BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002D20

Length=558
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004510647.1|  PREDICTED: ORM1-like protein 3-like                270   3e-89   Cicer arietinum [garbanzo]
ref|XP_004133804.1|  PREDICTED: uncharacterized protein C119.09c-...    269   7e-89   Cucumis sativus [cucumbers]
ref|XP_011070364.1|  PREDICTED: ORM1-like protein 2                     268   2e-88   Sesamum indicum [beniseed]
ref|XP_008437865.1|  PREDICTED: ORM1-like protein 3                     268   3e-88   Cucumis melo [Oriental melon]
ref|XP_009766034.1|  PREDICTED: ORM1-like protein 2                     266   8e-88   Nicotiana sylvestris
gb|AFK37242.1|  unknown                                                 266   1e-87   Medicago truncatula
ref|XP_009796481.1|  PREDICTED: ORM1-like protein 2                     265   2e-87   Nicotiana sylvestris
gb|KHG28711.1|  ORM1-like protein 1                                     265   3e-87   Gossypium arboreum [tree cotton]
gb|KJB49589.1|  hypothetical protein B456_008G126900                    265   3e-87   Gossypium raimondii
ref|XP_009588445.1|  PREDICTED: uncharacterized protein C119.09c-...    265   3e-87   Nicotiana tomentosiformis
ref|XP_006491313.1|  PREDICTED: uncharacterized protein C119.09c-...    265   3e-87   Citrus sinensis [apfelsine]
ref|XP_007051495.1|  ORMDL family protein                               265   6e-87   
ref|XP_007135277.1|  hypothetical protein PHAVU_010G115700g             264   1e-86   Phaseolus vulgaris [French bean]
ref|XP_002266406.1|  PREDICTED: ORM1-like protein 2                     263   1e-86   Vitis vinifera
ref|XP_010544953.1|  PREDICTED: ORM1-like protein 3                     263   2e-86   Tarenaya hassleriana [spider flower]
ref|XP_010694659.1|  PREDICTED: ORM1-like protein 3                     263   3e-86   Beta vulgaris subsp. vulgaris [field beet]
emb|CDP12207.1|  unnamed protein product                                262   3e-86   Coffea canephora [robusta coffee]
ref|XP_011101008.1|  PREDICTED: ORM1-like protein 3                     262   5e-86   Sesamum indicum [beniseed]
ref|XP_006391597.1|  hypothetical protein EUTSA_v10023737mg             262   6e-86   Eutrema salsugineum [saltwater cress]
ref|XP_009617119.1|  PREDICTED: ORM1-like protein 3                     262   6e-86   Nicotiana tomentosiformis
ref|XP_010267515.1|  PREDICTED: ORM1-like protein 3                     262   7e-86   Nelumbo nucifera [Indian lotus]
ref|XP_002302648.1|  ORMDL family protein                               261   7e-86   Populus trichocarpa [western balsam poplar]
ref|XP_011023143.1|  PREDICTED: ORM1-like protein 3                     261   8e-86   Populus euphratica
ref|XP_010314513.1|  PREDICTED: uncharacterized protein C119.09c-...    261   9e-86   Solanum lycopersicum
ref|NP_001239812.1|  uncharacterized protein LOC100813346               261   1e-85   Glycine max [soybeans]
gb|KJB09620.1|  hypothetical protein B456_001G153200                    261   1e-85   Gossypium raimondii
ref|XP_003528781.1|  PREDICTED: uncharacterized protein C119.09c-...    261   1e-85   Glycine max [soybeans]
gb|KHF97455.1|  ORM1-like protein 1                                     261   1e-85   Gossypium arboreum [tree cotton]
ref|XP_010100706.1|  Uncharacterized protein L484_023475                261   2e-85   Morus notabilis
ref|XP_004245473.1|  PREDICTED: ORM1-like protein 3                     260   3e-85   Solanum lycopersicum
gb|EYU45251.1|  hypothetical protein MIMGU_mgv1a015446mg                260   3e-85   Erythranthe guttata [common monkey flower]
ref|XP_006360724.1|  PREDICTED: uncharacterized protein C119.09c-...    260   3e-85   Solanum tuberosum [potatoes]
ref|XP_002523307.1|  ormdl, putative                                    259   4e-85   Ricinus communis
ref|XP_009607387.1|  PREDICTED: ORM1-like protein 3                     259   4e-85   Nicotiana tomentosiformis
ref|XP_011038573.1|  PREDICTED: ORM1-like protein 3                     259   7e-85   Populus euphratica
ref|XP_010054988.1|  PREDICTED: ORM1-like protein 3                     259   8e-85   Eucalyptus grandis [rose gum]
ref|XP_009334366.1|  PREDICTED: ORM1-like protein 2                     259   8e-85   Pyrus x bretschneideri [bai li]
gb|AFK39095.1|  unknown                                                 259   9e-85   Lotus japonicus
ref|XP_009760285.1|  PREDICTED: ORM1-like protein 3                     258   1e-84   Nicotiana sylvestris
gb|KDP28459.1|  hypothetical protein JCGZ_14230                         258   1e-84   Jatropha curcas
gb|KFK32957.1|  hypothetical protein AALP_AA6G311700                    258   2e-84   Arabis alpina [alpine rockcress]
emb|CDY65660.1|  BnaAnng20920D                                          258   2e-84   Brassica napus [oilseed rape]
ref|XP_004306644.1|  PREDICTED: ORM1-like protein 2                     258   2e-84   Fragaria vesca subsp. vesca
gb|AFK48443.1|  unknown                                                 258   2e-84   Lotus japonicus
ref|XP_002320877.1|  ORMDL family protein                               258   2e-84   Populus trichocarpa [western balsam poplar]
ref|XP_006405287.1|  hypothetical protein EUTSA_v10027975mg             257   3e-84   Eutrema salsugineum [saltwater cress]
ref|XP_010106134.1|  Uncharacterized protein L484_003637                257   5e-84   Morus notabilis
ref|XP_002870598.1|  ORMDL family protein                               257   5e-84   Arabidopsis lyrata subsp. lyrata
ref|XP_009125212.1|  PREDICTED: ORM1-like protein 3                     256   7e-84   Brassica rapa
emb|CDY13373.1|  BnaC06g13840D                                          256   7e-84   Brassica napus [oilseed rape]
ref|NP_199015.1|  ORMDL domain-containing protein                       256   8e-84   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009112851.1|  PREDICTED: uncharacterized protein C119.09c-...    256   9e-84   Brassica rapa
emb|CDY61368.1|  BnaA09g53130D                                          256   9e-84   Brassica napus [oilseed rape]
ref|XP_008376160.1|  PREDICTED: ORM1-like protein 2                     256   1e-83   Malus domestica [apple tree]
ref|XP_007218539.1|  hypothetical protein PRUPE_ppa012722mg             256   1e-83   Prunus persica
ref|XP_010055997.1|  PREDICTED: ORM1-like protein 3                     256   1e-83   Eucalyptus grandis [rose gum]
ref|XP_010522906.1|  PREDICTED: ORM1-like protein 2                     256   1e-83   Tarenaya hassleriana [spider flower]
ref|XP_002262624.1|  PREDICTED: ORM1-like protein 2                     256   2e-83   Vitis vinifera
ref|XP_007039444.1|  ORMDL family protein                               255   2e-83   Theobroma cacao [chocolate]
ref|XP_009375425.1|  PREDICTED: ORM1-like protein 2                     255   3e-83   Pyrus x bretschneideri [bai li]
ref|XP_010553574.1|  PREDICTED: ORM1-like protein 2 isoform X2          254   5e-83   Tarenaya hassleriana [spider flower]
ref|XP_009400445.1|  PREDICTED: ORM1-like protein 3                     254   5e-83   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010933840.1|  PREDICTED: ORM1-like protein 3                     254   5e-83   Elaeis guineensis
gb|KHG27773.1|  ORM1-like protein 2                                     254   6e-83   Gossypium arboreum [tree cotton]
ref|XP_007135276.1|  hypothetical protein PHAVU_010G115700g             254   7e-83   Phaseolus vulgaris [French bean]
ref|XP_010252767.1|  PREDICTED: ORM1-like protein 3                     254   8e-83   Nelumbo nucifera [Indian lotus]
gb|KDP25241.1|  hypothetical protein JCGZ_20397                         254   8e-83   Jatropha curcas
gb|KHN15857.1|  Hypothetical protein glysoja_013073                     254   9e-83   Glycine soja [wild soybean]
ref|XP_011022440.1|  PREDICTED: ORM1-like protein 1                     253   1e-82   Populus euphratica
ref|XP_002304572.1|  ORMDL family protein                               253   2e-82   Populus trichocarpa [western balsam poplar]
ref|XP_008790519.1|  PREDICTED: ORM1-like protein 3                     253   2e-82   Phoenix dactylifera
ref|XP_004230001.1|  PREDICTED: ORM1-like protein 3                     253   2e-82   Solanum lycopersicum
ref|XP_011026819.1|  PREDICTED: ORM1-like protein 1                     253   2e-82   Populus euphratica
ref|XP_002297957.1|  ORMDL family protein                               253   2e-82   Populus trichocarpa [western balsam poplar]
ref|XP_010544436.1|  PREDICTED: ORM1-like protein 3 isoform X1          253   3e-82   Tarenaya hassleriana [spider flower]
ref|XP_003580344.1|  PREDICTED: ORM1-like protein 2                     252   6e-82   Brachypodium distachyon [annual false brome]
ref|XP_002446948.1|  hypothetical protein SORBIDRAFT_06g025660          251   8e-82   Sorghum bicolor [broomcorn]
ref|XP_004976521.1|  PREDICTED: ORM1-like protein 3-like                251   8e-82   Setaria italica
ref|XP_009418131.1|  PREDICTED: ORM1-like protein 3                     251   1e-81   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001238512.1|  uncharacterized protein LOC100527600               251   1e-81   Glycine max [soybeans]
ref|XP_011094077.1|  PREDICTED: ORM1-like protein 2                     251   1e-81   Sesamum indicum [beniseed]
ref|XP_006439266.1|  hypothetical protein CICLE_v10022658mg             251   1e-81   Citrus clementina [clementine]
gb|EPS68280.1|  hypothetical protein M569_06491                         251   2e-81   Genlisea aurea
ref|XP_006339732.1|  PREDICTED: uncharacterized protein C119.09c-...    250   3e-81   Solanum tuberosum [potatoes]
ref|XP_010934479.1|  PREDICTED: ORM1-like protein 3                     249   4e-81   Elaeis guineensis
ref|XP_008806928.1|  PREDICTED: ORM1-like protein 3                     249   4e-81   Phoenix dactylifera
ref|XP_009119680.1|  PREDICTED: ORM1-like protein 3                     249   8e-81   Brassica rapa
emb|CDY15191.1|  BnaC05g00700D                                          249   9e-81   Brassica napus [oilseed rape]
gb|EPS66391.1|  hypothetical protein M569_08393                         248   9e-81   Genlisea aurea
ref|NP_001148597.1|  ORM1-like protein 2                                248   2e-80   Zea mays [maize]
ref|XP_002892079.1|  ORMDL family protein                               248   2e-80   
ref|XP_008676888.1|  PREDICTED: hypothetical protein isoform X1         248   2e-80   Zea mays [maize]
ref|XP_006303379.1|  hypothetical protein CARUB_v10010529mg             248   2e-80   Capsella rubella
ref|XP_010553573.1|  PREDICTED: ORM1-like protein 2 isoform X1          247   5e-80   Tarenaya hassleriana [spider flower]
ref|NP_563622.1|  ORMDL family protein                                  247   5e-80   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004956119.1|  PREDICTED: ORM1-like protein 3-like isoform X1     247   6e-80   Setaria italica
ref|XP_008775080.1|  PREDICTED: ORM1-like protein 3                     246   6e-80   Phoenix dactylifera
gb|ACG38638.1|  ORMDL family protein                                    246   7e-80   Zea mays [maize]
ref|XP_010480516.1|  PREDICTED: ORM1-like protein 3 isoform X1          246   7e-80   Camelina sativa [gold-of-pleasure]
ref|XP_009358667.1|  PREDICTED: ORM1-like protein 1                     246   9e-80   Pyrus x bretschneideri [bai li]
ref|XP_004953426.1|  PREDICTED: ORM1-like protein 3-like                246   9e-80   Setaria italica
gb|KHG08344.1|  Uncharacterized protein F383_35910                      246   1e-79   Gossypium arboreum [tree cotton]
ref|XP_006665130.1|  PREDICTED: ORM1-like protein 3-like                246   1e-79   Oryza brachyantha
ref|XP_008374090.1|  PREDICTED: ORM1-like protein 1                     246   1e-79   
ref|XP_006418402.1|  hypothetical protein EUTSA_v10008983mg             246   1e-79   Eutrema salsugineum [saltwater cress]
ref|NP_001059551.1|  Os07g0452500                                       246   1e-79   
ref|XP_002461937.1|  hypothetical protein SORBIDRAFT_02g010850          245   2e-79   Sorghum bicolor [broomcorn]
gb|KJB24159.1|  hypothetical protein B456_004G130600                    245   3e-79   Gossypium raimondii
ref|XP_008390306.1|  PREDICTED: ORM1-like protein 3                     245   3e-79   
ref|XP_010474712.1|  PREDICTED: ORM1-like protein 3                     245   3e-79   Camelina sativa [gold-of-pleasure]
ref|NP_001148636.1|  LOC100282252                                       245   3e-79   
gb|EYU32271.1|  hypothetical protein MIMGU_mgv1a015441mg                244   3e-79   Erythranthe guttata [common monkey flower]
ref|XP_010940864.1|  PREDICTED: ORM1-like protein 3                     244   3e-79   Elaeis guineensis
ref|NP_001241770.1|  ORMDL family protein                               244   6e-79   
gb|KFK42508.1|  hypothetical protein AALP_AA1G002900                    244   9e-79   Arabis alpina [alpine rockcress]
ref|XP_007209727.1|  hypothetical protein PRUPE_ppa012781mg             243   9e-79   Prunus persica
ref|XP_004300483.1|  PREDICTED: uncharacterized protein C119.09c-...    243   1e-78   Fragaria vesca subsp. vesca
ref|XP_009418320.1|  PREDICTED: ORM1-like protein 3                     243   1e-78   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009415831.1|  PREDICTED: ORM1-like protein 3                     243   2e-78   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006846226.1|  hypothetical protein AMTR_s00012p00233130          243   2e-78   Amborella trichopoda
gb|KHG01337.1|  Uncharacterized protein F383_23307                      242   3e-78   Gossypium arboreum [tree cotton]
emb|CAH66850.1|  OSIGBa0103M18.2                                        242   4e-78   Oryza sativa [red rice]
gb|ABK26973.1|  unknown                                                 241   1e-77   Picea sitchensis
emb|CDP08650.1|  unnamed protein product                                240   1e-77   Coffea canephora [robusta coffee]
ref|XP_009383183.1|  PREDICTED: ORM1-like protein 3                     239   4e-77   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001053587.1|  Os04g0567700                                       239   4e-77   
ref|XP_010676855.1|  PREDICTED: uncharacterized protein C119.09c-...    239   5e-77   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006857840.1|  hypothetical protein AMTR_s00069p00050010          239   7e-77   Amborella trichopoda
ref|XP_003572809.1|  PREDICTED: ORM1-like protein 2                     239   7e-77   Brachypodium distachyon [annual false brome]
ref|XP_009420786.1|  PREDICTED: ORM1-like protein 2                     238   9e-77   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY37999.1|  BnaCnng08600D                                          238   1e-76   Brassica napus [oilseed rape]
ref|XP_006652652.1|  PREDICTED: ORM1-like protein 3-like                238   1e-76   Oryza brachyantha
ref|XP_009389450.1|  PREDICTED: LOW QUALITY PROTEIN: ORM1-like pr...    238   2e-76   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009118800.1|  PREDICTED: ORM1-like protein 2                     237   4e-76   Brassica rapa
gb|EEE67100.1|  hypothetical protein OsJ_24107                          237   5e-76   Oryza sativa Japonica Group [Japonica rice]
emb|CDX90018.1|  BnaA10g00640D                                          236   1e-75   
ref|XP_008782518.1|  PREDICTED: ORM1-like protein 2 isoform X3          235   2e-75   Phoenix dactylifera
ref|XP_008803045.1|  PREDICTED: ORM1-like protein 3                     234   3e-75   Phoenix dactylifera
dbj|BAK03210.1|  predicted protein                                      234   5e-75   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ97177.1|  predicted protein                                      233   2e-74   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010936907.1|  PREDICTED: ORM1-like protein 2                     231   9e-74   Elaeis guineensis
ref|XP_008782511.1|  PREDICTED: ORM1-like protein 2 isoform X2          230   2e-73   Phoenix dactylifera
gb|AAF97341.1|AC023628_22  Unknown protein                              231   2e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003563172.1|  PREDICTED: ORM1-like protein 3                     229   3e-73   Brachypodium distachyon [annual false brome]
ref|XP_008802460.1|  PREDICTED: ORM1-like protein 2                     228   1e-72   Phoenix dactylifera
ref|XP_006647676.1|  PREDICTED: uncharacterized protein C119.09c-...    228   1e-72   Oryza brachyantha
ref|NP_001047715.1|  Os02g0673600                                       228   1e-72   
ref|XP_002963972.1|  hypothetical protein SELMODRAFT_81257              226   5e-72   Selaginella moellendorffii
gb|EAY87043.1|  hypothetical protein OsI_08441                          226   6e-72   Oryza sativa Indica Group [Indian rice]
ref|XP_001770210.1|  predicted protein                                  221   9e-70   
gb|ABK93306.1|  unknown                                                 209   8e-66   Populus trichocarpa [western balsam poplar]
gb|ABK22066.1|  unknown                                                 191   1e-58   Picea sitchensis
ref|XP_006439267.1|  hypothetical protein CICLE_v10022658mg             187   2e-57   
gb|AAL69388.1|AF462225_1  unknown                                       186   4e-57   Narcissus pseudonarcissus
ref|XP_006444803.1|  hypothetical protein CICLE_v100226372mg            182   2e-55   
ref|XP_010533557.1|  PREDICTED: uncharacterized protein C119.09c-...    181   4e-55   Tarenaya hassleriana [spider flower]
ref|XP_010544437.1|  PREDICTED: uncharacterized protein C119.09c-...    183   5e-55   Tarenaya hassleriana [spider flower]
gb|KJB09621.1|  hypothetical protein B456_001G153200                    181   7e-55   Gossypium raimondii
gb|ACN33697.1|  unknown                                                 179   3e-54   Zea mays [maize]
ref|XP_008353054.1|  PREDICTED: uncharacterized protein C119.09c-...    178   9e-54   
gb|EMT22363.1|  hypothetical protein F775_43827                         177   3e-53   
ref|XP_010919291.1|  PREDICTED: uncharacterized protein C119.09c-...    176   4e-53   Elaeis guineensis
ref|NP_001142353.1|  hypothetical protein                               176   9e-53   Zea mays [maize]
ref|XP_010441380.1|  PREDICTED: uncharacterized protein C119.09c-...    173   1e-51   Camelina sativa [gold-of-pleasure]
ref|XP_010457152.1|  PREDICTED: uncharacterized protein C119.09c-...    173   1e-51   Camelina sativa [gold-of-pleasure]
ref|NP_001154758.1|  ORMDL domain-containing protein                    172   2e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006439265.1|  hypothetical protein CICLE_v10022658mg             171   7e-51   
gb|ACF87007.1|  unknown                                                 169   3e-50   Zea mays [maize]
gb|EMT26151.1|  hypothetical protein F775_18242                         166   7e-49   
tpg|DAA39688.1|  TPA: hypothetical protein ZEAMMB73_441359              155   1e-44   
ref|XP_008782503.1|  PREDICTED: ORM1-like protein 2 isoform X1          155   3e-44   
ref|XP_004340266.1|  hypothetical protein ACA1_369890                   139   1e-37   Acanthamoeba castellanii str. Neff
ref|XP_005851151.1|  hypothetical protein CHLNCDRAFT_29488              132   3e-35   Chlorella variabilis
ref|XP_011398421.1|  Uncharacterized protein F751_0552                  129   6e-34   Auxenochlorella protothecoides
ref|XP_005644615.1|  ORMDL-domain-containing protein                    125   3e-32   Coccomyxa subellipsoidea C-169
ref|XP_002518881.1|  ormdl, putative                                    122   8e-32   
gb|EPB84369.1|  hypothetical protein HMPREF1544_08888                   123   2e-31   Mucor circinelloides f. circinelloides 1006PhL
emb|CEG72541.1|  Putative ORM1 protein                                  122   4e-31   Rhizopus microsporus
emb|CDH57818.1|  protein orm1                                           120   1e-30   Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_001703235.1|  hypothetical protein CHLREDRAFT_185995             119   3e-30   Chlamydomonas reinhardtii
gb|ESA18892.1|  hypothetical protein GLOINDRAFT_139068                  119   4e-30   
ref|XP_002948063.1|  hypothetical protein VOLCADRAFT_73521              116   3e-29   Volvox carteri f. nagariensis
gb|KIZ03999.1|  Uncharacterized protein MNEG_3962                       115   1e-28   Monoraphidium neglectum
ref|XP_001329089.1|  ORMDL family protein                               115   1e-28   Trichomonas vaginalis G3
emb|CEP06814.1|  hypothetical protein                                   115   1e-28   Parasitella parasitica
dbj|GAN07203.1|  protein orm1 protein                                   114   2e-28   Mucor ambiguus
gb|EPB89821.1|  hypothetical protein HMPREF1544_03342                   114   3e-28   Mucor circinelloides f. circinelloides 1006PhL
gb|EMT11480.1|  hypothetical protein F775_30106                         115   5e-28   
ref|XP_006681681.1|  hypothetical protein BATDEDRAFT_27467              113   7e-28   Batrachochytrium dendrobatidis JAM81
dbj|GAN07945.1|  conserved hypothetical protein                         113   1e-27   Mucor ambiguus
ref|XP_004349986.1|  hypothetical protein DFA_11048                     112   1e-27   Cavenderia fasciculata
gb|KFH68279.1|  hypothetical protein MVEG_05097                         112   1e-27   Mortierella verticillata NRRL 6337
gb|KFH67995.1|  hypothetical protein MVEG_06725                         112   2e-27   Mortierella verticillata NRRL 6337
emb|CCJ31302.1|  unnamed protein product                                112   2e-27   Pneumocystis jirovecii
gb|EPY49458.1|  ORMDL family protein                                    112   3e-27   Schizosaccharomyces cryophilus OY26
ref|XP_004349070.1|  Ormdl2 protein                                     111   3e-27   Capsaspora owczarzaki ATCC 30864
gb|EPX75182.1|  ORMDL family protein                                    112   4e-27   Schizosaccharomyces octosporus yFS286
dbj|GAM18040.1|  hypothetical protein SAMD00019534_012150               111   4e-27   Acytostelium subglobosum LB1
ref|XP_002739204.1|  PREDICTED: ORM1-like protein 2-like                111   4e-27   Saccoglossus kowalevskii
ref|NP_595290.1|  ORMDL family protein (predicted)                      112   4e-27   Schizosaccharomyces pombe
ref|XP_002719392.1|  PREDICTED: ORM1-like protein 3                     110   5e-27   Oryctolagus cuniculus [domestic rabbit]
ref|XP_002175643.1|  ORMDL family protein                               112   5e-27   Schizosaccharomyces japonicus yFS275
ref|XP_004799109.1|  PREDICTED: ORM1-like protein 3 isoform X1          112   7e-27   
ref|XP_010178182.1|  PREDICTED: ORM1-like protein 1                     110   1e-26   Mesitornis unicolor
emb|CCG82007.1|  ORM1                                                   111   1e-26   Taphrina deformans PYCC 5710
gb|KDO76667.1|  hypothetical protein CISIN_1g0317191mg                  107   2e-26   Citrus sinensis [apfelsine]
ref|XP_007531079.1|  PREDICTED: ORM1-like protein 3 isoform X2          109   2e-26   Erinaceus europaeus [common hedgehog]
ref|NP_663492.3|  ORM1-like protein 1                                   109   2e-26   Mus musculus [mouse]
dbj|BAC36865.1|  unnamed protein product                                109   2e-26   Mus musculus [mouse]
ref|XP_008580235.1|  PREDICTED: ORM1-like protein 3                     108   3e-26   Galeopterus variegatus [Malayan flying lemur]
ref|XP_007177632.1|  PREDICTED: ORM1-like protein 3 isoform X1          108   3e-26   
ref|XP_004655521.1|  PREDICTED: ORM1-like protein 3 isoform X2          108   4e-26   Jaculus jaculus
ref|XP_003768309.1|  PREDICTED: ORM1-like protein 3                     108   4e-26   
ref|NP_001069835.1|  ORM1-like protein 3                                108   4e-26   Bos taurus [bovine]
ref|XP_004633771.1|  PREDICTED: ORM1-like protein 3 isoform X1          108   4e-26   Octodon degus
ref|NP_001126832.1|  ORM1-like protein 3                                108   5e-26   Pongo abelii [orang utan]
ref|NP_644809.1|  ORM1-like protein 3                                   108   6e-26   Homo sapiens [man]
ref|XP_005584109.1|  PREDICTED: ORM1-like protein 3 isoform X5          108   6e-26   
ref|XP_006638294.1|  PREDICTED: ORM1-like protein 3-like                108   6e-26   Lepisosteus oculatus
gb|ELK01557.1|  ORM1-like protein 3                                     108   6e-26   Pteropus alecto
ref|XP_010788227.1|  PREDICTED: ORM1-like protein 3                     108   6e-26   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_009911347.1|  PREDICTED: ORM1-like protein 3 isoform X2          108   7e-26   Haliaeetus albicilla
ref|XP_004859533.1|  PREDICTED: ORM1-like protein 3 isoform X2          108   7e-26   
ref|XP_003284429.1|  hypothetical protein DICPUDRAFT_148200             107   7e-26   Dictyostelium purpureum
ref|XP_005584108.1|  PREDICTED: ORM1-like protein 3 isoform X4          108   7e-26   
ref|XP_009250106.1|  PREDICTED: ORM1-like protein 3 isoform X2          108   7e-26   Pongo abelii [orang utan]
ref|XP_007652017.1|  PREDICTED: ORM1-like protein 1 isoform X1          109   7e-26   
ref|XP_004764684.1|  PREDICTED: ORM1-like protein 3 isoform X1          108   8e-26   
ref|NP_079937.1|  ORM1-like protein 3                                   107   8e-26   Mus musculus [mouse]
ref|XP_005257882.1|  PREDICTED: ORM1-like protein 3 isoform X1          108   8e-26   
ref|NP_001088231.1|  ORM1-like protein 1                                107   9e-26   Xenopus laevis [clawed frog]
ref|XP_005584107.1|  PREDICTED: ORM1-like protein 3 isoform X3          108   9e-26   
ref|XP_005537992.1|  hypothetical protein, conserved                    107   9e-26   Cyanidioschyzon merolae strain 10D
ref|XP_001500871.2|  PREDICTED: ORM1-like protein 3 isoform 1           108   9e-26   
ref|XP_005394385.1|  PREDICTED: ORM1-like protein 3 isoform X2          108   9e-26   
ref|XP_005076000.1|  PREDICTED: ORM1-like protein 3 isoform X1          107   1e-25   
ref|XP_004434610.1|  PREDICTED: ORM1-like protein 3                     107   1e-25   
ref|XP_007782865.1|  hypothetical protein W97_06916                     108   1e-25   Coniosporium apollinis CBS 100218
ref|XP_008687583.1|  PREDICTED: ORM1-like protein 3 isoform X1          107   1e-25   Ursus maritimus [white bear]
ref|XP_001366081.2|  PREDICTED: ORM1-like protein 3 isoform X1          108   1e-25   
gb|AAM43506.1|AF395707_1  ORMDL2                                        107   1e-25   Homo sapiens [man]
ref|NP_001016075.1|  ORMDL sphingolipid biosynthesis regulator 2        107   1e-25   Xenopus tropicalis [western clawed frog]
ref|XP_001932714.1|  hypothetical protein PTRG_02381                    107   2e-25   Pyrenophora tritici-repentis Pt-1C-BFP
ref|XP_005394384.1|  PREDICTED: ORM1-like protein 3 isoform X1          108   2e-25   
ref|XP_001796982.1|  hypothetical protein SNOG_06616                    107   2e-25   Parastagonospora nodorum SN15
ref|XP_010643085.1|  PREDICTED: ORM1-like protein 2                     107   2e-25   Fukomys damarensis [Damara mole rat]
ref|XP_005002473.1|  PREDICTED: ORM1-like protein 3 isoform X2          107   2e-25   Cavia porcellus [guinea pig]
ref|XP_002748577.2|  PREDICTED: ORM1-like protein 3 isoform X1          108   2e-25   
dbj|BAC39898.1|  unnamed protein product                                106   2e-25   Mus musculus [mouse]
ref|XP_010635146.1|  PREDICTED: ORM1-like protein 1                     106   2e-25   Fukomys damarensis [Damara mole rat]
ref|XP_005584106.1|  PREDICTED: ORM1-like protein 3 isoform X2          107   2e-25   
ref|XP_002842249.1|  hypothetical protein                               107   2e-25   Tuber melanosporum Mel28
ref|NP_001041362.1|  ORM1-like protein 3                                107   2e-25   Rattus norvegicus [brown rat]
gb|AHG98262.1|  ORM1-like protein 2 variant 1                           106   3e-25   Oncorhynchus mykiss
gb|EKG14462.1|  ORMDL domain-containing protein                         107   3e-25   Macrophomina phaseolina MS6
ref|XP_004692701.1|  PREDICTED: ORM1-like protein 2                     106   3e-25   Condylura cristata
ref|XP_003478718.1|  PREDICTED: ORM1-like protein 1                     106   3e-25   Cavia porcellus [guinea pig]
ref|XP_009023498.1|  hypothetical protein HELRODRAFT_177041             106   3e-25   Helobdella robusta
gb|EPY87219.1|  ORM1-like protein                                       108   3e-25   Camelus ferus
ref|XP_007529063.1|  PREDICTED: ORM1-like protein 1                     106   3e-25   Erinaceus europaeus [common hedgehog]
ref|XP_004899035.1|  PREDICTED: ORM1-like protein 3 isoform X1          107   3e-25   
emb|CEG84175.1|  Putative ORM1                                          104   3e-25   Rhizopus microsporus
ref|XP_010210538.1|  PREDICTED: ORM1-like protein 1                     106   4e-25   Tinamus guttatus
ref|XP_007436687.1|  PREDICTED: ORM1-like protein 3-like                106   4e-25   Python bivittatus
ref|XP_007580140.1|  putative unfolded protein response protein         106   4e-25   
ref|XP_003207464.1|  PREDICTED: ORM1-like protein 1                     106   4e-25   Meleagris gallopavo [common turkey]
ref|XP_006117467.1|  PREDICTED: ORM1-like protein 3                     105   4e-25   Pelodiscus sinensis [Chinese softshell turtle]
gb|EMT04567.1|  hypothetical protein F775_20465                         104   4e-25   
ref|XP_001171486.1|  PREDICTED: ORM1-like protein 3 isoform X2          105   4e-25   
dbj|BAA19218.1|  unnamed protein product                                105   4e-25   Schizosaccharomyces pombe
ref|XP_006878142.1|  PREDICTED: ORM1-like protein 1-like                105   4e-25   Chrysochloris asiatica
ref|XP_004608795.1|  PREDICTED: ORM1-like protein 3 isoform X1          105   4e-25   Sorex araneus [Eurasian shrew]
gb|ELW54895.1|  ORM1-like protein 3                                     108   4e-25   Tupaia chinensis
ref|NP_001096387.1|  ORMDL sphingolipid biosynthesis regulator 1        105   4e-25   Xenopus tropicalis [western clawed frog]
ref|XP_009558125.1|  PREDICTED: ORM1-like protein 1                     105   4e-25   Cuculus canorus
ref|XP_008062205.1|  PREDICTED: ORM1-like protein 2                     105   5e-25   Carlito syrichta
ref|XP_005794794.1|  PREDICTED: ORM1-like protein 3-like                105   5e-25   Xiphophorus maculatus
ref|XP_005241360.1|  PREDICTED: ORM1-like protein 1                     105   5e-25   Falco peregrinus [peregrine]
ref|XP_008293578.1|  PREDICTED: ORM1-like protein 3                     105   5e-25   Stegastes partitus
ref|XP_006793224.1|  PREDICTED: ORM1-like protein 3-like isoform X1     105   5e-25   
ref|XP_003315508.2|  PREDICTED: ORM1-like protein 3 isoform X1          106   5e-25   
ref|XP_009989821.1|  PREDICTED: ORM1-like protein 3                     105   5e-25   
ref|XP_004647153.1|  PREDICTED: ORM1-like protein 2                     105   5e-25   
ref|XP_003448712.1|  PREDICTED: ORM1-like protein 3-like                105   5e-25   
ref|XP_006864104.1|  PREDICTED: ORM1-like protein 1                     105   6e-25   
ref|XP_007494568.1|  PREDICTED: ORM1-like protein 1 isoform X2          105   6e-25   
ref|XP_003513599.1|  PREDICTED: ORM1-like protein 1 isoform X2          105   6e-25   
ref|XP_011235675.1|  PREDICTED: ORM1-like protein 3                     105   6e-25   
ref|XP_006022605.1|  PREDICTED: ORM1-like protein 3-like isoform X1     105   6e-25   
ref|XP_005006481.1|  PREDICTED: ORM1-like protein 2                     105   6e-25   
ref|XP_003405158.1|  PREDICTED: ORM1-like protein 2                     105   6e-25   
gb|EIE78666.1|  hypothetical protein RO3G_03370                         103   6e-25   
ref|XP_005145643.1|  PREDICTED: ORM1-like protein 1                     105   6e-25   
gb|KFO34885.1|  ORM1-like protein 3                                     108   6e-25   
ref|XP_001369421.2|  PREDICTED: ORM1-like protein 1 isoform X1          105   6e-25   
ref|XP_001170058.1|  PREDICTED: ORM1-like protein 2                     105   7e-25   
gb|EMP33838.1|  ORM1-like protein 3                                     105   7e-25   
ref|XP_010197947.1|  PREDICTED: ORM1-like protein 1                     105   7e-25   
ref|XP_010194304.1|  PREDICTED: ORM1-like protein 3                     105   7e-25   
ref|XP_003940875.1|  PREDICTED: ORM1-like protein 1                     105   7e-25   
dbj|GAC95890.1|  response to unfolded-protein protein                   105   7e-25   
ref|XP_005986243.1|  PREDICTED: ORM1-like protein 2                     105   7e-25   
gb|AAQ13618.1|AF173375_1  MSTP095                                       105   7e-25   
ref|XP_006878822.1|  PREDICTED: ORM1-like protein 1                     105   7e-25   
ref|XP_009888435.1|  PREDICTED: ORM1-like protein 1                     105   8e-25   
ref|XP_005308090.1|  PREDICTED: ORM1-like protein 1                     105   8e-25   
ref|XP_009465283.1|  PREDICTED: ORM1-like protein 1                     105   8e-25   
gb|ELR09372.1|  hypothetical protein GMDG_03936                         105   8e-25   
gb|KEQ77174.1|  ORMDL family protein                                    105   8e-25   
gb|EMT13427.1|  hypothetical protein F775_30968                         103   8e-25   
ref|XP_004004553.1|  PREDICTED: ORM1-like protein 1 isoform 2           105   8e-25   
gb|AIC56274.1|  ORMDL2                                                  105   8e-25   
gb|KEQ65217.1|  ORMDL family protein                                    105   8e-25   
ref|XP_002712384.2|  PREDICTED: ORM1-like protein 1                     105   9e-25   
ref|NP_054901.1|  ORM1-like protein 2                                   105   9e-25   
ref|XP_004601280.1|  PREDICTED: ORM1-like protein 1                     105   9e-25   
ref|NP_001006087.1|  ORM1-like protein 3                                105   9e-25   
ref|XP_007533423.1|  PREDICTED: ORM1-like protein 2                     105   9e-25   
gb|KFY05448.1|  hypothetical protein V492_08533                         105   9e-25   
ref|XP_006075146.1|  PREDICTED: ORM1-like protein 2                     105   9e-25   
ref|XP_005397317.1|  PREDICTED: ORM1-like protein 2 isoform X1          105   9e-25   
gb|ETE58732.1|  ORM1-like protein 3                                     105   9e-25   
ref|XP_009499341.1|  PREDICTED: ORM1-like protein 1                     105   9e-25   
ref|XP_007425375.1|  PREDICTED: ORM1-like protein 1 isoform X1          105   9e-25   
ref|XP_010737021.1|  PREDICTED: ORM1-like protein 3                     105   9e-25   
ref|XP_005501775.1|  PREDICTED: ORM1-like protein 1                     105   9e-25   
emb|CBJ29398.1|  conserved unknown protein                              105   1e-24   
ref|XP_009672100.1|  PREDICTED: ORM1-like protein 3                     105   1e-24   
ref|XP_005294195.1|  PREDICTED: ORM1-like protein 3                     105   1e-24   
ref|XP_003961085.1|  PREDICTED: ORM1-like protein 3-like                105   1e-24   
emb|CCA15375.1|  ORM1like protein putative                              106   1e-24   
ref|XP_007235776.1|  PREDICTED: ORM1-like protein 2-like                105   1e-24   
ref|XP_008312643.1|  PREDICTED: ORM1-like protein 3 isoform X2          105   1e-24   
ref|XP_009908177.1|  PREDICTED: ORM1-like protein 3                     104   1e-24   
ref|XP_002711104.1|  PREDICTED: ORM1-like protein 2                     104   1e-24   
ref|XP_005866338.1|  PREDICTED: ORM1-like protein 1                     104   1e-24   
ref|XP_008144734.1|  PREDICTED: ORM1-like protein 1                     104   1e-24   
ref|XP_003217469.1|  PREDICTED: ORM1-like protein 1                     104   1e-24   
ref|XP_004452598.1|  PREDICTED: ORM1-like protein 1 isoform 1           104   1e-24   
ref|NP_057551.1|  ORM1-like protein 1                                   104   1e-24   
gb|ETE59620.1|  ORM1-like protein 1                                     104   1e-24   
ref|XP_005011461.1|  PREDICTED: ORM1-like protein 1 isoform X1          104   1e-24   
ref|XP_001553090.1|  conserved hypothetical protein                     105   1e-24   
ref|XP_004628682.1|  PREDICTED: ORM1-like protein 1                     104   1e-24   
ref|XP_010011487.1|  PREDICTED: ORM1-like protein 1                     104   1e-24   
ref|XP_006974911.1|  PREDICTED: ORM1-like protein 1                     104   1e-24   
ref|XP_007695784.1|  hypothetical protein COCSADRAFT_81405              105   1e-24   
ref|XP_004763429.1|  PREDICTED: ORM1-like protein 1 isoform X1          104   1e-24   
gb|KFY13177.1|  hypothetical protein V491_06492                         105   1e-24   
ref|XP_005584105.1|  PREDICTED: ORM1-like protein 3 isoform X1          106   1e-24   
dbj|GAC71475.1|  predicted membrane protein                             106   1e-24   
ref|XP_009672161.1|  PREDICTED: ORM1-like protein 1                     104   1e-24   
gb|KFQ87338.1|  ORM1-like 3                                             104   1e-24   
ref|XP_004601643.1|  PREDICTED: ORM1-like protein 2                     104   1e-24   
ref|XP_008063907.1|  PREDICTED: ORM1-like protein 1                     104   1e-24   
ref|XP_004053375.1|  PREDICTED: ORM1-like protein 2                     104   1e-24   
ref|XP_007873854.1|  hypothetical protein PNEG_01880                    105   1e-24   
ref|XP_010142273.1|  PREDICTED: ORM1-like protein 3                     104   1e-24   
ref|XP_009077806.1|  PREDICTED: ORM1-like protein 1                     104   1e-24   
gb|KFY52647.1|  hypothetical protein V496_08288                         105   1e-24   
dbj|BAD96900.1|  ORMDL2 variant                                         104   1e-24   
ref|XP_006147893.1|  PREDICTED: ORM1-like protein 1                     104   1e-24   
ref|XP_001502006.1|  PREDICTED: ORM1-like protein 1                     104   1e-24   
ref|XP_005703926.1|  hypothetical protein Gasu_50030                    104   1e-24   
ref|NP_001070601.1|  ORM1-like protein 1                                104   2e-24   
ref|XP_005232713.1|  PREDICTED: ORM1-like protein 3-like                104   2e-24   
gb|EST09171.1|  putative ORM1-unfolded protein response protein         106   2e-24   
ref|XP_005084543.1|  PREDICTED: ORM1-like protein 1                     104   2e-24   
ref|XP_009964745.1|  PREDICTED: ORM1-like protein 3                     104   2e-24   
ref|XP_009944692.1|  PREDICTED: ORM1-like protein 3                     104   2e-24   
ref|XP_004385642.1|  PREDICTED: ORM1-like protein 1                     104   2e-24   
ref|XP_008503876.1|  PREDICTED: ORM1-like protein 3                     104   2e-24   
ref|XP_005059842.1|  PREDICTED: ORM1-like protein 3-like isoform X2     104   2e-24   
ref|XP_001322953.1|  ORMDL family protein                               104   2e-24   
ref|XP_005999582.1|  PREDICTED: ORM1-like protein 3-like isoform X1     104   2e-24   
ref|XP_003213866.1|  PREDICTED: ORM1-like protein 3                     104   2e-24   
gb|KIV77276.1|  hypothetical protein PV11_09087                         105   2e-24   
ref|XP_004577033.1|  PREDICTED: ORM1-like protein 1                     104   2e-24   
ref|XP_009333245.1|  PREDICTED: ORM1-like protein 1 isoform X1          105   2e-24   
ref|XP_006897715.1|  PREDICTED: ORM1-like protein 2                     103   2e-24   
ref|XP_004401691.1|  PREDICTED: ORM1-like protein 2 isoform 2           103   2e-24   
ref|XP_848266.2|  PREDICTED: ORM1-like protein 1 isoform 1              105   2e-24   
ref|XP_423802.1|  PREDICTED: ORM1-like protein 3 isoformX2              103   2e-24   
gb|ELK04784.1|  ORM1-like protein 1                                     104   2e-24   
ref|XP_005513818.1|  PREDICTED: ORM1-like protein 3-like                103   2e-24   
ref|XP_004890333.1|  PREDICTED: ORM1-like protein 2                     103   2e-24   
gb|EXX73439.1|  Orm1p                                                   105   2e-24   
ref|XP_009086388.1|  PREDICTED: ORM1-like protein 1                     103   2e-24   
ref|XP_003790551.1|  PREDICTED: ORM1-like protein 2                     103   2e-24   
ref|XP_006165627.1|  PREDICTED: ORM1-like protein 2                     103   2e-24   
gb|ERE85753.1|  ORM1-like protein 1                                     105   3e-24   
dbj|GAM82665.1|  hypothetical protein ANO11243_006470                   104   3e-24   
gb|KFY18454.1|  hypothetical protein V493_08599                         106   3e-24   
ref|XP_008833850.1|  PREDICTED: ORM1-like protein 1 isoform X1          105   3e-24   
ref|XP_008944226.1|  PREDICTED: ORM1-like protein 1                     103   3e-24   
gb|KIX01526.1|  hypothetical protein Z518_09252                         104   3e-24   
ref|XP_009288942.1|  PREDICTED: ORM1-like protein 3                     103   3e-24   
ref|XP_002111281.1|  hypothetical protein TRIADDRAFT_23050              103   3e-24   
gb|EMD93412.1|  hypothetical protein COCHEDRAFT_1097232                 104   3e-24   
ref|XP_004401690.1|  PREDICTED: ORM1-like protein 2 isoform 1           104   3e-24   
gb|ERE68317.1|  ORM1-like protein 3                                     107   3e-24   
ref|XP_008291959.1|  PREDICTED: ORM1-like protein 2                     103   3e-24   
ref|XP_001928873.1|  PREDICTED: Ormdl2 protein isoform 1                103   3e-24   
ref|NP_001014931.1|  ORM1-like protein 2                                103   3e-24   
ref|XP_008628425.1|  PREDICTED: ORM1-like protein 1                     103   3e-24   
ref|XP_009931719.1|  PREDICTED: ORM1-like protein 1                     103   3e-24   
ref|XP_003709887.1|  hypothetical protein MGG_16259                     104   4e-24   
ref|XP_007908061.1|  PREDICTED: ORM1-like protein 3                     103   4e-24   
ref|XP_007737436.1|  hypothetical protein A1O3_09150                    103   4e-24   
ref|XP_003222494.1|  PREDICTED: ORM1-like protein 3                     103   4e-24   
ref|XP_002752633.1|  PREDICTED: ORM1-like protein 2 isoform X1          103   4e-24   
ref|XP_003642856.1|  PREDICTED: ORM1-like protein 3 isoformX1           104   4e-24   
ref|XP_005675918.1|  PREDICTED: ORM1-like protein 1                     103   4e-24   
ref|XP_006036828.1|  PREDICTED: ORM1-like protein 1                     103   4e-24   
ref|XP_011475831.1|  PREDICTED: ORM1-like protein 2 isoform X1          103   4e-24   
ref|XP_003733822.1|  PREDICTED: ORM1-like protein 2 isoform X2          103   4e-24   
ref|XP_007888333.1|  PREDICTED: ORM1-like protein 1 isoform X3          103   4e-24   
ref|XP_003772211.1|  PREDICTED: ORM1-like protein 2                     103   4e-24   
emb|CDQ61849.1|  unnamed protein product                                103   4e-24   
ref|XP_005496947.1|  PREDICTED: ORM1-like protein 3-like                103   4e-24   
ref|XP_006636686.1|  PREDICTED: ORM1-like protein 1-like                103   4e-24   
gb|ACO10047.1|  ORM1-like protein 2                                     103   5e-24   
ref|XP_002196482.1|  PREDICTED: ORM1-like protein 3-like                103   5e-24   
gb|KFZ62310.1|  ORM1-like 1                                             103   5e-24   
ref|XP_005416038.1|  PREDICTED: ORM1-like protein 1 isoform X1          103   5e-24   
ref|XP_005049324.1|  PREDICTED: ORM1-like protein 1 isoform X1          103   5e-24   
ref|XP_008710244.1|  PREDICTED: ORM1-like protein 2                     104   5e-24   
ref|XP_005139995.1|  PREDICTED: ORM1-like protein 2-like                103   5e-24   
ref|XP_007724694.1|  hypothetical protein A1O1_05620                    103   5e-24   
ref|XP_010151216.1|  PREDICTED: ORM1-like protein 1                     103   5e-24   
ref|XP_004466131.1|  PREDICTED: ORM1-like protein 2                     103   5e-24   
emb|CDI55525.1|  probable ORM1-unfolded protein response protein        105   5e-24   
ref|XP_002147666.1|  unfolded protein response protein Orm1, puta...    103   5e-24   
gb|EPE02212.1|  protein orm1                                            103   5e-24   
ref|XP_004674499.1|  PREDICTED: ORM1-like protein 1                     103   5e-24   
ref|XP_005059841.1|  PREDICTED: ORM1-like protein 3-like isoform X1     104   5e-24   
ref|XP_009990737.1|  PREDICTED: ORM1-like protein 1                     103   5e-24   
emb|CCF50147.1|  probable ORM1-unfolded protein response protein        105   5e-24   
gb|KIW92247.1|  hypothetical protein Z519_07231                         103   6e-24   
ref|XP_006908926.1|  PREDICTED: ORM1-like protein 2 isoform X1          103   6e-24   
ref|XP_007741502.1|  hypothetical protein A1O5_02698                    103   6e-24   
ref|XP_005611332.1|  PREDICTED: ORM1-like protein 2 isoform X2          102   6e-24   
ref|XP_001231893.1|  PREDICTED: ORM1-like protein 1 isoformX1           102   6e-24   
emb|CCD59407.1|  ormdl proteins, putative                               102   6e-24   
gb|KIW83230.1|  hypothetical protein Z517_02475                         103   6e-24   
ref|XP_010864650.1|  PREDICTED: ORM1-like protein 3                     102   6e-24   
ref|XP_008725771.1|  hypothetical protein G647_03203                    103   6e-24   
ref|XP_008312641.1|  PREDICTED: ORM1-like protein 3 isoform X1          104   6e-24   
ref|XP_002481833.1|  unfolded protein response protein Orm1, puta...    103   6e-24   
ref|XP_008495167.1|  PREDICTED: ORM1-like protein 1                     102   6e-24   
dbj|GAM36313.1|  unfolded protein response protein                      103   6e-24   
gb|KFX92247.1|  hypothetical protein V490_05477                         105   6e-24   
emb|CBQ69402.1|  probable ORM1-unfolded protein response protein        104   6e-24   
ref|XP_007833622.1|  hypothetical protein PFICI_06850                   103   6e-24   
ref|XP_009160026.1|  hypothetical protein HMPREF1120_07553              103   6e-24   
gb|EFA76698.1|  hypothetical protein PPL_09449                          102   7e-24   
ref|XP_008327220.1|  PREDICTED: ORM1-like protein 1                     102   7e-24   
ref|XP_010713853.1|  PREDICTED: ORM1-like protein 2                     102   7e-24   
ref|XP_006908927.1|  PREDICTED: ORM1-like protein 2 isoform X2          102   7e-24   
ref|XP_007759081.1|  hypothetical protein A1O7_06891                    103   7e-24   
gb|EPQ14222.1|  ORM1-like protein 2                                     102   7e-24   
ref|XP_007953276.1|  PREDICTED: ORM1-like protein 2                     102   7e-24   
ref|XP_788585.1|  PREDICTED: ORM1-like protein 2-like                   102   8e-24   
ref|XP_002195267.2|  PREDICTED: ORM1-like protein 1                     103   8e-24   
gb|EPS33364.1|  hypothetical protein PDE_08326                          103   8e-24   
gb|KDR23200.1|  ORM1-like protein 3                                     102   8e-24   
ref|XP_010756942.1|  hypothetical protein PADG_01514                    103   8e-24   
ref|XP_002791069.1|  unfolded protein response Orm1                     103   8e-24   
ref|XP_007888332.1|  PREDICTED: ORM1-like protein 1 isoform X2          103   9e-24   
ref|XP_004650013.1|  PREDICTED: ORM1-like protein 2                     102   9e-24   
gb|AAW26256.1|  SJCHGC06423 protein                                     102   9e-24   
ref|XP_009698181.1|  PREDICTED: ORM1-like protein 1                     102   9e-24   
ref|XP_002823429.1|  PREDICTED: ORM1-like protein 2                     102   9e-24   
ref|XP_001239480.1|  conserved hypothetical protein                     103   9e-24   
ref|XP_008081851.1|  hypothetical protein GLAREA_03407                  102   9e-24   
gb|KIW22809.1|  hypothetical protein PV07_11070                         103   1e-23   
gb|KIX99108.1|  hypothetical protein Z520_05569                         103   1e-23   
ref|XP_006179873.1|  PREDICTED: ORM1-like protein 2                     102   1e-23   
ref|XP_005487010.1|  PREDICTED: ORM1-like protein 1                     102   1e-23   
gb|KIW03932.1|  hypothetical protein PV09_04772                         102   1e-23   
ref|XP_002584468.1|  protein ORM1                                       102   1e-23   
ref|XP_004589700.1|  PREDICTED: ORM1-like protein 2                     102   1e-23   
gb|EYE90042.1|  putative unfolded protein response protein Orm1         102   1e-23   
gb|KIW65029.1|  hypothetical protein PV04_07318                         103   1e-23   
ref|XP_005311119.1|  PREDICTED: ORM1-like protein 2                     102   1e-23   
ref|NP_077142.1|  ORM1-like protein 2                                   102   1e-23   
ref|NP_001277548.1|  ORM1-like 2                                        102   1e-23   
dbj|GAD99743.1|  ORM1                                                   102   1e-23   
gb|KIV95525.1|  hypothetical protein PV10_03169                         103   1e-23   
ref|XP_009695006.1|  PREDICTED: ORM1-like protein 2                     102   1e-23   
ref|XP_004700632.1|  PREDICTED: ORM1-like protein 2                     102   1e-23   
ref|XP_005876761.1|  PREDICTED: ORM1-like protein 2                     103   1e-23   
ref|XP_007064964.1|  PREDICTED: ORM1-like protein 2                     102   1e-23   
ref|XP_002627518.1|  ORM1                                               102   1e-23   
ref|NP_001099410.1|  ORM1-like protein 2                                102   1e-23   
gb|EEH07326.1|  ORMDL family protein                                    102   1e-23   
ref|XP_007888331.1|  PREDICTED: ORM1-like protein 1 isoform X1          103   1e-23   
ref|XP_010888886.1|  PREDICTED: ORM1-like protein 2                     102   1e-23   
ref|XP_007912538.1|  putative protein orm1 protein                      102   1e-23   
ref|XP_001504831.2|  PREDICTED: ORM1-like protein 2 isoform X1          103   1e-23   



