGQSE  520
            QL RCSVS      I+  +L  K L+W  F  DQ+  Y       AA Q+++ A  G   
Sbjct  69   QLSRCSVSAYCKREIQCPLL--KNLSWVHFLLDQVAVYTVFATTVAATQASLLAVTGSKA  126

Query  521  LQWMRICNMY  550
            +QWM++CN Y
Sbjct  127  MQWMKLCNRY  136



>ref|XP_002325065.1| hypothetical protein POPTR_0018s10260g [Populus trichocarpa]
 gb|EEF03630.1| hypothetical protein POPTR_0018s10260g [Populus trichocarpa]
Length=120

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 53/93 (57%), Gaps = 8/93 (9%)
 Frame = +2

Query  179  ELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAYSLVQ  358
            E I R +   L +  A L+G DSQ + +    K+  + D+ ALV LV  + +AAAY+L+Q
Sbjct  9    EAILRGIAILLLVSTACLVGLDSQTKFVIVYEKEVTYKDLHALVVLVYVDAVAAAYNLLQ  68

Query  359  LVRCSVSMI-----RGSVLFNKPLAWAIFSGDQ  442
            L RCSVS +     +GS  +   L+WA F  DQ
Sbjct  69   LCRCSVSALSKGNFKGSYRY---LSWACFVLDQ  98



>emb|CBI17818.3| unnamed protein product [Vitis vinifera]
Length=224

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 48/129 (37%), Positives = 69/129 (53%), Gaps = 4/129 (3%)
 Frame = +2

Query  176  AELIFRCVICGLAIVGAVLIGTDSQVREIFS-IRKKAKFTDMKALVFLVIANGLAAAYSL  352
            AE   R     + ++ A L+G D+Q + +FS I+K A F D+ AL  +V  + +AA Y+L
Sbjct  53   AEAFLRLFAILVLVLTACLLGFDTQTKLLFSTIKKTATFRDLGALQVVVYVDSVAAGYNL  112

Query  353  VQLVRCSVSMIRGSVLFNK---PLAWAIFSGDQLMaylslgavaaaaqsavyaKIGQSEL  523
            +QL R  +S      L N     L W  F  DQ   Y    A  AA Q+++ A  G+S L
Sbjct  113  LQLGRGFISAKLKGKLINVSYVTLPWVCFLLDQAAVYTVFSANTAALQASIIAVTGESSL  172

Query  524  QWMRICNMY  550
            QWM++CN Y
Sbjct  173  QWMKVCNRY  181



>ref|XP_010913648.1| PREDICTED: CASP-like protein 2C1 isoform X2 [Elaeis guineensis]
Length=151

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 50/90 (56%), Gaps = 2/90 (2%)
 Frame = +2

Query  179  ELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAYSLVQ  358
            E + R     LA + A+LIG D+Q + +F +R+KA   D++AL    I   +AA Y L+Q
Sbjct  8    ESLLRVFCLVLASMAAILIGMDTQTKTVFFVRRKATVKDLEALWISTIITSVAAGYHLLQ  67

Query  359  LVRCSV--SMIRGSVLFNKPLAWAIFSGDQ  442
              RC V   +++     NK +AWA F  DQ
Sbjct  68   FCRCLVFAWLMKNPCWSNKFMAWASFLLDQ  97



>gb|EYU42435.1| hypothetical protein MIMGU_mgv1a014854mg [Erythranthe guttata]
Length=176

 Score = 59.7 bits (143),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 45/122 (37%), Positives = 67/122 (55%), Gaps = 5/122 (4%)
 Frame = +2

Query  191  RCVICGLAIVGAVLIGTDSQVREIF-SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVR  367
            R +   L ++ A L+G D+Q + IF +  +KA F D+ AL  LV  +  AA Y+L+QL R
Sbjct  11   RIISTVLLVLSACLVGLDTQTKVIFYTFTRKATFRDLDALYLLVWIDSGAAVYNLLQLFR  70

Query  368  C-SVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyaKIGQSELQWMRICN  544
                ++I       K LAW ++  DQ  AY+   A  AA Q++  A  G+   QWM++CN
Sbjct  71   SFRKNLITAPY---KNLAWGVYFLDQAAAYVVFAANTAAIQASALAVTGEESFQWMKLCN  127

Query  545  MY  550
             Y
Sbjct  128  RY  129



>ref|XP_011069901.1| PREDICTED: CASP-like protein 2C1 isoform X2 [Sesamum indicum]
Length=176

 Score = 58.5 bits (140),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 66/133 (50%), Gaps = 19/133 (14%)
 Frame = +2

Query  179  ELIFRCVICGLAIVGAVLIGTDSQVREIF-SIRKKAKFTDMKALVFLVIANGLAAAYSLV  355
            E   R +   L ++ A L+G DSQ +  F +  +KA F D+ AL  LV  +  AAAY+L+
Sbjct  7    ETFLRVLSTVLLVLTACLVGFDSQTKVFFYTYARKATFRDLNALYVLVWVDAAAAAYNLI  66

Query  356  QLVRCSVSMIRGSVLFNKPLA--------WAIFSGDQLMaylslgavaaaaqsavyaKIG  511
            QL R           F K LA        W  +  DQ  +Y+   A  AA Q++V A  G
Sbjct  67   QLFRS----------FRKDLADNSYTYLRWGTYLLDQAASYVVFAANTAAVQASVLALTG  116

Query  512  QSELQWMRICNMY  550
            +   QWM++CN Y
Sbjct  117  EKSFQWMKLCNRY  129



>ref|XP_010265455.1| PREDICTED: CASP-like protein 2C1 [Nelumbo nucifera]
Length=181

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 43/128 (34%), Positives = 71/128 (55%), Gaps = 3/128 (2%)
 Frame = +2

Query  176  AELIFRCVICGLAIVGAVLIGTDSQVREIF-SIRKKAKFTDMKALVFLVIANGLAAAYSL  352
             E + R    G+ ++ A L+GT++Q + +F S+ +KA   D+ ALV LVI   + A Y L
Sbjct  8    TEALLRLSAIGVLVLTACLVGTNTQTKHVFFSVERKATVKDLDALVILVIVESVTAFYHL  67

Query  353  VQLVRCSV--SMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyaKIGQSELQ  526
            +QL +            +  +  AW  F  DQ++ Y++ GA  AAAQ+++ A  G  + Q
Sbjct  68   LQLGKYFAFPRFKEKKAISYETQAWICFMLDQIVTYVNFGATVAAAQASMLAVTGSRDFQ  127

Query  527  WMRICNMY  550
            WM++C +Y
Sbjct  128  WMKVCRIY  135



>ref|XP_009396107.1| PREDICTED: CASP-like protein 2C1 [Musa acuminata subsp. malaccensis]
Length=190

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 66/132 (50%), Gaps = 2/132 (2%)
 Frame = +2

Query  161  KRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAA  340
             +V  AE + R +    A + A+L+G D+Q + +F + + A   DM AL  + +   + A
Sbjct  3    SKVLRAESVLRILSLVFAAMAALLVGLDTQTKTVFFVTRTATVKDMDALWVMTVVFSVVA  62

Query  341  AYSLVQLVRCSVSMIRGS--VLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyaKIGQ  514
             Y L+ L RC      G      NK +AW  F  DQ   Y + GA  AA Q+A+    G 
Sbjct  63   GYHLLHLFRCMAFTWLGKNPCHCNKFVAWLYFVLDQGSTYATFGATMAALQAALVGLFGI  122

Query  515  SELQWMRICNMY  550
              LQW ++CN+Y
Sbjct  123  GSLQWSKLCNIY  134



>ref|XP_007223970.1| hypothetical protein PRUPE_ppa014614mg, partial [Prunus persica]
 gb|EMJ25169.1| hypothetical protein PRUPE_ppa014614mg, partial [Prunus persica]
Length=180

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 71/117 (61%), Gaps = 8/117 (7%)
 Frame = +2

Query  215  IVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSM----  382
            ++ A L+G DSQ + +  I +KA F D+K+L  LV    +AA Y+L+QL +CS S     
Sbjct  19   VLTACLVGFDSQTKYLIFIYRKATFRDLKSLSVLVYVVSVAAGYNLLQLGKCSKSAWCKE  78

Query  383  -IRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyaKIGQSELQWMRICNMY  550
             ++GS   N  +AW  F  DQ+  Y++ GA +AA +++V A  G  + QWM++CN Y
Sbjct  79   NLKGS---NIYVAWLCFLLDQVAVYVTFGANSAALEASVLAIKGAQDFQWMKLCNKY  132



>ref|XP_009396704.1| PREDICTED: CASP-like protein 2C1 [Musa acuminata subsp. malaccensis]
Length=187

 Score = 56.2 bits (134),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 44/134 (33%), Positives = 73/134 (54%), Gaps = 2/134 (1%)
 Frame = +2

Query  155  VDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGL  334
            ++ R+  AE + R +   LA   A+L+G D++ + +  +RKKA   D+  L  + +   +
Sbjct  1    MESRLLKAEGVLRMLSLALAATAALLVGLDTETKTVLFVRKKATAKDLDGLWTMTLVTSI  60

Query  335  AAAYSLVQLVRCSVSMI--RGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyaKI  508
             A Y L+QL RC    +  R     +K +AW +F  DQ + Y + GA  A  Q+A+ A  
Sbjct  61   TAGYHLLQLFRCMALALLGRNPCRGSKSVAWFLFLLDQGVTYATFGATMAGLQAALVAVF  120

Query  509  GQSELQWMRICNMY  550
            G  +LQW ++CN+Y
Sbjct  121  GVDDLQWSKLCNIY  134



>ref|XP_004149074.1| PREDICTED: CASP-like protein POPTRDRAFT_578614-like [Cucumis 
sativus]
 ref|XP_004163171.1| PREDICTED: CASP-like protein POPTRDRAFT_578614-like [Cucumis 
sativus]
 gb|KGN61092.1| hypothetical protein Csa_2G048830 [Cucumis sativus]
Length=188

 Score = 56.2 bits (134),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 35/110 (32%), Positives = 62/110 (56%), Gaps = 5/110 (5%)
 Frame = +2

Query  236  GTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSV-----SMIRGSVL  400
            G D +  +IF + KKA F  ++ALV ++  + +AA Y+++QL +C +      + +    
Sbjct  28   GFDKETVQIFHVDKKASFKSLRALVIIIYVDSMAAGYNILQLCKCWIFAQPKGISKLGTH  87

Query  401  FNKPLAWAIFSGDQLMaylslgavaaaaqsavyaKIGQSELQWMRICNMY  550
            F+  L W  F  DQ+ AYL+  +  A  ++A+ A  G  + QWM++CN +
Sbjct  88   FHIYLFWLSFFLDQVAAYLTFASNTAGMEAALLAVTGAHDFQWMKLCNRF  137



>emb|CDY68034.1| BnaCnng57380D [Brassica napus]
Length=139

 Score = 55.5 bits (132),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 37/58 (64%), Gaps = 1/58 (2%)
 Frame = +2

Query  383  IRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyaKI-GQSELQWMRICNMYG  553
            ++GSV  NK LAWAIFSGDQ        A  AA+  +    I G+ ELQWM++CNM+G
Sbjct  4    MKGSVFLNKSLAWAIFSGDQQAMAYMSVAAIAASSESGVIGIRGEEELQWMKVCNMFG  61



>ref|XP_006845610.1| hypothetical protein AMTR_s00019p00209400 [Amborella trichopoda]
 gb|ERN07285.1| hypothetical protein AMTR_s00019p00209400 [Amborella trichopoda]
Length=178

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 47/132 (36%), Positives = 75/132 (57%), Gaps = 3/132 (2%)
 Frame = +2

Query  155  VDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGL  334
            +D R++ +E + R ++  +  V   ++   ++  E   I+K+A   D+  L  LV+   +
Sbjct  1    MDARLKRSEALLR-LLAAMFAVATAVVVATNRETEYMIIQKRATMKDLNCLEVLVMVESI  59