>ref|XP_004510647.1| PREDICTED: ORM1-like protein 3-like [Cicer arietinum]
Length=157

 Score =   270 bits (691),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 138/156 (88%), Positives = 150/156 (96%), Gaps = 0/156 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MANLYV+A P  DLN+NTEWFTYPGVW+TYILILFFSW++ LSVFGCSPG AWTIVNL+H
Sbjct  1    MANLYVKAVPPADLNRNTEWFTYPGVWTTYILILFFSWILVLSVFGCSPGIAWTIVNLAH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F++TYHFFHWKKGTPFADDQGIYNRLTWWEQ+DNGKQLTRNRKFLTVVP+VLYLIASHTT
Sbjct  61   FLVTYHFFHWKKGTPFADDQGIYNRLTWWEQVDNGKQLTRNRKFLTVVPLVLYLIASHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            DY+HPMLF NTVAVF+LVVAKFPHMHKVRIFGINAD
Sbjct  121  DYEHPMLFFNTVAVFVLVVAKFPHMHKVRIFGINAD  156



>ref|XP_004133804.1| PREDICTED: uncharacterized protein C119.09c-like [Cucumis sativus]
 ref|XP_004155172.1| PREDICTED: uncharacterized protein C119.09c-like [Cucumis sativus]
 gb|KGN56408.1| hypothetical protein Csa_3G119410 [Cucumis sativus]
Length=157

 Score =   269 bits (688),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 138/156 (88%), Positives = 149/156 (96%), Gaps = 0/156 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MANLYV+A P TDLN+NTEWF YPGVW+TYILILFF+WL+ LSVFGCSPG AWT+VNLSH
Sbjct  1    MANLYVKAVPPTDLNRNTEWFMYPGVWTTYILILFFAWLLVLSVFGCSPGMAWTVVNLSH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F +TYHFFHWKKGTPFA+DQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT
Sbjct  61   FAVTYHFFHWKKGTPFAEDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            DYQHPMLFLNT+AV +LV+AKFPHMHKVRIFGINAD
Sbjct  121  DYQHPMLFLNTLAVIVLVIAKFPHMHKVRIFGINAD  156



>ref|XP_011070364.1| PREDICTED: ORM1-like protein 2 [Sesamum indicum]
Length=157

 Score =   268 bits (686),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 142/156 (91%), Positives = 149/156 (96%), Gaps = 0/156 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MANLYVRA   TDLN+NTEWFTYPGVW+TYILILFFSWLV LSVFGCSPG AWT+V+LSH
Sbjct  1    MANLYVRAVMPTDLNRNTEWFTYPGVWTTYILILFFSWLVVLSVFGCSPGIAWTVVHLSH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F++TY FFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT
Sbjct  61   FVVTYQFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            DYQHPMLF NT+AVFILVVAKFPHMHKVRIFGINAD
Sbjct  121  DYQHPMLFFNTLAVFILVVAKFPHMHKVRIFGINAD  156



>ref|XP_008437865.1| PREDICTED: ORM1-like protein 3 [Cucumis melo]
Length=157

 Score =   268 bits (684),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 137/156 (88%), Positives = 148/156 (95%), Gaps = 0/156 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MANLYV+A P  DLN+NTEWF YPGVW+TYILILFF+WL+ LSVFGCSPG AWT+VNLSH
Sbjct  1    MANLYVKAVPPADLNRNTEWFMYPGVWTTYILILFFAWLLVLSVFGCSPGMAWTVVNLSH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F +TYHFFHWKKGTPFA+DQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT
Sbjct  61   FAVTYHFFHWKKGTPFAEDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            DYQHPMLFLNT+AV +LV+AKFPHMHKVRIFGINAD
Sbjct  121  DYQHPMLFLNTLAVIVLVIAKFPHMHKVRIFGINAD  156



>ref|XP_009766034.1| PREDICTED: ORM1-like protein 2 [Nicotiana sylvestris]
Length=157

 Score =   266 bits (681),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 142/156 (91%), Positives = 149/156 (96%), Gaps = 0/156 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MANLYV A PTTDLN+NTEWFTYPGVW+TYILILFFSWLV LSVFGCSPG AWTIV+LSH
Sbjct  1    MANLYVTAVPTTDLNRNTEWFTYPGVWTTYILILFFSWLVVLSVFGCSPGMAWTIVHLSH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F++TY  FHWKKGTPF+DDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT
Sbjct  61   FLVTYQCFHWKKGTPFSDDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            DYQHPMLF NTVAVFILVVAKFP+MHKVRIFGINAD
Sbjct  121  DYQHPMLFFNTVAVFILVVAKFPNMHKVRIFGINAD  156



>gb|AFK37242.1| unknown [Medicago truncatula]
 gb|KEH18613.1| ORMDL family protein [Medicago truncatula]
Length=157

 Score =   266 bits (680),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 136/156 (87%), Positives = 149/156 (96%), Gaps = 0/156 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MANLYV+A P  DLN+NTEWFTYPGVW+TYILILFFSW++ LSVFGCSPG AWTIVNL+H
Sbjct  1    MANLYVKAVPPADLNRNTEWFTYPGVWTTYILILFFSWIMVLSVFGCSPGIAWTIVNLAH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F++TYHFFHWKKGTPFADDQGIYNRLTWWEQ+DNGKQLTRNRKFLTVVP+VLYLIASHTT
Sbjct  61   FLVTYHFFHWKKGTPFADDQGIYNRLTWWEQVDNGKQLTRNRKFLTVVPLVLYLIASHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            DY+HPMLF NTVAV +LVVAKFP+MHKVRIFGINAD
Sbjct  121  DYEHPMLFFNTVAVIVLVVAKFPNMHKVRIFGINAD  156



>ref|XP_009796481.1| PREDICTED: ORM1-like protein 2 [Nicotiana sylvestris]
Length=157

 Score =   265 bits (678),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 137/156 (88%), Positives = 145/156 (93%), Gaps = 0/156 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MAN YVRAAPTTDLN+NTEWFTYPGVW+ YI ILFFSW+  LSV G SPG AWTIVNLSH
Sbjct  1    MANYYVRAAPTTDLNRNTEWFTYPGVWTIYIFILFFSWMAVLSVLGVSPGVAWTIVNLSH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F++TYHFFHWKKGTPFA+DQGIYNRLTWWEQ+DNGKQLT NRKFLTVVPVVLYLIASHTT
Sbjct  61   FLVTYHFFHWKKGTPFAEDQGIYNRLTWWEQMDNGKQLTPNRKFLTVVPVVLYLIASHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            DYQHPMLF NT AVFILVVAKFP+MHKVRIFGINAD
Sbjct  121  DYQHPMLFFNTFAVFILVVAKFPNMHKVRIFGINAD  156



>gb|KHG28711.1| ORM1-like protein 1 [Gossypium arboreum]
Length=157

 Score =   265 bits (678),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 136/156 (87%), Positives = 146/156 (94%), Gaps = 0/156 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MANLYV+A P  DLN+NTEWF YPGVW+TYIL L FSWL+ LS+FGCSPG AWTIVNL+H
Sbjct  1    MANLYVKAVPPADLNRNTEWFMYPGVWTTYILFLLFSWLLVLSIFGCSPGMAWTIVNLAH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F++TYHFFHWKKGTPFADDQGIYN LTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT
Sbjct  61   FLVTYHFFHWKKGTPFADDQGIYNGLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            DYQHPMLFLNT+AV ILVVAKFP+MHKVRIFGINAD
Sbjct  121  DYQHPMLFLNTLAVIILVVAKFPNMHKVRIFGINAD  156



>gb|KJB49589.1| hypothetical protein B456_008G126900 [Gossypium raimondii]
 gb|KJB49590.1| hypothetical protein B456_008G126900 [Gossypium raimondii]
Length=157

 Score =   265 bits (678),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 137/156 (88%), Positives = 147/156 (94%), Gaps = 0/156 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MANLYV+A P  DLN+NTEWF YPGVW+TYIL LFFSWL+ LS+FGCSPG AWTIVNL+H
Sbjct  1    MANLYVKAVPPADLNRNTEWFMYPGVWTTYILFLFFSWLLVLSIFGCSPGMAWTIVNLAH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F++TYHFFHWKKGTPFADDQGIYN LTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT
Sbjct  61   FLVTYHFFHWKKGTPFADDQGIYNGLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            DYQHPMLFLNT+AV ILVVAKFP+MHKVRIFGINAD
Sbjct  121  DYQHPMLFLNTLAVIILVVAKFPNMHKVRIFGINAD  156



>ref|XP_009588445.1| PREDICTED: uncharacterized protein C119.09c-like [Nicotiana tomentosiformis]
Length=157

 Score =   265 bits (677),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 138/156 (88%), Positives = 146/156 (94%), Gaps = 0/156 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MAN YVRAAPTTDLN+NTEWFTYPGVW+ YI ILFFSW+  LSVFG SPG AWTIVNLSH
Sbjct  1    MANYYVRAAPTTDLNRNTEWFTYPGVWTIYIFILFFSWMAVLSVFGVSPGIAWTIVNLSH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F++TYHFFHWKKGTPFA+DQGIYNRLTWWEQ+DNGKQLT NRKFLTVVPVVLYLIASHTT
Sbjct  61   FLVTYHFFHWKKGTPFAEDQGIYNRLTWWEQMDNGKQLTPNRKFLTVVPVVLYLIASHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            DYQHPMLF NT AVFILVVAKFP+MHKVRIFGINAD
Sbjct  121  DYQHPMLFFNTFAVFILVVAKFPNMHKVRIFGINAD  156



>ref|XP_006491313.1| PREDICTED: uncharacterized protein C119.09c-like [Citrus sinensis]
 gb|KDO86530.1| hypothetical protein CISIN_1g031522mg [Citrus sinensis]
Length=158

 Score =   265 bits (677),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 137/156 (88%), Positives = 149/156 (96%), Gaps = 0/156 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MANLYV+A P  DLN+NTEWFTYPGVW+TYILILFF+WL+ LSVFGCSPG AWTIVNL+H
Sbjct  2    MANLYVKATPPADLNRNTEWFTYPGVWTTYILILFFAWLIVLSVFGCSPGMAWTIVNLAH  61

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F+ITYHFFHWKKGTPFA+DQGIYN LTWWEQIDNG+QLTRNRKFLTVVPVVLYLIASHTT
Sbjct  62   FLITYHFFHWKKGTPFAEDQGIYNGLTWWEQIDNGQQLTRNRKFLTVVPVVLYLIASHTT  121

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            DYQHPMLF NT+AVF+LVVAKFP+MHKVRIFGINAD
Sbjct  122  DYQHPMLFFNTLAVFVLVVAKFPNMHKVRIFGINAD  157



>ref|XP_007051495.1| ORMDL family protein [Theobroma cacao]
 gb|EOX95652.1| ORMDL family protein [Theobroma cacao]
Length=160

 Score =   265 bits (676),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 136/156 (87%), Positives = 148/156 (95%), Gaps = 0/156 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MANLYV+A P  DLN+NTEWF YPGVW+TYILILFFSWL+ LS+FGCSPG AWTIVNLSH
Sbjct  1    MANLYVKAVPPADLNRNTEWFMYPGVWTTYILILFFSWLLVLSIFGCSPGMAWTIVNLSH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F++TYHFFHWKKGTPFA+DQGIYN LTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT
Sbjct  61   FLVTYHFFHWKKGTPFAEDQGIYNGLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            DYQHPMLFLNT+AV +LV+AKFP+MHKVRIFGINAD
Sbjct  121  DYQHPMLFLNTLAVLVLVIAKFPNMHKVRIFGINAD  156



>ref|XP_007135277.1| hypothetical protein PHAVU_010G115700g [Phaseolus vulgaris]
 gb|ESW07271.1| hypothetical protein PHAVU_010G115700g [Phaseolus vulgaris]
Length=157

 Score =   264 bits (674),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 136/156 (87%), Positives = 147/156 (94%), Gaps = 0/156 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MANLYV+A P  DLN+NTEWFTYPGVW+TYILILFFSW++ LSVFGCSPG AWTIVNL H
Sbjct  1    MANLYVKAVPPADLNRNTEWFTYPGVWTTYILILFFSWILVLSVFGCSPGIAWTIVNLVH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F +TYHFFHWKKGTPFA+DQGIYNRLTWWEQ+DNGKQLTRNRKFLTVVP+VLYLIASHTT
Sbjct  61   FAVTYHFFHWKKGTPFAEDQGIYNRLTWWEQVDNGKQLTRNRKFLTVVPLVLYLIASHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            DYQ+PMLF NTVAV +LVVAKFPHMHKVRIFGINAD
Sbjct  121  DYQNPMLFFNTVAVIVLVVAKFPHMHKVRIFGINAD  156



>ref|XP_002266406.1| PREDICTED: ORM1-like protein 2 [Vitis vinifera]
 emb|CAN64101.1| hypothetical protein VITISV_008727 [Vitis vinifera]
 emb|CBI40581.3| unnamed protein product [Vitis vinifera]
Length=157

 Score =   263 bits (673),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 134/156 (86%), Positives = 148/156 (95%), Gaps = 0/156 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MANLYV+A P  DLN+NTEWFTYPGVW+TYILILFF+WL+ LS+FGCSPG AWT+VNL H
Sbjct  1    MANLYVKAEPPADLNRNTEWFTYPGVWTTYILILFFAWLLVLSIFGCSPGMAWTVVNLFH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F++TYHFFHWKKGTPFA+DQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT
Sbjct  61   FLVTYHFFHWKKGTPFAEDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            DYQHPMLF NT+AV +LV+AKFP+MHKVRIFGINAD
Sbjct  121  DYQHPMLFFNTLAVIVLVIAKFPNMHKVRIFGINAD  156



>ref|XP_010544953.1| PREDICTED: ORM1-like protein 3 [Tarenaya hassleriana]
 ref|XP_010544961.1| PREDICTED: ORM1-like protein 3 [Tarenaya hassleriana]
 ref|XP_010544969.1| PREDICTED: ORM1-like protein 3 [Tarenaya hassleriana]
 ref|XP_010544977.1| PREDICTED: ORM1-like protein 3 [Tarenaya hassleriana]
 ref|XP_010544985.1| PREDICTED: ORM1-like protein 3 [Tarenaya hassleriana]
Length=155

 Score =   263 bits (671),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 137/153 (90%), Positives = 148/153 (97%), Gaps = 0/153 (0%)
 Frame = +1

Query  100  LYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMI  279
            +YVRA P TD+N+NTEWFTYPGVW+TYILILFFSWL+ LSVFGCSPG AWTIV+L+HF++
Sbjct  2    MYVRAVPPTDVNRNTEWFTYPGVWTTYILILFFSWLIVLSVFGCSPGMAWTIVHLAHFVV  61

Query  280  TYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQ  459
            TYH FHW+KGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQ
Sbjct  62   TYHSFHWRKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQ  121

Query  460  HPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            HPMLFLNT+AVFILVVAKFPHMHKVRIFGINAD
Sbjct  122  HPMLFLNTLAVFILVVAKFPHMHKVRIFGINAD  154



>ref|XP_010694659.1| PREDICTED: ORM1-like protein 3 [Beta vulgaris subsp. vulgaris]
Length=157

 Score =   263 bits (671),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 132/156 (85%), Positives = 145/156 (93%), Gaps = 0/156 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MANLYV+A+P  DLN+NTEWFTYPGVW+TYIL LFF+WL+ LSV GC+PG AWTIVNL H
Sbjct  1    MANLYVKASPPPDLNRNTEWFTYPGVWTTYILFLFFAWLLVLSVSGCTPGMAWTIVNLGH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F +TYHFFHWKKGTPF+DDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT
Sbjct  61   FAVTYHFFHWKKGTPFSDDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            DY+HPMLF NT+A+ ILV+AKFPHMHKVRIFGIN D
Sbjct  121  DYEHPMLFFNTIAMIILVIAKFPHMHKVRIFGINGD  156