Query  335  AAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyaKIGQ  514
            AA Y +VQL++C +S    S      LAW   S DQ++ Y  LGAVAAA Q + +AK G 
Sbjct  60   AAGYQMVQLLKCILSWNSTSCC--TRLAWLTLSFDQVVVYGCLGAVAAAIQGSYFAKFGA  117

Query  515  SELQWMRICNMY  550
             ELQW ++CN+Y
Sbjct  118  RELQWSKLCNIY  129



>ref|XP_011069900.1| PREDICTED: CASP-like protein 2C1 isoform X1 [Sesamum indicum]
Length=179

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 43/136 (32%), Positives = 62/136 (46%), Gaps = 22/136 (16%)
 Frame = +2

Query  179  ELIFRCVICGLAIVGAVLIGTDSQVREIF-SIRKKAKFTDMKALVFLVIANGLAAAYSLV  355
            E   R +   L ++ A L+G DSQ +  F +  +KA F D+ AL  LV  +  AAAY+L+
Sbjct  7    ETFLRVLSTVLLVLTACLVGFDSQTKVFFYTYARKATFRDLNALYVLVWVDAAAAAYNLI  66

Query  356  QLVRCSVSMIRGSVLFNKPLA--------WAIFSGDQLMaylslgavaaaaqsavyaKI-  508
            QL R           F K LA        W  +  DQ +   S    AA   +   + + 
Sbjct  67   QLFRS----------FRKDLADNSYTYLRWGTYLLDQELQAASYVVFAANTAAVQASVLA  116

Query  509  --GQSELQWMRICNMY  550
              G+   QWM++CN Y
Sbjct  117  LTGEKSFQWMKLCNRY  132



>ref|XP_009798279.1| PREDICTED: CASP-like protein 2C1 [Nicotiana sylvestris]
Length=190

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 39/116 (34%), Positives = 65/116 (56%), Gaps = 4/116 (3%)
 Frame = +2

Query  215  IVGAVLIGTDSQVREIF-SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSV--SMI  385
            ++ A L+G DSQ + +F ++ +KA F DM AL FLV  +   A+Y+++ ++RC +  +  
Sbjct  19   VLTACLMGFDSQTKLLFDTVERKASFNDMDALFFLVWIDAAVASYNVLHVLRCFLIPTTA  78

Query  386  RGSV-LFNKPLAWAIFSGDQLMaylslgavaaaaqsavyaKIGQSELQWMRICNMY  550
            +G V   +    W  F  DQ   Y    A +AA +++  A  G   LQWM++CN +
Sbjct  79   KGDVKQRSYKNYWLFFFLDQAAVYTVFAAQSAAVEASAIALAGVRSLQWMKLCNRF  134



>ref|XP_003553094.1| PREDICTED: CASP-like protein 10-like [Glycine max]
Length=203

 Score = 53.9 bits (128),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 45/139 (32%), Positives = 66/139 (47%), Gaps = 9/139 (6%)
 Frame = +2

Query  137  GSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFL  316
            G  L+     +R AE   R V  GL +   VL+  +SQ  E  S+     ++D+ A  +L
Sbjct  21   GDELEGNTSALRTAETFLRLVPVGLCVSALVLMLKNSQQNEYGSV----DYSDLGAFRYL  76

Query  317  VIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsav  496
            V ANG+ A YSL   V    +M R S +   P AW  F  DQ++ Y+ L A A + +   
Sbjct  77   VHANGICAGYSLFSAVI--AAMPRPSTM---PRAWTFFLLDQVLTYIILAAGAVSTEVLY  131

Query  497  yaKIGQSELQWMRICNMYG  553
             A+ G +   W   C  +G
Sbjct  132  LAEKGDAATTWSSACGSFG  150



>emb|CDP02964.1| unnamed protein product [Coffea canephora]
Length=169

 Score = 53.1 bits (126),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 47/125 (38%), Positives = 69/125 (55%), Gaps = 6/125 (5%)
 Frame = +2

Query  179  ELIFRCVICGLAIVGAVLIGTDSQVREIF-SIRKKAKFTDMKALVFLVIANGLAAAYSLV  355
             L+ R       ++ A L+  DSQ + +F S+ +KA F D+KAL  LV     AAAY+++
Sbjct  3    TLVLRLFATSSLVLTACLVAFDSQTKLLFYSMVRKASFRDLKALSILVWVASAAAAYNVL  62

Query  356  QLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyaKIGQSELQWMR  535
            Q++R  +    G     K LAW  +  DQ +AYL   A +AA Q  V+A  GQS   WM+
Sbjct  63   QILRSRLFPQMG-----KNLAWFGYLLDQAVAYLVFAANSAALQGCVFAVSGQSNFGWMK  117

Query  536  ICNMY  550
            +C+ Y
Sbjct  118  VCDKY  122



>ref|XP_003579514.1| PREDICTED: CASP-like protein 2A1 [Brachypodium distachyon]
Length=204

 Score = 53.5 bits (127),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 45/134 (34%), Positives = 67/134 (50%), Gaps = 9/134 (7%)
 Frame = +2

Query  152  VVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANG  331
            V + RVR  E + R V  GL +    ++  D+Q  E  ++     ++D+    +LV ANG
Sbjct  27   VAEARVRPVETLLRAVPLGLCVAAMAVMLRDTQTNEYGTV----SYSDLGGFRYLVYANG  82

Query  332  LAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyaKIG  511
            L AAYSLV     +V   R + L     +W +F  DQ+  YL L A AA+A+    A  G
Sbjct  83   LCAAYSLVSAFYTAVP--RPATLCR---SWIVFLLDQVFTYLILAAGAASAELLYLAYNG  137

Query  512  QSELQWMRICNMYG  553
              E+ W   C ++G
Sbjct  138  DKEVTWSEACGVFG  151



>dbj|BAJ84836.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=207

 Score = 53.5 bits (127),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 67/137 (49%), Gaps = 9/137 (7%)
 Frame = +2

Query  143  NLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVI  322
            +L   + RVR  E + R    GL +    ++  D+Q  E  ++     ++D+    +LV 
Sbjct  26   DLSAAEARVRPLETLLRAAPLGLCVAAMAVMLRDTQTNEYGTV----SYSDLGGFKYLVY  81

Query  323  ANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavya  502
            ANGL AAYSLV     +V   R + L     +W +F  DQ+  YL L A AA+A+    A
Sbjct  82   ANGLCAAYSLVSAFYTAVP--RPATLSR---SWIVFLLDQVFTYLILAAGAASAELLYLA  136

Query  503  KIGQSELQWMRICNMYG  553
              G  E+ W   C ++G
Sbjct  137  YNGDKEVTWSEACGVFG  153



>dbj|BAJ85571.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=207

 Score = 53.5 bits (127),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 67/137 (49%), Gaps = 9/137 (7%)
 Frame = +2

Query  143  NLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVI  322
            +L   + RVR  E + R    GL +    ++  D+Q  E  ++     ++D+    +LV 
Sbjct  26   DLSAAEARVRPLETLLRAAPLGLCVAAMAVMLRDTQTNEYGTV----SYSDLGGFKYLVY  81

Query  323  ANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavya  502
            ANGL AAYSLV     +V   R + L     +W +F  DQ+  YL L A AA+A+    A
Sbjct  82   ANGLCAAYSLVSAFYTAVP--RPATLSR---SWIVFLLDQVFTYLILAAGAASAELLYLA  136

Query  503  KIGQSELQWMRICNMYG  553
              G  E+ W   C ++G
Sbjct  137  YNGDKEVTWSEACGVFG  153



>gb|EMT22680.1| hypothetical protein F775_30108 [Aegilops tauschii]
Length=204

 Score = 53.5 bits (127),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 67/137 (49%), Gaps = 9/137 (7%)
 Frame = +2

Query  143  NLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVI  322
            +L   + RVR  E + R    GL +    ++  D+Q  E  ++     ++D+    +LV 
Sbjct  23   DLSAAEARVRPLETLLRAAPLGLCVAAMAVMLRDTQTNEYGTV----SYSDLGGFKYLVY  78

Query  323  ANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavya  502
            ANGL AAYSLV     +V   R + L     +W +F  DQ+  YL L A AA+A+    A
Sbjct  79   ANGLCAAYSLVSAFYTAVP--RPATLSR---SWIVFLLDQVFTYLILAAGAASAELLYLA  133

Query  503  KIGQSELQWMRICNMYG  553
              G  E+ W   C ++G
Sbjct  134  YNGDKEVTWSEACGVFG  150



>ref|XP_002890211.1| integral membrane family protein [Arabidopsis lyrata subsp. lyrata]
 sp|D7KFC7.1|CSPLB_ARALL RecName: Full=CASP-like protein 2A1; Short=AlCASPL2A1 [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH66470.1| integral membrane family protein [Arabidopsis lyrata subsp. lyrata]
Length=204

 Score = 53.5 bits (127),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 45/129 (35%), Positives = 63/129 (49%), Gaps = 8/129 (6%)
 Frame = +2

Query  167  VRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAY  346
            +R AE + R    GL +   V++  DS+  E  SI     ++++ A  +LV ANG+ A Y
Sbjct  30   IRTAETMLRLAPVGLCVAALVVMLKDSETNEFGSI----SYSNLTAFRYLVHANGICAGY  85

Query  347  SLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyaKIGQSELQ  526
            SL  L     +M R S     P  W  F  DQL+ YL L A A +A+    A  G S + 
Sbjct  86   SL--LSAAIAAMPRSSS--TMPRVWTFFCLDQLLTYLVLAAGAVSAEVLYLAYNGDSAIT  141

Query  527  WMRICNMYG  553
            W   C+ YG
Sbjct  142  WSDACSSYG  150



>gb|AAL36294.1| unknown protein [Arabidopsis thaliana]
Length=204

 Score = 53.5 bits (127),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 45/129 (35%), Positives = 63/129 (49%), Gaps = 8/129 (6%)
 Frame = +2

Query  167  VRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAY  346
            +R AE + R    GL +   V++  DS+  E  SI     ++++ A  +LV ANG+ A Y
Sbjct  30   IRTAETMLRLAPVGLCVAALVVMLKDSETNEFGSI----SYSNLTAFRYLVHANGICAGY  85

Query  347  SLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyaKIGQSELQ  526
            SL  L     +M R S     P  W  F  DQL+ YL L A A +A+    A  G S + 
Sbjct  86   SL--LSAAIAAMPRSSS--TMPRVWTFFCLDQLLTYLVLAAGAVSAEVLYLAYNGDSAIT  141

Query  527  WMRICNMYG  553
            W   C+ YG
Sbjct  142  WSDACSSYG  150



>ref|NP_564017.1| uncharacterized protein [Arabidopsis thaliana]
 sp|Q8VZQ3.2|CSPL3_ARATH RecName: Full=CASP-like protein 2A1; Short=AtCASPL2A1 [Arabidopsis 
thaliana]
 gb|AAD50013.1|AC007651_8 Unknown protein [Arabidopsis thaliana]
 gb|AAM63874.1| unknown [Arabidopsis thaliana]
 gb|AAN12953.1| unknown protein [Arabidopsis thaliana]
 gb|AEE29557.1| uncharacterized protein AT1G17200 [Arabidopsis thaliana]
Length=204

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 45/129 (35%), Positives = 63/129 (49%), Gaps = 8/129 (6%)
 Frame = +2

Query  167  VRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAY  346
            +R AE + R    GL +   V++  DS+  E  SI     ++++ A  +LV ANG+ A Y
Sbjct  30   IRTAETMLRLAPVGLCVAALVVMLKDSETNEFGSI----SYSNLTAFRYLVHANGICAGY  85

Query  347  SLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyaKIGQSELQ  526
            SL  L     +M R S     P  W  F  DQL+ YL L A A +A+    A  G S + 
Sbjct  86   SL--LSAAIAAMPRSSS--TMPRVWTFFCLDQLLTYLVLAAGAVSAEVLYLAYNGDSAIT  141

Query  527  WMRICNMYG  553
            W   C+ YG
Sbjct  142  WSDACSSYG  150



>ref|NP_001237350.1| CASP-like protein 2C1 [Glycine max]
 sp|C6SZ04.1|CSPL3_SOYBN RecName: Full=CASP-like protein 2C1; Short=GmCASPL2C1 [Glycine 
max]
 gb|ACU14477.1| unknown [Glycine max]
Length=180

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 63/116 (54%), Gaps = 7/116 (6%)
 Frame = +2

Query  215  IVGAVLIGTDSQVREIF-SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSV---SM  382
            ++ A L+  D+Q + +F SI KKA + D+ AL  LV     AA Y+L+ L + S+     
Sbjct  21   VLTACLVALDTQTKVVFVSIEKKATYKDLNALKILVYVTCAAAGYNLLLLCKHSIWSRKN  80

Query  383  IRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyaKIGQSELQWMRICNMY  550
             +GS L    +AW  FS DQ+  Y++  A  A   +AV A  G    QW+++C+ +
Sbjct  81   FKGSYL---CMAWICFSLDQIAVYMTFAANTATMGAAVLAISGSEAFQWLKVCDKF  133



>gb|KHN22710.1| CASP-like protein 3 [Glycine soja]
Length=180

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 63/116 (54%), Gaps = 7/116 (6%)
 Frame = +2

Query  215  IVGAVLIGTDSQVREIF-SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSV---SM  382
            ++ A L+  D+Q + +F SI KKA + D+ AL  LV     AA Y+L+ L + S+     
Sbjct  21   VLTACLVALDTQTKVVFISIEKKATYKDLNALKILVYVTCAAAGYNLLLLCKHSIWSRKN  80

Query  383  IRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyaKIGQSELQWMRICNMY  550
             +GS L    +AW  FS DQ+  Y++  A  A   +AV A  G    QW+++C+ +
Sbjct  81   FKGSYL---CMAWICFSLDQIAVYMTFAANTATMGAAVLAISGSEAFQWLKVCDKF  133



>ref|XP_010327104.1| PREDICTED: CASP-like protein 2A1 [Solanum lycopersicum]
Length=189

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 67/128 (52%), Gaps = 9/128 (7%)
 Frame = +2

Query  170  RLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAYS  349
             + E+I R +  GL +V  V++  +SQ  +  S+     ++D+    +LV ANG+ AAYS
Sbjct  18   NIGEIILRLLPMGLCVVALVIMLKNSQTNDYGSL----SYSDLGTFRYLVHANGICAAYS  73

Query  350  LVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyaKIGQSELQW  529
            L+  +  ++   R + L   P AW IF  DQ++ Y+ L A AA+ +    A  G + + W
Sbjct  74   LISAIVAALP--RPTTL---PRAWTIFLLDQILTYIILAAGAASTEVIYLAYKGDTNVTW  128

Query  530  MRICNMYG  553
               C  +G
Sbjct  129  SETCGSFG  136



>ref|XP_008223711.1| PREDICTED: CASP-like protein POPTRDRAFT_578614 [Prunus mume]
Length=182

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 72/117 (62%), Gaps = 8/117 (7%)
 Frame = +2

Query  215  IVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSM----  382
            ++ A L+G DSQ + +  I +KA F D+KAL+ LV    +AA Y+L+QL +CS S     
Sbjct  21   VLTACLVGFDSQTKYVIFIYRKATFRDLKALLVLVYVVSVAAGYNLLQLGKCSKSAWYKE  80

Query  383  -IRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyaKIGQSELQWMRICNMY  550
             ++GS   N  +AW  F  DQ+  Y++ GA +AA +++V A  G  + QW+++CN Y
Sbjct  81   NLKGS---NIYVAWLCFLLDQVAVYVTFGANSAALEASVLAIKGAQDFQWIKLCNKY  134



>ref|XP_002533365.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF29010.1| conserved hypothetical protein, partial [Ricinus communis]
Length=98

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 46/81 (57%), Gaps = 8/81 (10%)
 Frame = +2

Query  215  IVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRC-----SVS  379
            ++ A L+G DSQ + ++ + K   +  +KAL+ LV  + +AAAY+L+QL RC     S  
Sbjct  21   VLTACLLGLDSQTKPVYFLEKHVTYKYLKALLVLVYVDAVAAAYNLIQLGRCYFLASSKG  80

Query  380  MIRGSVLFNKPLAWAIFSGDQ  442
              +GS  +   +AW  +  DQ
Sbjct  81   NFKGSYRY---MAWGSYLLDQ  98



>ref|XP_006304211.1| hypothetical protein CARUB_v10010315mg [Capsella rubella]
 gb|EOA37109.1| hypothetical protein CARUB_v10010315mg [Capsella rubella]
Length=204

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 62/128 (48%), Gaps = 8/128 (6%)
 Frame = +2

Query  170  RLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAYS  349
            R AE + R    GL +   V++  DSQ  E  SI     ++++ A  +LV ANG+ A YS
Sbjct  31   RTAETMLRLAPVGLCVAALVVMLKDSQDNEFGSI----SYSNLTAFRYLVHANGICAGYS  86

Query  350  LVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyaKIGQSELQW  529
            L  L     +M R S     P  W  F  DQL+ YL L A A +A+    A  G + + W
Sbjct  87   L--LSAAMAAMPRSSSTM--PRVWTFFCLDQLLTYLVLAAGAVSAEVLYLAYNGDAAITW  142

Query  530  MRICNMYG  553
               C+ YG
Sbjct  143  SDACSSYG  150



>ref|XP_010062716.1| PREDICTED: CASP-like protein 2A1 [Eucalyptus grandis]
Length=200

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 68/140 (49%), Gaps = 9/140 (6%)
 Frame = +2

Query  134  HGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVF  313
            HG      ++RVR AE++ R V  GL +   V++  +S+  +  S+     ++D+ A  +
Sbjct  17   HGGENGGENERVRTAEMLMRVVPMGLCVAALVMMLRNSESNDYGSL----SYSDLGAFRY  72

Query  314  LVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsa  493
            LV ANG+ A YSL+  +   V+M R   +     AW  F  DQ++ Y  L A A + +  
Sbjct  73   LVHANGICAGYSLLSAII--VAMPRPPTISR---AWTFFLLDQVLTYTILAAGAVSTEVL  127

Query  494  vyaKIGQSELQWMRICNMYG  553
              A  G   + W   C  +G
Sbjct  128  YLAYKGDVAITWSSACGSFG  147



>ref|XP_002991776.1| hypothetical protein SELMODRAFT_272229 [Selaginella moellendorffii]
 sp|D8T829.1|CSPL2_SELML RecName: Full=CASP-like protein 2U5; Short=SmCASPL2U5 [Selaginella 
moellendorffii]
 gb|EFJ07180.1| hypothetical protein SELMODRAFT_272229 [Selaginella moellendorffii]
Length=203

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 50/143 (35%), Positives = 71/143 (50%), Gaps = 19/143 (13%)
 Frame = +2

Query  146  LKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREI-------FSIRKKAKFTDMKA  304
            LK  D  +R A      V C + +V  VLI TD Q   I        +I K   F   KA
Sbjct  29   LKRTDLMLRFAAF----VCCAVTMV--VLI-TDKQTSAIQVPGFNNLTITKTVSFDLAKA  81

Query  305  LVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaa  484
             V+LV A G+ A Y+L+ LV   +S  R     +K +AW IF  DQL+ Y+ L A AA+ 
Sbjct  82   FVYLVSAAGIGAGYTLLVLVLSIISAER-----SKAIAWFIFVFDQLITYVLLAAAAAST  136

Query  485  qsavyaKIGQSELQWMRICNMYG  553
            + A        E  W+++C+++G
Sbjct  137  EVAYMGAHAPPEASWLKVCSLFG  159



>ref|XP_010433586.1| PREDICTED: CASP-like protein 2C1 [Camelina sativa]
Length=175

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 45/133 (34%), Positives = 63/133 (47%), Gaps = 18/133 (14%)
 Frame = +2

Query  164  RVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAA  343
            ++R  E+I R  I  L ++ A LIG DSQ +EI  I KK  F  + AL   +  + + AA
Sbjct  3    KLRETEVILRVFIVFLLLLTACLIGLDSQTKEIAYIHKKVSFKYLIALEAELYIDVVVAA  62

Query  344  YSLVQL------VRCSVSMIRG-SVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavya  502
            Y+L QL      V    S  +  S L ++  A+ +F+G    A  SL  V          
Sbjct  63   YNLAQLGLHWHSVEKKTSNTKWFSYLLDQTAAYVVFAGTSAAAQHSLLVVT---------  113

Query  503  KIGQSELQWMRIC  541
              G  ELQWM+ C
Sbjct  114  --GSKELQWMKWC  124



>gb|KCW69848.1| hypothetical protein EUGRSUZ_F03189 [Eucalyptus grandis]
Length=217

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 68/140 (49%), Gaps = 9/140 (6%)
 Frame = +2

Query  134  HGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVF  313
            HG      ++RVR AE++ R V  GL +   V++  +S+  +  S+     ++D+ A  +
Sbjct  34   HGGENGGENERVRTAEMLMRVVPMGLCVAALVMMLRNSESNDYGSL----SYSDLGAFRY  89

Query  314  LVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsa  493
            LV ANG+ A YSL+  +   V+M R   +     AW  F  DQ++ Y  L A A + +  
Sbjct  90   LVHANGICAGYSLLSAI--IVAMPRPPTISR---AWTFFLLDQVLTYTILAAGAVSTEVL  144

Query  494  vyaKIGQSELQWMRICNMYG  553
              A  G   + W   C  +G
Sbjct  145  YLAYKGDVAITWSSACGSFG  164



>ref|XP_004494327.1| PREDICTED: CASP-like protein VIT_07s0104g01350-like [Cicer arietinum]
Length=186

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 39/140 (28%), Positives = 71/140 (51%), Gaps = 8/140 (6%)
 Frame = +2

Query  143  NLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREI----FSIRKKAKFTDMKALV  310
            N+++   +  + +++ RCV   L +   V++G   Q + I    F  +  AK+  M A V
Sbjct  14   NVEMESGKRSVYDVLLRCVGLLLTLTATVMVGVGKQTKVISYADFQFKATAKWEYMSATV  73

Query  311  FLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqs  490
            FL++AN +  +Y+ + LV  +++   G    NK   + I   D ++  L   A  AA+  
Sbjct  74   FLLVANAIGCSYAAISLVVSTMARSNG----NKMKLFMITVLDLIIVALLFSANGAASAV  129

Query  491  avyaKIGQSELQWMRICNMY  550
             V    G S +QWM++CN++
Sbjct  130  GVIGMKGNSHVQWMKVCNVF  149



>ref|XP_010448363.1| PREDICTED: CASP-like protein 2C1 [Camelina sativa]
Length=175

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 45/133 (34%), Positives = 63/133 (47%), Gaps = 18/133 (14%)
 Frame = +2

Query  164  RVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAA  343
            ++R  E+I R  I  L ++ A LIG DSQ +EI  I KK  F  + AL   +  + + AA
Sbjct  3    KLRETEVILRVCIVFLLLLTACLIGMDSQTKEIAYIHKKVSFKYLVALEAELYIDVVVAA  62

Query  344  YSLVQL------VRCSVSMIRG-SVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavya  502
            Y+L QL      V    S  +  S L ++  A+ +F+G    A  SL  V          
Sbjct  63   YNLAQLGLHWHSVEQKTSNTKWFSYLLDQTAAYVVFAGTSAAAQHSLLVVT---------  113

Query  503  KIGQSELQWMRIC  541
              G  ELQWM+ C
Sbjct  114  --GSKELQWMKWC  124



>emb|CDX96785.1| BnaA08g23280D [Brassica napus]
Length=204

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 41/129 (32%), Positives = 63/129 (49%), Gaps = 8/129 (6%)
 Frame = +2

Query  167  VRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAY  346
            +R AE + R    GL I   V++  DSQ  E  SI     ++++ A  +LV ANG+ A Y
Sbjct  30   IRTAETMLRLAPVGLCIAALVIMLQDSQDNEFGSI----SYSNLSAFRYLVHANGICAGY  85

Query  347  SLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyaKIGQSELQ  526
            SL+     ++S + GS     P  W  F  DQ++ Y+ L A A + +    A  G   + 
Sbjct  86   SLLS---AAISAMPGSSS-TMPRVWTFFCLDQILTYVVLAAGAVSTEVLYLAYKGDDAIT  141