>emb|CDP12207.1| unnamed protein product [Coffea canephora]
Length=157

 Score =   262 bits (670),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 137/156 (88%), Positives = 148/156 (95%), Gaps = 0/156 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MANLYV+A P TDLN+NTEWFTYPGVW+TYILILFFSWL+ LSVFGCSPG AW++V+LSH
Sbjct  1    MANLYVKAVPPTDLNRNTEWFTYPGVWTTYILILFFSWLMVLSVFGCSPGIAWSVVHLSH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
             +ITYH FHWKKGTPF+DDQGIYNRLTWWEQID+GKQLTRNRKFLTVVPVVLYLIASHTT
Sbjct  61   SLITYHCFHWKKGTPFSDDQGIYNRLTWWEQIDSGKQLTRNRKFLTVVPVVLYLIASHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            DYQHPML  NTVAVF+LVVAKFPHMHKVRIFGINAD
Sbjct  121  DYQHPMLLFNTVAVFVLVVAKFPHMHKVRIFGINAD  156



>ref|XP_011101008.1| PREDICTED: ORM1-like protein 3 [Sesamum indicum]
Length=157

 Score =   262 bits (669),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 137/156 (88%), Positives = 148/156 (95%), Gaps = 0/156 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MANLYV+A PTTDLNKNTEWFTYP  W+TYILILFFSWLV LSVFGCS G AWT+V+LSH
Sbjct  1    MANLYVQATPTTDLNKNTEWFTYPAAWTTYILILFFSWLVVLSVFGCSAGMAWTVVHLSH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F++TY FFHWKKGTPF+DDQG+YNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT
Sbjct  61   FVVTYQFFHWKKGTPFSDDQGVYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            +YQHPMLF NT+AVFILVVAKFP+MHKVRIFGINAD
Sbjct  121  NYQHPMLFFNTIAVFILVVAKFPNMHKVRIFGINAD  156



>ref|XP_006391597.1| hypothetical protein EUTSA_v10023737mg [Eutrema salsugineum]
 gb|ESQ28883.1| hypothetical protein EUTSA_v10023737mg [Eutrema salsugineum]
Length=155

 Score =   262 bits (669),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 134/153 (88%), Positives = 146/153 (95%), Gaps = 0/153 (0%)
 Frame = +1

Query  100  LYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMI  279
            +YVRA PTTD+N+NTEWFTYPGVW+TYILILFF WL+ LS+F CSPG AWTIV+L+HF +
Sbjct  2    MYVRAVPTTDVNRNTEWFTYPGVWTTYILILFFGWLLVLSIFNCSPGMAWTIVHLAHFSV  61

Query  280  TYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQ  459
            TYHFFHWKKGTPF DDQGIYNRLTWWEQIDNGKQLTRNRKFLT+VPVVLYLIASHTTDYQ
Sbjct  62   TYHFFHWKKGTPFGDDQGIYNRLTWWEQIDNGKQLTRNRKFLTLVPVVLYLIASHTTDYQ  121

Query  460  HPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            HPMLFLNT+AVFI+VVAKFPHMHKVRIFGINAD
Sbjct  122  HPMLFLNTLAVFIMVVAKFPHMHKVRIFGINAD  154



>ref|XP_009617119.1| PREDICTED: ORM1-like protein 3 [Nicotiana tomentosiformis]
Length=157

 Score =   262 bits (669),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 140/156 (90%), Positives = 147/156 (94%), Gaps = 0/156 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MANLYV A P TDLN+NTEWFTYPGVW+TYILILFFSWLV LSVFGCSPG AWTIV+LSH
Sbjct  1    MANLYVTAVPPTDLNRNTEWFTYPGVWTTYILILFFSWLVVLSVFGCSPGMAWTIVHLSH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F++TY  FHWKKGTPF+DDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT
Sbjct  61   FLVTYQCFHWKKGTPFSDDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            DYQHPMLF NT AVFILVVAKFP+MHKVRIFGINAD
Sbjct  121  DYQHPMLFFNTFAVFILVVAKFPNMHKVRIFGINAD  156



>ref|XP_010267515.1| PREDICTED: ORM1-like protein 3 [Nelumbo nucifera]
Length=157

 Score =   262 bits (669),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 138/156 (88%), Positives = 147/156 (94%), Gaps = 0/156 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            M+ LYV AAP TDLNKNTEWF YPGVW+TYILILFFSWL+ LS+FGC+PG AWTIVNL H
Sbjct  1    MSKLYVHAAPPTDLNKNTEWFMYPGVWTTYILILFFSWLLVLSLFGCTPGMAWTIVNLCH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F +TYHFFHWKKGTPFA+DQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT
Sbjct  61   FAVTYHFFHWKKGTPFAEDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            DYQHPML LNT+AVFILVVAKFP+MHKVRIFGINAD
Sbjct  121  DYQHPMLALNTLAVFILVVAKFPNMHKVRIFGINAD  156



>ref|XP_002302648.1| ORMDL family protein [Populus trichocarpa]
 gb|EEE81921.1| ORMDL family protein [Populus trichocarpa]
Length=157

 Score =   261 bits (668),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 135/156 (87%), Positives = 144/156 (92%), Gaps = 0/156 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MANLYV A PT DLN+NTEWF YPGVW+TYILILFF WL+ L++FGCSPG AWTIVNLSH
Sbjct  1    MANLYVTAVPTADLNRNTEWFMYPGVWTTYILILFFFWLIVLAIFGCSPGLAWTIVNLSH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F ITYHFFHWKKGTPFA+DQGIYNRLTWWEQID GKQLTRNRKFLTVVPVVLYLIASHTT
Sbjct  61   FAITYHFFHWKKGTPFAEDQGIYNRLTWWEQIDKGKQLTRNRKFLTVVPVVLYLIASHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            DYQHPML  NT+AV +LVVAKFP+MHKVRIFGINAD
Sbjct  121  DYQHPMLIFNTLAVMVLVVAKFPNMHKVRIFGINAD  156



>ref|XP_011023143.1| PREDICTED: ORM1-like protein 3 [Populus euphratica]
Length=157

 Score =   261 bits (668),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 136/156 (87%), Positives = 144/156 (92%), Gaps = 0/156 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MANLYV A PT DLN+NTEWF YPGVW+TYILILFF WL+ LS+FGCSPG AWTIVNLSH
Sbjct  1    MANLYVTAVPTADLNRNTEWFMYPGVWTTYILILFFFWLLVLSIFGCSPGMAWTIVNLSH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F ITYHFFHWKKGTPFA+DQGIYNRLTWWEQID GKQLTRNRKFLTVVPVVLYLIASHTT
Sbjct  61   FAITYHFFHWKKGTPFAEDQGIYNRLTWWEQIDKGKQLTRNRKFLTVVPVVLYLIASHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            DYQHPML  NT+AV +LVVAKFP+MHKVRIFGINAD
Sbjct  121  DYQHPMLIFNTLAVMVLVVAKFPNMHKVRIFGINAD  156



>ref|XP_010314513.1| PREDICTED: uncharacterized protein C119.09c-like [Solanum lycopersicum]
Length=157

 Score =   261 bits (668),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 138/156 (88%), Positives = 146/156 (94%), Gaps = 0/156 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MANLYVRAAPTTDLN+NTEWFTYPGVW+ YI IL FSWLV LSVFG S G AWTIVNL+H
Sbjct  1    MANLYVRAAPTTDLNRNTEWFTYPGVWTIYIFILLFSWLVVLSVFGSSSGMAWTIVNLAH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F++TYH FHWKKGTPFA+DQGIYNRLTWWEQ+DNGKQLT NRKFLTVVPVVLYLIASHTT
Sbjct  61   FLVTYHCFHWKKGTPFAEDQGIYNRLTWWEQMDNGKQLTPNRKFLTVVPVVLYLIASHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            DYQHPMLFLNT AVFILVVAKFP+MHKVRIFGINAD
Sbjct  121  DYQHPMLFLNTFAVFILVVAKFPNMHKVRIFGINAD  156



>ref|NP_001239812.1| uncharacterized protein LOC100813346 [Glycine max]
 gb|ACU17097.1| unknown [Glycine max]
 gb|KHN15914.1| Hypothetical protein glysoja_013130 [Glycine soja]
Length=157

 Score =   261 bits (667),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 134/156 (86%), Positives = 146/156 (94%), Gaps = 0/156 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MANLYV+A P  DLN+NTEWFTYPGVW+TYILILFFSW++ LSVFGCSPG AWTIVNL+H
Sbjct  1    MANLYVKAVPPADLNRNTEWFTYPGVWTTYILILFFSWILVLSVFGCSPGIAWTIVNLAH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F +TYHFFHWKKGTPFA+DQGIYNRLTWWEQ+DNGKQLTRNRKFLTVVP+VLYLIASHTT
Sbjct  61   FAVTYHFFHWKKGTPFAEDQGIYNRLTWWEQVDNGKQLTRNRKFLTVVPLVLYLIASHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            DYQ+PM   NTVAV +LVVAKFPHMHKVRIFGINAD
Sbjct  121  DYQNPMFLFNTVAVIVLVVAKFPHMHKVRIFGINAD  156



>gb|KJB09620.1| hypothetical protein B456_001G153200 [Gossypium raimondii]
Length=157

 Score =   261 bits (667),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 133/156 (85%), Positives = 147/156 (94%), Gaps = 0/156 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MANLYV+A P  DLN+NTEWF YPGVW+TYILILFFSWL+ LS+FGCSPG AWT+VNL+H
Sbjct  1    MANLYVKAVPPADLNRNTEWFMYPGVWTTYILILFFSWLLVLSIFGCSPGMAWTVVNLAH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F++TYHFFHWKKGTPFA+DQGIYN LTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT
Sbjct  61   FLVTYHFFHWKKGTPFAEDQGIYNGLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            DYQHPMLF NT+AV +LV+AKFP+MHKVRIFGINAD
Sbjct  121  DYQHPMLFFNTLAVLVLVIAKFPNMHKVRIFGINAD  156



>ref|XP_003528781.1| PREDICTED: uncharacterized protein C119.09c-like isoform 1 [Glycine 
max]
 gb|KHN06327.1| Hypothetical protein glysoja_021165 [Glycine soja]
Length=157

 Score =   261 bits (666),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 134/156 (86%), Positives = 146/156 (94%), Gaps = 0/156 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MA LYV+A P  DLN+NTEWFTYPGVW+TYILILFFSW++ LSVFGCSPG AWTIVNL+H
Sbjct  1    MAKLYVKAVPPADLNRNTEWFTYPGVWTTYILILFFSWILVLSVFGCSPGIAWTIVNLAH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F +TYHFFHWKKGTPFA+DQGIYNRLTWWEQ+DNGKQLTRNRKFLTVVP+VLYLIASHTT
Sbjct  61   FAVTYHFFHWKKGTPFAEDQGIYNRLTWWEQVDNGKQLTRNRKFLTVVPLVLYLIASHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            DYQ+PML  NTVAV +LVVAKFPHMHKVRIFGINAD
Sbjct  121  DYQNPMLLFNTVAVIVLVVAKFPHMHKVRIFGINAD  156



>gb|KHF97455.1| ORM1-like protein 1 [Gossypium arboreum]
Length=157

 Score =   261 bits (666),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 133/156 (85%), Positives = 147/156 (94%), Gaps = 0/156 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MANLYV+A P  DLN+NTEWF YPGVW+TYILILFFSWL+ LS+FGCSPG AWT+VNL+H
Sbjct  1    MANLYVKAVPPADLNRNTEWFLYPGVWTTYILILFFSWLLVLSIFGCSPGMAWTVVNLAH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F++TYHFFHWKKGTPFA+DQGIYN LTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT
Sbjct  61   FLVTYHFFHWKKGTPFAEDQGIYNGLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            DYQHPMLF NT+AV +LV+AKFP+MHKVRIFGINAD
Sbjct  121  DYQHPMLFFNTLAVLVLVIAKFPNMHKVRIFGINAD  156



>ref|XP_010100706.1| Uncharacterized protein L484_023475 [Morus notabilis]
 gb|EXB83868.1| Uncharacterized protein L484_023475 [Morus notabilis]
Length=157

 Score =   261 bits (666),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 137/156 (88%), Positives = 147/156 (94%), Gaps = 0/156 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MANLYV+A P  DLN+NTEWF YPGVW+TYILILFFSWLV LSVF CSPG AWT+VNL+H
Sbjct  1    MANLYVQAFPPADLNRNTEWFMYPGVWTTYILILFFSWLVVLSVFACSPGMAWTVVNLAH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F +TYHFFHWKKGTPFA+DQGIYNRLTWWEQIDNG+QLTRNRKFLTVVP+VLYLIASHTT
Sbjct  61   FAVTYHFFHWKKGTPFAEDQGIYNRLTWWEQIDNGQQLTRNRKFLTVVPLVLYLIASHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            DYQHPMLFLNTVAV ILVVAKFP+MHKVRIFGINAD
Sbjct  121  DYQHPMLFLNTVAVIILVVAKFPNMHKVRIFGINAD  156



>ref|XP_004245473.1| PREDICTED: ORM1-like protein 3 [Solanum lycopersicum]
 ref|XP_006343801.1| PREDICTED: uncharacterized protein C119.09c-like [Solanum tuberosum]
Length=157

 Score =   260 bits (664),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 138/156 (88%), Positives = 147/156 (94%), Gaps = 0/156 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MAN YV A P TDLN+NTEWFTYPGVW+TYILILFFSWLV LSVFGCSPG AWTIV+LSH
Sbjct  1    MANYYVTAVPPTDLNRNTEWFTYPGVWTTYILILFFSWLVVLSVFGCSPGMAWTIVHLSH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F++TY  FHWKKGTPFADDQGIYNRLTWWEQID+GKQLTRNRKFLTVVPVVLYLIASHTT
Sbjct  61   FLVTYQCFHWKKGTPFADDQGIYNRLTWWEQIDSGKQLTRNRKFLTVVPVVLYLIASHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            DYQHPMLF NT+AVF+LVVAKFP+MHKVRIFGINAD
Sbjct  121  DYQHPMLFFNTIAVFVLVVAKFPNMHKVRIFGINAD  156



>gb|EYU45251.1| hypothetical protein MIMGU_mgv1a015446mg [Erythranthe guttata]
Length=157

 Score =   260 bits (664),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 134/156 (86%), Positives = 149/156 (96%), Gaps = 0/156 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MANLYV+A PTTDLN+NTEWFTYPGVW+ YILIL FSWLVF+SVFGCS G AWT+V+L+H
Sbjct  1    MANLYVQAVPTTDLNRNTEWFTYPGVWTIYILILMFSWLVFVSVFGCSAGMAWTVVHLAH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
             ++TYHFFHWKKGTPF+DDQGIYNRLTWWEQI+NGKQLTRNRKFLT+VP+VLYLIASHTT
Sbjct  61   SIVTYHFFHWKKGTPFSDDQGIYNRLTWWEQIENGKQLTRNRKFLTLVPIVLYLIASHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            DYQHPMLF NT+AVFILVVAKFP+MHKVRIFGINAD
Sbjct  121  DYQHPMLFFNTLAVFILVVAKFPNMHKVRIFGINAD  156



>ref|XP_006360724.1| PREDICTED: uncharacterized protein C119.09c-like [Solanum tuberosum]
Length=157

 Score =   260 bits (664),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 136/156 (87%), Positives = 145/156 (93%), Gaps = 0/156 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MANLYVRAAPTTDLN+NTEWFTYPGVW+ YI IL FSWLV +SVFG S G AWTIVNL+H
Sbjct  1    MANLYVRAAPTTDLNRNTEWFTYPGVWTIYIFILLFSWLVVMSVFGSSSGMAWTIVNLAH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F++TYH FHWKKGTPFA+DQGIYNRLTWWEQ+DNGKQLT NRKFLTVVPVVLYLIASHTT
Sbjct  61   FLVTYHCFHWKKGTPFAEDQGIYNRLTWWEQMDNGKQLTPNRKFLTVVPVVLYLIASHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            DYQHPMLF NT AVFILVVAKFP+MHKVRIFGINAD
Sbjct  121  DYQHPMLFFNTFAVFILVVAKFPNMHKVRIFGINAD  156



>ref|XP_002523307.1| ormdl, putative [Ricinus communis]
 gb|EEF39023.1| ormdl, putative [Ricinus communis]
Length=157

 Score =   259 bits (663),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 135/156 (87%), Positives = 147/156 (94%), Gaps = 0/156 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MANLYV+A P  DLN+NTEWF YPGVW+TYILILFFSWL+ LSVFGCSPG AWTIVNL+H
Sbjct  1    MANLYVKAVPPADLNRNTEWFMYPGVWTTYILILFFSWLLVLSVFGCSPGMAWTIVNLAH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F ITYHFFHWKKGTPFA+DQGIYNRLTWWEQ+D+GKQLTRNRKFLTVVPVVLYLIASHTT
Sbjct  61   FCITYHFFHWKKGTPFAEDQGIYNRLTWWEQMDSGKQLTRNRKFLTVVPVVLYLIASHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            DYQHPMLF NT+AV +LV+AKFP+MHKVRIFGINAD
Sbjct  121  DYQHPMLFFNTLAVAVLVIAKFPNMHKVRIFGINAD  156



>ref|XP_009607387.1| PREDICTED: ORM1-like protein 3 [Nicotiana tomentosiformis]
Length=157

 Score =   259 bits (663),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 132/156 (85%), Positives = 146/156 (94%), Gaps = 0/156 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MANLYV+A P  DLN+NT+WF YPGVW+TYILILFFSWL+ LS+FGCSPG AWT+VNL H
Sbjct  1    MANLYVKAVPPADLNRNTDWFMYPGVWTTYILILFFSWLLVLSLFGCSPGIAWTVVNLGH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F++TYHFFHWKKGTPFADDQGIYN+LTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT
Sbjct  61   FLVTYHFFHWKKGTPFADDQGIYNQLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            DYQHPMLF NT+AV +LV+AKFP+MHKVRIFGIN D
Sbjct  121  DYQHPMLFFNTIAVMVLVIAKFPNMHKVRIFGINGD  156



>ref|XP_011038573.1| PREDICTED: ORM1-like protein 3 [Populus euphratica]
Length=157

 Score =   259 bits (662),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 135/156 (87%), Positives = 145/156 (93%), Gaps = 0/156 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MANLYV A P  DLN+NTEWF YPGVW+TYILILFFSWL+ LS+F CSPG AWTIVNLSH
Sbjct  1    MANLYVTAVPPADLNRNTEWFMYPGVWTTYILILFFSWLIVLSIFACSPGMAWTIVNLSH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F ITYHFFHWKKGTPFA+DQGIYNRLTWWEQ+DNGKQLTRNRKFLTVVP+VLYLIASHTT
Sbjct  61   FAITYHFFHWKKGTPFAEDQGIYNRLTWWEQMDNGKQLTRNRKFLTVVPLVLYLIASHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            DY+HPMLF NTVAV +LVVAKFP+MHKVRIFGINAD
Sbjct  121  DYRHPMLFFNTVAVIVLVVAKFPNMHKVRIFGINAD  156



>ref|XP_010054988.1| PREDICTED: ORM1-like protein 3 [Eucalyptus grandis]
 gb|KCW71476.1| hypothetical protein EUGRSUZ_E00036 [Eucalyptus grandis]
Length=157

 Score =   259 bits (661),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 131/156 (84%), Positives = 146/156 (94%), Gaps = 0/156 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MANLYV+A P  DLN+NTEWF YPGVW+TYILILFFSWL+ LS+  CSPG AWT+VNLSH
Sbjct  1    MANLYVKAVPPADLNRNTEWFMYPGVWTTYILILFFSWLLVLSLTACSPGMAWTVVNLSH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F++TYHFFHWKKGTPF++DQGIYN LTWWEQ+DNGKQLTRNRKFLTVVPVVLYLIASHTT
Sbjct  61   FLVTYHFFHWKKGTPFSEDQGIYNSLTWWEQMDNGKQLTRNRKFLTVVPVVLYLIASHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            DYQ+PMLFLNT+AV +LVVAKFP+MHKVRIFGINAD
Sbjct  121  DYQNPMLFLNTLAVIVLVVAKFPNMHKVRIFGINAD  156



>ref|XP_009334366.1| PREDICTED: ORM1-like protein 2 [Pyrus x bretschneideri]
Length=157

 Score =   259 bits (661),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 133/156 (85%), Positives = 145/156 (93%), Gaps = 0/156 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MA LYV+A P  DLN+NTEWF YPGVW+TYILILFFSWL+ LS+FGCSPG AWTIVNLSH
Sbjct  1    MAGLYVKAVPPADLNRNTEWFMYPGVWTTYILILFFSWLLVLSIFGCSPGMAWTIVNLSH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F ITYHFFHWKKGTPFADDQGIYNRLTWWEQ+D+GKQLTRNRKFLTVVPVVLYLIASHTT
Sbjct  61   FAITYHFFHWKKGTPFADDQGIYNRLTWWEQMDSGKQLTRNRKFLTVVPVVLYLIASHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            DYQHPMLF N++AV +LV+AKFP+MHKVRIFGIN D
Sbjct  121  DYQHPMLFFNSLAVIVLVIAKFPNMHKVRIFGINGD  156



>gb|AFK39095.1| unknown [Lotus japonicus]
Length=157

 Score =   259 bits (661),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 134/156 (86%), Positives = 147/156 (94%), Gaps = 0/156 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MANLYV+A P  DLN+NTEWFT+PGVW+TYILILFFSW++ LSVF CSPG AWTIVNL H
Sbjct  1    MANLYVKAVPPADLNRNTEWFTHPGVWTTYILILFFSWILVLSVFSCSPGIAWTIVNLVH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F++TYHFFHWKKGTPFA+DQGIYNRLTWWEQIDNGKQLTRNRKFLTVVP+VLYLIASHTT
Sbjct  61   FLVTYHFFHWKKGTPFAEDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPLVLYLIASHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            DYQ+PMLF NTVAV +LVVAKFP+MHKVRIFGINAD
Sbjct  121  DYQNPMLFFNTVAVIVLVVAKFPNMHKVRIFGINAD  156



>ref|XP_009760285.1| PREDICTED: ORM1-like protein 3 [Nicotiana sylvestris]
Length=157

 Score =   258 bits (660),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 131/156 (84%), Positives = 146/156 (94%), Gaps = 0/156 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MANLYV+A P  DLN+NT+WF YPGVW+TYILILFFSWL+ LS+FGCSPG AWT+VNL H
Sbjct  1    MANLYVKAVPPADLNRNTDWFMYPGVWTTYILILFFSWLLVLSLFGCSPGIAWTVVNLGH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F++TYHFFHWKKGTPFADDQG+YN+LTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT
Sbjct  61   FLVTYHFFHWKKGTPFADDQGMYNQLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            DYQHPMLF NT+AV +LV+AKFP+MHKVRIFGIN D
Sbjct  121  DYQHPMLFFNTIAVMVLVIAKFPNMHKVRIFGINED  156



>gb|KDP28459.1| hypothetical protein JCGZ_14230 [Jatropha curcas]
Length=157

 Score =   258 bits (660),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 134/156 (86%), Positives = 145/156 (93%), Gaps = 0/156 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MANLYV+A P  DLN+NTEWF YPGVW+TYILILFF WL+ LS+FGCSPG AWTIVNL+H
Sbjct  1    MANLYVKAVPPADLNRNTEWFMYPGVWTTYILILFFCWLLVLSIFGCSPGMAWTIVNLAH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F ITYHFFHWKKGTPFA+DQGIYN LTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT
Sbjct  61   FCITYHFFHWKKGTPFAEDQGIYNGLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            DYQ+PMLF NT+AV +LVVAKFP+MHKVRIFGINAD
Sbjct  121  DYQYPMLFFNTLAVLVLVVAKFPNMHKVRIFGINAD  156



>gb|KFK32957.1| hypothetical protein AALP_AA6G311700 [Arabis alpina]
Length=155

 Score =   258 bits (659),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 134/153 (88%), Positives = 145/153 (95%), Gaps = 0/153 (0%)
 Frame = +1

Query  100  LYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMI  279
            +YVRA PTTD+N+NTEWFTYPGVW+TYILILFFSWL+ LS+F CS G AWTIV+LSHF +
Sbjct  2    MYVRALPTTDVNRNTEWFTYPGVWTTYILILFFSWLIVLSIFNCSSGMAWTIVHLSHFSV  61

Query  280  TYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQ  459
            TYHFFHWKKGTPF DDQGIYNRLTWWEQIDNGKQLTRNRKFLT+VPVVLYLIASHTTDYQ
Sbjct  62   TYHFFHWKKGTPFGDDQGIYNRLTWWEQIDNGKQLTRNRKFLTLVPVVLYLIASHTTDYQ  121

Query  460  HPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            HPMLFLNT+AVFI+VVAKFP MHKVRIFGINAD
Sbjct  122  HPMLFLNTLAVFIMVVAKFPRMHKVRIFGINAD  154



>emb|CDY65660.1| BnaAnng20920D [Brassica napus]
Length=155

 Score =   258 bits (659),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 133/153 (87%), Positives = 146/153 (95%), Gaps = 0/153 (0%)
 Frame = +1

Query  100  LYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMI  279
            +YVRA PTTD+N+NTEWFTYPGVW+TYILILFFSWL+ LS+F CSPG AWTIV+L+HF +
Sbjct  2    MYVRALPTTDVNRNTEWFTYPGVWTTYILILFFSWLLVLSIFNCSPGMAWTIVHLAHFAV  61

Query  280  TYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQ  459
            TYH FHWKKGTPF DDQGIYNRLTWWEQIDNGKQLTRNRKFLT+VPVVLYLIASHTTDYQ
Sbjct  62   TYHLFHWKKGTPFGDDQGIYNRLTWWEQIDNGKQLTRNRKFLTLVPVVLYLIASHTTDYQ  121

Query  460  HPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            +PMLFLNT+AVFI+VVAKFPHMHKVRIFGINAD
Sbjct  122  NPMLFLNTLAVFIMVVAKFPHMHKVRIFGINAD  154



>ref|XP_004306644.1| PREDICTED: ORM1-like protein 2 [Fragaria vesca subsp. vesca]
Length=157

 Score =   258 bits (659),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 132/156 (85%), Positives = 146/156 (94%), Gaps = 0/156 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MA+LYV+A P  DLN+NTEWF YPGVW+TYILILFFSWL+ LS+FGCSPG AWTIVNLSH
Sbjct  1    MASLYVKAVPPADLNRNTEWFMYPGVWTTYILILFFSWLLVLSIFGCSPGMAWTIVNLSH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F++TY FFHWKKGTPFA+DQGIYN LTWWEQ+DNGKQLTRNRKFLTVVPVVLYLIASHTT
Sbjct  61   FLVTYQFFHWKKGTPFAEDQGIYNGLTWWEQMDNGKQLTRNRKFLTVVPVVLYLIASHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            DYQHPMLFLNT+AV +LV+AKFP+MHKVRIFGIN D
Sbjct  121  DYQHPMLFLNTLAVIVLVIAKFPNMHKVRIFGINGD  156



>gb|AFK48443.1| unknown [Lotus japonicus]
Length=157

 Score =   258 bits (659),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 133/156 (85%), Positives = 146/156 (94%), Gaps = 0/156 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MANLYV+A P  DLN+NTEWFTYPGVW+TYILILFFSW++ LSVF CSPG AWTIVNL H
Sbjct  1    MANLYVKAVPPADLNRNTEWFTYPGVWTTYILILFFSWILVLSVFSCSPGIAWTIVNLVH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F++TYHFFHWKKGTPFA+DQGIYNRLTWWE+IDNGKQL RNRKFLTVVP+VLYLIASHTT
Sbjct  61   FLVTYHFFHWKKGTPFAEDQGIYNRLTWWERIDNGKQLARNRKFLTVVPLVLYLIASHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            DYQ+PMLF NTVAV +LVVAKFP+MHKVRIFGINAD
Sbjct  121  DYQNPMLFFNTVAVIVLVVAKFPNMHKVRIFGINAD  156



>ref|XP_002320877.1| ORMDL family protein [Populus trichocarpa]
 gb|ABK92655.1| unknown [Populus trichocarpa]
 gb|ABK96618.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE99192.1| ORMDL family protein [Populus trichocarpa]
Length=157

 Score =   258 bits (658),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 134/156 (86%), Positives = 145/156 (93%), Gaps = 0/156 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MANLYV A P  DLN+NTEWF YPGVW+TYILILFFSWL+ LS+F CSPG AWTIVNLSH
Sbjct  1    MANLYVTAVPPADLNRNTEWFMYPGVWTTYILILFFSWLIVLSIFACSPGMAWTIVNLSH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F ITYHFFHWKKGTPFA+DQGIYNRLTWWEQ+D+GKQLTRNRKFLTVVP+VLYLIASHTT
Sbjct  61   FAITYHFFHWKKGTPFAEDQGIYNRLTWWEQMDSGKQLTRNRKFLTVVPLVLYLIASHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            DY+HPMLF NTVAV +LVVAKFP+MHKVRIFGINAD
Sbjct  121  DYRHPMLFFNTVAVIVLVVAKFPNMHKVRIFGINAD  156



>ref|XP_006405287.1| hypothetical protein EUTSA_v10027975mg [Eutrema salsugineum]
 gb|ESQ46740.1| hypothetical protein EUTSA_v10027975mg [Eutrema salsugineum]
Length=154

 Score =   257 bits (657),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 133/153 (87%), Positives = 146/153 (95%), Gaps = 0/153 (0%)
 Frame = +1

Query  100  LYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMI  279
            +YVRA PTTD+N+NTEWFTYPGVW+TYILILFFSWL+ LSVF CSPG AWT+V+L+HF +
Sbjct  1    MYVRAVPTTDVNRNTEWFTYPGVWTTYILILFFSWLLVLSVFHCSPGIAWTVVHLAHFTV  60

Query  280  TYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQ  459
            TYH FHWKKGTPF DDQGIYNRLTWWEQIDNGKQLTRNRKFLT+VPVVLYLIASHTTDYQ
Sbjct  61   TYHSFHWKKGTPFGDDQGIYNRLTWWEQIDNGKQLTRNRKFLTLVPVVLYLIASHTTDYQ  120

Query  460  HPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            HPMLFLNT+AVF++VVAKFPHMHKVRIFGINAD
Sbjct  121  HPMLFLNTLAVFVMVVAKFPHMHKVRIFGINAD  153



>ref|XP_010106134.1| Uncharacterized protein L484_003637 [Morus notabilis]
 gb|EXC07928.1| Uncharacterized protein L484_003637 [Morus notabilis]
Length=154

 Score =   257 bits (656),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 133/153 (87%), Positives = 147/153 (96%), Gaps = 0/153 (0%)
 Frame = +1

Query  100  LYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMI  279
            +YV+A PTTDLN+NTEWFTYPGVW+TYILILFFSWL+ LS+FGCS G AWTIV+L+HF++
Sbjct  1    MYVKAVPTTDLNRNTEWFTYPGVWTTYILILFFSWLIVLSLFGCSSGMAWTIVHLAHFLV  60

Query  280  TYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQ  459
            TY FFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDY+
Sbjct  61   TYQFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYE  120

Query  460  HPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            +PMLF NT+AVFILVVAKFP+MHKVRIFGINAD
Sbjct  121  NPMLFFNTLAVFILVVAKFPNMHKVRIFGINAD  153



>ref|XP_002870598.1| ORMDL family protein [Arabidopsis lyrata subsp. lyrata]
 ref|XP_006284679.1| hypothetical protein CARUB_v10005937mg [Capsella rubella]
 ref|XP_010446938.1| PREDICTED: ORM1-like protein 3 [Camelina sativa]
 ref|XP_010441381.1| PREDICTED: ORM1-like protein 3 [Camelina sativa]
 gb|EFH46857.1| ORMDL family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EOA17577.1| hypothetical protein CARUB_v10005937mg [Capsella rubella]
Length=154

 Score =   257 bits (656),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 134/153 (88%), Positives = 145/153 (95%), Gaps = 0/153 (0%)
 Frame = +1

Query  100  LYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMI  279
            +YVRA PTTD+N+NTEWFTYPGVW+TYILILFFSWL+ LSVF CSPG AWTIV+L+HF +
Sbjct  1    MYVRALPTTDVNRNTEWFTYPGVWTTYILILFFSWLLVLSVFHCSPGIAWTIVHLAHFTV  60

Query  280  TYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQ  459
            TYH FHWKKGTPF DDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQ
Sbjct  61   TYHSFHWKKGTPFGDDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQ  120

Query  460  HPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            HPMLFLNT+AVF++VVAKFPHMHKVRIFGIN D
Sbjct  121  HPMLFLNTLAVFVMVVAKFPHMHKVRIFGINGD  153



>ref|XP_009125212.1| PREDICTED: ORM1-like protein 3 [Brassica rapa]
 emb|CDX67521.1| BnaA07g15610D [Brassica napus]
Length=154

 Score =   256 bits (655),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 133/153 (87%), Positives = 145/153 (95%), Gaps = 0/153 (0%)
 Frame = +1

Query  100  LYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMI  279
            +YVRA PTTD+N+NTEWFTYPGVW+TYILILFFSWL+ LSVF CSPG AWTIV+L+HF +
Sbjct  1    MYVRALPTTDVNRNTEWFTYPGVWTTYILILFFSWLLVLSVFHCSPGMAWTIVHLAHFTV  60

Query  280  TYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQ  459
            TYH FHWKKGTPF DDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVP+VLYLIASHTTDYQ
Sbjct  61   TYHSFHWKKGTPFGDDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPIVLYLIASHTTDYQ  120

Query  460  HPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            HPMLFLNT+AVF++VVAKFPHMHKVRIFGIN D
Sbjct  121  HPMLFLNTLAVFVMVVAKFPHMHKVRIFGINGD  153



>emb|CDY13373.1| BnaC06g13840D [Brassica napus]
Length=154

 Score =   256 bits (655),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 132/153 (86%), Positives = 145/153 (95%), Gaps = 0/153 (0%)
 Frame = +1

Query  100  LYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMI  279
            +YVRA PTTD+N+NTEWFTYPGVW+TYI+ILFFSWL+ LSVF CSPG AWTIV+L+HF +
Sbjct  1    MYVRALPTTDVNRNTEWFTYPGVWTTYIIILFFSWLLVLSVFHCSPGMAWTIVHLAHFTV  60

Query  280  TYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQ  459
            TYH FHWKKGTPF DDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVP+VLYLIASHTTDYQ
Sbjct  61   TYHSFHWKKGTPFGDDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPIVLYLIASHTTDYQ  120

Query  460  HPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            HPMLFLNT+AVF++VVAKFPHMHKVRIFGIN D
Sbjct  121  HPMLFLNTLAVFVMVVAKFPHMHKVRIFGINGD  153



>ref|NP_199015.1| ORMDL domain-containing protein [Arabidopsis thaliana]
 ref|XP_010436149.1| PREDICTED: ORM1-like protein 3 [Camelina sativa]
 dbj|BAB08433.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAS47671.1| At5g42000 [Arabidopsis thaliana]
 dbj|BAD94546.1| putative protein [Arabidopsis thaliana]
 gb|AED94752.1| ORMDL domain-containing protein [Arabidopsis thaliana]
Length=154

 Score =   256 bits (654),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 133/153 (87%), Positives = 145/153 (95%), Gaps = 0/153 (0%)
 Frame = +1

Query  100  LYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMI  279
            +YVRA PTTD+N+NTEWFTYPGVW+TYILILFFSWL+ LSVF CSPG AWTIV+L+HF +
Sbjct  1    MYVRALPTTDVNRNTEWFTYPGVWTTYILILFFSWLLVLSVFHCSPGIAWTIVHLAHFTV  60

Query  280  TYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQ  459
            TYH FHWKKGTPF DDQG+YNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQ
Sbjct  61   TYHSFHWKKGTPFGDDQGVYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQ  120

Query  460  HPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            HPMLFLNT+AVF++VVAKFPHMHKVRIFGIN D
Sbjct  121  HPMLFLNTLAVFVMVVAKFPHMHKVRIFGINGD  153



>ref|XP_009112851.1| PREDICTED: uncharacterized protein C119.09c-like [Brassica rapa]
Length=155

 Score =   256 bits (654),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 133/153 (87%), Positives = 145/153 (95%), Gaps = 0/153 (0%)
 Frame = +1

Query  100  LYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMI  279
            +YVRA PTTD+N+NTEWFTYPGVW+TYILILFFSWL+ LS+F CSPG AWTIV+L+HF  
Sbjct  2    MYVRALPTTDVNRNTEWFTYPGVWTTYILILFFSWLLVLSIFNCSPGMAWTIVHLAHFAA  61

Query  280  TYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQ  459
            TYH FHWKKGTPF DDQGIYNRLTWWEQIDNGKQLTRNRKFLT+VPVVLYLIASHTTDYQ
Sbjct  62   TYHLFHWKKGTPFGDDQGIYNRLTWWEQIDNGKQLTRNRKFLTLVPVVLYLIASHTTDYQ  121

Query  460  HPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            +PMLFLNT+AVFI+VVAKFPHMHKVRIFGINAD
Sbjct  122  NPMLFLNTLAVFIMVVAKFPHMHKVRIFGINAD  154



>emb|CDY61368.1| BnaA09g53130D [Brassica napus]
Length=154

 Score =   256 bits (654),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 133/153 (87%), Positives = 145/153 (95%), Gaps = 0/153 (0%)
 Frame = +1

Query  100  LYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMI  279
            +YVRA PTTD+N+NTEWFTYPGVW+TYILILFFSWL+ LS+F CSPG AWTIV+L+HF  
Sbjct  1    MYVRALPTTDVNRNTEWFTYPGVWTTYILILFFSWLLVLSIFNCSPGMAWTIVHLAHFAA  60

Query  280  TYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQ  459
            TYH FHWKKGTPF DDQGIYNRLTWWEQIDNGKQLTRNRKFLT+VPVVLYLIASHTTDYQ
Sbjct  61   TYHLFHWKKGTPFGDDQGIYNRLTWWEQIDNGKQLTRNRKFLTLVPVVLYLIASHTTDYQ  120

Query  460  HPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            +PMLFLNT+AVFI+VVAKFPHMHKVRIFGINAD
Sbjct  121  NPMLFLNTLAVFIMVVAKFPHMHKVRIFGINAD  153



>ref|XP_008376160.1| PREDICTED: ORM1-like protein 2 [Malus domestica]
Length=157

 Score =   256 bits (653),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 131/156 (84%), Positives = 145/156 (93%), Gaps = 0/156 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MA+LYV+A P  DLN+NTEWF YPGVW+TYILILFFSWL+ LS+FGCSPG AWTIVNLSH
Sbjct  1    MASLYVKAVPPADLNRNTEWFMYPGVWTTYILILFFSWLLVLSIFGCSPGMAWTIVNLSH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F +TYHFFHWKKGTPFADDQGIYN LTWWEQ+D+GKQLTRNRKFLTVVPVVLYLIASHTT
Sbjct  61   FAVTYHFFHWKKGTPFADDQGIYNGLTWWEQMDSGKQLTRNRKFLTVVPVVLYLIASHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            DYQHPMLF N++AV +LV+AKFP+MHKVRIFGIN D
Sbjct  121  DYQHPMLFFNSLAVIVLVIAKFPNMHKVRIFGINGD  156



>ref|XP_007218539.1| hypothetical protein PRUPE_ppa012722mg [Prunus persica]
 ref|XP_008233110.1| PREDICTED: ORM1-like protein 2 [Prunus mume]
 gb|EMJ19738.1| hypothetical protein PRUPE_ppa012722mg [Prunus persica]
Length=157

 Score =   256 bits (653),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 130/156 (83%), Positives = 146/156 (94%), Gaps = 0/156 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MA+LYV+A P  DLN+NTEWF YPGVW+TYILILFFSWL+ LS+FGCSPG AWTIVNLSH
Sbjct  1    MASLYVKAVPPADLNRNTEWFMYPGVWTTYILILFFSWLLVLSIFGCSPGMAWTIVNLSH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F++TYHFFHWKKGTPFA+DQGIYN LTWWEQ+D+GKQLTRNRKFLTVVPVVLYLIASHTT
Sbjct  61   FLVTYHFFHWKKGTPFAEDQGIYNGLTWWEQMDSGKQLTRNRKFLTVVPVVLYLIASHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            DYQHPMLF N++AV +LV+AKFP+MHKVRIFGIN D
Sbjct  121  DYQHPMLFFNSLAVIVLVIAKFPNMHKVRIFGINGD  156



>ref|XP_010055997.1| PREDICTED: ORM1-like protein 3 [Eucalyptus grandis]
 gb|KCW72564.1| hypothetical protein EUGRSUZ_E01032 [Eucalyptus grandis]
Length=154

 Score =   256 bits (653),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 131/153 (86%), Positives = 146/153 (95%), Gaps = 0/153 (0%)
 Frame = +1

Query  100  LYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMI  279
            +YV+A P TDLN+NTEWFTYPGVW+TYILILF SWL+ LS+F CSPG AWTIVNLSHF++
Sbjct  1    MYVKAVPPTDLNRNTEWFTYPGVWTTYILILFISWLIVLSLFNCSPGMAWTIVNLSHFLV  60

Query  280  TYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQ  459
            TYHFFHWKKGTPF+DDQGIYN LTWWEQID+GKQLTRNRKFLTVVPVVLYLIASHTTDY+
Sbjct  61   TYHFFHWKKGTPFSDDQGIYNALTWWEQIDSGKQLTRNRKFLTVVPVVLYLIASHTTDYK  120

Query  460  HPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            +PMLFLNT+AVF+LVVAKFP+MHKVRIFGINAD
Sbjct  121  NPMLFLNTLAVFVLVVAKFPNMHKVRIFGINAD  153



>ref|XP_010522906.1| PREDICTED: ORM1-like protein 2 [Tarenaya hassleriana]
Length=156

 Score =   256 bits (653),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 131/156 (84%), Positives = 145/156 (93%), Gaps = 0/156 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MANLYV+A P  DLN+NTEWF YPGVW+TYILILFF+WL+ LSV GCSPG AWT+VNL+H
Sbjct  1    MANLYVKAVPPADLNRNTEWFMYPGVWTTYILILFFAWLIVLSVSGCSPGMAWTVVNLAH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F +TYHFFHWKKGTPFA+DQGIYN LTWWEQ+DNGKQLTRNRKFLTVVPVVLYLIASHTT
Sbjct  61   FAVTYHFFHWKKGTPFAEDQGIYNSLTWWEQMDNGKQLTRNRKFLTVVPVVLYLIASHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            DY+HP LFLNT+AV ILVVAKFP+MHKVRIFGIN+D
Sbjct  121  DYRHPWLFLNTLAVIILVVAKFPNMHKVRIFGINSD  156



>ref|XP_002262624.1| PREDICTED: ORM1-like protein 2 [Vitis vinifera]
 emb|CAN68846.1| hypothetical protein VITISV_024149 [Vitis vinifera]
 emb|CBI34558.3| unnamed protein product [Vitis vinifera]
Length=157

 Score =   256 bits (653),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 132/156 (85%), Positives = 146/156 (94%), Gaps = 0/156 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MA LYV+A P TDLN+NTEWFTYPGVW+TYILILFFSWL+ LS+  CS G AWTI++LSH
Sbjct  1    MAKLYVQALPPTDLNRNTEWFTYPGVWTTYILILFFSWLLVLSLLRCSSGAAWTILHLSH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F++TYH FHWKKGTPFADDQGIYNRLTWWEQID+GKQLTRNRKFLTVVP+VLYLIASHTT
Sbjct  61   FLVTYHCFHWKKGTPFADDQGIYNRLTWWEQIDSGKQLTRNRKFLTVVPLVLYLIASHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            DYQHPMLF NT+AVF+LVVAKFP+MHKVRIFGINAD
Sbjct  121  DYQHPMLFFNTLAVFVLVVAKFPNMHKVRIFGINAD  156



>ref|XP_007039444.1| ORMDL family protein [Theobroma cacao]
 gb|EOY23945.1| ORMDL family protein [Theobroma cacao]
Length=154

 Score =   255 bits (652),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 134/153 (88%), Positives = 145/153 (95%), Gaps = 0/153 (0%)
 Frame = +1

Query  100  LYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMI  279
            +YVRA P TDLN+NTEWFTYPGVW+TYILILFFSWL+ LS+FG SPGTAWTIV+LSHF +
Sbjct  1    MYVRAVPPTDLNRNTEWFTYPGVWTTYILILFFSWLIVLSLFGSSPGTAWTIVHLSHFFV  60

Query  280  TYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQ  459
            TYHFFHWKKGTPF DDQGIYN LTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQ
Sbjct  61   TYHFFHWKKGTPFGDDQGIYNGLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQ  120

Query  460  HPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            +PMLF NT+AVF+LVVAKFP+MHKVRIFGINAD
Sbjct  121  NPMLFFNTLAVFVLVVAKFPNMHKVRIFGINAD  153



>ref|XP_009375425.1| PREDICTED: ORM1-like protein 2 [Pyrus x bretschneideri]
Length=158

 Score =   255 bits (651),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 131/156 (84%), Positives = 145/156 (93%), Gaps = 0/156 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MA+LYV+AAP  DLN+NTEWF YPGVW+TYILILFFSWL+ LS+FGCSPG AWTIVNLSH
Sbjct  1    MASLYVKAAPPADLNRNTEWFMYPGVWTTYILILFFSWLLVLSIFGCSPGMAWTIVNLSH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F ITYHFFHWKKGTPFA+DQGIYN LTWWEQ+D GKQLTRNRKFLTVVPVVLYLIASHTT
Sbjct  61   FAITYHFFHWKKGTPFAEDQGIYNGLTWWEQMDGGKQLTRNRKFLTVVPVVLYLIASHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            DYQHPMLF N++AV +LV+AKFP+MHKVRIFGIN +
Sbjct  121  DYQHPMLFFNSLAVIVLVIAKFPNMHKVRIFGINGE  156



>ref|XP_010553574.1| PREDICTED: ORM1-like protein 2 isoform X2 [Tarenaya hassleriana]
Length=155

 Score =   254 bits (650),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 133/153 (87%), Positives = 147/153 (96%), Gaps = 0/153 (0%)
 Frame = +1

Query  100  LYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMI  279
            +YV  APTTD+N+NTEWFTYPGVW+TYI ILFFSWL+FLSVFGCSPG AWTIV+L+HF+ 
Sbjct  2    VYVSTAPTTDVNRNTEWFTYPGVWTTYISILFFSWLIFLSVFGCSPGMAWTIVHLAHFIA  61

Query  280  TYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQ  459
            TY+FFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTV+PVVLYLIASHTT+Y+
Sbjct  62   TYNFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVIPVVLYLIASHTTNYE  121

Query  460  HPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            HPMLF+NT+AV ILVVAKFPHMHKVRIFGINAD
Sbjct  122  HPMLFINTLAVCILVVAKFPHMHKVRIFGINAD  154



>ref|XP_009400445.1| PREDICTED: ORM1-like protein 3 [Musa acuminata subsp. malaccensis]
Length=157

 Score =   254 bits (650),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MA LYV+A P  D+NKNTEWF YPGVW+TYILILFFSWLVFLS+FGC+PGTAWTIVNL H
Sbjct  1    MAKLYVQAVPPVDMNKNTEWFMYPGVWTTYILILFFSWLVFLSIFGCNPGTAWTIVNLVH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F ITYHFFHWKKGTPF+DDQGIYN LTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT
Sbjct  61   FAITYHFFHWKKGTPFSDDQGIYNSLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINA  555
            DY+HPMLFLNTVAV +LV+AK P+MHKVRIFGINA
Sbjct  121  DYRHPMLFLNTVAVIVLVIAKLPNMHKVRIFGINA  155



>ref|XP_010933840.1| PREDICTED: ORM1-like protein 3 [Elaeis guineensis]
Length=157

 Score =   254 bits (649),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MA LYV+A P  DLNKNTEWF YPGVW+TYILILFFSWL+ LSVFGC+PG AWTIVNL H
Sbjct  1    MAKLYVQAVPPADLNKNTEWFMYPGVWTTYILILFFSWLLVLSVFGCTPGMAWTIVNLFH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F ITYHFFHWKKGTPFADDQGIYN LTWWEQ+DNGKQLTRNRKFLTVVPVVLYLIASHTT
Sbjct  61   FAITYHFFHWKKGTPFADDQGIYNTLTWWEQMDNGKQLTRNRKFLTVVPVVLYLIASHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINA  555
            DYQHPMLFLNT+AV +LVVAK P+MHKVRIFGINA
Sbjct  121  DYQHPMLFLNTLAVIVLVVAKLPNMHKVRIFGINA  155



>gb|KHG27773.1| ORM1-like protein 2 [Gossypium arboreum]
 gb|KJB52344.1| hypothetical protein B456_008G256900 [Gossypium raimondii]
Length=154

 Score =   254 bits (649),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 130/153 (85%), Positives = 144/153 (94%), Gaps = 0/153 (0%)
 Frame = +1

Query  100  LYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMI  279
            +YVRA PTTDLNKNTEWFTYPGVW+TYIL++F SWL+ LS+FG S GTAWTIV+L+HF +
Sbjct  1    MYVRAVPTTDLNKNTEWFTYPGVWTTYILMVFISWLLVLSLFGTSAGTAWTIVHLAHFFV  60

Query  280  TYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQ  459
            TYHFFHWKKGTPFADDQGIYN LTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQ
Sbjct  61   TYHFFHWKKGTPFADDQGIYNGLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQ  120

Query  460  HPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            +PMLF NT+AVF+LVVAKFP+MHKVRIFGIN +
Sbjct  121  NPMLFFNTLAVFVLVVAKFPNMHKVRIFGINGE  153



>ref|XP_007135276.1| hypothetical protein PHAVU_010G115700g [Phaseolus vulgaris]
 gb|ESW07270.1| hypothetical protein PHAVU_010G115700g [Phaseolus vulgaris]
Length=153

 Score =   254 bits (648),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 134/156 (86%), Positives = 145/156 (93%), Gaps = 4/156 (3%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MANLYV+A P  DLN+NTEWFTYPGVW+TYILILFFSW++ LSVFGCSPG AWTIVNL  
Sbjct  1    MANLYVKAVPPADLNRNTEWFTYPGVWTTYILILFFSWILVLSVFGCSPGIAWTIVNL--  58

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
              +TYHFFHWKKGTPFA+DQGIYNRLTWWEQ+DNGKQLTRNRKFLTVVP+VLYLIASHTT
Sbjct  59   --VTYHFFHWKKGTPFAEDQGIYNRLTWWEQVDNGKQLTRNRKFLTVVPLVLYLIASHTT  116

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            DYQ+PMLF NTVAV +LVVAKFPHMHKVRIFGINAD
Sbjct  117  DYQNPMLFFNTVAVIVLVVAKFPHMHKVRIFGINAD  152



>ref|XP_010252767.1| PREDICTED: ORM1-like protein 3 [Nelumbo nucifera]
Length=157

 Score =   254 bits (648),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 135/156 (87%), Positives = 144/156 (92%), Gaps = 0/156 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            M+ LYV A P  DLNKNTEWF YPGVW+TYILILFFSWLV LS+FGC+PG AWTIVNL H
Sbjct  1    MSKLYVHAVPPPDLNKNTEWFMYPGVWTTYILILFFSWLVVLSLFGCTPGMAWTIVNLCH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F++TYHFFHWKKGTPFA+DQGIYN LTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT
Sbjct  61   FVVTYHFFHWKKGTPFAEDQGIYNGLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            DYQHPML LNT+AVFILVVAKFP+MHKVRIFGIN D
Sbjct  121  DYQHPMLALNTLAVFILVVAKFPNMHKVRIFGINGD  156



>gb|KDP25241.1| hypothetical protein JCGZ_20397 [Jatropha curcas]
Length=154

 Score =   254 bits (648),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 129/152 (85%), Positives = 144/152 (95%), Gaps = 0/152 (0%)
 Frame = +1

Query  100  LYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMI  279
            +YV+A P TD+N+NTEWFTYPGVW+TYIL++F SWL+ LS+FGCSPG AWTIV+LSHF+I
Sbjct  1    MYVKAEPPTDVNRNTEWFTYPGVWTTYILMVFMSWLLVLSLFGCSPGMAWTIVHLSHFII  60

Query  280  TYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQ  459
            TYHFFHW KGTPFADDQGIYN LTWWEQI+NGKQLTRNRKFLTVVPVVLYLIASHTTDYQ
Sbjct  61   TYHFFHWMKGTPFADDQGIYNGLTWWEQIENGKQLTRNRKFLTVVPVVLYLIASHTTDYQ  120

Query  460  HPMLFLNTVAVFILVVAKFPHMHKVRIFGINA  555
            +PMLF NT+AVF+LVVAKFPHMHKVRIFGINA
Sbjct  121  NPMLFFNTLAVFVLVVAKFPHMHKVRIFGINA  152



>gb|KHN15857.1| Hypothetical protein glysoja_013073 [Glycine soja]
Length=157

 Score =   254 bits (648),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 130/156 (83%), Positives = 144/156 (92%), Gaps = 0/156 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MA LYV+A P  DLN+NT+WFTYPGVW++YILILFFSW++ LSVFGCSPG AWTIVNL+H
Sbjct  1    MAKLYVKAVPPADLNRNTDWFTYPGVWTSYILILFFSWILVLSVFGCSPGIAWTIVNLAH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F +TY FFHWKKGTPFA+DQGIYNRLTWWEQ+DNGKQLTRNRKFLTVVP+VLYLIASHTT
Sbjct  61   FAVTYDFFHWKKGTPFAEDQGIYNRLTWWEQVDNGKQLTRNRKFLTVVPLVLYLIASHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            DYQ+PM   NTVAV +LVVAKFPHMHKVRIFGINAD
Sbjct  121  DYQNPMFLFNTVAVIVLVVAKFPHMHKVRIFGINAD  156



>ref|XP_011022440.1| PREDICTED: ORM1-like protein 1 [Populus euphratica]
Length=154

 Score =   253 bits (647),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 128/153 (84%), Positives = 145/153 (95%), Gaps = 0/153 (0%)
 Frame = +1

Query  100  LYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMI  279
            +YV+A PTTD+N+NTEWFTYPGVW+TY+LI+F SWL+ LS+FGCSPG AWTIV+L HF +
Sbjct  1    MYVKAEPTTDVNRNTEWFTYPGVWTTYMLIVFMSWLLVLSIFGCSPGMAWTIVHLCHFAV  60

Query  280  TYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQ  459
            TYHFFHWKKGTPFADDQGIYN LTWWEQI+NGKQLTRNRKFLTVVPVVLYL+ASHTTDYQ
Sbjct  61   TYHFFHWKKGTPFADDQGIYNGLTWWEQIENGKQLTRNRKFLTVVPVVLYLMASHTTDYQ  120

Query  460  HPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            +PMLF NT+AVF+LVVAKFP+MHKVRIFGINAD
Sbjct  121  NPMLFFNTLAVFVLVVAKFPNMHKVRIFGINAD  153



>ref|XP_002304572.1| ORMDL family protein [Populus trichocarpa]
 gb|EEE79551.1| ORMDL family protein [Populus trichocarpa]
Length=154

 Score =   253 bits (646),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/153 (84%), Positives = 144/153 (94%), Gaps = 0/153 (0%)
 Frame = +1

Query  100  LYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMI  279
            +YV+A PTTD+N+NTEWFTYPGVW+TY+LI+F SWL+ LS+FGCSPG AWTIV+  HF +
Sbjct  1    MYVKAEPTTDVNRNTEWFTYPGVWTTYMLIVFMSWLLVLSIFGCSPGMAWTIVHFCHFAV  60

Query  280  TYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQ  459
            TYHFFHWKKGTPFADDQGIYN LTWWEQI+NGKQLTRNRKFLTVVPVVLYLIASHTTDYQ
Sbjct  61   TYHFFHWKKGTPFADDQGIYNGLTWWEQIENGKQLTRNRKFLTVVPVVLYLIASHTTDYQ  120

Query  460  HPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            +PMLF NT+AVF+LVVAKFP+MHKVRIFGINAD
Sbjct  121  NPMLFFNTLAVFVLVVAKFPNMHKVRIFGINAD  153



>ref|XP_008790519.1| PREDICTED: ORM1-like protein 3 [Phoenix dactylifera]
Length=157

 Score =   253 bits (646),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 133/155 (86%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MA LYV+A P  DLNKNTEWF YPGVW+TYILILFFSWL+ LSVFGC+PG AWT+VNL H
Sbjct  1    MAKLYVQAVPPADLNKNTEWFMYPGVWTTYILILFFSWLLVLSVFGCTPGMAWTVVNLFH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F ITYHFFHWKKGTPFADDQG+YN LTWWEQ+DNGKQLTRNRKFLTVVPVVLYLIASHTT
Sbjct  61   FAITYHFFHWKKGTPFADDQGMYNTLTWWEQMDNGKQLTRNRKFLTVVPVVLYLIASHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINA  555
            DYQHPMLFLNT+AV +LVVAK P+MHKVRIFGINA
Sbjct  121  DYQHPMLFLNTLAVIVLVVAKLPNMHKVRIFGINA  155



>ref|XP_004230001.1| PREDICTED: ORM1-like protein 3 [Solanum lycopersicum]
Length=156

 Score =   253 bits (646),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 130/156 (83%), Positives = 143/156 (92%), Gaps = 1/156 (1%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MANLYV+A P  DLN+NT+WF YPGVW+TYILILFFSWLV  +  GCSPG AWT+VNLSH
Sbjct  1    MANLYVKAVPPADLNRNTDWFMYPGVWTTYILILFFSWLVLTAF-GCSPGMAWTVVNLSH  59

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F++TYHFFHWKKGTPFADDQG+YN+LTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT
Sbjct  60   FIVTYHFFHWKKGTPFADDQGMYNQLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  119

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            DYQ PMLF NT+AV +LVVAKFP+MHKVRIFGIN D
Sbjct  120  DYQQPMLFFNTIAVTVLVVAKFPNMHKVRIFGINGD  155



>ref|XP_011026819.1| PREDICTED: ORM1-like protein 1 [Populus euphratica]
Length=154

 Score =   253 bits (645),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 126/153 (82%), Positives = 141/153 (92%), Gaps = 0/153 (0%)
 Frame = +1

Query  100  LYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMI  279
            +YV+A P TD+N+NTEWFTYPGVW+TY+LI+F S L+ LS+FGCS G AWTIV+L HF +
Sbjct  1    MYVKAEPATDVNRNTEWFTYPGVWTTYMLIVFMSLLLVLSIFGCSAGMAWTIVHLCHFAV  60

Query  280  TYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQ  459
            TYHFFHWKKGTPFADDQGIYN LTWWEQI+NGKQLTRNRKFLTVVPVVLYLIASHTTDYQ
Sbjct  61   TYHFFHWKKGTPFADDQGIYNGLTWWEQIENGKQLTRNRKFLTVVPVVLYLIASHTTDYQ  120

Query  460  HPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            +PMLF NT+AV +LVVAKFPHMHKVRIFGINAD
Sbjct  121  NPMLFFNTLAVLVLVVAKFPHMHKVRIFGINAD  153



>ref|XP_002297957.1| ORMDL family protein [Populus trichocarpa]
 gb|EEE82762.1| ORMDL family protein [Populus trichocarpa]
Length=154

 Score =   253 bits (645),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 125/153 (82%), Positives = 140/153 (92%), Gaps = 0/153 (0%)
 Frame = +1

Query  100  LYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMI  279
            +YV+A P TD+N+NTEWFTYPGVW+ Y+LI+  S L+ LS+FGCS G AWTIV+L HF +
Sbjct  1    MYVKAEPATDVNRNTEWFTYPGVWTIYMLIVCMSLLLVLSIFGCSAGMAWTIVHLCHFAV  60

Query  280  TYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQ  459
            TYHFFHWKKGTPFADDQGIYN LTWWEQI+NGKQLTRNRKFLTVVPVVLYLIASHTTDYQ
Sbjct  61   TYHFFHWKKGTPFADDQGIYNGLTWWEQIENGKQLTRNRKFLTVVPVVLYLIASHTTDYQ  120

Query  460  HPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            +PMLF NT+AVF+LVVAKFPHMHKVRIFGINAD
Sbjct  121  NPMLFFNTLAVFVLVVAKFPHMHKVRIFGINAD  153



>ref|XP_010544436.1| PREDICTED: ORM1-like protein 3 isoform X1 [Tarenaya hassleriana]
Length=157

 Score =   253 bits (645),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 132/156 (85%), Positives = 145/156 (93%), Gaps = 0/156 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MANLYV+A P  DLN+NTEWF YPGVW+TYILILFF+WL+FLSVFGCSPG AWT+VNLSH
Sbjct  1    MANLYVKAVPPADLNRNTEWFMYPGVWTTYILILFFAWLIFLSVFGCSPGMAWTVVNLSH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F + YHFFHWKKGTPFA+DQGIYNRLTWWEQ+D GKQLTRNRKFLTVVPVVLYLIASHTT
Sbjct  61   FAVIYHFFHWKKGTPFAEDQGIYNRLTWWEQMDGGKQLTRNRKFLTVVPVVLYLIASHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            DY+HP LFLNT+AV ILV+AKFP+MHKVRIFGIN D
Sbjct  121  DYKHPWLFLNTLAVTILVIAKFPNMHKVRIFGINGD  156



>ref|XP_003580344.1| PREDICTED: ORM1-like protein 2 [Brachypodium distachyon]
Length=157

 Score =   252 bits (643),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 130/155 (84%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MA LYV+A P  DLNKNTEWF YPGVW+TYI ILF SWL+ LSVFGC+PG AWT+VNL H
Sbjct  1    MAKLYVQAVPPPDLNKNTEWFMYPGVWTTYIFILFVSWLLVLSVFGCTPGMAWTLVNLGH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F ITYHFFHWKKGTPFADDQG+YNRLTWWEQ+DNGKQLTRNRKFL VVPVVLYLIASHTT
Sbjct  61   FAITYHFFHWKKGTPFADDQGMYNRLTWWEQMDNGKQLTRNRKFLAVVPVVLYLIASHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINA  555
            DYQHPMLF NT+AV +LVVAK P+MHKVRIFGINA
Sbjct  121  DYQHPMLFFNTIAVTVLVVAKLPNMHKVRIFGINA  155



>ref|XP_002446948.1| hypothetical protein SORBIDRAFT_06g025660 [Sorghum bicolor]
 gb|EES11276.1| hypothetical protein SORBIDRAFT_06g025660 [Sorghum bicolor]
Length=157

 Score =   251 bits (642),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 130/155 (84%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MA LYV+A P  DLN+NTEWF YPGVW+TYILILFF W++ LSVFGC+PGTAWT+VNL H
Sbjct  1    MAKLYVQAVPPPDLNRNTEWFMYPGVWTTYILILFFCWILVLSVFGCAPGTAWTLVNLGH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F ITYHFFHWKKGTPFADDQG+YN LTWWEQ+DNGKQLTRNRKFLT VPVVLYLIASHTT
Sbjct  61   FAITYHFFHWKKGTPFADDQGMYNTLTWWEQMDNGKQLTRNRKFLTAVPVVLYLIASHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINA  555
            DYQHPMLFLNT+AV +LVVAK P+MHKVRIFGINA
Sbjct  121  DYQHPMLFLNTLAVIVLVVAKLPNMHKVRIFGINA  155



>ref|XP_004976521.1| PREDICTED: ORM1-like protein 3-like [Setaria italica]
Length=157

 Score =   251 bits (642),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 131/155 (85%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MA LYV+A P  DLN+NTEWF YPGVW+TYILILFFSW++ LSVFGC+PGTAWT+VNL H
Sbjct  1    MAKLYVQAVPPPDLNRNTEWFMYPGVWTTYILILFFSWILVLSVFGCAPGTAWTLVNLGH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F ITYHFFHWKKGTPFADDQG+YN LTWWEQ+DNGKQLTRNRKFLT VPVVLYLIASHTT
Sbjct  61   FAITYHFFHWKKGTPFADDQGMYNTLTWWEQMDNGKQLTRNRKFLTAVPVVLYLIASHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINA  555
            DYQHPMLFLNT+AV +LVVAK P+MHKVRIFGINA
Sbjct  121  DYQHPMLFLNTLAVTVLVVAKLPNMHKVRIFGINA  155



>ref|XP_009418131.1| PREDICTED: ORM1-like protein 3 [Musa acuminata subsp. malaccensis]
Length=164

 Score =   251 bits (641),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MA LYV A P  DLNKNTEWF YPGVW+TYILILFFSWL+ LSVFGC+PGTAWT+VNL H
Sbjct  1    MAKLYVEAVPPADLNKNTEWFMYPGVWTTYILILFFSWLLVLSVFGCNPGTAWTVVNLVH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F ITYHFFHWKKGTPF+DDQGIYN LTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT
Sbjct  61   FAITYHFFHWKKGTPFSDDQGIYNNLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINA  555
            DY+HPML LNTVAV +LVVAK+P+MHKVRIFGINA
Sbjct  121  DYRHPMLSLNTVAVIVLVVAKWPNMHKVRIFGINA  155



>ref|NP_001238512.1| uncharacterized protein LOC100527600 [Glycine max]
 gb|ACU16714.1| unknown [Glycine max]
Length=157

 Score =   251 bits (640),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 129/156 (83%), Positives = 143/156 (92%), Gaps = 0/156 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MA LYV+A P  DLN+NT+WFTYPGVW++YILILFFSW++ LSVFGCSPG AWTIVNL+H
Sbjct  1    MAKLYVKAVPPVDLNRNTDWFTYPGVWTSYILILFFSWILVLSVFGCSPGIAWTIVNLAH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F +TY FFHWKKGTPFA+DQGIYNRLTWWEQ+DNGKQLTRNRKFLTVVP+VLYLIASHTT
Sbjct  61   FAVTYDFFHWKKGTPFAEDQGIYNRLTWWEQVDNGKQLTRNRKFLTVVPLVLYLIASHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            DYQ+PM   NTVAV +LVVAKFPHMHKVRIF INAD
Sbjct  121  DYQNPMFLFNTVAVIVLVVAKFPHMHKVRIFRINAD  156



>ref|XP_011094077.1| PREDICTED: ORM1-like protein 2 [Sesamum indicum]
Length=158

 Score =   251 bits (640),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 128/156 (82%), Positives = 140/156 (90%), Gaps = 0/156 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            M  LYV+  P  DLN+NTEWFTYPGVW+TYILILFFSWL+ LS+  C+PG AWTI+NLSH
Sbjct  2    MGKLYVKMDPPADLNRNTEWFTYPGVWTTYILILFFSWLIVLSLTNCTPGMAWTILNLSH  61

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F +TYHFFHWKKGTPF DDQGIYN LTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT
Sbjct  62   FAVTYHFFHWKKGTPFGDDQGIYNGLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  121

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            DYQHPMLF NT+AV +LV+AKFP+MHKVRIFGIN D
Sbjct  122  DYQHPMLFFNTLAVLVLVIAKFPNMHKVRIFGINGD  157



>ref|XP_006439266.1| hypothetical protein CICLE_v10022658mg [Citrus clementina]
 ref|XP_006476322.1| PREDICTED: uncharacterized protein C119.09c-like [Citrus sinensis]
 gb|ESR52506.1| hypothetical protein CICLE_v10022658mg [Citrus clementina]
Length=154

 Score =   251 bits (640),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 128/153 (84%), Positives = 141/153 (92%), Gaps = 0/153 (0%)
 Frame = +1

Query  100  LYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMI  279
            +YVR  P TDLN+NTEWFTYPGVW+TY+ ILF SWL+ LS+F CS G AWT+V+LSHF +
Sbjct  1    MYVRTVPPTDLNRNTEWFTYPGVWTTYLSILFISWLLVLSLFNCSSGMAWTLVHLSHFFV  60

Query  280  TYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQ  459
            TYHFFHWKKGTPFADDQGIYN LTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQ
Sbjct  61   TYHFFHWKKGTPFADDQGIYNGLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQ  120

Query  460  HPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            +PMLF NT+AVF+LVVAKFP+MHKVRIFGINAD
Sbjct  121  NPMLFFNTLAVFVLVVAKFPNMHKVRIFGINAD  153



>gb|EPS68280.1| hypothetical protein M569_06491 [Genlisea aurea]
Length=157

 Score =   251 bits (640),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 132/156 (85%), Positives = 141/156 (90%), Gaps = 0/156 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MANLYV+A P TDLNKNTEWFTYPGVW+ YILIL FSWLV LSVFGCS G AWT+V+L H
Sbjct  1    MANLYVQAVPPTDLNKNTEWFTYPGVWTAYILILLFSWLVVLSVFGCSAGVAWTVVHLFH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
             +ITYHFFHWKKGTPFADDQGIYN LTWWEQIDNGKQLT NRKFLTV+PV LYLIASH+T
Sbjct  61   SVITYHFFHWKKGTPFADDQGIYNMLTWWEQIDNGKQLTLNRKFLTVIPVALYLIASHST  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
             YQ PML +NT+AVFILVVAKFPHMHKVRIFGINAD
Sbjct  121  SYQSPMLLINTLAVFILVVAKFPHMHKVRIFGINAD  156