Query  527  WMRICNMYG  553
            W   C+ +G
Sbjct  142  WSDACSSFG  150



>ref|XP_002869651.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 sp|D7MFW5.1|CSPL4_ARALL RecName: Full=CASP-like protein 2C1; Short=AlCASPL2C1 [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH45910.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=175

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 45/133 (34%), Positives = 65/133 (49%), Gaps = 18/133 (14%)
 Frame = +2

Query  164  RVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAA  343
            R+R  E+I R  I    ++ + LIG DSQ +EI  I KK  F  + AL   +  N + AA
Sbjct  3    RLRETEVILRLCIVFFILLSSCLIGLDSQTKEIAYIHKKVSFRYLLALEAELYINVVVAA  62

Query  344  YSLVQL------VRCSVSMIRG-SVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavya  502
            Y+LVQ+      V    S  +  S L ++  A+ +F+G             AAAQ ++  
Sbjct  63   YNLVQIGLGWYNVEQKTSNPKWFSYLLDQTAAYVVFAGTS-----------AAAQHSLLV  111

Query  503  KIGQSELQWMRIC  541
              G  ELQWM+ C
Sbjct  112  VTGSRELQWMKWC  124



>gb|KFK43914.1| hypothetical protein AALP_AA1G190800 [Arabis alpina]
Length=205

 Score = 51.6 bits (122),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 42/133 (32%), Positives = 61/133 (46%), Gaps = 8/133 (6%)
 Frame = +2

Query  155  VDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGL  334
            V   +R AE + R    GL +   V++  DS+  E  SI     + ++ A  +LV ANG+
Sbjct  27   VSPGIRTAETMLRLAPVGLCVAALVVMLKDSETNEFGSI----SYNNLTAFRYLVHANGI  82

Query  335  AAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyaKIGQ  514
             A YSL  L     +M R S     P  W  F  DQ++ Y+ L A A + +    A  G 
Sbjct  83   CAGYSL--LSAAIAAMPRSSS--TMPRVWTFFCFDQILTYVVLAAGAVSTEVLYLAYKGD  138

Query  515  SELQWMRICNMYG  553
              + W   C+ YG
Sbjct  139  DAITWSDACSSYG  151



>ref|XP_010438829.1| PREDICTED: CASP-like protein 2C1 [Camelina sativa]
Length=175

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 45/133 (34%), Positives = 63/133 (47%), Gaps = 18/133 (14%)
 Frame = +2

Query  164  RVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAA  343
            ++R  E+I R  I  L ++ A LIG DSQ +EI  I KK  F  + AL   +  + + AA
Sbjct  3    KLRETEVILRVCIVFLLLLTACLIGLDSQTKEIAYIHKKVSFKYLIALEAELYIDVVVAA  62

Query  344  YSLVQL------VRCSVSMIRG-SVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavya  502
            Y+L QL      V    S  +  S L ++  A+ +F+G    A  SL  V          
Sbjct  63   YNLAQLGLHWHSVEKKTSNTKWFSYLLDQTAAYVVFAGTSAAAQHSLLVVT---------  113

Query  503  KIGQSELQWMRIC  541
              G  ELQWM+ C
Sbjct  114  --GSKELQWMKWC  124



>ref|XP_002989705.1| hypothetical protein SELMODRAFT_272089 [Selaginella moellendorffii]
 sp|D8T2C0.1|CSPL1_SELML RecName: Full=CASP-like protein 2U6; Short=SmCASPL2U6 [Selaginella 
moellendorffii]
 gb|EFJ09182.1| hypothetical protein SELMODRAFT_272089 [Selaginella moellendorffii]
Length=203

 Score = 51.2 bits (121),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 50/143 (35%), Positives = 71/143 (50%), Gaps = 19/143 (13%)
 Frame = +2

Query  146  LKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREI-------FSIRKKAKFTDMKA  304
            LK  D  +R A      V C + +V  VLI TD Q   I        +I K   F   KA
Sbjct  29   LKRTDLMLRFAAF----VCCTVTMV--VLI-TDKQTSAIQVPGFNNLTITKTVSFDLAKA  81

Query  305  LVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaa  484
             V+LV A G+ A Y+L+ LV   +S  R     +K +AW IF  DQL+ Y+ L A AA+ 
Sbjct  82   FVYLVSAAGIGAGYTLLVLVLSIISAER-----SKAIAWFIFVFDQLITYVLLAAAAAST  136

Query  485  qsavyaKIGQSELQWMRICNMYG  553
            + A        E  W+++C+++G
Sbjct  137  EVAYMGAHAPPEASWLKVCSLFG  159



>ref|XP_002317605.1| integral membrane family protein [Populus trichocarpa]
 sp|B9I0G0.1|CSPLA_POPTR RecName: Full=CASP-like protein 2A1; Short=PtCASPL2A1 [Populus 
trichocarpa]
 gb|EEE98217.1| integral membrane family protein [Populus trichocarpa]
Length=201

 Score = 51.2 bits (121),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 65/133 (49%), Gaps = 9/133 (7%)
 Frame = +2

Query  155  VDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGL  334
            V+   R AE + R V   L +   V++  ++Q  +  S+     ++D+ A  +LV  NG+
Sbjct  24   VENTTRTAETMLRLVPMALCVSALVVMLKNTQTNDYGSL----SYSDLGAFRYLVHVNGI  79

Query  335  AAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyaKIGQ  514
             A YSL+  V   V+M R S +   P AWA F  DQ++ Y+ L A   + +    A  G 
Sbjct  80   CAGYSLLSAVI--VAMPRASTM---PRAWAFFLLDQVLTYVILAAGTVSTEVLYLASKGD  134

Query  515  SELQWMRICNMYG  553
            + + W   C  +G
Sbjct  135  TTITWSEACVSFG  147



>emb|CDX94411.1| BnaC01g17730D [Brassica napus]
Length=175

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 44/136 (32%), Positives = 66/136 (49%), Gaps = 18/136 (13%)
 Frame = +2

Query  164  RVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAA  343
            R+R +E+I R  I  L I+ +VLIG DSQ ++I  I K+  F  + AL   +  N + AA
Sbjct  3    RLRESEVILRLCIVALLILSSVLIGLDSQTKDIAYIHKRVTFRYLFALEIELYINVVVAA  62

Query  344  YSLVQL------VRCSVSMIRG-SVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavya  502
            Y++ QL      V    S  +  S L ++   + +F+G    A  SL  V          
Sbjct  63   YNIAQLGFGWYGVAQKTSNSKWLSYLLDQTAVYVVFAGASAAAQHSLLVVT---------  113

Query  503  KIGQSELQWMRICNMY  550
              G  ELQWM+ C+ +
Sbjct  114  --GSRELQWMKWCSKF  127



>ref|XP_009341031.1| PREDICTED: CASP-like protein POPTRDRAFT_578614 [Pyrus x bretschneideri]
Length=192

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 41/115 (36%), Positives = 67/115 (58%), Gaps = 3/115 (3%)
 Frame = +2

Query  215  IVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRG-  391
            ++ A L+G DSQ + +    +KA F D+ AL+ LV    +AA Y+L+Q+ + S+S     
Sbjct  30   VLTACLVGFDSQTKYVVFFYRKATFRDLNALLLLVYVVSVAAGYNLLQVGKSSLSACFKP  89

Query  392  --SVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyaKIGQSELQWMRICNMY  550
               V  N  LAW  F  DQ+  Y++ GA +A  Q+++ A  GQ + QW+++C+ Y
Sbjct  90   NLKVRTNIYLAWICFLLDQMAVYVTFGANSATFQASLLAVTGQEDFQWIKLCSKY  144



>ref|XP_007146967.1| hypothetical protein PHAVU_006G085600g [Phaseolus vulgaris]
 gb|ESW18961.1| hypothetical protein PHAVU_006G085600g [Phaseolus vulgaris]
Length=163

 Score = 50.4 bits (119),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 41/138 (30%), Positives = 65/138 (47%), Gaps = 9/138 (7%)
 Frame = +2

Query  137  GSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFL  316
            G  ++     +R AE   R +  GL +   VL+  +SQ  +  S+     +TD+ A  +L
Sbjct  19   GGEMEGNTNTLRTAETFLRLLPVGLCVSALVLMLKNSQQNQYGSV----DYTDLGAFKYL  74

Query  317  VIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsav  496
            V ANG+ A YSL   V    +M R S +   P AW  F  DQ++ Y+ L   A + +   
Sbjct  75   VHANGICAGYSLFSAVIA--AMPRPSTM---PRAWTFFLLDQVLTYIILAGGAVSTEFLY  129

Query  497  yaKIGQSELQWMRICNMY  550
             A+ G ++  W   C  +
Sbjct  130  LAENGNTDTTWSSACGSF  147



>gb|KDP24708.1| hypothetical protein JCGZ_25699 [Jatropha curcas]
Length=193

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 42/129 (33%), Positives = 64/129 (50%), Gaps = 9/129 (7%)
 Frame = +2

Query  167  VRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAY  346
            +R AE I R +   L +   VL+  DSQ  +  S+     ++D+ A  +LV ANG+ A Y
Sbjct  19   MRTAETILRLIPMALCLSALVLMLKDSQSNDFGSL----SYSDLGAFRYLVHANGICAGY  74

Query  347  SLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyaKIGQSELQ  526
            SL+  +   V+M R S +   P AW  F  DQ++ Y  L A A + +    A+ G   + 
Sbjct  75   SLLSAII--VAMPRPSTM---PQAWTFFFLDQVLTYAILAAGAVSVEVLYLARKGDMAIT  129

Query  527  WMRICNMYG  553
            W   C  +G
Sbjct  130  WSAACMSFG  138



>ref|XP_009611405.1| PREDICTED: CASP-like protein 2C1 [Nicotiana tomentosiformis]
Length=242

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 44/147 (30%), Positives = 78/147 (53%), Gaps = 19/147 (13%)
 Frame = +2

Query  137  GSNLKVVDKR--VRLAELIFRCVICGLAIVGAVLIGTDSQVREIF-SIRKKAKFTDMKAL  307
              N+ +V K   +RL  ++F        ++ A L+G DSQ + +F ++ +KA F D+ AL
Sbjct  50   DHNMDIVRKEGFLRLFAILF-------LVLTACLMGFDSQTKLLFDTVERKASFKDLNAL  102

Query  308  VFLVIANGLAAAYSLVQLVRCSV--SMIRGSVLFNKPLA----WAIFSGDQLMaylslga  469
              LV  +   A+Y+++Q++RC +  +  +G +   K ++    W  F  DQ   Y    A
Sbjct  103  FVLVWIDAAVASYNVLQVLRCFLIPTTSKGDI---KQMSYKNYWLFFFLDQAAVYTVFAA  159

Query  470  vaaaaqsavyaKIGQSELQWMRICNMY  550
             +AA +++  A  G   LQWM++CN +
Sbjct  160  QSAAVEASAIALAGVRSLQWMKLCNRF  186



>ref|XP_009783950.1| PREDICTED: CASP-like protein 2A1 [Nicotiana sylvestris]
Length=189

 Score = 50.8 bits (120),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 43/148 (29%), Positives = 74/148 (50%), Gaps = 14/148 (9%)
 Frame = +2

Query  110  SPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKF  289
            SP  +   +GS+       +R AE + R +   L +V  V++  +SQ  +  S+     +
Sbjct  3    SPQGLEDENGSS-----SSMRTAETMLRLLPMALCVVALVIMLKNSQTNDFGSL----SY  53

Query  290  TDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslga  469
            +D+    +LV ANG+ AAYSL+  +  +V   R + +   P AW  F  DQ++ Y+ L A
Sbjct  54   SDLGTFRYLVHANGICAAYSLLSAIVSAVP--RPTTM---PKAWTFFLLDQILTYVILAA  108

Query  470  vaaaaqsavyaKIGQSELQWMRICNMYG  553
             AA+ +    A  G + + W   C ++G
Sbjct  109  GAASTEVVYLAYKGDTAVTWSETCGLFG  136