>ref|XP_006339732.1| PREDICTED: uncharacterized protein C119.09c-like [Solanum tuberosum]
Length=156

 Score =   250 bits (638),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 128/156 (82%), Positives = 142/156 (91%), Gaps = 1/156 (1%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            M NLYV+A P  DLN+NT+WF YPGVW+TYILILFFSWLV  +  GCSPG AWT+VNLSH
Sbjct  1    MPNLYVKAVPPADLNRNTDWFMYPGVWTTYILILFFSWLVLTAF-GCSPGMAWTVVNLSH  59

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F++TYHFFHWKKGTPFADDQG+YN+LTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT
Sbjct  60   FIVTYHFFHWKKGTPFADDQGMYNQLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  119

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            DYQ PMLF NT+AV ++VVAKFP+MHKVRIFGIN D
Sbjct  120  DYQQPMLFFNTIAVTVMVVAKFPNMHKVRIFGINGD  155



>ref|XP_010934479.1| PREDICTED: ORM1-like protein 3 [Elaeis guineensis]
Length=157

 Score =   249 bits (637),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 130/156 (83%), Positives = 144/156 (92%), Gaps = 0/156 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MA LYV+A P  DLNKNTEWF YPGVW+TYILILFFSWL+ LSVFGC+PG AWT+VNL H
Sbjct  1    MAKLYVQAVPPADLNKNTEWFMYPGVWTTYILILFFSWLLVLSVFGCTPGMAWTVVNLFH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F +TY FFHWKKGTPFA+DQG+YN LTWWEQ+DNGKQLTRNRKFLTVVPVVLYL+ASHTT
Sbjct  61   FAVTYLFFHWKKGTPFAEDQGMYNSLTWWEQMDNGKQLTRNRKFLTVVPVVLYLLASHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            DYQ+PMLFLNT+AV +LVVAKFP+MHKVRIFGINAD
Sbjct  121  DYQNPMLFLNTLAVMVLVVAKFPNMHKVRIFGINAD  156



>ref|XP_008806928.1| PREDICTED: ORM1-like protein 3 [Phoenix dactylifera]
Length=157

 Score =   249 bits (637),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 132/155 (85%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MA LYV+A    DLNKNTEWFTYPGVW+TYILILFFSWL+ LS+FGC+PG AWTIVNL H
Sbjct  1    MAKLYVQAVQPVDLNKNTEWFTYPGVWTTYILILFFSWLLVLSIFGCTPGMAWTIVNLFH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F ITY FFHWKKGTPFADDQGIYN LTWWEQ+DNGKQLTRNRKFLTVVPVVLYLIASHTT
Sbjct  61   FAITYQFFHWKKGTPFADDQGIYNTLTWWEQMDNGKQLTRNRKFLTVVPVVLYLIASHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINA  555
            DY+HPMLFLNT+AV +LVVAK P+MHKVRIFGINA
Sbjct  121  DYRHPMLFLNTLAVIVLVVAKLPNMHKVRIFGINA  155



>ref|XP_009119680.1| PREDICTED: ORM1-like protein 3 [Brassica rapa]
Length=157

 Score =   249 bits (635),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 127/156 (81%), Positives = 143/156 (92%), Gaps = 0/156 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MANLYV+AAP  D+N+NTEWF YPGVW+TYILILFF WLV LS+ GCSPG AWT+VNL+H
Sbjct  1    MANLYVKAAPPPDMNRNTEWFMYPGVWTTYILILFFGWLVVLSLSGCSPGMAWTVVNLAH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F++TYH FHW KGTPFADDQG+YN LTWWEQ+DNG+QLTRNRKFLTVVPVVLYLIASHTT
Sbjct  61   FVVTYHSFHWMKGTPFADDQGVYNGLTWWEQMDNGQQLTRNRKFLTVVPVVLYLIASHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            DY+HP LFLNT+AV +LVVAKFP+MHKVRIFGIN D
Sbjct  121  DYRHPWLFLNTLAVMVLVVAKFPNMHKVRIFGINGD  156



>emb|CDY15191.1| BnaC05g00700D [Brassica napus]
Length=157

 Score =   249 bits (635),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 128/156 (82%), Positives = 143/156 (92%), Gaps = 0/156 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MANLYV+AAP  D+N+NTEWF YPGVW+TYILILFF WLV LSV GCSPG AWT+VNL+H
Sbjct  1    MANLYVKAAPPPDMNRNTEWFMYPGVWTTYILILFFGWLVVLSVSGCSPGMAWTVVNLAH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F++TYH FHW KGTPFADDQG+YN LTWWEQ+DNG+QLTRNRKFLTVVPVVLYLIASHTT
Sbjct  61   FVVTYHSFHWMKGTPFADDQGVYNGLTWWEQMDNGQQLTRNRKFLTVVPVVLYLIASHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            DY+HP LFLNT+AV +LVVAKFP+MHKVRIFGIN D
Sbjct  121  DYRHPWLFLNTLAVMVLVVAKFPNMHKVRIFGINGD  156



>gb|EPS66391.1| hypothetical protein M569_08393 [Genlisea aurea]
Length=156

 Score =   248 bits (634),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 128/156 (82%), Positives = 139/156 (89%), Gaps = 0/156 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            M  LYV   P  DLN+NTEWFTYPGVW+TYILILFFSWLV LS+  C+PG AWT+VNL H
Sbjct  1    MGKLYVEMVPPQDLNRNTEWFTYPGVWTTYILILFFSWLVVLSITNCTPGMAWTVVNLCH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            FMITYHFFHWKKGTPF DDQG+YN LTWWEQIDNGKQLTRNRKFLTVVPVVLYL+ASHTT
Sbjct  61   FMITYHFFHWKKGTPFGDDQGMYNGLTWWEQIDNGKQLTRNRKFLTVVPVVLYLMASHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            DYQHPMLF NTVAV +LV+AKFP+MHKVRIFGIN +
Sbjct  121  DYQHPMLFFNTVAVVVLVIAKFPNMHKVRIFGINGE  156



>ref|NP_001148597.1| ORM1-like protein 2 [Zea mays]
 gb|ACG32169.1| ORM1-like protein 2 [Zea mays]
 gb|ACN37001.1| unknown [Zea mays]
 gb|AFW72764.1| ORM1-like protein 2 [Zea mays]
Length=157

 Score =   248 bits (633),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 129/156 (83%), Positives = 142/156 (91%), Gaps = 0/156 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MA LYV+A P  DLNKNTEWF YPGVW+TYI+I+FFSWL+ LSVFGC+PGTAWT+VNL H
Sbjct  1    MAKLYVQAFPPADLNKNTEWFMYPGVWTTYIIIVFFSWLLVLSVFGCTPGTAWTVVNLFH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F ITYHFFHWKKGTPFADDQG+YN LTWWEQ+DNGKQLTRNRKFL VVPVVLYLIA HTT
Sbjct  61   FAITYHFFHWKKGTPFADDQGMYNTLTWWEQMDNGKQLTRNRKFLIVVPVVLYLIALHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            DYQ PMLFLNT+AV +LVVAK P+MHKVRIFGINA+
Sbjct  121  DYQQPMLFLNTLAVSVLVVAKLPNMHKVRIFGINAE  156



>ref|XP_002892079.1| ORMDL family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68338.1| ORMDL family protein [Arabidopsis lyrata subsp. lyrata]
Length=157

 Score =   248 bits (633),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 127/156 (81%), Positives = 142/156 (91%), Gaps = 0/156 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MANLYV+A P  D+N+NTEWF YPGVW+TY+LILFF WLV LSV GCSPG AWT+VNL+H
Sbjct  1    MANLYVKAVPPPDMNRNTEWFMYPGVWTTYMLILFFGWLVVLSVSGCSPGMAWTVVNLAH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F++TYH FHW KGTPFADDQGIYN LTWWEQ+DNG+QLTRNRKFLTVVPVVLYLIASHTT
Sbjct  61   FVVTYHSFHWMKGTPFADDQGIYNGLTWWEQMDNGQQLTRNRKFLTVVPVVLYLIASHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            DY+HP LFLNT+AV +LVVAKFP+MHKVRIFGIN D
Sbjct  121  DYRHPWLFLNTLAVMVLVVAKFPNMHKVRIFGINGD  156



>ref|XP_008676888.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACF80575.1| unknown [Zea mays]
 gb|ACG40463.1| ORM1-like protein 2 [Zea mays]
 gb|AFW63355.1| ORM1-like protein 2 [Zea mays]
Length=157

 Score =   248 bits (633),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 130/156 (83%), Positives = 142/156 (91%), Gaps = 0/156 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MA LYV+A P  DLNKNTEWF YPGVW+TYILI+FFSWL+ LSVFGC+PGTAWT+VNL H
Sbjct  1    MAKLYVQAFPPADLNKNTEWFMYPGVWTTYILIVFFSWLLVLSVFGCTPGTAWTVVNLFH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F ITYHFFHWKKGTPFADDQG+YN LTWWEQ+DNGKQLTRNRKFL VVPVVLYLIA HTT
Sbjct  61   FAITYHFFHWKKGTPFADDQGMYNALTWWEQMDNGKQLTRNRKFLIVVPVVLYLIALHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            DYQ PMLFLNT+AV +LVVAK P+MHKVRIFGINA+
Sbjct  121  DYQQPMLFLNTLAVSVLVVAKLPNMHKVRIFGINAE  156



>ref|XP_006303379.1| hypothetical protein CARUB_v10010529mg [Capsella rubella]
 gb|EOA36277.1| hypothetical protein CARUB_v10010529mg [Capsella rubella]
Length=157

 Score =   248 bits (633),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 128/156 (82%), Positives = 142/156 (91%), Gaps = 0/156 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MANLYV+A P  D+N+NTEWF YPGVW+TY+LILFF WLV LSV GCSPG AWT+VNL+H
Sbjct  1    MANLYVKAVPPPDMNRNTEWFMYPGVWTTYMLILFFGWLVVLSVSGCSPGMAWTVVNLAH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F++TYH FHW KGTPFADDQGIYN LTWWEQ+DNG+QLTRNRKFLTVVPVVLYLIASHTT
Sbjct  61   FVVTYHCFHWMKGTPFADDQGIYNGLTWWEQMDNGQQLTRNRKFLTVVPVVLYLIASHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            DY+HP LFLNT+AV ILVVAKFP+MHKVRIFGIN D
Sbjct  121  DYRHPWLFLNTLAVMILVVAKFPNMHKVRIFGINGD  156



>ref|XP_010553573.1| PREDICTED: ORM1-like protein 2 isoform X1 [Tarenaya hassleriana]
Length=166

 Score =   247 bits (630),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 133/164 (81%), Positives = 148/164 (90%), Gaps = 11/164 (7%)
 Frame = +1

Query  100  LYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMI  279
            +YV  APTTD+N+NTEWFTYPGVW+TYI ILFFSWL+FLSVFGCSPG AWTIV+L+HF++
Sbjct  2    VYVSTAPTTDVNRNTEWFTYPGVWTTYISILFFSWLIFLSVFGCSPGMAWTIVHLAHFIV  61

Query  280  -----------TYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVL  426
                       TY+FFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTV+PVVL
Sbjct  62   IPLLGFDPFLATYNFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVIPVVL  121

Query  427  YLIASHTTDYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            YLIASHTT+Y+HPMLF+NT+AV ILVVAKFPHMHKVRIFGINAD
Sbjct  122  YLIASHTTNYEHPMLFINTLAVCILVVAKFPHMHKVRIFGINAD  165



>ref|NP_563622.1| ORMDL family protein [Arabidopsis thaliana]
 gb|AAK25947.1|AF360237_1 unknown protein [Arabidopsis thaliana]
 gb|AAK64094.1| unknown protein [Arabidopsis thaliana]
 gb|AEE27257.1| ORMDL family protein [Arabidopsis thaliana]
Length=157

 Score =   247 bits (630),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 126/156 (81%), Positives = 142/156 (91%), Gaps = 0/156 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MANLYV+A P  D+N+NTEWF YPGVW+TY+LILFF WLV LSV GCSPG AWT+VNL+H
Sbjct  1    MANLYVKAVPPPDMNRNTEWFMYPGVWTTYMLILFFGWLVVLSVSGCSPGMAWTVVNLAH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F++TYH FHW KGTPFADDQGIYN LTWWEQ+DNG+QLTRNRKFLT+VPVVLYLIASHTT
Sbjct  61   FVVTYHSFHWMKGTPFADDQGIYNGLTWWEQMDNGQQLTRNRKFLTLVPVVLYLIASHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            DY+HP LFLNT+AV +LVVAKFP+MHKVRIFGIN D
Sbjct  121  DYRHPWLFLNTLAVMVLVVAKFPNMHKVRIFGINGD  156



>ref|XP_004956119.1| PREDICTED: ORM1-like protein 3-like isoform X1 [Setaria italica]
Length=162

 Score =   247 bits (630),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 128/153 (84%), Positives = 140/153 (92%), Gaps = 1/153 (1%)
 Frame = +1

Query  103  YVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMIT  282
            YV AAP  D+NKNTEWF YPGVW+TYIL+LFF+WL+ LSV GCSPG AWT+VNL+HF IT
Sbjct  9    YVEAAPPVDVNKNTEWFMYPGVWTTYILLLFFAWLLVLSVSGCSPGAAWTVVNLAHFAIT  68

Query  283  YHFFHWKKGTPFA-DDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQ  459
            YHFFHWKKGTPFA DDQGIY+RLTWWEQIDNG+QLTRNRKFLTVVPVVLYLIASH TDY+
Sbjct  69   YHFFHWKKGTPFAADDQGIYSRLTWWEQIDNGQQLTRNRKFLTVVPVVLYLIASHLTDYK  128

Query  460  HPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
             PM FLNTVAVF+LVVAK P+MHKVRIFGINAD
Sbjct  129  QPMFFLNTVAVFVLVVAKLPNMHKVRIFGINAD  161



>ref|XP_008775080.1| PREDICTED: ORM1-like protein 3 [Phoenix dactylifera]
Length=157

 Score =   246 bits (629),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 129/156 (83%), Positives = 141/156 (90%), Gaps = 0/156 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MA LYV+  P  DLNKNTEWF YPGVW+TYI ILFFSWL+ LSVF C+PG AWT VNL H
Sbjct  1    MAKLYVQTVPPADLNKNTEWFVYPGVWTTYIFILFFSWLLALSVFCCTPGMAWTAVNLFH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F +TYHFFHWKKGTPFA+DQG+YN LTWWEQ+DNGKQLTRNRKFLTVVPVVLYLIASHTT
Sbjct  61   FAVTYHFFHWKKGTPFAEDQGMYNSLTWWEQMDNGKQLTRNRKFLTVVPVVLYLIASHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            DYQ+PMLFLNT+AV +LVVAKFP+MHKVRIFGINAD
Sbjct  121  DYQNPMLFLNTLAVMVLVVAKFPNMHKVRIFGINAD  156



>gb|ACG38638.1| ORMDL family protein [Zea mays]
Length=162

 Score =   246 bits (629),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 125/153 (82%), Positives = 138/153 (90%), Gaps = 1/153 (1%)
 Frame = +1

Query  103  YVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMIT  282
            YV A P  D+NKNTEWF YPGVW+TYIL+LFF+ L+ LSV GCSPG AWT+VNL+HF IT
Sbjct  9    YVEAVPPVDVNKNTEWFMYPGVWTTYILMLFFALLLVLSVSGCSPGAAWTVVNLAHFAIT  68

Query  283  YHFFHWKKGTPFA-DDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQ  459
            YHFFHWKKGTPFA DDQGIY+RLTWWEQIDNG+QLTRNRKFLTVVPVVLYLIASH TDY+
Sbjct  69   YHFFHWKKGTPFAADDQGIYSRLTWWEQIDNGQQLTRNRKFLTVVPVVLYLIASHLTDYK  128

Query  460  HPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
             PM FLNT+AVF+LVVAK P+MHKVRIFGINAD
Sbjct  129  QPMFFLNTIAVFVLVVAKLPNMHKVRIFGINAD  161



>ref|XP_010480516.1| PREDICTED: ORM1-like protein 3 isoform X1 [Camelina sativa]
 ref|XP_010480523.1| PREDICTED: ORM1-like protein 3 isoform X2 [Camelina sativa]
Length=158

 Score =   246 bits (629),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 126/156 (81%), Positives = 142/156 (91%), Gaps = 0/156 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MANLYV+A P  D+N+NTEWF YPGVW+TY+LILFF WLV LS+ GCSPG AWT+VNL+H
Sbjct  1    MANLYVKAVPPPDMNRNTEWFMYPGVWTTYMLILFFGWLVVLSISGCSPGMAWTVVNLAH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F++TYH FHW KGTPFADDQGIYN LTWWEQ+DNG+QLTRNRKFLTVVPVVLYLIASHTT
Sbjct  61   FVVTYHCFHWMKGTPFADDQGIYNGLTWWEQMDNGQQLTRNRKFLTVVPVVLYLIASHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            DY+HP LFLNT+AV ILVVAKFP+MHKVRIFGIN +
Sbjct  121  DYRHPWLFLNTLAVMILVVAKFPNMHKVRIFGINGE  156



>ref|XP_009358667.1| PREDICTED: ORM1-like protein 1 [Pyrus x bretschneideri]
 ref|XP_009359574.1| PREDICTED: ORM1-like protein 1 [Pyrus x bretschneideri]
Length=154

 Score =   246 bits (628),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 126/153 (82%), Positives = 140/153 (92%), Gaps = 0/153 (0%)
 Frame = +1

Query  100  LYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMI  279
            +YV A   TDLN+NTEWFTYPGVW+TYIL++FFSWL  L +F CSPG AWT+V+LSHF++
Sbjct  1    MYVTAVRPTDLNRNTEWFTYPGVWTTYILMVFFSWLTVLCLFSCSPGMAWTVVHLSHFLV  60

Query  280  TYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQ  459
            TYHFFHWKKGTPFADDQGIYN LTWWEQIDNG QLTRNRKFLTVVPVVLYLIASHTTDYQ
Sbjct  61   TYHFFHWKKGTPFADDQGIYNALTWWEQIDNGNQLTRNRKFLTVVPVVLYLIASHTTDYQ  120

Query  460  HPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            +PML  NT+AVF+LVVAKFP+MHKVRIFGINAD
Sbjct  121  NPMLIFNTLAVFVLVVAKFPNMHKVRIFGINAD  153



>ref|XP_004953426.1| PREDICTED: ORM1-like protein 3-like [Setaria italica]
Length=157

 Score =   246 bits (628),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 130/156 (83%), Positives = 141/156 (90%), Gaps = 0/156 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MA LYV+  P  DLNKNTEWF YPGVW+TYILILFFSWL+ LSVFGC+PGTAWT+VNL H
Sbjct  1    MAKLYVQTFPPADLNKNTEWFMYPGVWTTYILILFFSWLLVLSVFGCTPGTAWTVVNLFH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F ITYHFFHWKKGTPFADDQG+YN LTWWEQ+DNGKQLTRNRKFL VVPVVLYLIA HTT
Sbjct  61   FAITYHFFHWKKGTPFADDQGMYNALTWWEQMDNGKQLTRNRKFLIVVPVVLYLIALHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            DYQ PMLFLNT+AV +LVVAK P+MHKVRIFGINA+
Sbjct  121  DYQQPMLFLNTLAVSVLVVAKLPNMHKVRIFGINAE  156



>gb|KHG08344.1| Uncharacterized protein F383_35910 [Gossypium arboreum]
Length=154

 Score =   246 bits (627),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 130/153 (85%), Positives = 142/153 (93%), Gaps = 0/153 (0%)
 Frame = +1

Query  100  LYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMI  279
            +YVRA P TDLNKNTEWFTYPGVW+ YILI+FFSWL+ LSVFG SPG AWTIV+L+HF +
Sbjct  1    MYVRAVPPTDLNKNTEWFTYPGVWTAYILIVFFSWLMVLSVFGTSPGIAWTIVHLTHFFV  60

Query  280  TYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQ  459
            TYHFFHWKKGTPFADDQGIYN LTWWEQIDNGKQLT NRKFLTVVPVVLYLIASHTT YQ
Sbjct  61   TYHFFHWKKGTPFADDQGIYNGLTWWEQIDNGKQLTPNRKFLTVVPVVLYLIASHTTGYQ  120

Query  460  HPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            +P+LF NT+AVF+LVVAKFP+MHKVRIFGINAD
Sbjct  121  NPLLFFNTLAVFVLVVAKFPNMHKVRIFGINAD  153



>ref|XP_006665130.1| PREDICTED: ORM1-like protein 3-like [Oryza brachyantha]
Length=162

 Score =   246 bits (628),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 127/153 (83%), Positives = 139/153 (91%), Gaps = 1/153 (1%)
 Frame = +1

Query  103  YVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMIT  282
            YV AAP  D+NKNTEWF YPGVW+TYIL+LFF+WL+ LSV  CSPG AWT+VNL+HF IT
Sbjct  9    YVEAAPPVDVNKNTEWFMYPGVWTTYILLLFFAWLLVLSVSACSPGIAWTVVNLAHFAIT  68

Query  283  YHFFHWKKGTPFA-DDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQ  459
            YHFFHWKKGTPFA DDQGIYNRLTWWEQIDNG+QLTRNRKFLTVVPVVLYLIASH TDY+
Sbjct  69   YHFFHWKKGTPFAADDQGIYNRLTWWEQIDNGQQLTRNRKFLTVVPVVLYLIASHLTDYK  128

Query  460  HPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
             PMLFLNT+AV +LVVAK P+MHKVRIFGINAD
Sbjct  129  QPMLFLNTIAVLVLVVAKLPNMHKVRIFGINAD  161



>ref|XP_008374090.1| PREDICTED: ORM1-like protein 1 [Malus domestica]
Length=154

 Score =   246 bits (627),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 125/153 (82%), Positives = 139/153 (91%), Gaps = 0/153 (0%)
 Frame = +1

Query  100  LYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMI  279
            +YV A   TDLN+NTEWFTYPGVW+TY L++FFSWL  L +F CSPG AWT+V+LSHF++
Sbjct  1    MYVTAVRPTDLNRNTEWFTYPGVWTTYXLMVFFSWLTVLCLFSCSPGMAWTVVHLSHFLV  60

Query  280  TYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQ  459
            TYHFFHWKKGTPFADDQGIYN LTWWEQIDNG QLTRNRKFLTVVPVVLYLIASHTTDYQ
Sbjct  61   TYHFFHWKKGTPFADDQGIYNALTWWEQIDNGNQLTRNRKFLTVVPVVLYLIASHTTDYQ  120

Query  460  HPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            +PML  NT+AVF+LVVAKFP+MHKVRIFGINAD
Sbjct  121  NPMLIFNTLAVFVLVVAKFPNMHKVRIFGINAD  153



>ref|XP_006418402.1| hypothetical protein EUTSA_v10008983mg [Eutrema salsugineum]
 gb|ESQ36755.1| hypothetical protein EUTSA_v10008983mg [Eutrema salsugineum]
Length=157

 Score =   246 bits (627),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 127/156 (81%), Positives = 142/156 (91%), Gaps = 0/156 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MANLYV+A P  D+N+NTEWF YPGVW+TYILILFF WLV LSV GCSPG AWT+VNL+H
Sbjct  1    MANLYVKAVPPPDMNRNTEWFMYPGVWTTYILILFFGWLVVLSVSGCSPGMAWTVVNLAH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F++TYH FHW KGTPFA+DQGIYN LTWWEQ+DNG+QLTRNRKFLTVVPVVLYLIASHTT
Sbjct  61   FVVTYHCFHWMKGTPFAEDQGIYNGLTWWEQMDNGQQLTRNRKFLTVVPVVLYLIASHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            DY+HP LFLNT+AV +LVVAKFP+MHKVRIFGIN D
Sbjct  121  DYRHPWLFLNTLAVMVLVVAKFPNMHKVRIFGINGD  156



>ref|NP_001059551.1| Os07g0452500 [Oryza sativa Japonica Group]
 dbj|BAC84413.1| putative ORMDL2 [Oryza sativa Japonica Group]
 dbj|BAF21465.1| Os07g0452500 [Oryza sativa Japonica Group]
 dbj|BAG88161.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93891.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC81963.1| hypothetical protein OsI_25857 [Oryza sativa Indica Group]
Length=164

 Score =   246 bits (627),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 127/153 (83%), Positives = 139/153 (91%), Gaps = 1/153 (1%)
 Frame = +1

Query  103  YVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMIT  282
            YV AAP  D+NKNTEWF YPGVW+TYIL+LFF+WL+ LSV  CSPG AWT+VNL+HF IT
Sbjct  11   YVEAAPPVDVNKNTEWFMYPGVWTTYILLLFFAWLLVLSVSACSPGIAWTVVNLAHFAIT  70

Query  283  YHFFHWKKGTPFA-DDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQ  459
            YHFFHWKKGTPFA DDQGIYNRLTWWEQIDNG+QLTRNRKFLTVVPVVLYLIASH TDY+
Sbjct  71   YHFFHWKKGTPFAADDQGIYNRLTWWEQIDNGQQLTRNRKFLTVVPVVLYLIASHLTDYK  130

Query  460  HPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
             PMLFLNT+AV +LVVAK P+MHKVRIFGINAD
Sbjct  131  QPMLFLNTIAVLVLVVAKLPNMHKVRIFGINAD  163



>ref|XP_002461937.1| hypothetical protein SORBIDRAFT_02g010850 [Sorghum bicolor]
 gb|EER98458.1| hypothetical protein SORBIDRAFT_02g010850 [Sorghum bicolor]
Length=162

 Score =   245 bits (626),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 126/153 (82%), Positives = 140/153 (92%), Gaps = 1/153 (1%)
 Frame = +1

Query  103  YVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMIT  282
            YV AAP  D+NKNTEWF YPGVW+TYIL+LFF+WL+ LSV GCSPG AWT+VNL+HF IT
Sbjct  9    YVEAAPPVDVNKNTEWFMYPGVWTTYILLLFFAWLLVLSVSGCSPGAAWTVVNLAHFAIT  68

Query  283  YHFFHWKKGTPFA-DDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQ  459
            YHFFHWKKGTPFA DDQGIY+RLTWWEQ+DNG+QLTRNRKFLTVVPVVLYLIASH TDY+
Sbjct  69   YHFFHWKKGTPFAADDQGIYSRLTWWEQMDNGQQLTRNRKFLTVVPVVLYLIASHLTDYK  128

Query  460  HPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
             PM FLNT+AVF+LVVAK P+MHKVRIFGINAD
Sbjct  129  QPMFFLNTIAVFVLVVAKLPNMHKVRIFGINAD  161



>gb|KJB24159.1| hypothetical protein B456_004G130600 [Gossypium raimondii]
 gb|KJB24160.1| hypothetical protein B456_004G130600 [Gossypium raimondii]
Length=154

 Score =   245 bits (625),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 130/153 (85%), Positives = 141/153 (92%), Gaps = 0/153 (0%)
 Frame = +1

Query  100  LYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMI  279
            +YVRA P TDLNKNTEWFTYPGVW+ YILI+FFSWL+ LSVFG SPG AWTIV+L HF +
Sbjct  1    MYVRAVPPTDLNKNTEWFTYPGVWTAYILIVFFSWLMVLSVFGTSPGIAWTIVHLIHFFV  60

Query  280  TYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQ  459
            TYHFFHWKKGTPFADDQGIYN LTWWEQIDNGKQLT NRKFLTVVPVVLYLIASHTT YQ
Sbjct  61   TYHFFHWKKGTPFADDQGIYNGLTWWEQIDNGKQLTPNRKFLTVVPVVLYLIASHTTGYQ  120

Query  460  HPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            +P+LF NT+AVF+LVVAKFP+MHKVRIFGINAD
Sbjct  121  NPLLFFNTLAVFVLVVAKFPNMHKVRIFGINAD  153



>ref|XP_008390306.1| PREDICTED: ORM1-like protein 3 [Malus domestica]
Length=154

 Score =   245 bits (625),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 126/153 (82%), Positives = 139/153 (91%), Gaps = 0/153 (0%)
 Frame = +1

Query  100  LYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMI  279
            +YV A   TDLN+NTEWFTYPGVW+TYIL++FFSWL  L +F CSPG AWT+V+LSHF +
Sbjct  1    MYVTAVRPTDLNRNTEWFTYPGVWTTYILVVFFSWLTVLCLFSCSPGMAWTVVHLSHFFV  60

Query  280  TYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQ  459
            TYHFFHWKKGTPFADDQGIYN LTWWEQIDNG QLTRNRKFLTVVPVVLYLIASHTTDYQ
Sbjct  61   TYHFFHWKKGTPFADDQGIYNALTWWEQIDNGNQLTRNRKFLTVVPVVLYLIASHTTDYQ  120

Query  460  HPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            +PML  NT+AVF+LVVAKFP+MHKVRIFGINAD
Sbjct  121  NPMLIFNTLAVFVLVVAKFPNMHKVRIFGINAD  153



>ref|XP_010474712.1| PREDICTED: ORM1-like protein 3 [Camelina sativa]
Length=158

 Score =   245 bits (625),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 125/156 (80%), Positives = 142/156 (91%), Gaps = 0/156 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MANLYV+A P  D+N+NTEWF YPGVW+TY+LILFF WLV LS+ GCSPG AWT+VNL+H
Sbjct  1    MANLYVKAVPPPDMNRNTEWFMYPGVWTTYMLILFFGWLVVLSISGCSPGMAWTVVNLAH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F++TYH FHW KGTPFADDQGIYN LTWWEQ+D+G+QLTRNRKFLTVVPVVLYLIASHTT
Sbjct  61   FVVTYHCFHWMKGTPFADDQGIYNGLTWWEQMDSGQQLTRNRKFLTVVPVVLYLIASHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            DY+HP LFLNT+AV ILVVAKFP+MHKVRIFGIN +
Sbjct  121  DYRHPWLFLNTLAVMILVVAKFPNMHKVRIFGINGE  156



>ref|NP_001148636.1| LOC100282252 [Zea mays]
 gb|ACF87508.1| unknown [Zea mays]
 gb|ACG24622.1| ORMDL family protein [Zea mays]
 gb|ACG32325.1| ORMDL family protein [Zea mays]
 tpg|DAA39687.1| TPA: ORMDL family protein [Zea mays]
Length=162

 Score =   245 bits (625),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 126/153 (82%), Positives = 139/153 (91%), Gaps = 1/153 (1%)
 Frame = +1

Query  103  YVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMIT  282
            YV A P  D+NKNTEWF YPGVW+TYIL+LFF+WL+ LSV GCSPG AWT+VNL+HF IT
Sbjct  9    YVEAVPPVDVNKNTEWFMYPGVWTTYILMLFFAWLLVLSVSGCSPGAAWTVVNLAHFAIT  68

Query  283  YHFFHWKKGTPFA-DDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQ  459
            YHFFHWKKGTPFA DDQGIY+RLTWWEQIDNG+QLTRNRKFLTVVPVVLYLIASH TDY+
Sbjct  69   YHFFHWKKGTPFAADDQGIYSRLTWWEQIDNGQQLTRNRKFLTVVPVVLYLIASHLTDYK  128

Query  460  HPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
             PM FLNT+AVF+LVVAK P+MHKVRIFGINAD
Sbjct  129  QPMFFLNTIAVFVLVVAKLPNMHKVRIFGINAD  161



>gb|EYU32271.1| hypothetical protein MIMGU_mgv1a015441mg [Erythranthe guttata]
Length=157

 Score =   244 bits (624),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 124/156 (79%), Positives = 140/156 (90%), Gaps = 0/156 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            M  LYV+  P  DLN+NTEWFTYPGVW+TYILILFF+WL+ LSV  C+PG AWTIVNLSH
Sbjct  1    MGKLYVKMVPPADLNRNTEWFTYPGVWTTYILILFFAWLIVLSVTNCTPGMAWTIVNLSH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F++TYHFFHWKKGTPF +DQGIYN LTWWEQ+DNGKQLTRNRKFLTVVPVVLYLIASHTT
Sbjct  61   FLVTYHFFHWKKGTPFGEDQGIYNGLTWWEQMDNGKQLTRNRKFLTVVPVVLYLIASHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            DYQ+P+L+ NT AV +LVVAKFP+MHKVRIFGIN +
Sbjct  121  DYQYPLLYFNTFAVLVLVVAKFPNMHKVRIFGINGE  156



>ref|XP_010940864.1| PREDICTED: ORM1-like protein 3 [Elaeis guineensis]
Length=157

 Score =   244 bits (624),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 126/156 (81%), Positives = 141/156 (90%), Gaps = 0/156 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MA LYV+  P  DLNKNTEWF YPGVW+TYILILFFSWL+ LS+FGCSPG AWT+VNL H
Sbjct  1    MAKLYVQTVPPVDLNKNTEWFMYPGVWTTYILILFFSWLLVLSIFGCSPGMAWTVVNLFH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F +TYHFFHWKKGTPFA+DQGIYN LTWWEQ+DNGKQLTRNRKFLT+VPVVLYLI+SHTT
Sbjct  61   FAVTYHFFHWKKGTPFAEDQGIYNNLTWWEQMDNGKQLTRNRKFLTIVPVVLYLISSHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            DYQ+PML LNT+AV +LVVAK P+MH+VRI GINAD
Sbjct  121  DYQNPMLSLNTLAVIVLVVAKLPNMHRVRILGINAD  156



>ref|NP_001241770.1| ORMDL family protein [Zea mays]
 gb|ACG36887.1| ORMDL family protein [Zea mays]
 gb|ACN26605.1| unknown [Zea mays]
 tpg|DAA60487.1| TPA: ORMDL family [Zea mays]
Length=162

 Score =   244 bits (623),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 126/153 (82%), Positives = 139/153 (91%), Gaps = 1/153 (1%)
 Frame = +1

Query  103  YVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMIT  282
            YV AAP  D+NKNTEWF YPGVW+TYIL+LFF+WL+ LSV GCSPG AWT+VNL+HF IT
Sbjct  9    YVEAAPPVDVNKNTEWFMYPGVWTTYILLLFFAWLLVLSVSGCSPGAAWTVVNLAHFAIT  68