>ref|XP_008451819.1| PREDICTED: CASP-like protein F16 [Cucumis melo]
Length=199

 Score = 50.8 bits (120),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 70/146 (48%), Gaps = 9/146 (6%)
 Frame = +2

Query  116  GNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTD  295
             N P    S+  +    +R A+ + R V  GL I   +++  +S+  +  S+     ++D
Sbjct  8    NNPPGLSSSDDSLAATGMRAADTLLRLVPMGLCIAALIVMLKNSEANDYGSV----AYSD  63

Query  296  MKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgava  475
            + A  FLV ANG+ A YS +     +V+ +      +K  AW +F  DQL+ YL+L A  
Sbjct  64   LGAFKFLVHANGICAGYSFLS---AAVAAMSPPSTISK--AWTLFFLDQLLTYLTLAAGT  118

Query  476  aaaqsavyaKIGQSELQWMRICNMYG  553
             + +    A  G +E+ W   C  +G
Sbjct  119  VSTEVLYLAYNGDTEITWSAACGTFG  144



>emb|CDX81811.1| BnaC08g37900D [Brassica napus]
Length=204

 Score = 50.8 bits (120),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 64/133 (48%), Gaps = 8/133 (6%)
 Frame = +2

Query  155  VDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGL  334
            V    R AE + R    GL +   V+   DSQ  E  S+     ++++ A  +LV ANG+
Sbjct  26   VSTAFRTAETMLRLAPVGLCLAALVITLKDSQNNEFGSV----SYSNLSAFGYLVHANGI  81

Query  335  AAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyaKIGQ  514
             A YSL+     +++ +RGS     P  W  F  DQ++ Y+ L A A + +    A  G 
Sbjct  82   CAGYSLLS---AAIAAMRGSSS-TMPRVWTFFCLDQILTYVVLAAGAVSTEVLYLAYKGD  137

Query  515  SELQWMRICNMYG  553
            + + W   C+ +G
Sbjct  138  NAITWSDACSSFG  150



>gb|AFK47158.1| unknown [Lotus japonicus]
Length=207

 Score = 50.8 bits (120),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 61/129 (47%), Gaps = 9/129 (7%)
 Frame = +2

Query  167  VRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAY  346
            +R+ E   R    GL +   V++  +SQ  E  ++     +TD+ A  +LV ANG+ A Y
Sbjct  29   LRIVETFLRLFPIGLCVTALVIMLKNSQENEYGTL----DYTDLSAFRYLVHANGICAGY  84

Query  347  SLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyaKIGQSELQ  526
            SL   V   +++ R S +   P AW  F  DQL+ Y+ L A A + +     + G     
Sbjct  85   SLFSAVI--IALPRPSTM---PRAWTFFVLDQLLTYIILAAGALSMEVLYLTEKGDPPAA  139

Query  527  WMRICNMYG  553
            W   C  +G
Sbjct  140  WSSACGYFG  148



>ref|XP_004242688.1| PREDICTED: CASP-like protein 2C1 [Solanum lycopersicum]
Length=200

 Score = 50.8 bits (120),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 66/113 (58%), Gaps = 5/113 (4%)
 Frame = +2

Query  224  AVLIGTDSQVREIF-SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRC---SVSMIRG  391
            A L+G DSQ + +F +++ KA F  + AL  LV  +  AA Y+++QL+RC   + S +  
Sbjct  22   ACLVGFDSQTKVVFLTVQIKANFKYLGALSVLVWIDAAAAIYNVLQLLRCFFIATSKVDI  81

Query  392  SVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyaKIGQSELQWMRICNMY  550
              + +K   W  F  DQ++ Y+   A +AA +++  A IG   LQWM+ICN +
Sbjct  82   KQISHKNY-WFFFLLDQVVVYIVFAANSAAIEASAIALIGIKSLQWMKICNRF  133



>gb|KJB12801.1| hypothetical protein B456_002G037500 [Gossypium raimondii]
Length=207

 Score = 50.8 bits (120),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 41/133 (31%), Positives = 66/133 (50%), Gaps = 9/133 (7%)
 Frame = +2

Query  155  VDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGL  334
            V+  +R AE + R V   L +   V++  +SQ  +  S+     ++D+ A  +LV ANG+
Sbjct  31   VNTSMRTAETMLRLVPMALGVAALVVMLKNSQSNDFGSV----SYSDLGAFRYLVHANGI  86

Query  335  AAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyaKIGQ  514
             A YSL+  +  +V   R S +   P AW  F  DQ++ Y+ LGA A + +    A  G 
Sbjct  87   CAGYSLLSAIIAAVP--RPSTM---PRAWTFFLLDQILTYIILGAAAVSTEVLYLANKGD  141

Query  515  SELQWMRICNMYG  553
            S + W   C  + 
Sbjct  142  SAITWSAACGTFA  154



>emb|CDY48478.1| BnaC05g13380D [Brassica napus]
Length=204

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 64/133 (48%), Gaps = 8/133 (6%)
 Frame = +2

Query  155  VDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGL  334
            V   +R AE + R    GL +   V++  DSQ  E      +  ++++ A  +LV ANG+
Sbjct  26   VSTGIRTAETMLRVAPVGLCVAALVIMLKDSQTNE----YGEVSYSNLTAFRYLVHANGI  81

Query  335  AAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyaKIGQ  514
             A YSL+     +++ + GS     P  W IF  DQ++ Y+ L A A + +    A  G 
Sbjct  82   CAGYSLLS---AAIAAMPGSSS-TMPRVWTIFCLDQILTYVVLAAGAVSTEVLYLAYKGD  137

Query  515  SELQWMRICNMYG  553
              + W   C+ +G
Sbjct  138  DAITWSDACSSFG  150



>ref|XP_009117714.1| PREDICTED: CASP-like protein At1g17200 [Brassica rapa]
Length=201

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 65/133 (49%), Gaps = 8/133 (6%)
 Frame = +2

Query  155  VDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGL  334
            V   +R AE + R    GL +   V++  DSQ  E  S+     ++++ A  +LV ANG+
Sbjct  23   VSTAIRTAETMLRLAPVGLCLAALVIMLKDSQNNEFGSV----SYSNLSAFWYLVHANGI  78

Query  335  AAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyaKIGQ  514
             A YSL+     +++ + GS     P  W  F  DQ++ Y+ L A A + +    A  G 
Sbjct  79   CAGYSLLS---AAIAAMPGSSS-TTPRVWTFFCLDQILTYVVLAAGAVSTEVLYLAYKGD  134

Query  515  SELQWMRICNMYG  553
            + + W   C+ +G
Sbjct  135  NAITWSDACSSFG  147



>gb|KHN08760.1| CASP-like protein 10 [Glycine soja]
Length=203

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 44/139 (32%), Positives = 65/139 (47%), Gaps = 9/139 (6%)
 Frame = +2

Query  137  GSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFL  316
            G  L+     +R AE   R V  GL +   VL+  +SQ  E  S+     ++D+ A  +L
Sbjct  21   GDELEGNTSALRTAETFLRLVPVGLCVSALVLMLKNSQQNEYGSV----DYSDLGAFRYL  76

Query  317  VIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsav  496
            V ANG+ A YSL   V    +M R S +     AW  F  DQ++ Y+ L A A + +   
Sbjct  77   VHANGICAGYSLFSAVI--AAMPRPSTMTR---AWTFFLLDQVLTYIILAAGAVSTEVLY  131

Query  497  yaKIGQSELQWMRICNMYG  553
             A+ G +   W   C  +G
Sbjct  132  LAEKGDAATTWSSACGSFG  150



>ref|XP_010498065.1| PREDICTED: CASP-like protein 2A1 [Camelina sativa]
Length=204

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 63/129 (49%), Gaps = 8/129 (6%)
 Frame = +2

Query  167  VRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAY  346
            +R AE + R    GL +   V++  DS+  E  SI     ++++ A  +LV ANG+ A Y
Sbjct  30   MRTAETMLRLAPVGLCVAALVVMLKDSEDNEFGSI----SYSNLTAFRYLVHANGICAGY  85

Query  347  SLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyaKIGQSELQ  526
            SL  L     +M R S     P  W  F  DQL+ YL L A A +A+    A  G + + 
Sbjct  86   SL--LSAAIAAMPRSSSTM--PRVWTFFCLDQLLTYLVLAAGAVSAEVLYLAYNGDAAIT  141

Query  527  WMRICNMYG  553
            W   C+ YG
Sbjct  142  WSDACSSYG  150



>ref|XP_002276206.1| PREDICTED: CASP-like protein 1E2 [Vitis vinifera]
 sp|A7NW78.1|CSPL5_VITVI RecName: Full=CASP-like protein 1E2; Short=VvCASPL1E2 [Vitis 
vinifera]
Length=195

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 41/144 (28%), Positives = 70/144 (49%), Gaps = 15/144 (10%)
 Frame = +2

Query  152  VVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREI----------FSIRKKAKFTDMK  301
            V   ++R  +L+ R V   L +V AVL+G D Q + +            +   AK+  + 
Sbjct  22   VTGGKLRPFDLVLRVVALALTLVAAVLLGVDKQTKVVSLQLLPTLPPMDVPVTAKWRYLS  81

Query  302  ALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaa  481
            A V+ V++N +A +Y+ + L+  SV   +G    NK L  AI   D +M  L   +  AA
Sbjct  82   AFVYFVVSNAIACSYAALSLL-LSVGNSKG----NKGLGLAITVMDLVMVALLFSSNGAA  136

Query  482  aqsavyaKIGQSELQWMRICNMYG  553
                +    G S ++W ++CN++G
Sbjct  137  GAIGLMGYEGNSRVRWGKVCNVFG  160



>ref|XP_010459293.1| PREDICTED: CASP-like protein 2A1 [Camelina sativa]
Length=248

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 63/129 (49%), Gaps = 8/129 (6%)
 Frame = +2

Query  167  VRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAY  346
            +R AE + R    GL +   V++  DS+  E  SI     ++++ A  +LV ANG+ A Y
Sbjct  74   MRTAETMLRLAPVGLCVAALVVMLKDSEDNEFGSI----SYSNLTAFRYLVHANGICAGY  129

Query  347  SLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyaKIGQSELQ  526
            SL  L     +M R S     P  W  F  DQL+ YL L A A +A+    A  G + + 
Sbjct  130  SL--LSAAIAAMPRSSSTM--PRVWTFFCLDQLLTYLVLAAGAVSAEVLYLAYNGDAAIT  185

Query  527  WMRICNMYG  553
            W   C+ YG
Sbjct  186  WSDACSSYG  194



>ref|XP_007154779.1| hypothetical protein PHAVU_003G147200g [Phaseolus vulgaris]
 gb|ESW26773.1| hypothetical protein PHAVU_003G147200g [Phaseolus vulgaris]
Length=180

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 63/116 (54%), Gaps = 7/116 (6%)
 Frame = +2

Query  215  IVGAVLIGTDSQVREIF-SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVR---CSVSM  382
            ++ A L+  D+Q + +   I+KKA + D+ AL   V     AA Y+L+QL +   CS   
Sbjct  21   VLSACLVAFDTQTKVVLLGIQKKATYNDLHALKISVYVTSAAAGYNLLQLCKHSTCSRGN  80

Query  383  IRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyaKIGQSELQWMRICNMY  550
             +GS +    +AW     DQ+  Y++LG   A+  +++ A  G   LQWM++C+ +
Sbjct  81   FKGSYM---CMAWISLFLDQIAVYITLGTNTASVAASMMAVTGSEALQWMKVCDKF  133



>ref|XP_009139582.1| PREDICTED: CASP-like protein ARALYDRAFT_657503 [Brassica rapa]
 emb|CDX89392.1| BnaA01g15010D [Brassica napus]
Length=175

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 46/136 (34%), Positives = 70/136 (51%), Gaps = 18/136 (13%)
 Frame = +2

Query  164  RVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAA  343
            R+R +E+I R  I  L I+ +VLIG DSQ ++I  I KK  F  + AL   +  N + AA
Sbjct  3    RLRESEVILRLCIVFLLILTSVLIGFDSQTKDIAYIHKKVTFRYLFALEIELYINVVVAA  62

Query  344  YSLVQL------VRCSVSMIRG-SVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavya  502
            Y++ QL      V    S  +  S L ++   + +F+G           V+AAAQ ++  
Sbjct  63   YNIAQLGFGWYGVAQKTSNSKWLSYLLDQTAVYVVFAG-----------VSAAAQHSLLV  111

Query  503  KIGQSELQWMRICNMY  550
              G  ELQWM+ C+ +
Sbjct  112  VTGSRELQWMKWCSKF  127



>ref|XP_009380719.1| PREDICTED: CASP-like protein Os04g0281900 [Musa acuminata subsp. 
malaccensis]
Length=285

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 44/144 (31%), Positives = 71/144 (49%), Gaps = 11/144 (8%)
 Frame = +2

Query  125  PVYHGSNLKVVD--KRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDM  298
            P   G +   VD  +  R AE + R    GL +    ++  +SQ  E  ++     + D+
Sbjct  96   PAAVGEDAMAVDSAEEGRTAEALLRVAPVGLCLAAMAIMLRNSQENEFGAV----SYADL  151

Query  299  KALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaa  478
             A  +LV ANG+ AAYSL+      V+M R S L     AW++F  DQ++ Y+ L A   
Sbjct  152  TAFKYLVFANGVCAAYSLLSAF--CVAMRRPSTLSR---AWSVFLLDQVLTYVILAAGTV  206

Query  479  aaqsavyaKIGQSELQWMRICNMY  550
            AA+    A +G  ++ W + C+ +
Sbjct  207  AAEIVYLAYMGAEKVTWSKECSAF  230



>ref|XP_006366193.1| PREDICTED: CASP-like protein VIT_11s0052g01140-like [Solanum 
tuberosum]
Length=200

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 65/110 (59%), Gaps = 3/110 (3%)
 Frame = +2

Query  230  LIGTDSQVREIF-SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCS-VSMIRGSV-L  400
            L+G DSQ + +F ++  KA +  + AL  LV  +  AA+Y+++QL+R   ++  +G +  
Sbjct  24   LVGFDSQTKVVFLTVHIKANYKYLDALSVLVWIDAAAASYNVLQLLRSFFITTSKGDIKQ  83

Query  401  FNKPLAWAIFSGDQLMaylslgavaaaaqsavyaKIGQSELQWMRICNMY  550
            F+    W  F  DQ + Y+   A +AA +++V A IG   LQWM+ICN +
Sbjct  84   FSHKNYWFFFLLDQAVVYIVFAANSAAIEASVIALIGIKSLQWMKICNRF  133



>ref|XP_010540119.1| PREDICTED: CASP-like protein 2A1 [Tarenaya hassleriana]
Length=198

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 44/139 (32%), Positives = 65/139 (47%), Gaps = 8/139 (6%)
 Frame = +2

Query  137  GSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFL  316
            G   + V   +R  E + R     L +   V++  DSQ  +  S+     ++++ A  +L
Sbjct  14   GGAAEEVSAGIRTTETMLRLAPVALCVAALVVMLKDSQTNDFGSV----SYSNIFAFRYL  69

Query  317  VIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsav  496
            V ANG+ A YSL  L     +M R S     P AW  F  DQL+ YL L A A +++   
Sbjct  70   VHANGICAGYSL--LSAAISAMPRSSSTL--PRAWTFFCLDQLLTYLVLAAGAVSSEVLY  125

Query  497  yaKIGQSELQWMRICNMYG  553
             A  G S + W   C+ YG
Sbjct  126  LAYKGDSAITWSEACSSYG  144



>ref|XP_010476864.1| PREDICTED: CASP-like protein 2A1 [Camelina sativa]
Length=204

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 63/129 (49%), Gaps = 8/129 (6%)
 Frame = +2

Query  167  VRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAY  346
            +R AE + R    GL +   V++  DS+  E  SI     ++++ A  +LV ANG+ A Y
Sbjct  30   MRTAETMLRLAPVGLCVAALVVMLKDSEDNEFGSI----SYSNLAAFRYLVHANGICAGY  85

Query  347  SLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyaKIGQSELQ  526
            SL  L     +M R S     P  W  F  DQL+ YL L A A +A+    A  G + + 
Sbjct  86   SL--LSAAIAAMPRSSS--TMPRVWTFFCLDQLLTYLVLAAGAVSAEVLYLAYNGDAAIT  141

Query  527  WMRICNMYG  553
            W   C+ YG
Sbjct  142  WSDACSSYG  150



>ref|XP_003610149.1| hypothetical protein MTR_4g128520 [Medicago truncatula]
 gb|KEH15650.1| CASP POPTRDRAFT-like protein [Medicago truncatula]
Length=184

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/137 (28%), Positives = 69/137 (50%), Gaps = 5/137 (4%)
 Frame = +2

Query  155  VDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVRE-IFSIRKKAKFTDMKALVFLVIANG  331
            ++ R+   E++ R       +  A ++  D++ +  I  I+KKA + D+ AL  L+    
Sbjct  1    MEFRMAKGEVLLRVSAILFLVSTACIVAFDTETKVVILMIKKKATYKDLDALKILLYVTS  60

Query  332  LAAAYSLVQLVRCSVSMIRGSVLFNKP----LAWAIFSGDQLMaylslgavaaaaqsavy  499
             AA Y+++QL + S S       FN      +AW  F  DQ++ YL+     +A ++ ++
Sbjct  61   AAAGYNMLQLCKHSFSACSTIRNFNDSYYMHMAWISFLLDQIVVYLTFATNTSAFEACLF  120

Query  500  aKIGQSELQWMRICNMY  550
            A  G    QWM++CN +
Sbjct  121  ALTGSEAFQWMKVCNKF  137



>gb|KHG06274.1| CASP-like protein F16 [Gossypium arboreum]
Length=207

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 41/133 (31%), Positives = 66/133 (50%), Gaps = 9/133 (7%)
 Frame = +2

Query  155  VDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGL  334
            V+  +R AE + R V   L +   V++  +SQ  +  S+     ++D+ A  +LV ANG+
Sbjct  31   VNTGMRTAETMLRLVPMALGVAALVVMLKNSQSNDFGSV----SYSDLGAFRYLVHANGI  86

Query  335  AAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyaKIGQ  514
             A YSL+  +  +V   R S +   P AW  F  DQ++ Y+ LGA A + +    A  G 
Sbjct  87   CAGYSLLSAIIAAVP--RPSTM---PRAWTFFLLDQILTYIILGAAAVSTEVLYLANKGD  141

Query  515  SELQWMRICNMYG  553
            S + W   C  + 
Sbjct  142  SAITWSAACGTFA  154



>gb|KJB12800.1| hypothetical protein B456_002G037500 [Gossypium raimondii]
Length=221

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 41/133 (31%), Positives = 66/133 (50%), Gaps = 9/133 (7%)
 Frame = +2

Query  155  VDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGL  334
            V+  +R AE + R V   L +   V++  +SQ  +  S+     ++D+ A  +LV ANG+
Sbjct  31   VNTSMRTAETMLRLVPMALGVAALVVMLKNSQSNDFGSV----SYSDLGAFRYLVHANGI  86

Query  335  AAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyaKIGQ  514
             A YSL+  +  +V   R S +   P AW  F  DQ++ Y+ LGA A + +    A  G 
Sbjct  87   CAGYSLLSAIIAAVP--RPSTM---PRAWTFFLLDQILTYIILGAAAVSTEVLYLANKGD  141

Query  515  SELQWMRICNMYG  553
            S + W   C  + 
Sbjct  142  SAITWSAACGTFA  154



>ref|XP_006360011.1| PREDICTED: CASP-like protein VIT_01s0010g01870-like isoform X1 
[Solanum tuberosum]
Length=189

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 66/128 (52%), Gaps = 9/128 (7%)
 Frame = +2

Query  170  RLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAYS  349
             + E++ R     L +V  V++  DSQ  +  S+     ++D+    +LV ANG+ AAYS
Sbjct  18   NIGEIMLRLFPMALCVVALVIMLKDSQTNDYGSL----SYSDLGIFRYLVHANGICAAYS  73

Query  350  LVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyaKIGQSELQW  529
            L+  +  ++   R + L   P AW IF  DQ++ Y+ L A AA+ +    A  G +++ W
Sbjct  74   LLSAIVAALP--RPTTL---PRAWTIFLLDQILTYIILAAGAASTEVIYLAYKGDTDVTW  128

Query  530  MRICNMYG  553
               C  +G
Sbjct  129  SETCGSFG  136



>ref|XP_006289591.1| hypothetical protein CARUB_v10003142mg [Capsella rubella]
 gb|EOA22489.1| hypothetical protein CARUB_v10003142mg [Capsella rubella]
Length=187

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/136 (26%), Positives = 67/136 (49%), Gaps = 5/136 (4%)
 Frame = +2

Query  152  VVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFS--IRKKAKFTDMKALVFLVIA  325
            ++ +R+ + E I R V C   +  A+L+GT  +    F+  IR +A+++D+ AL F V+A
Sbjct  20   LMSRRIAILEFILRIVACFNTMGSAILMGTTHETLPFFTQFIRFQAEYSDLPALTFFVVA  79

Query  326  NGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyaK  505
            N + + Y ++ L    V +++     ++ L   +   D +M  L     ++AA     A 
Sbjct  80   NAVVSGYLILSLTLAFVHIVKSKTQNSRILLIVL---DVVMLGLLAAGASSAAAIVYLAH  136

Query  506  IGQSELQWMRICNMYG  553
             G ++  W  IC  + 
Sbjct  137  NGNNKTNWFAICQQFN  152



>ref|XP_011030770.1| PREDICTED: CASP-like protein 2A1 [Populus euphratica]
 ref|XP_011015697.1| PREDICTED: CASP-like protein 2A1 [Populus euphratica]
Length=201

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 63/133 (47%), Gaps = 9/133 (7%)
 Frame = +2

Query  155  VDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGL  334
            V+   R AE + R V   L +   V++  ++Q  +  S+     ++D+ A  +LV  NG+
Sbjct  24   VENTTRTAETMLRLVPMALCVSALVVMLKNTQTNDYGSL----SYSDLGAFRYLVHVNGI  79

Query  335  AAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyaKIGQ  514
             A YSL+  V   V+M R S +   P AW  F  DQ++ Y  L A   + +    A  G 
Sbjct  80   CAGYSLLSAVI--VAMPRASTM---PRAWTFFLLDQVLTYAILAAGTVSTEVLYLASKGD  134

Query  515  SELQWMRICNMYG  553
            + + W   C  +G
Sbjct  135  TAITWSEACVSFG  147



>emb|CDY21755.1| BnaA09g45060D [Brassica napus]
Length=201

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 65/133 (49%), Gaps = 8/133 (6%)
 Frame = +2

Query  155  VDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGL  334
            V   +R AE + R    GL +   V++  DSQ  E  S+     ++++ A  +LV ANG+
Sbjct  23   VSTAIRTAETMLRLAPVGLCLAALVIMLKDSQNNEFGSV----SYSNLSAFWYLVHANGI  78

Query  335  AAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyaKIGQ  514
             A YSL+     +++ + GS     P  W  F  DQ++ Y+ L A A + +    A  G 
Sbjct  79   CAGYSLLS---AAIAAMPGSSS-TMPRVWTFFCLDQVLTYVVLAAGAVSTEVLYLAYKGD  134

Query  515  SELQWMRICNMYG  553
            + + W   C+ +G
Sbjct  135  NAITWSDACSSFG  147



>emb|CAN64184.1| hypothetical protein VITISV_022648 [Vitis vinifera]
Length=484

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 65/124 (52%), Gaps = 4/124 (3%)
 Frame = +2

Query  176  AELIFRCVICGLAIVGAVLIGTDSQVREIFS-IRKKAKFTDMKALVFLVIANGLAAAYSL  352
            AE   R     + ++ A L+G D+Q + +FS I+K A F D+ AL  +V  + +AA Y+L
Sbjct  12   AEAFLRLFAILVLVLTACLLGFDTQTKLLFSTIKKTATFRDLGALQVVVYVDSVAAGYNL  71