Query  283  YHFFHWKKGTPFA-DDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQ  459
            YHFFHWKKGTPFA DDQGIY+RLTWWEQIDNG+QLTRNRKFLTVVPVVLYLIASH TDY+
Sbjct  69   YHFFHWKKGTPFAADDQGIYSRLTWWEQIDNGQQLTRNRKFLTVVPVVLYLIASHLTDYK  128

Query  460  HPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
             PM FLNT+AVF+LVVAK P+MHKVRIFGIN D
Sbjct  129  QPMFFLNTMAVFVLVVAKLPNMHKVRIFGINGD  161



>gb|KFK42508.1| hypothetical protein AALP_AA1G002900 [Arabis alpina]
Length=157

 Score =   244 bits (622),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 123/156 (79%), Positives = 142/156 (91%), Gaps = 0/156 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MANLYV+A P  D+N+NTEWF YPGVW+TY++ILFF WLV LSV GCSPG AWT+VNL+H
Sbjct  1    MANLYVKAVPPPDMNRNTEWFMYPGVWTTYMIILFFGWLVVLSVSGCSPGMAWTVVNLAH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F++TYH FHW KGTPFA+DQGIYN LTWWEQ+DNG+QLTRNRKFLTVVPVVLYLIASHTT
Sbjct  61   FVVTYHCFHWMKGTPFAEDQGIYNGLTWWEQMDNGQQLTRNRKFLTVVPVVLYLIASHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            DY+HP LFLNT+A+ +LVVAKFP+MHKVRIFGIN +
Sbjct  121  DYRHPWLFLNTLALMVLVVAKFPNMHKVRIFGINGE  156



>ref|XP_007209727.1| hypothetical protein PRUPE_ppa012781mg [Prunus persica]
 ref|XP_008239202.1| PREDICTED: ORM1-like protein 1 [Prunus mume]
 gb|EMJ10926.1| hypothetical protein PRUPE_ppa012781mg [Prunus persica]
Length=154

 Score =   243 bits (621),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 127/153 (83%), Positives = 139/153 (91%), Gaps = 0/153 (0%)
 Frame = +1

Query  100  LYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMI  279
            +YV A  TTDLN+NTEWFTYPGVW+TYIL +FFSWLV L +F CSPG AWTIV+L HF++
Sbjct  1    MYVTAVRTTDLNRNTEWFTYPGVWTTYILTVFFSWLVVLCLFSCSPGMAWTIVHLCHFLV  60

Query  280  TYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQ  459
            TYHFFHWKKGTPFADDQGIYN LTWWEQIDNG QLTRNRKFLTVVPVVLYLIASHTTDYQ
Sbjct  61   TYHFFHWKKGTPFADDQGIYNALTWWEQIDNGNQLTRNRKFLTVVPVVLYLIASHTTDYQ  120

Query  460  HPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            +P L  NT+AVF+LVVAKFP+MHKVRIFGINAD
Sbjct  121  NPNLIFNTLAVFVLVVAKFPNMHKVRIFGINAD  153



>ref|XP_004300483.1| PREDICTED: uncharacterized protein C119.09c-like [Fragaria vesca 
subsp. vesca]
Length=154

 Score =   243 bits (621),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 125/153 (82%), Positives = 140/153 (92%), Gaps = 0/153 (0%)
 Frame = +1

Query  100  LYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMI  279
            +YV A   TDLN+NTEWFTYPGVW+TYILI+FFSWL+ L +F CSPG AWT+V+L+HF++
Sbjct  1    MYVTAVRPTDLNRNTEWFTYPGVWTTYILIVFFSWLIVLCLFSCSPGMAWTVVHLAHFLV  60

Query  280  TYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQ  459
            TY FFHWKKGTPFADDQGIYN LTWWEQIDNG QLTRNRKFLTVVPVVLYLIASHTTDYQ
Sbjct  61   TYQFFHWKKGTPFADDQGIYNALTWWEQIDNGNQLTRNRKFLTVVPVVLYLIASHTTDYQ  120

Query  460  HPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            +PMLF NT+AVF+LVVAKFP+MHKVRIFGIN D
Sbjct  121  NPMLFFNTLAVFVLVVAKFPNMHKVRIFGINGD  153



>ref|XP_009418320.1| PREDICTED: ORM1-like protein 3 [Musa acuminata subsp. malaccensis]
Length=155

 Score =   243 bits (621),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 128/155 (83%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MA LYV   P  DLNKNTEWF YPGVW+TYILILFFSWL+ LSVFGC+ G AWT+VNL H
Sbjct  1    MAKLYVHTVPPPDLNKNTEWFMYPGVWTTYILILFFSWLLVLSVFGCTAGMAWTVVNLFH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F +TY+FFHWKKGTPFA+DQGIYN LTWWEQ+DNGKQLTRNRKFLTVVPVVLYLIASHTT
Sbjct  61   FAVTYYFFHWKKGTPFAEDQGIYNNLTWWEQMDNGKQLTRNRKFLTVVPVVLYLIASHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINA  555
            DYQHPMLFLNTV+V +LV+AKFP+MHKVRIFGIN 
Sbjct  121  DYQHPMLFLNTVSVAVLVIAKFPNMHKVRIFGING  155



>ref|XP_009415831.1| PREDICTED: ORM1-like protein 3 [Musa acuminata subsp. malaccensis]
Length=155

 Score =   243 bits (619),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 137/155 (88%), Gaps = 0/155 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MA LY + AP  D+NKNTEWF YPGVW+ Y+LIL  SWL+  SVFGC+PG AWT+VNL H
Sbjct  1    MAKLYAQTAPPMDMNKNTEWFLYPGVWTIYVLILLLSWLLVFSVFGCTPGMAWTLVNLFH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F +TY+FFHWKKGTPFA+DQGIYN LTWWEQ++NGKQLTRNRKFLTVVPVVLYLIASHTT
Sbjct  61   FAVTYYFFHWKKGTPFAEDQGIYNNLTWWEQMENGKQLTRNRKFLTVVPVVLYLIASHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINA  555
            DYQHPMLFLNT+AV IL VAKFP+MHKVRIFGIN 
Sbjct  121  DYQHPMLFLNTIAVAILEVAKFPNMHKVRIFGING  155



>ref|XP_006846226.1| hypothetical protein AMTR_s00012p00233130 [Amborella trichopoda]
 gb|ERN07901.1| hypothetical protein AMTR_s00012p00233130 [Amborella trichopoda]
Length=166

 Score =   243 bits (620),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 126/156 (81%), Positives = 141/156 (90%), Gaps = 0/156 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            M NLYV+  P  DLNKNTEWF YPGVW+TYILI+FFSWLV LSVFGCSPG AWTIVNL H
Sbjct  11   MGNLYVQTVPPPDLNKNTEWFMYPGVWTTYILIIFFSWLVVLSVFGCSPGMAWTIVNLGH  70

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            FM+TYH FHWKKGTPFA+DQG+YN LTWWEQ+DNGKQLTRNRKFL VVPVVLYLIASHTT
Sbjct  71   FMVTYHCFHWKKGTPFAEDQGVYNALTWWEQMDNGKQLTRNRKFLMVVPVVLYLIASHTT  130

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            DY++P +FLNT+A F+LV+AK P+MHKVRIFGINA+
Sbjct  131  DYRNPWIFLNTIAFFVLVIAKLPNMHKVRIFGINAE  166



>gb|KHG01337.1| Uncharacterized protein F383_23307 [Gossypium arboreum]
Length=157

 Score =   242 bits (618),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 124/156 (79%), Positives = 142/156 (91%), Gaps = 0/156 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MA+LYV A    +LN+NT+WF YPGVW+ YILILFF+WL+ LS+FGCSPG AWTI+NLSH
Sbjct  1    MASLYVNAESPVNLNRNTDWFMYPGVWTIYILILFFAWLLVLSIFGCSPGMAWTIINLSH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F+IT HFFHWKKGTPFA+DQG+YN LTWWEQIDNGKQLT NRKFLTVVPV+LYLIASHTT
Sbjct  61   FLITCHFFHWKKGTPFAEDQGVYNGLTWWEQIDNGKQLTPNRKFLTVVPVILYLIASHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            DYQHPMLF NT+AV +LVVAKFP+MHKVRIFGIN++
Sbjct  121  DYQHPMLFFNTIAVVVLVVAKFPNMHKVRIFGINSE  156



>emb|CAH66850.1| OSIGBa0103M18.2 [Oryza sativa Indica Group]
 gb|EAY95199.1| hypothetical protein OsI_17019 [Oryza sativa Indica Group]
Length=157

 Score =   242 bits (617),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 131/155 (85%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MA LYV+A    DLNKNTEWF YPGVW+TYILILFFSWL+ LSVFGC+PG AWT VNL+H
Sbjct  1    MAKLYVQAVQPADLNKNTEWFMYPGVWTTYILILFFSWLLVLSVFGCTPGMAWTFVNLAH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F +TYHFFHWKKGTPFADDQG+YNRLTWWEQ+DNGKQLTRNRKFLTVVP+VLYLIASHTT
Sbjct  61   FAMTYHFFHWKKGTPFADDQGMYNRLTWWEQMDNGKQLTRNRKFLTVVPLVLYLIASHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINA  555
            DYQHPMLFLNT+AV +LVVAK P+MHKVRIFGINA
Sbjct  121  DYQHPMLFLNTIAVVVLVVAKLPNMHKVRIFGINA  155



>gb|ABK26973.1| unknown [Picea sitchensis]
Length=171

 Score =   241 bits (615),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 123/156 (79%), Positives = 143/156 (92%), Gaps = 0/156 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            + NLYV+A P  DLNKNT WF YPGVW+TYILILFF+W++ LS+F C+ GTAWTIVNL H
Sbjct  13   IGNLYVQAVPPPDLNKNTSWFMYPGVWTTYILILFFTWIIVLSLFRCTAGTAWTIVNLFH  72

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F +TYHFFHWKKGTPF++DQGIYN+LTWWEQ+DNGKQLTRNRKFLTVVPVVLYLIASHTT
Sbjct  73   FAVTYHFFHWKKGTPFSEDQGIYNKLTWWEQVDNGKQLTRNRKFLTVVPVVLYLIASHTT  132

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            DY++P LFLNT+AV +LV+AKFP+MHKVRIFGIN+D
Sbjct  133  DYRNPWLFLNTIAVLVLVIAKFPNMHKVRIFGINSD  168



>emb|CDP08650.1| unnamed protein product [Coffea canephora]
Length=157

 Score =   240 bits (613),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 133/156 (85%), Positives = 145/156 (93%), Gaps = 0/156 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MA LYV+A P  DLN+NTEWFTYPGVW+TYILILFFSWL+ LS+FGC+PG AWTIVNLSH
Sbjct  1    MAKLYVKAVPPADLNRNTEWFTYPGVWTTYILILFFSWLLVLSIFGCTPGMAWTIVNLSH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F++TY FFHWKKGTPFADDQGIYN LTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT
Sbjct  61   FVVTYQFFHWKKGTPFADDQGIYNALTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            DYQ+PMLF NTVAV +LVVAKFP+MHKVRIFGIN +
Sbjct  121  DYQNPMLFFNTVAVLVLVVAKFPNMHKVRIFGINGE  156



>ref|XP_009383183.1| PREDICTED: ORM1-like protein 3 [Musa acuminata subsp. malaccensis]
Length=155

 Score =   239 bits (611),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MA LYV+  P  DLNKNTEWF YPGVWSTYILILFFSWL+ LSVF C+PG AWT+VNL H
Sbjct  1    MAKLYVQTVPPPDLNKNTEWFMYPGVWSTYILILFFSWLLVLSVFRCTPGMAWTVVNLFH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F ITY+FFHWKKGTPFA+DQGIYN LTWWEQ+DNGKQLTRNRKFLTVVPVVLYL+A HTT
Sbjct  61   FAITYYFFHWKKGTPFAEDQGIYNNLTWWEQMDNGKQLTRNRKFLTVVPVVLYLMALHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGIN  552
            DYQH MLFLNT+AV ILV+AKFP+MHKVRIFGIN
Sbjct  121  DYQHLMLFLNTLAVAILVIAKFPNMHKVRIFGIN  154



>ref|NP_001053587.1| Os04g0567700 [Oryza sativa Japonica Group]
 emb|CAD41291.2| OSJNBa0005N02.9 [Oryza sativa Japonica Group]
 dbj|BAF15501.1| Os04g0567700 [Oryza sativa Japonica Group]
 gb|EAZ31669.1| hypothetical protein OsJ_15817 [Oryza sativa Japonica Group]
 dbj|BAG89314.1| unnamed protein product [Oryza sativa Japonica Group]
Length=157

 Score =   239 bits (610),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 130/155 (84%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MA LYV+A    DLNKNTEWF YPGVW+TYILILFFSWL+ LSVFGC+PG AWT VNL+H
Sbjct  1    MAKLYVQAVQPADLNKNTEWFMYPGVWTTYILILFFSWLLVLSVFGCTPGMAWTFVNLAH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F +TYHFFHWKKGTPFADDQG+YNRLTWWEQ+DNGKQLTRNRKFLTVVP+VLYLIA HTT
Sbjct  61   FAMTYHFFHWKKGTPFADDQGMYNRLTWWEQMDNGKQLTRNRKFLTVVPLVLYLIALHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINA  555
            DYQHPMLFLNT+AV +LVVAK P+MHKVRIFGINA
Sbjct  121  DYQHPMLFLNTIAVVVLVVAKLPNMHKVRIFGINA  155



>ref|XP_010676855.1| PREDICTED: uncharacterized protein C119.09c-like [Beta vulgaris 
subsp. vulgaris]
Length=159

 Score =   239 bits (610),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 120/153 (78%), Positives = 137/153 (90%), Gaps = 0/153 (0%)
 Frame = +1

Query  100  LYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMI  279
            +YV A P  D+NKNTEW TYPGVW+ YI I+FF+WL+ LS+ GCSPG AWTIV+LSHF +
Sbjct  6    MYVMAEPPKDVNKNTEWVTYPGVWTIYIFIVFFAWLLVLSLLGCSPGMAWTIVHLSHFFV  65

Query  280  TYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQ  459
            TYH FHWKKGTPFADDQG+YN LTWWEQI+NG+QLTRNRKFLTVVPVVLYLIASHTTDYQ
Sbjct  66   TYHCFHWKKGTPFADDQGMYNGLTWWEQIENGQQLTRNRKFLTVVPVVLYLIASHTTDYQ  125

Query  460  HPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            +PML  NT+AVF+LVVAKFPHMH+VRIFGIN +
Sbjct  126  NPMLIFNTLAVFVLVVAKFPHMHRVRIFGINGE  158



>ref|XP_006857840.1| hypothetical protein AMTR_s00069p00050010 [Amborella trichopoda]
 gb|ERN19307.1| hypothetical protein AMTR_s00069p00050010 [Amborella trichopoda]
Length=165

 Score =   239 bits (610),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 125/156 (80%), Positives = 140/156 (90%), Gaps = 0/156 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            M NLYV+A P  DLNKNTEWF YPGVW+ YILILFF+WL+ LSVFGCS G AWTIVNLSH
Sbjct  10   MGNLYVQAVPPPDLNKNTEWFMYPGVWTIYILILFFAWLIVLSVFGCSAGMAWTIVNLSH  69

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F +TY  FHW+KGTPFA+DQGIYN LTWWEQ+DNGKQLTRNRKFL VVPVVLYLIASHTT
Sbjct  70   FAVTYRCFHWQKGTPFAEDQGIYNALTWWEQMDNGKQLTRNRKFLMVVPVVLYLIASHTT  129

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            DY++P L LNT+AVF+LV+AKFP+MHKVRIFGINA+
Sbjct  130  DYRNPWLLLNTIAVFVLVIAKFPNMHKVRIFGINAE  165



>ref|XP_003572809.1| PREDICTED: ORM1-like protein 2 [Brachypodium distachyon]
Length=157

 Score =   239 bits (609),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 126/155 (81%), Positives = 138/155 (89%), Gaps = 0/155 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MA LYV+A P  DLNKNTEWF YPGVW+TYILILFFSWL+ LSVFGC+ G AWT+VNL H
Sbjct  1    MAKLYVQAVPPADLNKNTEWFMYPGVWTTYILILFFSWLLVLSVFGCTAGMAWTVVNLFH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F ITYHFFHWKKGTPFADDQG+YN LTWWEQ+D+G+QLTRNRKFL VVPVVLYLIA HTT
Sbjct  61   FAITYHFFHWKKGTPFADDQGVYNTLTWWEQMDSGQQLTRNRKFLAVVPVVLYLIALHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINA  555
            DYQHPML LNT+AV +LVVAK P+MHKVRIFGIN 
Sbjct  121  DYQHPMLSLNTLAVTVLVVAKLPNMHKVRIFGING  155



>ref|XP_009420786.1| PREDICTED: ORM1-like protein 2 [Musa acuminata subsp. malaccensis]
Length=155

 Score =   238 bits (608),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 137/155 (88%), Gaps = 0/155 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            M  LYV+  P  DLNKNTEWF YPGVW+TYILILFF WL+ LSV GC+PG AWT VNL H
Sbjct  1    MVKLYVKTVPPPDLNKNTEWFMYPGVWTTYILILFFCWLLVLSVVGCTPGMAWTAVNLLH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F +TY+FFHWKKGTPFA+DQGIYN LTWWEQ+D+G+QLTRNRKFL VVPVVLYLIASHTT
Sbjct  61   FAVTYYFFHWKKGTPFAEDQGIYNNLTWWEQMDDGRQLTRNRKFLIVVPVVLYLIASHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINA  555
            DY+HPMLFLNT+AV ILV+AKFP+MHKVRIFGIN 
Sbjct  121  DYRHPMLFLNTLAVAILVIAKFPNMHKVRIFGING  155



>emb|CDY37999.1| BnaCnng08600D [Brassica napus]
Length=157

 Score =   238 bits (608),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 120/156 (77%), Positives = 137/156 (88%), Gaps = 0/156 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MA LYV+A    D+N+NTEWF YPGVW+TYILI+FF WL  LSV GCSPG AWT+VNLSH
Sbjct  1    MAKLYVKAVAPPDMNRNTEWFMYPGVWTTYILIIFFGWLAVLSVSGCSPGMAWTVVNLSH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F++TYH FHW KGTPF +DQGIYN LTWWEQ+DNG+QLT NRKFLTVVP+VLYLIASHTT
Sbjct  61   FLVTYHSFHWMKGTPFGEDQGIYNALTWWEQMDNGQQLTSNRKFLTVVPIVLYLIASHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            DY+HP L LNT+A+ +LVVAKFP+MHKVRIFGINAD
Sbjct  121  DYRHPWLLLNTLALMVLVVAKFPNMHKVRIFGINAD  156



>ref|XP_006652652.1| PREDICTED: ORM1-like protein 3-like [Oryza brachyantha]
Length=157

 Score =   238 bits (608),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 133/155 (86%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MA LYV+A    DLNKNTEWF YPGVW+TYILILFFSWL+ LSVFGC+PG AWT+VNL+H
Sbjct  1    MAKLYVQAVQPADLNKNTEWFMYPGVWTTYILILFFSWLLVLSVFGCTPGMAWTLVNLAH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F ITYHFFHWKKGTPFADDQG+YNRLTWWEQ+DNGKQLTRNRKFLTVVP+VLYLIASHTT
Sbjct  61   FAITYHFFHWKKGTPFADDQGMYNRLTWWEQMDNGKQLTRNRKFLTVVPLVLYLIASHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINA  555
            DYQHPMLFLNTVAV +LVVAK P+MHKVRIFGINA
Sbjct  121  DYQHPMLFLNTVAVVVLVVAKLPNMHKVRIFGINA  155



>ref|XP_009389450.1| PREDICTED: LOW QUALITY PROTEIN: ORM1-like protein 3 [Musa acuminata 
subsp. malaccensis]
Length=157

 Score =   238 bits (606),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 138/155 (89%), Gaps = 0/155 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MA LYV+  P  DLNKNTEWF  PGVW+TYILILFFSW++ LSVF C+PGTAWT+VNL H
Sbjct  1    MAKLYVQLVPPADLNKNTEWFMXPGVWTTYILILFFSWILVLSVFSCTPGTAWTVVNLVH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F ITYHFFHWKKGTPF+DDQGIYN LTWWEQ+DNGKQLTRNRKFLTVVPVVL  IASH +
Sbjct  61   FAITYHFFHWKKGTPFSDDQGIYNNLTWWEQMDNGKQLTRNRKFLTVVPVVLSFIASHMS  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINA  555
            DY+HP+LFLNT+AV +LVVAK P+MH+VRIFGINA
Sbjct  121  DYRHPVLFLNTIAVIVLVVAKLPNMHRVRIFGINA  155



>ref|XP_009118800.1| PREDICTED: ORM1-like protein 2 [Brassica rapa]
Length=157

 Score =   237 bits (604),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 119/156 (76%), Positives = 136/156 (87%), Gaps = 0/156 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MA  YV+A    D+N+NTEWF YPGVW+TYILI+FF WL  LSV GCSPG AWT+VNLSH
Sbjct  1    MAKQYVKAVAAPDMNRNTEWFMYPGVWTTYILIIFFGWLAVLSVSGCSPGMAWTVVNLSH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F++TYH FHW KGTPF +DQGIYN LTWWEQ+DNG+QLT NRKFLTVVP+VLYLIASHTT
Sbjct  61   FLVTYHSFHWMKGTPFGEDQGIYNALTWWEQMDNGQQLTSNRKFLTVVPIVLYLIASHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            DY+HP L LNT+A+ +LVVAKFP+MHKVRIFGINAD
Sbjct  121  DYRHPWLLLNTLALMVLVVAKFPNMHKVRIFGINAD  156



>gb|EEE67100.1| hypothetical protein OsJ_24107 [Oryza sativa Japonica Group]
Length=179

 Score =   237 bits (605),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 127/168 (76%), Positives = 139/168 (83%), Gaps = 16/168 (10%)
 Frame = +1

Query  103  YVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFM--  276
            YV AAP  D+NKNTEWF YPGVW+TYIL+LFF+WL+ LSV  CSPG AWT+VNL+HF   
Sbjct  11   YVEAAPPVDVNKNTEWFMYPGVWTTYILLLFFAWLLVLSVSACSPGIAWTVVNLAHFAVE  70

Query  277  -------------ITYHFFHWKKGTPFA-DDQGIYNRLTWWEQIDNGKQLTRNRKFLTVV  414
                         ITYHFFHWKKGTPFA DDQGIYNRLTWWEQIDNG+QLTRNRKFLTVV
Sbjct  71   LKSNYAFSLKQLAITYHFFHWKKGTPFAADDQGIYNRLTWWEQIDNGQQLTRNRKFLTVV  130

Query  415  PVVLYLIASHTTDYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            PVVLYLIASH TDY+ PMLFLNT+AV +LVVAK P+MHKVRIFGINAD
Sbjct  131  PVVLYLIASHLTDYKQPMLFLNTIAVLVLVVAKLPNMHKVRIFGINAD  178



>emb|CDX90018.1| BnaA10g00640D [Brassica napus]
Length=179

 Score =   236 bits (603),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 127/178 (71%), Positives = 143/178 (80%), Gaps = 22/178 (12%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MANLYV+AAP  D+N+NTEWF YPGVW+TYILILFF WLV LS+ GCSPG AWT+VNL+H
Sbjct  1    MANLYVKAAPPPDMNRNTEWFMYPGVWTTYILILFFGWLVVLSLSGCSPGMAWTVVNLAH  60

Query  271  FM----------------------ITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQL  384
            F+                      +TYH FHW KGTPFADDQG+YN LTWWEQ+DNG+QL
Sbjct  61   FVSQQFFEIDRFGSDDKAFDLDQAVTYHSFHWMKGTPFADDQGVYNGLTWWEQMDNGQQL  120

Query  385  TRNRKFLTVVPVVLYLIASHTTDYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            TRNRKFLTVVPVVLYLIASHTTDY+HP LFLNT+AV +LVVAKFP+MHKVRIFGIN D
Sbjct  121  TRNRKFLTVVPVVLYLIASHTTDYRHPWLFLNTLAVMVLVVAKFPNMHKVRIFGINGD  178



>ref|XP_008782518.1| PREDICTED: ORM1-like protein 2 isoform X3 [Phoenix dactylifera]
Length=157

 Score =   235 bits (599),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 116/156 (74%), Positives = 134/156 (86%), Gaps = 0/156 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            M  LYV A P   LN+NTEW  YPGVW+ Y+L++FF+W+  LS+  CSPG AWT+VNL+H
Sbjct  1    MLKLYVEAPPPPVLNRNTEWVMYPGVWTAYVLLIFFAWIAVLSLLRCSPGVAWTVVNLAH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F +TYH FHW+KGTPFA+DQGIYN LTWWEQ+DNGKQLT NRKFL  VPV+LYLIASHTT
Sbjct  61   FFVTYHCFHWRKGTPFAEDQGIYNGLTWWEQMDNGKQLTNNRKFLATVPVILYLIASHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            DYQHPMLFLNT+AVF+LVVAKFP+MHKVRIFGIN D
Sbjct  121  DYQHPMLFLNTLAVFVLVVAKFPNMHKVRIFGINGD  156



>ref|XP_008803045.1| PREDICTED: ORM1-like protein 3 [Phoenix dactylifera]
Length=159

 Score =   234 bits (598),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 139/158 (88%), Gaps = 2/158 (1%)
 Frame = +1

Query  91   MANLYVRAAP--TTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNL  264
            MA LYV+       DLNKNTEWF YPGVW+TYILILFFSWL+ LS+FGC+PG AWT+VNL
Sbjct  1    MAKLYVQTVQPVDVDLNKNTEWFMYPGVWTTYILILFFSWLLVLSIFGCTPGMAWTVVNL  60

Query  265  SHFMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASH  444
             HF +TYHFFHWKKGTPFA+DQGIYN LTWWEQ+DNGKQLT+NRKFL +VPVVLYLI+SH
Sbjct  61   FHFAVTYHFFHWKKGTPFAEDQGIYNNLTWWEQMDNGKQLTQNRKFLIIVPVVLYLISSH  120

Query  445  TTDYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            TTDYQ+PML LNTVAV +LVVAK P+MH+VRI GINAD
Sbjct  121  TTDYQYPMLLLNTVAVMVLVVAKLPNMHRVRILGINAD  158



>dbj|BAK03210.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=157

 Score =   234 bits (597),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 130/155 (84%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MA LYV+A P  DLNKNTEWF YPGVW+TYI ILF SWL+ LS+FGC+PG AWT+VNL H
Sbjct  1    MAKLYVQAVPPPDLNKNTEWFMYPGVWTTYIFILFVSWLLILSIFGCTPGMAWTLVNLGH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F ITYHFFHWKKGTPFADDQG+YNRLTWWEQ+DNGKQLTRNRKFL VVPVVLYLIASHTT
Sbjct  61   FAITYHFFHWKKGTPFADDQGMYNRLTWWEQMDNGKQLTRNRKFLVVVPVVLYLIASHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINA  555
            DYQHPMLFLNT+AV +LVVAK P+MHKVRIFGINA
Sbjct  121  DYQHPMLFLNTIAVIVLVVAKLPNMHKVRIFGINA  155



>dbj|BAJ97177.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=157

 Score =   233 bits (593),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 129/155 (83%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MA LYV+A P  DLNKNTEWF YPG W+TYI ILF SWL+ LS+FGC+PG AWT+VNL H
Sbjct  1    MAKLYVQAVPPPDLNKNTEWFMYPGAWTTYIFILFVSWLLILSIFGCTPGMAWTLVNLGH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F ITYHFFHWKKGTPFADDQG+YNRLTWWEQ+DNGKQLTRNRKFL VVPVVLYLIASHTT
Sbjct  61   FAITYHFFHWKKGTPFADDQGMYNRLTWWEQMDNGKQLTRNRKFLVVVPVVLYLIASHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINA  555
            DYQHPMLFLNT+AV +LVVAK P+MHKVRIFGINA
Sbjct  121  DYQHPMLFLNTIAVIVLVVAKLPNMHKVRIFGINA  155



>ref|XP_010936907.1| PREDICTED: ORM1-like protein 2 [Elaeis guineensis]
Length=157

 Score =   231 bits (588),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 114/156 (73%), Positives = 132/156 (85%), Gaps = 0/156 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            M  LY  AAP   LN+NTEW  YPGVW+ Y+L++FF+W+  LS+  CSPG AWT+VNL+H
Sbjct  1    MPKLYAEAAPPPVLNRNTEWVMYPGVWTAYVLLIFFAWIAILSLLRCSPGVAWTVVNLTH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F +TYH FHW+KGTPFA+DQGIYN LTWWEQ+DNGKQLT NRKFL  VPV+LYLIA HTT
Sbjct  61   FFVTYHCFHWRKGTPFAEDQGIYNGLTWWEQMDNGKQLTNNRKFLATVPVILYLIALHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            DYQHPMLFLNT+AVF+LVV KFP+MHKVRIFGIN D
Sbjct  121  DYQHPMLFLNTLAVFVLVVTKFPNMHKVRIFGINGD  156



>ref|XP_008782511.1| PREDICTED: ORM1-like protein 2 isoform X2 [Phoenix dactylifera]
Length=158

 Score =   230 bits (586),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 134/157 (85%), Gaps = 1/157 (1%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            M  LYV A P   LN+NTEW  YPGVW+ Y+L++FF+W+  LS+  CSPG AWT+VNL+H
Sbjct  1    MLKLYVEAPPPPVLNRNTEWVMYPGVWTAYVLLIFFAWIAVLSLLRCSPGVAWTVVNLAH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVL-YLIASHT  447
            F +TYH FHW+KGTPFA+DQGIYN LTWWEQ+DNGKQLT NRKFL  VPV+L YLIASHT
Sbjct  61   FFVTYHCFHWRKGTPFAEDQGIYNGLTWWEQMDNGKQLTNNRKFLATVPVILRYLIASHT  120

Query  448  TDYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            TDYQHPMLFLNT+AVF+LVVAKFP+MHKVRIFGIN D
Sbjct  121  TDYQHPMLFLNTLAVFVLVVAKFPNMHKVRIFGINGD  157



>gb|AAF97341.1|AC023628_22 Unknown protein [Arabidopsis thaliana]
Length=193

 Score =   231 bits (589),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MANLYV+A P  D+N+NTEWF YPGVW+TY+LILFF WLV LSV GCSPG AWT+VNL+H
Sbjct  1    MANLYVKAVPPPDMNRNTEWFMYPGVWTTYMLILFFGWLVVLSVSGCSPGMAWTVVNLAH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F++TYH FHW KGTPFADDQGIYN LTWWEQ+DNG+QLTRNRKFLT+VPVVLYLIASHTT
Sbjct  61   FVVTYHSFHWMKGTPFADDQGIYNGLTWWEQMDNGQQLTRNRKFLTLVPVVLYLIASHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHK  531
            DY+HP LFLNT+AV +LVVAKFP+MHK
Sbjct  121  DYRHPWLFLNTLAVMVLVVAKFPNMHK  147



>ref|XP_003563172.1| PREDICTED: ORM1-like protein 3 [Brachypodium distachyon]
Length=162

 Score =   229 bits (585),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 129/157 (82%), Positives = 139/157 (89%), Gaps = 1/157 (1%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            +A+ YV AAP  D+NKNTEWF YPGVW+TYIL+LFF+WL+ LSV  CSPG AWT VNL H
Sbjct  5    VASYYVEAAPPVDVNKNTEWFMYPGVWTTYILLLFFAWLLVLSVSACSPGAAWTAVNLGH  64

Query  271  FMITYHFFHWKKGTPFA-DDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHT  447
            F ITYHFFHWKKGTPFA DDQGIYNRLTWWEQIDNG+QLTRNRKFLTVVPVVLYLIASH 
Sbjct  65   FAITYHFFHWKKGTPFAADDQGIYNRLTWWEQIDNGQQLTRNRKFLTVVPVVLYLIASHL  124

Query  448  TDYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            TDY  PMLFLNTVAV +LVVAK P+MHKVRIFGINAD
Sbjct  125  TDYNQPMLFLNTVAVLVLVVAKLPNMHKVRIFGINAD  161



>ref|XP_008802460.1| PREDICTED: ORM1-like protein 2 [Phoenix dactylifera]
Length=158

 Score =   228 bits (581),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 134/157 (85%), Gaps = 1/157 (1%)
 Frame = +1

Query  91   MANLYVRAAPTTD-LNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLS  267
            M  LY  AA     LN+NTEW  YPGVW+TYIL++FF+W+  LS+  CSPG AWTIVNL+
Sbjct  1    MPKLYAEAAGAAPVLNRNTEWVVYPGVWTTYILLIFFAWIAVLSLLRCSPGVAWTIVNLA  60

Query  268  HFMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHT  447
            HF +TYH FHW+KGTPFA+DQGIYN LTWWEQ+DNGKQLT NRKFL+ VPV+LYLIA HT
Sbjct  61   HFFVTYHCFHWRKGTPFAEDQGIYNGLTWWEQVDNGKQLTNNRKFLSTVPVILYLIALHT  120

Query  448  TDYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            TDYQ+PMLFLNT+AVF+LVVAKFP+MHKVRIFGIN D
Sbjct  121  TDYQYPMLFLNTLAVFVLVVAKFPNMHKVRIFGINGD  157



>ref|XP_006647676.1| PREDICTED: uncharacterized protein C119.09c-like [Oryza brachyantha]
Length=157

 Score =   228 bits (581),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 130/155 (84%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MA LYV+A P  DLN+NTEWF YPGVW+TYI ILFFSWL+ LSVFGC+PG AWT+VNL H
Sbjct  1    MAKLYVQAVPPPDLNRNTEWFMYPGVWTTYICILFFSWLLVLSVFGCTPGMAWTVVNLFH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F ITYHFFHWKKGTPFADDQG+YN LTWWEQ+DNGKQLTRNRKFL VVPVVLYLIASHTT
Sbjct  61   FAITYHFFHWKKGTPFADDQGMYNTLTWWEQMDNGKQLTRNRKFLVVVPVVLYLIASHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINA  555
            DYQHPMLFLNT+AV +LVVAK P+MHKVRIFGINA
Sbjct  121  DYQHPMLFLNTLAVAVLVVAKLPNMHKVRIFGINA  155



>ref|NP_001047715.1| Os02g0673600 [Oryza sativa Japonica Group]
 dbj|BAD29457.1| ORMDL family protein-like [Oryza sativa Japonica Group]
 dbj|BAF09629.1| Os02g0673600 [Oryza sativa Japonica Group]
 gb|EAZ24158.1| hypothetical protein OsJ_07903 [Oryza sativa Japonica Group]
Length=157