Query  353  VQLVRCSVSMIRGSVLFNKP---LAWAIFSGDQLMaylslgavaaaaqsavyaKIGQSEL  523
            +QL R  +S      L N     L W  F  DQ   Y    A  AA Q+++ A  G+S L
Sbjct  72   LQLGRGFISAKLKGKLINVSYVTLPWVCFLLDQAAVYTVFSANTAALQASIIAVTGESSL  131

Query  524  QWMR  535
            QWM+
Sbjct  132  QWMK  135



>ref|XP_006282730.1| hypothetical protein CARUB_v10005865mg [Capsella rubella]
 gb|EOA15628.1| hypothetical protein CARUB_v10005865mg [Capsella rubella]
Length=176

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 45/133 (34%), Positives = 65/133 (49%), Gaps = 18/133 (14%)
 Frame = +2

Query  164  RVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAA  343
            ++R  E+I R  I  L ++ A L+G DSQ +EI  I KK  F  + AL   +  +   AA
Sbjct  4    KLRETEVILRLCIVFLLLLTACLVGLDSQTKEIAYIHKKVSFRYLIALEAELYIDVGVAA  63

Query  344  YSLVQL------VRCSVSMIRG-SVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavya  502
            Y+LVQL      V    S  +  S L ++  A+ +F+G             AAAQ ++  
Sbjct  64   YNLVQLGLHWHNVEQKTSNPKWFSYLLDQTAAYVVFAGT-----------TAAAQHSMLV  112

Query  503  KIGQSELQWMRIC  541
              G  ELQWM+ C
Sbjct  113  VTGSQELQWMKWC  125



>ref|XP_010666392.1| PREDICTED: CASP-like protein Ni6 [Beta vulgaris subsp. vulgaris]
Length=194

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 39/149 (26%), Positives = 67/149 (45%), Gaps = 6/149 (4%)
 Frame = +2

Query  116  GNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSI----RKKA  283
            G VP      +   D + R+ ++I R ++   +I   VL+ T  Q   I S        A
Sbjct  9    GAVPTPQAPPVAPTDNKYRVVDVILRVLLLAASIASVVLMVTSKQTEIIVSPLGSRPNAA  68

Query  284  KFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylsl  463
            KF +  A ++LV A  +A  YS++  +  S+S +   ++  K L W +   D L+  +  
Sbjct  69   KFQNSPAFIYLVAALSVAGLYSIITAL-VSLSYMMKPIVAPK-LFWILLIHDVLLLGIVA  126

Query  464  gavaaaaqsavyaKIGQSELQWMRICNMY  550
             A   A         G + ++W +ICN+Y
Sbjct  127  AATGTAGGVGYIGLKGNTHVRWGKICNVY  155



>gb|EAY84708.1| hypothetical protein OsI_06078 [Oryza sativa Indica Group]
Length=195

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 66/127 (52%), Gaps = 5/127 (4%)
 Frame = +2

Query  176  AELIFR--CVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAYS  349
            AE + R  CV+  +A   A+L+G  ++ + +  +RK A   D++AL  L +A   AA Y 
Sbjct  16   AERLLRGGCVV--MAATAALLLGFSAETKTVLFVRKTAVAKDVQALWVLTVAAAAAAGYH  73

Query  350  LVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyaKIGQSELQW  529
              QLVRC      G       +AW  F  D+  AY+   + AAA Q+ +   IG   LQW
Sbjct  74   FAQLVRCMYCSSSGDA-GAMAVAWTSFLLDKGCAYVVFASTAAALQACMVGLIGVEALQW  132

Query  530  MRICNMY  550
             ++CN+Y
Sbjct  133  SKLCNIY  139



>ref|NP_001046070.1| Os02g0177700 [Oryza sativa Japonica Group]
 sp|Q6ETN2.1|CSPLM_ORYSJ RecName: Full=CASP-like protein 2C2; Short=OsCASPL2C2 [Oryza 
sativa Japonica Group]
 dbj|BAD27988.1| integral membrane protein-like [Oryza sativa Japonica Group]
 dbj|BAF07984.1| Os02g0177700 [Oryza sativa Japonica Group]
 dbj|BAG99819.1| unnamed protein product [Oryza sativa Japonica Group]
Length=195

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 66/127 (52%), Gaps = 5/127 (4%)
 Frame = +2

Query  176  AELIFR--CVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAYS  349
            AE + R  CV+  +A   A+L+G  ++ + +  +RK A   D++AL  L +A   AA Y 
Sbjct  16   AERLLRGGCVV--MAATAALLLGFSAETKTVLFVRKTAVAKDVQALWVLTVAAAAAAGYQ  73

Query  350  LVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyaKIGQSELQW  529
              QLVRC      G       +AW  F  D+  AY+   + AAA Q+ +   IG   LQW
Sbjct  74   FAQLVRCMYCSSSGDA-GAMAVAWTSFLLDKGCAYVVFASTAAALQACMVGLIGVEALQW  132

Query  530  MRICNMY  550
             ++CN+Y
Sbjct  133  SKLCNIY  139



>sp|Q6YW53.1|CSPL9_ORYSJ RecName: Full=CASP-like protein 2D1; Short=OsCASPL2D1 [Oryza 
sativa Japonica Group]
 dbj|BAD17194.1| integral membrane family protein-like [Oryza sativa Japonica 
Group]
 dbj|BAD17607.1| integral membrane family protein-like [Oryza sativa Japonica 
Group]
 gb|EAZ22263.1| hypothetical protein OsJ_05918 [Oryza sativa Japonica Group]
 dbj|BAG96504.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87615.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93988.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96643.1| unnamed protein product [Oryza sativa Japonica Group]
Length=201

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 42/128 (33%), Positives = 63/128 (49%), Gaps = 10/128 (8%)
 Frame = +2

Query  170  RLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAYS  349
            RLAEL  R     LA+     + T+ QV E +    + +F+D+    +LV  N + AAYS
Sbjct  26   RLAELGLRVCAVPLAVASVWEMATNKQVDETYG---EVRFSDLSGFRYLVWINAITAAYS  82

Query  350  LVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyaKIGQSELQW  529
            +        S++  S  F     W IF  DQ  AYL L + +AAA+    A+ G  E+ W
Sbjct  83   V-------ASILLSSCRFITRFDWLIFLLDQASAYLLLTSASAAAEVVYLAREGDREVSW  135

Query  530  MRICNMYG  553
              +C+ +G
Sbjct  136  GEVCSYFG  143



>sp|A2X2I0.1|CSPL9_ORYSI RecName: Full=CASP-like protein 2D1; Short=OsCASPL2D1 [Oryza 
sativa Indica Group]
 gb|EAY85040.1| hypothetical protein OsI_06397 [Oryza sativa Indica Group]
Length=201

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 42/128 (33%), Positives = 63/128 (49%), Gaps = 10/128 (8%)
 Frame = +2

Query  170  RLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAYS  349
            RLAEL  R     LA+     + T+ QV E +    + +F+D+    +LV  N + AAYS
Sbjct  26   RLAELGLRVCAVPLAVASVWEMATNKQVDETYG---EVRFSDLSGFRYLVWINAITAAYS  82

Query  350  LVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyaKIGQSELQW  529
            +        S++  S  F     W IF  DQ  AYL L + +AAA+    A+ G  E+ W
Sbjct  83   V-------ASILLSSCRFITRFDWLIFILDQASAYLLLTSASAAAEVVYLAREGDREVSW  135

Query  530  MRICNMYG  553
              +C+ +G
Sbjct  136  GEVCSYFG  143



>emb|CDY26265.1| BnaA06g11520D [Brassica napus]
Length=204

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 38/133 (29%), Positives = 63/133 (47%), Gaps = 8/133 (6%)
 Frame = +2

Query  155  VDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGL  334
            V   +R AE + R    GL +   V++  DSQ  E      +  ++++ A  +LV ANG+
Sbjct  26   VSTGIRTAETMLRLAPVGLCVAALVIMLKDSQTNE----YGEVSYSNLTAFRYLVHANGI  81

Query  335  AAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyaKIGQ  514
             A YSL+     +++ + GS     P  W  F  DQ++ Y+ L A A + +    A  G 
Sbjct  82   CAGYSLLS---AAIAAMPGSSS-TMPRVWTFFCLDQILTYVVLAAGAVSTEVLYLAYKGD  137

Query  515  SELQWMRICNMYG  553
              + W   C+ +G
Sbjct  138  DAITWSDACSSFG  150



>sp|Q8W4Z5.1|CSPL1_GOSHI RecName: Full=CASP-like protein F16; AltName: Full=CASP-like 
protein 2A1; Short=GhCASPL2A1 [Gossypium hirsutum]
 emb|CAC84114.1| hypothetical protein [Gossypium hirsutum]
Length=207

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 63/133 (47%), Gaps = 9/133 (7%)
 Frame = +2

Query  155  VDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGL  334
            V+  +R AE + R V   L +   V++  +SQ  +  S+     ++D+ A  +LV ANG+
Sbjct  31   VNTSMRTAETMLRLVPMALGVAALVVMLKNSQSNDFGSV----SYSDLGAFRYLVHANGI  86

Query  335  AAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyaKIGQ  514
             A YSL+  +  +V           P AW  F  DQ++ Y+ LGA A + +    A  G 
Sbjct  87   CAGYSLLSAIIAAVPSPS-----TMPRAWTFFLLDQILTYVILGAAAVSTEVLYLANKGD  141

Query  515  SELQWMRICNMYG  553
            S + W   C  + 
Sbjct  142  SAITWSAACGTFA  154



>ref|XP_010531897.1| PREDICTED: CASP-like protein 2A1 [Tarenaya hassleriana]
Length=199

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 42/139 (30%), Positives = 69/139 (50%), Gaps = 8/139 (6%)
 Frame = +2

Query  137  GSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFL  316
            G+  + +   +R AE + R     L +   V++  DS+  +  S+     ++++ A  +L
Sbjct  12   GAAEEEMSAGIRTAETMLRLAPVALCVAALVVMLKDSESSDFGSV----SYSNLIAFRYL  67

Query  317  VIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsav  496
            V ANG+ A YSL  L     +M R S  F  P AW  F  DQ++ Y+ LGA A +++   
Sbjct  68   VHANGICAGYSL--LSAAITAMSRSSSTF--PRAWTFFCLDQVLTYMVLGAGAVSSEVIY  123

Query  497  yaKIGQSELQWMRICNMYG  553
             A  G S + W   C+ +G
Sbjct  124  IAYRGDSAITWSEACSSFG  142



>ref|XP_009149166.1| PREDICTED: CASP-like protein At1g17200 isoform X1 [Brassica rapa]
Length=204

 Score = 48.5 bits (114),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 38/133 (29%), Positives = 63/133 (47%), Gaps = 8/133 (6%)
 Frame = +2

Query  155  VDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGL  334
            V   +R AE + R    GL +   V++  DSQ  E   +     ++++ A  +LV ANG+
Sbjct  26   VSTGIRTAETMLRLAPVGLCVAALVIMLKDSQTNEYGDV----SYSNLTAFRYLVHANGI  81

Query  335  AAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyaKIGQ  514
             A YSL+     +++ + GS     P  W  F  DQ++ Y+ L A A + +    A  G 
Sbjct  82   CAGYSLLS---AAIAAMPGSSS-TMPRVWTFFCLDQILTYVVLAAGAVSTEVLYLAYKGD  137

Query  515  SELQWMRICNMYG  553
              + W   C+ +G
Sbjct  138  DAITWSDACSSFG  150



>ref|XP_004975109.1| PREDICTED: CASP-like protein 6-like [Setaria italica]
Length=209

 Score = 48.5 bits (114),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 63/130 (48%), Gaps = 9/130 (7%)
 Frame = +2

Query  164  RVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAA  343
            RVR  E + R    GL +    ++  D Q  E  ++     ++D+    +LV ANGL AA
Sbjct  34   RVRPVETLLRAAPLGLCVAAMAIMLKDQQTNEYGTV----AYSDLGGFKYLVYANGLCAA  89

Query  344  YSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyaKIGQSEL  523
            YSLV     +V   R + +     +W +F  DQ+  YL L A AAAA+    A  G  E+
Sbjct  90   YSLVTAFYTAVP--RPATVSR---SWVVFLLDQVFTYLILAAGAAAAELLYLAYNGDKEV  144

Query  524  QWMRICNMYG  553
             W   C ++G
Sbjct  145  TWSEACGVFG  154



>gb|KCW69847.1| hypothetical protein EUGRSUZ_F03189 [Eucalyptus grandis]
Length=221

 Score = 48.5 bits (114),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 33/104 (32%), Positives = 53/104 (51%), Gaps = 9/104 (9%)
 Frame = +2

Query  134  HGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVF  313
            HG      ++RVR AE++ R V  GL +   V++  +S+  +  S+     ++D+ A  +
Sbjct  34   HGGENGGENERVRTAEMLMRVVPMGLCVAALVMMLRNSESNDYGSL----SYSDLGAFRY  89

Query  314  LVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  445
            LV ANG+ A YSL+  +   V+M R   +     AW  F  DQ 
Sbjct  90   LVHANGICAGYSLLSAI--IVAMPRPPTISR---AWTFFLLDQF  128



>ref|XP_002300480.2| hypothetical protein POPTR_0001s42730g [Populus trichocarpa]
 sp|B9GHX8.2|CSPL8_POPTR RecName: Full=CASP-like protein 2A2; Short=PtCASPL2A2 [Populus 
trichocarpa]
 gb|EEE85285.2| hypothetical protein POPTR_0001s42730g [Populus trichocarpa]
Length=230

 Score = 48.5 bits (114),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 64/133 (48%), Gaps = 9/133 (7%)
 Frame = +2

Query  155  VDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGL  334
            V   +R AE + R V   L +   V++  ++Q  +  S+     ++D+ A  +LV ANG+
Sbjct  23   VKSTMRTAETMLRLVPVALCVSALVVMLKNTQTNDYGSL----SYSDLGAFRYLVNANGI  78

Query  335  AAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyaKIGQ  514
             A YSL+  V   V+M R    +  P AW  F  DQ++ Y+ L A   + +    A  G 
Sbjct  79   CAGYSLLSAVI--VAMPRA---WTMPQAWTFFLLDQVLTYVILAAGTVSTEVLYLANKGD  133

Query  515  SELQWMRICNMYG  553
            + + W   C  +G
Sbjct  134  TSIAWSAACASFG  146



>ref|XP_004147759.1| PREDICTED: CASP-like protein F16-like [Cucumis sativus]
 gb|KGN53525.1| UPF0497 membrane protein f16 [Cucumis sativus]
Length=200

 Score = 48.1 bits (113),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 64/129 (50%), Gaps = 9/129 (7%)
 Frame = +2

Query  167  VRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAY  346
            +R A+ + R V  GL I   +++  +S+  +  S+     ++D+ A  FLV ANG+ A Y
Sbjct  26   MRAADTLLRLVPMGLCIAALIVMLKNSEANDYGSV----AYSDLGAFKFLVHANGICAGY  81

Query  347  SLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyaKIGQSELQ  526
            S +     +V+ +      +K  AW +F  DQL+ YL+L A   + +    A  G  E+ 
Sbjct  82   SFLS---AAVAAMSPPSTLSK--AWTLFFLDQLLTYLTLAAGTVSTEVLYLAYNGDKEIT  136

Query  527  WMRICNMYG  553
            W   C  +G
Sbjct  137  WSAACGTFG  145



>sp|P0DI24.1|CSPL3_PTEAA RecName: Full=CASP-like protein 2U1; Short=PaCASPL2U1 [Pteridium 
aquilinum subsp. aquilinum]
Length=196

 Score = 48.1 bits (113),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 75/136 (55%), Gaps = 7/136 (5%)
 Frame = +2

Query  161  KRVRLAELIFRCVICGLAIVGAVLIGTDSQ--VRE--IFSIRKKAKFTDMKALVFLVIAN  328
            +R  + EL+ RC    + ++  +L+  D Q  V+E  + S+  + +++    LV+LV AN
Sbjct  8    RRRNVGELVLRCAATLVCMLSLMLLVRDQQIAVQEVGVTSVTTQLRYSSSTGLVYLVYAN  67

Query  329  GLAAAYSLVQLVRCSVSMIRGSVL-FNKPLAWAIFSGDQLMaylslgavaaaaqsavyaK  505
            GL A Y  V ++  S +   GSV+  NK  AWA+F  DQ++A + L A +AA++ A   +
Sbjct  68   GLVALYCFVVVLTSSFN--GGSVMRRNKSGAWALFVLDQVLACILLSAASAASEIAFLVE  125

Query  506  IGQSELQWMRICNMYG  553
             G  +  W   C +YG
Sbjct  126  KGAKKTIWDSKCIVYG  141



>emb|CDX83921.1| BnaC08g17240D [Brassica napus]
Length=197

 Score = 48.1 bits (113),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 62/129 (48%), Gaps = 8/129 (6%)
 Frame = +2

Query  167  VRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAY  346
            +R AE + R    GL +   V++  DSQ  E  SI     ++++ A  +LV ANG+ A Y
Sbjct  23   IRTAETMLRLAPVGLCLAALVIMLKDSQDNEFGSI----SYSNLSAFRYLVHANGICAGY  78

Query  347  SLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyaKIGQSELQ  526
            SL+     ++S +  S     P  W  F  DQ++ Y+ L A A + +    A  G   + 
Sbjct  79   SLLS---AAISAMPDSSS-TMPRVWTFFCLDQILTYVVLAAGAVSTEVLYLAYKGDDAIT  134

Query  527  WMRICNMYG  553
            W   C+ +G
Sbjct  135  WSDACSSFG  143



>emb|CDO98909.1| unnamed protein product [Coffea canephora]
Length=196

 Score = 48.1 bits (113),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 40/150 (27%), Positives = 74/150 (49%), Gaps = 16/150 (11%)
 Frame = +2

Query  137  GSNLKVVDKR-VRLAELIFRCVICGLAIVGAVLIGTDSQVREI----------FSIRKKA  283
            G  ++V +K  +R +++I R +     +V A+++G D Q + +           ++   A
Sbjct  16   GKEVEVANKSSLRGSDVILRFLAFASTLVAAIVLGVDKQTKLVSMTVVSTLPPITVPVTA  75

Query  284  KFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylsl  463
            K+  M A V+ V+AN +A AY+ + L+     ++ G+    K LA  I + D +M  L  
Sbjct  76   KWHYMSAFVYFVVANVVACAYAALSLL-----LVLGNRGAKKGLALMIITLDLVMVALLS  130

Query  464  gavaaaaqsavyaKIGQSELQWMRICNMYG  553
                AA    +    G S +QW ++CN++G
Sbjct  131  SGGGAALAVGLIGYRGNSHVQWNKVCNVFG  160



>ref|XP_006416730.1| hypothetical protein EUTSA_v10008792mg [Eutrema salsugineum]
 gb|ESQ35083.1| hypothetical protein EUTSA_v10008792mg [Eutrema salsugineum]
Length=205

 Score = 48.1 bits (113),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 38/133 (29%), Positives = 61/133 (46%), Gaps = 7/133 (5%)
 Frame = +2

Query  155  VDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGL  334
            V   +R AE + R    GL +   V++  DSQ  E  SI     ++++ A  +LV ANG+
Sbjct  26   VSPGIRTAETMLRLAPVGLCVAALVVMLKDSQTNEFGSI----SYSNLSAFRYLVHANGI  81

Query  335  AAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyaKIGQ  514
             A YSL+     ++     S +      W  F  DQ++ Y+ L A A + +    A  G 
Sbjct  82   CAGYSLLSAAIAAMPAGSSSTMTR---VWTFFCLDQILTYVVLAAGAVSTEVLYLAYKGD  138

Query  515  SELQWMRICNMYG  553
              + W   C+ +G
Sbjct  139  DSITWSDACSSFG  151



>ref|XP_009790738.1| PREDICTED: CASP-like protein 2A1 [Nicotiana sylvestris]
Length=202

 Score = 48.1 bits (113),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 42/150 (28%), Positives = 75/150 (50%), Gaps = 14/150 (9%)
 Frame = +2

Query  116  GNVPVYHGSNLKVVDKR----VRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKA  283
            G+ P+  GS  +  D+     +R AE + R +  GL +V  V++  +SQ  +  S+    
Sbjct  10   GSTPLQKGSQ-EFEDENGSSSMRTAETVLRLLPMGLCVVALVIMLKNSQTNDFGSL----  64

Query  284  KFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylsl  463
             ++D+    +LV ANG+ A YSL+  +   V+ +   +  ++  AW  F  DQ++ Y+ L
Sbjct  65   SYSDLGTFRYLVHANGICAGYSLLSAI---VAAVPRPITMSR--AWTFFLLDQILTYIIL  119

Query  464  gavaaaaqsavyaKIGQSELQWMRICNMYG  553
             A AA+ +    A  G + + W   C  +G
Sbjct  120  AAGAASTEVVYLAYKGDTAVTWSESCGSFG  149



>ref|NP_001174676.1| Os06g0231050 [Oryza sativa Japonica Group]
 sp|Q67X40.1|CASP3_ORYSJ RecName: Full=Casparian strip membrane protein 3; Short=OsCASP3 
[Oryza sativa Japonica Group]
 sp|A2YAZ1.1|CASP3_ORYSI RecName: Full=Casparian strip membrane protein 3; Short=OsCASP3 
[Oryza sativa Indica Group]
 dbj|BAD37279.1| integral membrane family protein-like [Oryza sativa Japonica 
Group]
 gb|EAZ00252.1| hypothetical protein OsI_22263 [Oryza sativa Indica Group]
 gb|EAZ36366.1| hypothetical protein OsJ_20694 [Oryza sativa Japonica Group]
 dbj|BAH93404.1| Os06g0231050 [Oryza sativa Japonica Group]
Length=184

 Score = 47.8 bits (112),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 43/146 (29%), Positives = 68/146 (47%), Gaps = 10/146 (7%)
 Frame = +2

Query  134  HGSNLKV-----VDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFS--IRKKAKFT  292
            HG   K      V K V + ++I R V     +  A+ +GT +Q    F+  IR KA+++
Sbjct  7    HGETSKAPLSRGVSKGVSILDVILRFVAIIGTLASAIAMGTTNQTLPFFTQFIRFKAQYS  66

Query  293  DMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgav  472
            D+  L F V+AN + +AY ++ L    V +IR    +++ L    F  D  M  L     
Sbjct  67   DLPTLTFFVVANSIVSAYLILSLPLSIVHVIRSRAKYSR-LILIFF--DAAMLALVTAGA  123

Query  473  aaaaqsavyaKIGQSELQWMRICNMY  550
            +AAA     A  G +   W+ IC  +
Sbjct  124  SAAAAIVYLAHKGNARANWLAICQQF  149



>ref|XP_009602689.1| PREDICTED: CASP-like protein 2A1 [Nicotiana tomentosiformis]
Length=202

 Score = 48.1 bits (113),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 42/150 (28%), Positives = 75/150 (50%), Gaps = 14/150 (9%)
 Frame = +2

Query  116  GNVPVYHGSNLKVVDKR----VRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKA  283
            G+ P+  GS  +  D+     +R AE + R +  GL +V  V++  +SQ  +  S+    
Sbjct  10   GSTPLQKGSG-EFEDENGSSSMRTAETVLRLLPMGLCVVALVIMLKNSQTNDFGSL----  64

Query  284  KFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylsl  463
             ++D+    +LV ANG+ A YSL+  +   V+ +   +  ++  AW  F  DQ++ Y+ L
Sbjct  65   SYSDLGTFRYLVHANGICAGYSLLSAI---VAAVPRPITMSR--AWTFFLLDQILTYIIL  119

Query  464  gavaaaaqsavyaKIGQSELQWMRICNMYG  553
             A AA+ +    A  G + + W   C  +G
Sbjct  120  AAGAASTEVVYLAYKGDTAVTWSESCGSFG  149



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 603802497760