 Score =   228 bits (581),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 130/155 (84%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MA LYV+A P  DLN+NTEWF YPGVW+TYI ILFFSWL+ LSVFGC+PG AWT+VNL H
Sbjct  1    MAKLYVQAVPPPDLNRNTEWFMYPGVWTTYICILFFSWLLVLSVFGCTPGMAWTVVNLFH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F ITYHFFHWKKGTPFADDQG+YN LTWWEQ+DNGKQLTRNRKFL VVPVVLYLIASHTT
Sbjct  61   FAITYHFFHWKKGTPFADDQGMYNTLTWWEQMDNGKQLTRNRKFLVVVPVVLYLIASHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINA  555
            DYQHPMLFLNT+AV +LVVAK P+MHKVRIFGINA
Sbjct  121  DYQHPMLFLNTLAVAVLVVAKLPNMHKVRIFGINA  155



>ref|XP_002963972.1| hypothetical protein SELMODRAFT_81257 [Selaginella moellendorffii]
 ref|XP_002967948.1| hypothetical protein SELMODRAFT_145077 [Selaginella moellendorffii]
 gb|EFJ31295.1| hypothetical protein SELMODRAFT_145077 [Selaginella moellendorffii]
 gb|EFJ34305.1| hypothetical protein SELMODRAFT_81257 [Selaginella moellendorffii]
Length=156

 Score =   226 bits (577),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 113/153 (74%), Positives = 135/153 (88%), Gaps = 0/153 (0%)
 Frame = +1

Query  100  LYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMI  279
            ++V+     DLNKNTEWF YPG+W+TYILI+F SWL+ LS+ GCS GTAWTIVNL HF +
Sbjct  1    MFVKVGHPADLNKNTEWFQYPGIWTTYILIIFLSWLLVLSLLGCSVGTAWTIVNLVHFGV  60

Query  280  TYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQ  459
            TY+FFHWKKGTPFA+DQG+Y++LTWWEQ+D+G+QLTRNRKFL VVPVVLYLIASHTTDY+
Sbjct  61   TYNFFHWKKGTPFAEDQGLYSKLTWWEQMDHGRQLTRNRKFLMVVPVVLYLIASHTTDYK  120

Query  460  HPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            +P L LNT+AV +LV+AK PHMHKVRI GINAD
Sbjct  121  NPFLLLNTIAVLVLVIAKLPHMHKVRILGINAD  153



>gb|EAY87043.1| hypothetical protein OsI_08441 [Oryza sativa Indica Group]
Length=157

 Score =   226 bits (577),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 129/155 (83%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MA LYV+A P  DLN+NTEWF YPGVW+TYI ILFFSWL+ LSVFGC+PG AWT+VNL H
Sbjct  1    MAKLYVQAVPPPDLNRNTEWFMYPGVWTTYICILFFSWLLVLSVFGCTPGMAWTVVNLFH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F ITYHFFHWKKGTPFADDQG+YN LTWWEQ+DNGKQLTRNRKFL VVPVVLYLIASHTT
Sbjct  61   FAITYHFFHWKKGTPFADDQGMYNTLTWWEQMDNGKQLTRNRKFLVVVPVVLYLIASHTT  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINA  555
            DYQHPMLFLNT+A  +LVVAK P+MHKVRIFGINA
Sbjct  121  DYQHPMLFLNTLAAAVLVVAKLPNMHKVRIFGINA  155



>ref|XP_001770210.1| predicted protein [Physcomitrella patens]
 gb|EDQ64885.1| predicted protein [Physcomitrella patens]
Length=179

 Score =   221 bits (564),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 131/155 (85%), Gaps = 0/155 (0%)
 Frame = +1

Query  94   ANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHF  273
              LYV+  P  D NKNT WF YPG+W+TYILI+ FSWL  +S F C  GTAWT+VNL HF
Sbjct  22   GGLYVKVVPPPDTNKNTSWFQYPGIWTTYILIILFSWLAIVSAFRCDAGTAWTVVNLVHF  81

Query  274  MITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTD  453
             +TY FFHWKKGTPFA+DQG Y +LTWWEQ+D+G+QLTRNRKFLTVVPVVLYLIASHTTD
Sbjct  82   AVTYRFFHWKKGTPFAEDQGDYGKLTWWEQVDDGRQLTRNRKFLTVVPVVLYLIASHTTD  141

Query  454  YQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            Y++P LFLNT+AV  LV+AKFP+MH+VRIFGIN+D
Sbjct  142  YRNPNLFLNTIAVCWLVIAKFPNMHRVRIFGINSD  176



>gb|ABK93306.1| unknown [Populus trichocarpa]
Length=127

 Score =   209 bits (533),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 98/111 (88%), Positives = 105/111 (95%), Gaps = 0/111 (0%)
 Frame = +1

Query  226  GCSPGTAWTIVNLSHFMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFL  405
            GCSPG AWTIV+  HF +TYHFFHWKKGTPFADDQGIYN LTWWEQI+NGKQLTRNRKFL
Sbjct  16   GCSPGMAWTIVHFCHFAVTYHFFHWKKGTPFADDQGIYNGLTWWEQIENGKQLTRNRKFL  75

Query  406  TVVPVVLYLIASHTTDYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            TVVPVVLYLIASHTTDYQ+PMLF NT+AVF+LVVAKFP+MHKVRIFGINAD
Sbjct  76   TVVPVVLYLIASHTTDYQNPMLFFNTLAVFVLVVAKFPNMHKVRIFGINAD  126



>gb|ABK22066.1| unknown [Picea sitchensis]
Length=128

 Score =   191 bits (486),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 100/128 (78%), Positives = 113/128 (88%), Gaps = 0/128 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            M NLYV A    DLNKNT WF YPGVW+ YI ILFFSWLV LS+ GC+ GTAWTIV+L+H
Sbjct  1    MRNLYVEAVQPVDLNKNTSWFQYPGVWTIYIFILFFSWLVVLSLLGCTAGTAWTIVHLAH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F +TYHFFHWKKGTPF++DQG+YN+LTWWEQ+DNGKQLTRNRKFLTVVPVVLYLIASHTT
Sbjct  61   FAVTYHFFHWKKGTPFSEDQGMYNKLTWWEQMDNGKQLTRNRKFLTVVPVVLYLIASHTT  120

Query  451  DYQHPMLF  474
            DY++P LF
Sbjct  121  DYRNPWLF  128



>ref|XP_006439267.1| hypothetical protein CICLE_v10022658mg [Citrus clementina]
 gb|ESR52507.1| hypothetical protein CICLE_v10022658mg [Citrus clementina]
Length=109

 Score =   187 bits (475),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = +1

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F +TYHFFHWKKGTPFADDQGIYN LTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT
Sbjct  13   FQVTYHFFHWKKGTPFADDQGIYNGLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  72

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            DYQ+PMLF NT+AVF+LVVAKFP+MHKVRIFGINAD
Sbjct  73   DYQNPMLFFNTLAVFVLVVAKFPNMHKVRIFGINAD  108



>gb|AAL69388.1|AF462225_1 unknown [Narcissus pseudonarcissus]
Length=102

 Score =   186 bits (473),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 87/101 (86%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +1

Query  256  VNLSHFMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLI  435
            VNLSHF +TYHFFHWKKGTPF +DQGIY  LTWWEQ+D+GKQLTRNRKFLTVVPVVLYLI
Sbjct  1    VNLSHFAVTYHFFHWKKGTPFGEDQGIYRALTWWEQMDDGKQLTRNRKFLTVVPVVLYLI  60

Query  436  ASHTTDYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            ASHTTDYQ+PML LNT+AVFILVVAK P+MHKVRIFGIN D
Sbjct  61   ASHTTDYQNPMLLLNTLAVFILVVAKLPNMHKVRIFGINGD  101



>ref|XP_006444803.1| hypothetical protein CICLE_v100226372mg, partial [Citrus clementina]
 gb|ESR58043.1| hypothetical protein CICLE_v100226372mg, partial [Citrus clementina]
Length=113

 Score =   182 bits (463),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 97/112 (87%), Positives = 106/112 (95%), Gaps = 0/112 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MANLYV+A P  DLN+NTEWFTYPGVW+TYILILFF+WL+ LSVFGCSPG AWTIVNL+H
Sbjct  2    MANLYVKATPPADLNRNTEWFTYPGVWTTYILILFFAWLIVLSVFGCSPGMAWTIVNLAH  61

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVL  426
            F+ITYHFFHWKKGTPFA+DQGIYN LTWWEQIDNG+QLTRNRKFLTVVPVVL
Sbjct  62   FLITYHFFHWKKGTPFAEDQGIYNGLTWWEQIDNGQQLTRNRKFLTVVPVVL  113



>ref|XP_010533557.1| PREDICTED: uncharacterized protein C119.09c-like [Tarenaya hassleriana]
Length=97

 Score =   181 bits (460),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 91/104 (88%), Positives = 92/104 (88%), Gaps = 9/104 (9%)
 Frame = +1

Query  244  AWTIVNLSHFMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVV  423
            AWTIV+LSHF          KGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVV
Sbjct  2    AWTIVHLSHF---------TKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVV  52

Query  424  LYLIASHTTDYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINA  555
            LYLIASHTTDYQHPMLFLNT AVFILVVAKFPHMHKVRIFGIN 
Sbjct  53   LYLIASHTTDYQHPMLFLNTFAVFILVVAKFPHMHKVRIFGINE  96



>ref|XP_010544437.1| PREDICTED: uncharacterized protein C119.09c-like isoform X2 [Tarenaya 
hassleriana]
Length=147

 Score =   183 bits (464),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 102/144 (71%), Positives = 115/144 (80%), Gaps = 4/144 (3%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MANLYV+A P  DLN+NTEWF YPGVW+TYILILFF+WL+FLSVFGCSPG AWT+VNLSH
Sbjct  1    MANLYVKAVPPADLNRNTEWFMYPGVWTTYILILFFAWLIFLSVFGCSPGMAWTVVNLSH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            F + YHFFHWKKGTPFA+DQGIYNRLTWWEQ+D GKQLTRNRKFLTVVPVVL    S+  
Sbjct  61   FAVIYHFFHWKKGTPFAEDQGIYNRLTWWEQMDGGKQLTRNRKFLTVVPVVLSAGTSNRL  120

Query  451  DYQHPMLFLNTVAVFILVVAKFPH  522
            D    +L  N   V  ++   FP 
Sbjct  121  D----LLLTNCPDVVYIICLGFPR  140



>gb|KJB09621.1| hypothetical protein B456_001G153200 [Gossypium raimondii]
Length=112

 Score =   181 bits (459),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 95/112 (85%), Positives = 105/112 (94%), Gaps = 0/112 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MANLYV+A P  DLN+NTEWF YPGVW+TYILILFFSWL+ LS+FGCSPG AWT+VNL+H
Sbjct  1    MANLYVKAVPPADLNRNTEWFMYPGVWTTYILILFFSWLLVLSIFGCSPGMAWTVVNLAH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVL  426
            F++TYHFFHWKKGTPFA+DQGIYN LTWWEQIDNGKQLTRNRKFLTVVPVVL
Sbjct  61   FLVTYHFFHWKKGTPFAEDQGIYNGLTWWEQIDNGKQLTRNRKFLTVVPVVL  112



>gb|ACN33697.1| unknown [Zea mays]
Length=101

 Score =   179 bits (455),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 85/98 (87%), Positives = 92/98 (94%), Gaps = 1/98 (1%)
 Frame = +1

Query  268  HFMITYHFFHWKKGTPFA-DDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASH  444
            +F ITYHFFHWKKGTPFA DDQGIY+RLTWWEQIDNG+QLTRNRKFLTVVPVVLYLIASH
Sbjct  3    YFQITYHFFHWKKGTPFAADDQGIYSRLTWWEQIDNGQQLTRNRKFLTVVPVVLYLIASH  62

Query  445  TTDYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
             TDY+ PM FLNT+AVF+LVVAK P+MHKVRIFGINAD
Sbjct  63   LTDYKQPMFFLNTIAVFVLVVAKLPNMHKVRIFGINAD  100



>ref|XP_008353054.1| PREDICTED: uncharacterized protein C119.09c-like [Malus domestica]
Length=112

 Score =   178 bits (452),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 95/112 (85%), Positives = 104/112 (93%), Gaps = 0/112 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MA+LYV+A P  DLN+NTEWF YPGVW+TYILILFFSWL+ LS+FGCSPG AWTIVNLSH
Sbjct  1    MASLYVKAVPPADLNRNTEWFMYPGVWTTYILILFFSWLLVLSIFGCSPGMAWTIVNLSH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVL  426
            F ITYHFFHWKKGTPFA+DQGIYN LTWWEQ+D+GKQLTRNRKFLTVVPVVL
Sbjct  61   FAITYHFFHWKKGTPFAEDQGIYNGLTWWEQMDSGKQLTRNRKFLTVVPVVL  112



>gb|EMT22363.1| hypothetical protein F775_43827 [Aegilops tauschii]
Length=112

 Score =   177 bits (448),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 92/112 (82%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MA LYV+A P  DLNKNTEWF YPGVW+TYI ILF SWL+ LS+FGC+PG AWT+VNL H
Sbjct  1    MAKLYVQAVPPPDLNKNTEWFMYPGVWTTYIFILFVSWLLILSIFGCTPGMAWTLVNLGH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVL  426
            F ITYHFFHWKKGTPFADDQG+YNRLTWWEQ+DNGKQLTRNRKFL VVPVVL
Sbjct  61   FAITYHFFHWKKGTPFADDQGMYNRLTWWEQMDNGKQLTRNRKFLVVVPVVL  112



>ref|XP_010919291.1| PREDICTED: uncharacterized protein C119.09c-like [Elaeis guineensis]
Length=112

 Score =   176 bits (447),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 95/112 (85%), Positives = 102/112 (91%), Gaps = 0/112 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MA LYV+A P  DLNKNTEWF YPGVW+TYILILFFSWL+ LS+FGC+PG AWT+VNL H
Sbjct  1    MAKLYVQAVPPADLNKNTEWFMYPGVWTTYILILFFSWLLVLSIFGCTPGMAWTMVNLFH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVL  426
            F ITYHFFHWKKGTPFADDQGIYN LTWWEQ+DNGKQLTRNRKFLTVVPVVL
Sbjct  61   FAITYHFFHWKKGTPFADDQGIYNTLTWWEQMDNGKQLTRNRKFLTVVPVVL  112



>ref|NP_001142353.1| hypothetical protein [Zea mays]
 gb|ACF88268.1| unknown [Zea mays]
 gb|AFW63354.1| hypothetical protein ZEAMMB73_030085 [Zea mays]
Length=127

 Score =   176 bits (447),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 94/117 (80%), Positives = 105/117 (90%), Gaps = 0/117 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MA LYV+A P  DLNKNTEWF YPGVW+TYILI+FFSWL+ LSVFGC+PGTAWT+VNL H
Sbjct  1    MAKLYVQAFPPADLNKNTEWFMYPGVWTTYILIVFFSWLLVLSVFGCTPGTAWTVVNLFH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIAS  441
            F ITYHFFHWKKGTPFADDQG+YN LTWWEQ+DNGKQLTRNRKFL VVPVVL++  +
Sbjct  61   FAITYHFFHWKKGTPFADDQGMYNALTWWEQMDNGKQLTRNRKFLIVVPVVLFIFDA  117



>ref|XP_010441380.1| PREDICTED: uncharacterized protein C119.09c-like [Camelina sativa]
Length=109

 Score =   173 bits (438),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = +1

Query  100  LYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMI  279
            +YVRA PTTD+N+NTEWFTYPGVW+TYILILFFSWL+ LSVF CSPG AWTIV+L+HF +
Sbjct  1    MYVRALPTTDVNRNTEWFTYPGVWTTYILILFFSWLLVLSVFHCSPGIAWTIVHLAHFTV  60

Query  280  TYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVL  426
            TYH FHWKKGTPF DDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVL
Sbjct  61   TYHSFHWKKGTPFGDDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVL  109



>ref|XP_010457152.1| PREDICTED: uncharacterized protein C119.09c-like [Camelina sativa]
Length=112

 Score =   173 bits (438),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 90/112 (80%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MANLYV+A P  D+N+NTEWF YPGVW+TY+LILFF WLV LSV GCSPG AWT+VNL+H
Sbjct  1    MANLYVKAVPPPDMNRNTEWFMYPGVWTTYMLILFFGWLVVLSVSGCSPGMAWTVVNLAH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVL  426
            F++TYH FHW KGTPFADDQGIYN LTWWEQ+DNG+QLTRNRKFLTVVPVVL
Sbjct  61   FVVTYHCFHWMKGTPFADDQGIYNGLTWWEQMDNGQQLTRNRKFLTVVPVVL  112



>ref|NP_001154758.1| ORMDL domain-containing protein [Arabidopsis thaliana]
 gb|AED94753.1| ORMDL domain-containing protein [Arabidopsis thaliana]
Length=109

 Score =   172 bits (436),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 93/109 (85%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = +1

Query  100  LYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMI  279
            +YVRA PTTD+N+NTEWFTYPGVW+TYILILFFSWL+ LSVF CSPG AWTIV+L+HF +
Sbjct  1    MYVRALPTTDVNRNTEWFTYPGVWTTYILILFFSWLLVLSVFHCSPGIAWTIVHLAHFTV  60

Query  280  TYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVL  426
            TYH FHWKKGTPF DDQG+YNRLTWWEQIDNGKQLTRNRKFLTVVPVVL
Sbjct  61   TYHSFHWKKGTPFGDDQGVYNRLTWWEQIDNGKQLTRNRKFLTVVPVVL  109



>ref|XP_006439265.1| hypothetical protein CICLE_v10022658mg [Citrus clementina]
 gb|ESR52505.1| hypothetical protein CICLE_v10022658mg [Citrus clementina]
 gb|KDO76665.1| hypothetical protein CISIN_1g0317191mg [Citrus sinensis]
 gb|KDO76666.1| hypothetical protein CISIN_1g0317191mg, partial [Citrus sinensis]
Length=109

 Score =   171 bits (432),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 98/109 (90%), Gaps = 0/109 (0%)
 Frame = +1

Query  100  LYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMI  279
            +YVR  P TDLN+NTEWFTYPGVW+TY+ ILF SWL+ LS+F CS G AWT+V+LSHF +
Sbjct  1    MYVRTVPPTDLNRNTEWFTYPGVWTTYLSILFISWLLVLSLFNCSSGMAWTLVHLSHFFV  60

Query  280  TYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVL  426
            TYHFFHWKKGTPFADDQGIYN LTWWEQIDNGKQLTRNRKFLTVVPVVL
Sbjct  61   TYHFFHWKKGTPFADDQGIYNGLTWWEQIDNGKQLTRNRKFLTVVPVVL  109



>gb|ACF87007.1| unknown [Zea mays]
 tpg|DAA39686.1| TPA: hypothetical protein ZEAMMB73_441359 [Zea mays]
Length=117

 Score =   169 bits (429),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 90/109 (83%), Positives = 99/109 (91%), Gaps = 1/109 (1%)
 Frame = +1

Query  103  YVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMIT  282
            YV A P  D+NKNTEWF YPGVW+TYIL+LFF+WL+ LSV GCSPG AWT+VNL+HF IT
Sbjct  9    YVEAVPPVDVNKNTEWFMYPGVWTTYILMLFFAWLLVLSVSGCSPGAAWTVVNLAHFAIT  68

Query  283  YHFFHWKKGTPF-ADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVL  426
            YHFFHWKKGTPF ADDQGIY+RLTWWEQIDNG+QLTRNRKFLTVVPVVL
Sbjct  69   YHFFHWKKGTPFAADDQGIYSRLTWWEQIDNGQQLTRNRKFLTVVPVVL  117



>gb|EMT26151.1| hypothetical protein F775_18242 [Aegilops tauschii]
Length=112

 Score =   166 bits (420),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 87/112 (78%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            MA LY++A P  DLNKNTEWF Y GVW+T+I ILF SWL+ LS+FGC+P  AWT+VNL H
Sbjct  1    MAKLYMQAVPPLDLNKNTEWFMYLGVWTTHIFILFVSWLLILSIFGCTPSMAWTLVNLGH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVL  426
            F ITYHFFHWKKGTPFADDQG+YNRLTWWEQ+DN KQLTRNRKFL VVPVVL
Sbjct  61   FAITYHFFHWKKGTPFADDQGMYNRLTWWEQMDNDKQLTRNRKFLVVVPVVL  112



>tpg|DAA39688.1| TPA: hypothetical protein ZEAMMB73_441359 [Zea mays]
Length=134

 Score =   155 bits (393),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 91/101 (90%), Gaps = 1/101 (1%)
 Frame = +1

Query  103  YVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMIT  282
            YV A P  D+NKNTEWF YPGVW+TYIL+LFF+WL+ LSV GCSPG AWT+VNL+HF IT
Sbjct  9    YVEAVPPVDVNKNTEWFMYPGVWTTYILMLFFAWLLVLSVSGCSPGAAWTVVNLAHFAIT  68

Query  283  YHFFHWKKGTPF-ADDQGIYNRLTWWEQIDNGKQLTRNRKF  402
            YHFFHWKKGTPF ADDQGIY+RLTWWEQIDNG+QLTRNRKF
Sbjct  69   YHFFHWKKGTPFAADDQGIYSRLTWWEQIDNGQQLTRNRKF  109



>ref|XP_008782503.1| PREDICTED: ORM1-like protein 2 isoform X1 [Phoenix dactylifera]
Length=166

 Score =   155 bits (393),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 95/119 (80%), Gaps = 1/119 (1%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            M  LYV A P   LN+NTEW  YPGVW+ Y+L++FF+W+  LS+  CSPG AWT+VNL+H
Sbjct  1    MLKLYVEAPPPPVLNRNTEWVMYPGVWTAYVLLIFFAWIAVLSLLRCSPGVAWTVVNLAH  60

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYL-IASH  444
            F +TYH FHW+KGTPFA+DQGIYN LTWWEQ+DNGKQLT NRKFL  VPV+L L + SH
Sbjct  61   FFVTYHCFHWRKGTPFAEDQGIYNGLTWWEQMDNGKQLTNNRKFLATVPVILMLCVRSH  119



>ref|XP_004340266.1| hypothetical protein ACA1_369890 [Acanthamoeba castellanii str. 
Neff]
 gb|ELR18246.1| hypothetical protein ACA1_369890 [Acanthamoeba castellanii str. 
Neff]
Length=155

 Score =   139 bits (349),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/142 (48%), Positives = 90/142 (63%), Gaps = 1/142 (1%)
 Frame = +1

Query  133  NKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMITYHFFHWKKGT  312
            N+N  WF   G W  Y+ ++    +    V G SP TAWTI NL H + T+  FHW KG 
Sbjct  11   NRNVTWFDSKGAWVAYLSLIIGFRIFLTFVPGISPSTAWTITNLVHALGTWMAFHWSKGA  70

Query  313  PF-ADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQHPMLFLNTVA  489
            PF   DQ  Y +LT WEQ+D G Q +  RK LTVVP+VL+L+ +H T Y   ML +N VA
Sbjct  71   PFTGSDQDKYAKLTMWEQLDQGIQFSPTRKLLTVVPIVLFLLTTHYTQYNFLMLVINIVA  130

Query  490  VFILVVAKFPHMHKVRIFGINA  555
            + +L+V+K P MHKVR+FG+N+
Sbjct  131  LIVLLVSKLPRMHKVRLFGLNS  152



>ref|XP_005851151.1| hypothetical protein CHLNCDRAFT_29488 [Chlorella variabilis]
 gb|EFN59049.1| hypothetical protein CHLNCDRAFT_29488 [Chlorella variabilis]
Length=163

 Score =   132 bits (332),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 81/154 (53%), Positives = 99/154 (64%), Gaps = 5/154 (3%)
 Frame = +1

Query  97   NLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFM  276
             + +R+ PT   NKNTEW      W  YI+++   WLV  S     PG AWT V+L H  
Sbjct  15   GVRLRSVPT---NKNTEWLNQKAAWCFYIILIVLCWLVLASW--TDPGMAWTYVHLGHGA  69

Query  277  ITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDY  456
            ITY   HW KG+P  DDQGIY+ LT+WEQID+G Q T  RKF TVVPVVL+L+ASH  D+
Sbjct  70   ITYFLLHWNKGSPIQDDQGIYDNLTFWEQIDDGVQGTATRKFFTVVPVVLFLLASHGADF  129

Query  457  QHPMLFLNTVAVFILVVAKFPHMHKVRIFGINAD  558
            +   L LN + V +L +AK   MHKVRIFGIN D
Sbjct  130  RRQPLGLNLLVVVVLTIAKMSGMHKVRIFGINRD  163



>ref|XP_011398421.1| Uncharacterized protein F751_0552 [Auxenochlorella protothecoides]
 gb|KFM25525.1| Uncharacterized protein F751_0552 [Auxenochlorella protothecoides]
Length=157

 Score =   129 bits (323),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 76/154 (49%), Positives = 104/154 (68%), Gaps = 5/154 (3%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
             A L ++A   ++ NKNT W   P  W  Y+ +L  SWL+  S     PG AWT V+++H
Sbjct  7    QAGLGIKA---SEANKNTNWLDSPAAWVYYVALLLLSWLLVSSF--TDPGIAWTYVHIAH  61

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
             ++TY  FHW KG+P A+DQG+Y+  T+WEQID+G+Q T  RKFLT VPVVL+L+AS+ T
Sbjct  62   GVLTYIIFHWVKGSPIANDQGVYDSQTFWEQIDDGQQFTPARKFLTAVPVVLFLLASNGT  121

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGIN  552
            DY+   L +N + V +LV+AK   MH+VRI GIN
Sbjct  122  DYRRQPLGVNLIVVIVLVIAKLASMHRVRILGIN  155



>ref|XP_005644615.1| ORMDL-domain-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE20071.1| ORMDL-domain-containing protein [Coccomyxa subellipsoidea C-169]
Length=170

 Score =   125 bits (313),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 73/148 (49%), Positives = 97/148 (66%), Gaps = 2/148 (1%)
 Frame = +1

Query  109  RAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMITYH  288
            RA+     NKN EW + P  W+  + ++   WL+         G AWT V+L H +ITY+
Sbjct  23   RASQPVTTNKNVEWLSAPEAWTFIVALICLGWLILSLFMDS--GLAWTYVHLLHGVITYY  80

Query  289  FFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQHPM  468
              HW KG+P   DQG Y+ LT+WEQ+D+G Q T  RKFLT+VPV L+L+A+H TDY+   
Sbjct  81   LLHWNKGSPVQMDQGKYDSLTFWEQLDDGVQNTNTRKFLTLVPVALFLLATHGTDYRRQP  140

Query  469  LFLNTVAVFILVVAKFPHMHKVRIFGIN  552
            L LN + + +LV+AKFP MHKVRIFGIN
Sbjct  141  LGLNLIVLLVLVIAKFPAMHKVRIFGIN  168



>ref|XP_002518881.1| ormdl, putative [Ricinus communis]
 gb|EEF43414.1| ormdl, putative [Ricinus communis]
Length=108

 Score =   122 bits (305),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = +1

Query  100  LYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMI  279
            +YV+A PTTD+N+NTEWFTYPGVW+TYIL++F SWL+ LS+FGCSPG AWTIV+LSHF+I
Sbjct  1    MYVKAVPTTDVNRNTEWFTYPGVWTTYILMVFISWLIVLSLFGCSPGMAWTIVHLSHFVI  60

Query  280  TYHFFHWKKGTPFADDQGIY  339
            TY FFHWKKGTPFADDQGIY
Sbjct  61   TYQFFHWKKGTPFADDQGIY  80



>gb|EPB84369.1| hypothetical protein HMPREF1544_08888 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=165

 Score =   123 bits (308),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 86/140 (61%), Gaps = 0/140 (0%)
 Frame = +1

Query  133  NKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMITYHFFHWKKGT  312
            N N+ W  Y G W T I +      +F  +   +P  +WT+ NLS     Y  FHW +G 
Sbjct  19   NFNSSWVNYKGAWITTIFVAVALKALFTVIPFITPEASWTLTNLSFNFGHYIMFHWVQGI  78

Query  313  PFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQHPMLFLNTVAV  492
            PF ++QG Y+ LT WEQID G Q T  RKFLT VP+VL+L+++H T Y   +  +N  A+
Sbjct  79   PFENNQGAYDGLTLWEQIDGGVQFTATRKFLTAVPIVLFLLSTHYTHYDVFLFGINFTAL  138

Query  493  FILVVAKFPHMHKVRIFGIN  552
             +++VAK P MH+VRIFGIN
Sbjct  139  MVVLVAKLPVMHRVRIFGIN  158



>emb|CEG72541.1| Putative ORM1 protein [Rhizopus microsporus]
 emb|CEJ02652.1| Putative ORM1 protein [Rhizopus microsporus]
Length=167

 Score =   122 bits (305),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 61/140 (44%), Positives = 87/140 (62%), Gaps = 0/140 (0%)
 Frame = +1

Query  133  NKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMITYHFFHWKKGT  312
            N N+ W  Y G W T I ++     +F  +   +P  +WT+ NL+     Y  FHW +G 
Sbjct  21   NFNSSWVNYKGAWFTTIFVIVVLKALFTLIPFITPEASWTLTNLAFNCGHYIMFHWVQGI  80

Query  313  PFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQHPMLFLNTVAV  492
            PF ++QG Y+ LT WEQID G Q T  RKFLT VP+VL+L+++H T Y   +  +N  A+
Sbjct  81   PFENNQGAYDGLTLWEQIDGGVQFTATRKFLTAVPIVLFLLSTHYTHYDFFLFGINFTAL  140

Query  493  FILVVAKFPHMHKVRIFGIN  552
             +++VAK P MH+VR+FGIN
Sbjct  141  LVVLVAKLPMMHRVRVFGIN  160



>emb|CDH57818.1| protein orm1 [Lichtheimia corymbifera JMRC:FSU:9682]
 emb|CDS05161.1| hypothetical protein LRAMOSA07690 [Absidia idahoensis var. thermophila]
Length=166

 Score =   120 bits (302),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/140 (43%), Positives = 86/140 (61%), Gaps = 0/140 (0%)
 Frame = +1

Query  133  NKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMITYHFFHWKKGT  312
            N N+ W  Y G WST I ++     ++  +   SP  +WT+ NL+  +  Y  FHW +G 
Sbjct  20   NFNSSWVNYKGAWSTTIFVIVLLKTLYSIIPFISPEASWTLTNLTFNIGHYIMFHWVQGI  79

Query  313  PFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQHPMLFLNTVAV  492
            PF + QG Y+ LT WEQID G Q T  RKF T VP+ L+L+++H T Y   +L +N   +
Sbjct  80   PFENHQGAYDGLTLWEQIDGGVQFTATRKFFTAVPIALFLLSTHYTHYNLLLLAINFAPL  139

Query  493  FILVVAKFPHMHKVRIFGIN  552
             +++VAK P MH+VR+FGIN
Sbjct  140  MLVLVAKLPVMHRVRVFGIN  159



>ref|XP_001703235.1| hypothetical protein CHLREDRAFT_185995 [Chlamydomonas reinhardtii]
 gb|EDO96531.1| predicted protein [Chlamydomonas reinhardtii]
Length=153

 Score =   119 bits (299),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 66/148 (45%), Positives = 95/148 (64%), Gaps = 1/148 (1%)
 Frame = +1

Query  109  RAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMITYH  288
            R     D+NKNT W  YP VW+ Y+ ++   WL   ++   + G AWT V++ H ++TY+
Sbjct  5    RTVSEVDVNKNTNWLNYPSVWTWYLALIVLGWLGISALIDDA-GLAWTYVHIIHGVLTYY  63

Query  289  FFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQHPM  468
              HW KG+P  +DQG Y  LT+WEQ+D     TRNRK   VVPV+L+++A+H TD++   
Sbjct  64   LLHWLKGSPNPEDQGKYEALTFWEQVDGEAYGTRNRKIFAVVPVLLFVLATHGTDFRKQP  123

Query  469  LFLNTVAVFILVVAKFPHMHKVRIFGIN  552
            L +N   V +L++AK P +HKVR FGIN
Sbjct  124  LGVNLAVVLVLLIAKLPALHKVRFFGIN  151



>gb|ESA18892.1| hypothetical protein GLOINDRAFT_139068 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX73440.1| Orm1p [Rhizophagus irregularis DAOM 197198w]
 gb|EXX73441.1| Orm1p [Rhizophagus irregularis DAOM 197198w]
Length=171

 Score =   119 bits (299),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/140 (41%), Positives = 89/140 (64%), Gaps = 0/140 (0%)
 Frame = +1

Query  133  NKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMITYHFFHWKKGT  312
            N N+ W  Y G W  +I+++    ++  SV G S  T+WT+ NLS+ + ++  FHW KG 
Sbjct  27   NLNSNWVYYKGAWLVHIILIICVKILLSSVPGVSSETSWTLTNLSYMLGSFVMFHWVKGV  86

Query  313  PFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQHPMLFLNTVAV  492
            PF  + G Y+ LT WEQIDNG Q T  +K+LT +P+ L+L+++H T Y      +N   +
Sbjct  87   PFDFNSGAYDGLTLWEQIDNGAQFTPAKKYLTALPIGLFLLSTHYTHYDAITFLVNFTFL  146

Query  493  FILVVAKFPHMHKVRIFGIN  552
             ++++AK P +HKVR+FGIN
Sbjct  147  AVVIIAKLPQLHKVRLFGIN  166



>ref|XP_002948063.1| hypothetical protein VOLCADRAFT_73521 [Volvox carteri f. nagariensis]
 gb|EFJ51051.1| hypothetical protein VOLCADRAFT_73521 [Volvox carteri f. nagariensis]
Length=153

 Score =   116 bits (291),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 72/148 (49%), Positives = 97/148 (66%), Gaps = 1/148 (1%)
 Frame = +1

Query  109  RAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMITYH  288
            R     D+NKNT W  YP VW+ Y+ ++   WL   ++   + G AWT V+L H + TY+
Sbjct  5    RTVSEVDVNKNTNWLNYPSVWTWYLAVIVLGWLGISALIDDA-GLAWTYVHLIHGVATYY  63

Query  289  FFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQHPM  468
              HW KG+P  +DQG Y  LT+WEQ+DN    TRNRK  TVVPV+L+++A+H TD++   
Sbjct  64   LLHWIKGSPNPEDQGKYQALTFWEQVDNEAYGTRNRKIFTVVPVLLFVLATHGTDFRKQP  123

Query  469  LFLNTVAVFILVVAKFPHMHKVRIFGIN  552
            L LN V V +L+VAK P +HKVR FGIN
Sbjct  124  LGLNLVVVVVLLVAKLPALHKVRFFGIN  151



>gb|KIZ03999.1| Uncharacterized protein MNEG_3962 [Monoraphidium neglectum]
Length=154

 Score =   115 bits (287),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 69/155 (45%), Positives = 92/155 (59%), Gaps = 1/155 (1%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSH  270
            M   + R     D+NK T W   PGVW  Y+ ++  SWL   ++   S G AWT V+L H
Sbjct  1    MTGRHRRVPSEVDVNKTTNWLDSPGVWVWYLSVICLSWLCLTALTSDS-GLAWTYVHLMH  59

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
               +Y   HW KG+   +DQG Y  LT WEQ+DN    T  RKFLT VP+ L+++A+H T
Sbjct  60   GAASYWLLHWTKGSFAPEDQGRYGSLTLWEQVDNEMYGTSTRKFLTAVPLALFVLATHGT  119

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGINA  555
            D++   L LN V V +L++AK P +HKVR FGI A
Sbjct  120  DFRKQPLGLNFVVVLVLLIAKLPALHKVRFFGIGA  154



>ref|XP_001329089.1| ORMDL family protein [Trichomonas vaginalis G3]
 gb|EAY16866.1| ORMDL family protein [Trichomonas vaginalis G3]
Length=151

 Score =   115 bits (287),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/142 (43%), Positives = 88/142 (62%), Gaps = 1/142 (1%)
 Frame = +1

Query  130  LNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMITYHFFHWKKG  309
            LNKN ++   P  W  Y L+  F  +    + G S   AWT+V+  H ++T   FHW KG
Sbjct  11   LNKNVQFIDNPVCWVFYTLLFLFLRIFLSGL-GFSIPMAWTLVSWVHGIVTIILFHWIKG  69

Query  310  TPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQHPMLFLNTVA  489
            +PF DD G Y++LT+WEQID+  Q TR RKFL + P++L+ +A  +  ++   +FLN   
Sbjct  70   SPFIDDHGAYSQLTFWEQIDDQLQNTRARKFLIIFPIILFFLAVDSGHWELAYIFLNFPI  129

Query  490  VFILVVAKFPHMHKVRIFGINA  555
            +F+ ++AK P MH VRIFGIN 
Sbjct  130  LFVCILAKLPFMHGVRIFGING  151



>emb|CEP06814.1| hypothetical protein [Parasitella parasitica]
Length=154

 Score =   115 bits (287),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 73/108 (68%), Gaps = 0/108 (0%)
 Frame = +1

Query  229  CSPGTAWTIVNLSHFMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLT  408
             SP  +WT+ NL+     Y  FHW +G PF ++QG Y+ LT WEQID G Q T  RKFLT
Sbjct  40   ISPEASWTLTNLTFNFGHYIMFHWVQGIPFENNQGAYDGLTLWEQIDGGVQFTATRKFLT  99

Query  409  VVPVVLYLIASHTTDYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGIN  552
             VP+VL+L+++H T Y   +  +N  A+ +++VAK P MHKVR+FGIN
Sbjct  100  AVPIVLFLLSTHYTHYDVFLFGINFTALMVVLVAKLPVMHKVRLFGIN  147



>dbj|GAN07203.1| protein orm1 protein [Mucor ambiguus]
Length=131

 Score =   114 bits (285),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 73/108 (68%), Gaps = 0/108 (0%)
 Frame = +1

Query  229  CSPGTAWTIVNLSHFMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLT  408
             +P  +WT+ NLS     Y  FHW +G PF ++QG Y+ LT WEQID G Q T  RKFLT
Sbjct  17   ITPEASWTLTNLSFNFGHYIMFHWVQGIPFENNQGAYDGLTLWEQIDGGVQFTATRKFLT  76

Query  409  VVPVVLYLIASHTTDYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGIN  552
             VP+VL+L+++H T Y   +  +N  A+ +++VAK P MH+VRIFGIN
Sbjct  77   AVPIVLFLLSTHYTHYDVFLFGINFTALMVVLVAKLPVMHRVRIFGIN  124



>gb|EPB89821.1| hypothetical protein HMPREF1544_03342 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=170

 Score =   114 bits (286),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 62/149 (42%), Positives = 92/149 (62%), Gaps = 1/149 (1%)
 Frame = +1

Query  109  RAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMITYH  288
            + +    LN +T W +Y G W T +LI+    +++  +   S  T+WT+ NL+     + 
Sbjct  15   QGSAPNQLNYSTNWMSYKGAWVTIVLIVVVIKILYSLIPFISSETSWTLTNLTFNAGHFI  74

Query  289  FFHWKKGTPFADD-QGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQHP  465
             FHW +GTP  D+ QG Y+ LT WEQID+G Q T  RKFL  VP+VL+L+++H T Y   
Sbjct  75   MFHWLQGTPTLDNNQGAYDGLTVWEQIDDGIQFTATRKFLMAVPIVLFLLSTHYTHYAML  134

Query  466  MLFLNTVAVFILVVAKFPHMHKVRIFGIN  552
               +N  ++ I+++AK P MH+VRIFGIN
Sbjct  135  QFAINFCSLAIVLIAKLPAMHQVRIFGIN  163



>gb|EMT11480.1| hypothetical protein F775_30106 [Aegilops tauschii]
Length=242

 Score =   115 bits (289),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 72/167 (43%), Positives = 87/167 (52%), Gaps = 32/167 (19%)
 Frame = +1

Query  91   MANLYVRAAPTTDLNKNTEWFTY------------------------PGVWSTYililff  198
            MA LYV+A P  DLNKNTEWF Y                        PG  ST       
Sbjct  1    MAKLYVQAVPPPDLNKNTEWFMYLGSGPPTSSSSSSPGSSSSPSSAWPGRSSTSATSRGK  60

Query  199  swlvflsvfGCSPGTAWTIVNLSHFMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGK  378
               + L+V       A  +   S   ITYHFFHWKKGTPFADDQG+YNRLTWWEQ+DNGK
Sbjct  61   IHEIILAV-----NIAVLVGPTSIMEITYHFFHWKKGTPFADDQGMYNRLTWWEQMDNGK  115

Query  379  QLTRNRKFLTVVPVVLYLIASHTTDYQHPMLFLNTVAVFILVVAKFP  519
            QLTRNRKFL V      ++  +  ++    L++  +A  + V A  P
Sbjct  116  QLTRNRKFLVVELANFVVLQLNERNFS---LYVTQLAAAVAVDASEP  159



>ref|XP_006681681.1| hypothetical protein BATDEDRAFT_27467 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF77625.1| hypothetical protein BATDEDRAFT_27467 [Batrachochytrium dendrobatidis 
JAM81]
Length=157

 Score =   113 bits (282),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 57/144 (40%), Positives = 89/144 (62%), Gaps = 0/144 (0%)
 Frame = +1

Query  121  TTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMITYHFFHW  300
            TT+ N N+ W    G W   I+++FF  +    V G +   +WT+ N+ +  IT+  FHW
Sbjct  8    TTNNNPNSTWVNSRGSWIATIVVIFFMRVGLAVVPGITTEASWTLTNVGYNTITFFMFHW  67

Query  301  KKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQHPMLFLN  480
              G P++ +Q  Y+ LT WEQID G Q T  +K+LT VP+VL+L+++H T Y      +N
Sbjct  68   ISGVPYSINQNEYDGLTLWEQIDGGAQFTPTKKYLTAVPIVLFLLSTHYTHYDFLTFMIN  127

Query  481  TVAVFILVVAKFPHMHKVRIFGIN  552
              ++ I+++AK P MH+VR+FG+N
Sbjct  128  LTSLVIVLIAKLPSMHRVRLFGLN  151



>dbj|GAN07945.1| conserved hypothetical protein [Mucor ambiguus]
Length=170

 Score =   113 bits (282),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 61/149 (41%), Positives = 91/149 (61%), Gaps = 1/149 (1%)
 Frame = +1

Query  109  RAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMITYH  288
            + +    LN +T W +Y G W T +LI+    +++  +   S  T+WT+ NL+     + 
Sbjct  15   QGSAPNQLNYSTNWMSYKGAWVTIVLIVVAIKILYSLIPFISSETSWTLTNLTFNAGHFI  74

Query  289  FFHWKKGTPFADD-QGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQHP  465
             FHW +GTP  D+ QG Y+ LT WEQID+G Q T  RKFL  VP+VL+L+++H T Y   
Sbjct  75   MFHWLQGTPTLDNNQGAYDGLTVWEQIDDGIQFTATRKFLMAVPIVLFLLSTHYTHYDVL  134

Query  466  MLFLNTVAVFILVVAKFPHMHKVRIFGIN  552
               +N  ++ I+++AK P MH+VRI GIN
Sbjct  135  QFAINFCSLAIVLIAKLPAMHQVRILGIN  163



>ref|XP_004349986.1| hypothetical protein DFA_11048 [Dictyostelium fasciculatum]
 gb|EGG13287.1| hypothetical protein DFA_11048 [Dictyostelium fasciculatum]
Length=157

 Score =   112 bits (281),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 67/154 (44%), Positives = 91/154 (59%), Gaps = 5/154 (3%)
 Frame = +1

Query  103  YVRAAPTTD---LNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHF  273
            ++R   TTD   +N+N  W      W  YI+ L    L+   VF       W +V + H 
Sbjct  3    HMRRNSTTDDFQINRNESWMHSQSFWVVYIIGLLLFKLIISIVF-PDYQYGWLVVTVIHA  61

Query  274  MITYHFFHWKKGTPF-ADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTT  450
            +IT+  FHW+KG PF   DQG YNRLT WEQID G+Q T  RKFLT+VP+ L++I  H+ 
Sbjct  62   IITWFAFHWQKGIPFDLSDQGKYNRLTLWEQIDKGQQYTPTRKFLTLVPIFLFMITLHSN  121

Query  451  DYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGIN  552
                   +LN +A FI+V++K P M +VR+FGIN
Sbjct  122  GILGAPFYLNALASFIVVLSKMPRMDRVRLFGIN  155



>gb|KFH68279.1| hypothetical protein MVEG_05097 [Mortierella verticillata NRRL 
6337]
Length=173

 Score =   112 bits (281),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/140 (41%), Positives = 84/140 (60%), Gaps = 0/140 (0%)
 Frame = +1

Query  133  NKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMITYHFFHWKKGT  312
            N N+ W    G W T +LI+      F  + G SP  +W++  L++ + +Y  FH   G 
Sbjct  22   NLNSSWMNDKGAWVTNVLIVVLIKFFFGIIPGISPELSWSMTTLTYNVGSYVMFHAVTGV  81

Query  313  PFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQHPMLFLNTVAV  492
            PF   QG Y+ +T WEQID G+Q T  RK+LT VP+VL+L+++H T Y   + F+N V  
Sbjct  82   PFEFSQGAYDGITLWEQIDGGEQFTATRKYLTTVPIVLFLVSTHYTHYAPSVFFVNLVLT  141

Query  493  FILVVAKFPHMHKVRIFGIN  552
             I ++AK P MH+VR+F IN
Sbjct  142  VINLIAKLPAMHQVRLFDIN  161



>gb|KFH67995.1| hypothetical protein MVEG_06725 [Mortierella verticillata NRRL 
6337]
Length=169

 Score =   112 bits (281),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 62/140 (44%), Positives = 84/140 (60%), Gaps = 0/140 (0%)
 Frame = +1

Query  133  NKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMITYHFFHWKKGT  312
            N N+ W    G W T  +++FF    F  + G SP  +WT+  L++ + +Y  FH   G 
Sbjct  22   NLNSSWVNAKGAWMTNFILIFFIKFFFGIIPGISPELSWTLTTLTYNIGSYIMFHAVTGV  81

Query  313  PFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQHPMLFLNTVAV  492
            PF   QG Y+ +T WEQID G Q T  RK+LT VPVVL+L+++H T Y     F+N VA 
Sbjct  82   PFEFTQGAYDGITLWEQIDGGVQFTATRKYLTTVPVVLFLLSTHYTHYAPFAFFVNFVAT  141

Query  493  FILVVAKFPHMHKVRIFGIN  552
            FI +VA  P MH+VR+F IN
Sbjct  142  FINLVANLPAMHQVRLFNIN  161



>emb|CCJ31302.1| unnamed protein product [Pneumocystis jirovecii]
Length=190

 Score =   112 bits (281),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/140 (39%), Positives = 86/140 (61%), Gaps = 0/140 (0%)
 Frame = +1

Query  133  NKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMITYHFFHWKKGT  312
            N N  W  + G W  +I+++    + + +    S   +WT+ NL++ + +Y  FHW KG 
Sbjct  46   NFNCNWVNFKGAWIIHIVVISCLKIFYNAFPAVSQELSWTLTNLTYMLSSYIMFHWVKGI  105

Query  313  PFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQHPMLFLNTVAV  492
            PF  + G Y+ LT WEQ+DNG Q T  +K+LT VP++L+L+++H T Y   M F+N  A+
Sbjct  106  PFEFNSGAYDNLTMWEQMDNGAQYTPAKKYLTTVPIILFLLSTHYTHYDFWMFFINLWAL  165

Query  493  FILVVAKFPHMHKVRIFGIN  552
             +++V K P  H+ RIFGIN
Sbjct  166  TMVLVPKLPSTHRKRIFGIN  185



>gb|EPY49458.1| ORMDL family protein [Schizosaccharomyces cryophilus OY26]
Length=185

 Score =   112 bits (280),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 58/140 (41%), Positives = 88/140 (63%), Gaps = 0/140 (0%)
 Frame = +1

Query  133  NKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMITYHFFHWKKGT  312
            N N+ W  Y G W  +I+++    LVF +V   S   AWT+ NL++   ++  FHW  GT
Sbjct  32   NYNSNWVNYKGAWIIHIVLIAALRLVFHAVPSVSRELAWTLTNLTYMAGSFTMFHWVTGT  91

Query  313  PFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQHPMLFLNTVAV  492
            PF  + G Y+RLT WEQ+D G Q T  RK+L V+P++L+L+++H T Y   M  +N  A+
Sbjct  92   PFEFNGGAYDRLTMWEQLDEGNQYTPARKYLLVLPIILFLLSTHYTHYNGWMFLVNIWAL  151

Query  493  FILVVAKFPHMHKVRIFGIN  552
            F++++ K P +H+ RIFGI 
Sbjct  152  FMVLIPKLPAVHRKRIFGIQ  171



>ref|XP_004349070.1| Ormdl2 protein [Capsaspora owczarzaki ATCC 30864]
 gb|KJE91140.1| Ormdl2 protein [Capsaspora owczarzaki ATCC 30864]
Length=160

 Score =   111 bits (278),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 63/138 (46%), Positives = 85/138 (62%), Gaps = 1/138 (1%)
 Frame = +1

Query  133  NKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMITYHFFHWKKGT  312
            N N  W    G W  YIL+L    L F SV   S   ++T+ N+ H M++++ FH  +GT
Sbjct  11   NPNEVWLHGKGAWLAYILLLVVLRLAFASVPFLSVPVSFTLTNVVHNMLSFYLFHLMRGT  70

Query  313  PFAD-DQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQHPMLFLNTVA  489
            PF   DQG   RLT WEQID G Q T  RKFL  +P+VL+L+ SH T+Y   +  +N V+
Sbjct  71   PFVSADQGESARLTQWEQIDAGAQFTNTRKFLAAIPIVLFLLTSHYTEYDPVLFAINFVS  130

Query  490  VFILVVAKFPHMHKVRIF  543
            + I++VAK P MHKVR+F
Sbjct  131  LCIVMVAKLPQMHKVRLF  148



>gb|EPX75182.1| ORMDL family protein [Schizosaccharomyces octosporus yFS286]
Length=185

 Score =   112 bits (279),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 58/140 (41%), Positives = 88/140 (63%), Gaps = 0/140 (0%)
 Frame = +1

Query  133  NKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMITYHFFHWKKGT  312
            N N+ W  Y G W  +I+++    LVF +V   S   AWT+ NL++   ++  FHW  GT
Sbjct  32   NYNSNWVNYKGAWIIHIVLIAALRLVFHAVPSVSRELAWTLTNLTYMAGSFIMFHWVTGT  91

Query  313  PFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQHPMLFLNTVAV  492
            PF  + G Y+RLT WEQ+D G Q T  RK+L V+P++L+L+++H T Y   M  +N  A+
Sbjct  92   PFEFNGGAYDRLTMWEQLDEGNQYTPARKYLLVLPIILFLLSTHYTHYNGWMFLVNIWAL  151

Query  493  FILVVAKFPHMHKVRIFGIN  552
            F++++ K P +H+ RIFGI 
Sbjct  152  FMVLIPKLPAVHRKRIFGIQ  171



>dbj|GAM18040.1| hypothetical protein SAMD00019534_012150 [Acytostelium subglobosum 
LB1]
Length=147

 Score =   111 bits (277),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 68/103 (66%), Gaps = 0/103 (0%)
 Frame = +1

Query  244  AWTIVNLSHFMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVV  423
            AW  V + H  +TY   HW+KG PF   QG Y+RLT WEQID G+Q T  RKF T+VP+V
Sbjct  43   AWLTVTIMHAAVTYCGLHWQKGLPFLFHQGKYSRLTLWEQIDKGQQYTPTRKFFTLVPIV  102

Query  424  LYLIASHTTDYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGIN  552
            L++I  +   Y     +LN V  FIL++AK P +H+VRIFGIN
Sbjct  103  LFMITLNDNGYGGIPFYLNAVPTFILLLAKMPQLHRVRIFGIN  145



>ref|XP_002739204.1| PREDICTED: ORM1-like protein 2-like [Saccoglossus kowalevskii]
Length=153

 Score =   111 bits (277),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 87/144 (60%), Gaps = 1/144 (1%)
 Frame = +1

Query  124  TDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMITYHFFHWK  303
            ++LN NT W    G+W TY L       + LSV   S   AWT+ N++H +I Y  FH+ 
Sbjct  8    SELNPNTTWLNSKGMWITYTLATAALHYIILSVPWFSVAVAWTLTNVAHNVIMYMAFHYV  67

Query  304  KGTPFA-DDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQHPMLFLN  480
            KG P+   +QG    LT WEQ+D+G+Q T  +KFLT VP+VL+L+AS  T Y H    +N
Sbjct  68   KGAPWETGNQGKDRYLTHWEQMDHGEQYTATKKFLTFVPIVLFLLASFYTKYDHRHFVIN  127

Query  481  TVAVFILVVAKFPHMHKVRIFGIN  552
             VA+  +++ K P+ H+ R FGIN
Sbjct  128  AVALMAVLLPKLPYFHRKRFFGIN  151



>ref|NP_595290.1| ORMDL family protein (predicted) [Schizosaccharomyces pombe 972h-]
 sp|O42901.3|YBA9_SCHPO RecName: Full=Uncharacterized protein C119.09c [Schizosaccharomyces 
pombe 972h-]
 emb|CAA17924.1| ORMDL family protein (predicted) [Schizosaccharomyces pombe]
Length=186

 Score =   112 bits (279),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 56/140 (40%), Positives = 88/140 (63%), Gaps = 0/140 (0%)
 Frame = +1

Query  133  NKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMITYHFFHWKKGT  312
            N N+ W  Y G W  +I+++    L+F ++   S   AWT+ NL++   ++  FHW  GT
Sbjct  33   NYNSNWVNYKGAWVIHIVLIAALRLIFHAIPSVSRELAWTLTNLTYMAGSFIMFHWVTGT  92

Query  313  PFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQHPMLFLNTVAV  492
            PF  + G Y+RLT WEQ+D G Q T  RK+L V+P++L+L+++H T Y   M  +N  A+
Sbjct  93   PFEFNGGAYDRLTMWEQLDEGNQYTPARKYLLVLPIILFLMSTHYTHYNGWMFLVNIWAL  152

Query  493  FILVVAKFPHMHKVRIFGIN  552
            F++++ K P +H+ RIFGI 
Sbjct  153  FMVLIPKLPAVHRKRIFGIQ  172



>ref|XP_002719392.1| PREDICTED: ORM1-like protein 3 [Oryctolagus cuniculus]
 ref|XP_008269643.1| PREDICTED: ORM1-like protein 3 [Oryctolagus cuniculus]
 ref|XP_008269644.1| PREDICTED: ORM1-like protein 3 [Oryctolagus cuniculus]
 ref|XP_008269645.1| PREDICTED: ORM1-like protein 3 [Oryctolagus cuniculus]
 ref|XP_008269646.1| PREDICTED: ORM1-like protein 3 [Oryctolagus cuniculus]
Length=153

 Score =   110 bits (276),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 64/144 (44%), Positives = 85/144 (59%), Gaps = 1/144 (1%)
 Frame = +1

Query  124  TDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMITYHFFHWK  303
            +++N NT      G+W +Y+L +    +V LS+   S    WT+ NL H M  Y F H  
Sbjct  8    SEVNPNTRVMNSRGIWLSYVLAIGLLHVVLLSIPFVSVPVVWTLTNLIHNMGMYIFLHTV  67

Query  304  KGTPFAD-DQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQHPMLFLN  480
            KGTPF   DQG    LT WEQ+D G Q T +RKFLT+ P+VLY + S  T Y H    LN
Sbjct  68   KGTPFETPDQGKARLLTHWEQMDYGVQFTASRKFLTITPIVLYFLTSFYTKYDHIHFILN  127

Query  481  TVAVFILVVAKFPHMHKVRIFGIN  552
            TV++  +++ K P +H VRIFGIN
Sbjct  128  TVSLMSVLIPKLPQLHGVRIFGIN  151



>ref|XP_002175643.1| ORMDL family protein [Schizosaccharomyces japonicus yFS275]
 gb|EEB09350.1| ORMDL family protein [Schizosaccharomyces japonicus yFS275]
Length=188

 Score =   112 bits (279),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 58/140 (41%), Positives = 88/140 (63%), Gaps = 0/140 (0%)
 Frame = +1

Query  133  NKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMITYHFFHWKKGT  312
            N N+ W  Y G W  +I+I+    +VF ++   S   AWT+ NL++   ++  FHW  GT
Sbjct  33   NYNSNWVNYKGAWIIHIVIIAALRIVFHAIPSVSRELAWTLTNLTYMTGSFIMFHWVTGT  92

Query  313  PFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQHPMLFLNTVAV  492
            PF  + G Y+RLT WEQ+D G Q T  RK+L V+P+VL+L+++H T Y   M  +N  A+
Sbjct  93   PFEFNAGAYDRLTMWEQLDEGNQYTPARKYLLVLPIVLFLLSTHYTHYNGWMFLVNIWAL  152

Query  493  FILVVAKFPHMHKVRIFGIN  552
            F++++ K P +H+ RIFGI 
Sbjct  153  FMVLIPKLPVVHRKRIFGIQ  172



>ref|XP_004799109.1| PREDICTED: ORM1-like protein 3 isoform X1 [Mustela putorius furo]
Length=213

 Score =   112 bits (280),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 70/190 (37%), Positives = 95/190 (50%), Gaps = 12/190 (6%)
 Frame = +1

Query  19   RPIPSKFQARPSIVGSSSSCCLNWMANLYVR-----------AAPTTDLNKNTEWFTYPG  165
            R  P   Q    + G    C L+ +  L+                 +++N NT      G
Sbjct  22   RAEPPSLQDVDGVRGQGKRCDLSHLCCLFAEQRQERGGRMNVGTAHSEVNPNTRVMNSRG  81

Query  166  VWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMITYHFFHWKKGTPFAD-DQGIYN  342
            +W +Y+L +    +V LS+   S    WT+ NL H M  Y F H  KGTPF   DQG   
Sbjct  82   IWLSYVLAIGLLHVVLLSIPFVSVPVVWTLTNLIHNMGMYIFLHTVKGTPFETPDQGKAR  141

Query  343  RLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQHPMLFLNTVAVFILVVAKFPH  522
             LT WEQ+D G Q T +RKFLT+ P+VLY + S  T Y      LNTV++  +++ K P 
Sbjct  142  LLTHWEQMDYGVQFTASRKFLTITPIVLYFLTSFYTKYDQIHFILNTVSLMSVLIPKLPQ  201

Query  523  MHKVRIFGIN  552
            +H VRIFGIN
Sbjct  202  LHGVRIFGIN  211



>ref|XP_010178182.1| PREDICTED: ORM1-like protein 1 [Mesitornis unicolor]
 gb|KFQ31299.1| ORM1-like 1 [Mesitornis unicolor]
Length=153

 Score =   110 bits (274),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 84/144 (58%), Gaps = 1/144 (1%)
 Frame = +1

Query  124  TDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMITYHFFHWK  303
            +++N NT      G+W TY L +    +V LS+  CS   AWT+ N+ H +  Y F H  
Sbjct  8    SEVNPNTRVMNSRGMWLTYALGVGMLHIVLLSIPFCSVPVAWTLTNVIHNLGMYVFLHAV  67

Query  304  KGTPFAD-DQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQHPMLFLN  480
            KGTPF   DQG    LT WEQ+D G Q T +RKF T+ P++LY +AS  T Y      LN
Sbjct  68   KGTPFETPDQGKARLLTHWEQLDYGVQFTSSRKFFTISPIILYFLASFYTKYDPAHFILN  127

Query  481  TVAVFILVVAKFPHMHKVRIFGIN  552
            T ++  +++ K P +H VRIFGIN
Sbjct  128  TASLLTVLIPKLPQLHGVRIFGIN  151



>emb|CCG82007.1| ORM1 [Taphrina deformans PYCC 5710]
Length=204

 Score =   111 bits (277),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/140 (40%), Positives = 91/140 (65%), Gaps = 0/140 (0%)
 Frame = +1

Query  133  NKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMITYHFFHWKKGT  312
            N N++W    G WS +I+++  + + + ++ G S    WT+ NLS+   ++  FHW KG 
Sbjct  54   NHNSDWVQSKGAWSIHIILILLAKIFYNTLPGVSKELGWTLTNLSYLAGSFLMFHWVKGI  113

Query  313  PFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQHPMLFLNTVAV  492
            PF  + G +++L  WEQ+DNG+Q T  +KFLT VP+VL+L+++H T+Y   M  +N VA+
Sbjct  114  PFEFNSGAFDQLNMWEQMDNGRQFTPAKKFLTAVPIVLFLLSTHYTNYNIKMFGVNLVAL  173

Query  493  FILVVAKFPHMHKVRIFGIN  552
             ++++ K P  H+ RIFGIN
Sbjct  174  LVVLIPKLPMAHRTRIFGIN  193



>gb|KDO76667.1| hypothetical protein CISIN_1g0317191mg, partial [Citrus sinensis]
Length=64

 Score =   107 bits (266),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 49/52 (94%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = +1

Query  271  FMITYHFFHWKKGTPFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVL  426
            F +TYHFFHWKKGTPFADDQGIYN LTWWEQIDNGKQLTRNRKFLTVVPVVL
Sbjct  13   FQVTYHFFHWKKGTPFADDQGIYNGLTWWEQIDNGKQLTRNRKFLTVVPVVL  64



>ref|XP_007531079.1| PREDICTED: ORM1-like protein 3 isoform X2 [Erinaceus europaeus]
Length=153

 Score =   109 bits (273),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 63/144 (44%), Positives = 85/144 (59%), Gaps = 1/144 (1%)
 Frame = +1

Query  124  TDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMITYHFFHWK  303
            +++N NT      G+W +Y+L +    +V LS+   S    WT+ NL H +  Y F H  
Sbjct  8    SEVNPNTRVMNSRGIWLSYVLAIGLLHVVLLSIPFVSVPVVWTLTNLIHNLGMYIFLHTV  67

Query  304  KGTPFAD-DQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQHPMLFLN  480
            KGTPF   DQG    LT WEQ+D G Q T +RKFLT+ P+VLY + S  T Y H    LN
Sbjct  68   KGTPFETPDQGKARLLTHWEQMDYGVQFTASRKFLTITPIVLYFLTSFYTKYDHIHFILN  127

Query  481  TVAVFILVVAKFPHMHKVRIFGIN  552
            TV++  +++ K P +H VRIFGIN
Sbjct  128  TVSLMSVLIPKLPQLHGVRIFGIN  151



>ref|NP_663492.3| ORM1-like protein 1 [Mus musculus]
 sp|Q921I0.1|ORML1_MOUSE RecName: Full=ORM1-like protein 1 [Mus musculus]
 gb|AAH12315.1| Ormdl1 protein [Mus musculus]
 gb|AAH25572.1| Ormdl1 protein [Mus musculus]
 gb|AAH23695.1| Ormdl1 protein [Mus musculus]
 dbj|BAC34226.1| unnamed protein product [Mus musculus]
 gb|EDK99989.1| ORM1-like 1 (S. cerevisiae), isoform CRA_a [Mus musculus]
Length=153

 Score =   109 bits (272),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 84/144 (58%), Gaps = 1/144 (1%)
 Frame = +1

Query  124  TDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMITYHFFHWK  303
            +++N NT      G+W TY L +    +V LS+  CS   AWT+ N+ H +  Y F H  
Sbjct  8    SEVNPNTRVMNSRGMWLTYALGVGLLHIVLLSIPFCSVPVAWTLTNIIHNLGMYVFLHAV  67

Query  304  KGTPFAD-DQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQHPMLFLN  480
            KGTPF   DQG    LT WEQ+D G Q T +RKF T+ P++LY +AS  T Y      LN
Sbjct  68   KGTPFETPDQGRARLLTHWEQLDYGVQFTSSRKFFTISPIILYFLASFYTKYDPTHFILN  127

Query  481  TVAVFILVVAKFPHMHKVRIFGIN  552
            T ++  +++ K P +H VRIFGIN
Sbjct  128  TASLLSVLIPKMPQLHGVRIFGIN  151



>dbj|BAC36865.1| unnamed protein product [Mus musculus]
Length=153

 Score =   109 bits (272),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 84/144 (58%), Gaps = 1/144 (1%)
 Frame = +1

Query  124  TDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMITYHFFHWK  303
            +++N NT      G+W TY L +    +V LS+  CS   AWT+ N+ H +  Y F H  
Sbjct  8    SEVNPNTRVMNSRGMWLTYALGVGLLHIVLLSIPFCSVPVAWTLTNIIHNLGMYVFLHAV  67

Query  304  KGTPFAD-DQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQHPMLFLN  480
            KGTPF   DQG    LT WEQ+D G Q T +RKF T+ P++LY +AS  T Y      LN
Sbjct  68   KGTPFETPDQGRARLLTHWEQLDYGVQFTSSRKFFTISPIILYFLASFYTKYDPTNFILN  127

Query  481  TVAVFILVVAKFPHMHKVRIFGIN  552
            T ++  +++ K P +H VRIFGIN
Sbjct  128  TASLLSVLIPKMPQLHGVRIFGIN  151



>ref|XP_008580235.1| PREDICTED: ORM1-like protein 3 [Galeopterus variegatus]
 ref|XP_008580236.1| PREDICTED: ORM1-like protein 3 [Galeopterus variegatus]
Length=153

 Score =   108 bits (271),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 63/144 (44%), Positives = 83/144 (58%), Gaps = 1/144 (1%)
 Frame = +1

Query  124  TDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMITYHFFHWK  303
            +++N NT      G+W +Y+L +     V LS+   S    WT+ NL H M  Y F H  
Sbjct  8    SEVNPNTRVMNSRGIWLSYVLAIGLLHAVLLSIPFVSVPVVWTLTNLIHNMGMYIFLHTV  67

Query  304  KGTPFAD-DQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQHPMLFLN  480
            KGTPF   DQG    LT WEQ+D G Q T +RKFLT+ P+VLY + S  T Y      LN
Sbjct  68   KGTPFETPDQGKARLLTHWEQMDYGVQFTASRKFLTITPIVLYFLTSFYTKYDQIHFILN  127

Query  481  TVAVFILVVAKFPHMHKVRIFGIN  552
            TV++  +++ K P +H VRIFGIN
Sbjct  128  TVSLMSVLIPKLPQLHGVRIFGIN  151



>ref|XP_007177632.1| PREDICTED: ORM1-like protein 3 isoform X1 [Balaenoptera acutorostrata 
scammoni]
 ref|XP_007177633.1| PREDICTED: ORM1-like protein 3 isoform X2 [Balaenoptera acutorostrata 
scammoni]
 ref|XP_007177634.1| PREDICTED: ORM1-like protein 3 isoform X3 [Balaenoptera acutorostrata 
scammoni]
 ref|XP_007177635.1| PREDICTED: ORM1-like protein 3 isoform X4 [Balaenoptera acutorostrata 
scammoni]
 ref|XP_007177636.1| PREDICTED: ORM1-like protein 3 isoform X5 [Balaenoptera acutorostrata 
scammoni]
 ref|XP_007177637.1| PREDICTED: ORM1-like protein 3 isoform X6 [Balaenoptera acutorostrata 
scammoni]
 ref|XP_007177638.1| PREDICTED: ORM1-like protein 3 isoform X7 [Balaenoptera acutorostrata 
scammoni]
Length=153

 Score =   108 bits (271),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 63/144 (44%), Positives = 84/144 (58%), Gaps = 1/144 (1%)
 Frame = +1

Query  124  TDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMITYHFFHWK  303
            +++N NT      G+W +Y+L +    +V LS+   S    WT+ NL H M  Y F H  
Sbjct  8    SEVNPNTRVMNSRGIWLSYVLAIGLLHVVLLSIPFVSVPVVWTLTNLIHNMGMYIFLHTV  67

Query  304  KGTPFAD-DQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQHPMLFLN  480
            KGTPF   DQG    LT WEQ+D G Q T +RKFLT+ P+VLY + S  T Y      LN
Sbjct  68   KGTPFETPDQGKARLLTHWEQMDYGVQFTASRKFLTITPIVLYFLTSFYTKYDQMHFILN  127

Query  481  TVAVFILVVAKFPHMHKVRIFGIN  552
            TV++  +++ K P +H VRIFGIN
Sbjct  128  TVSLMSVLIPKLPQLHGVRIFGIN  151



>ref|XP_004655521.1| PREDICTED: ORM1-like protein 3 isoform X2 [Jaculus jaculus]
 ref|XP_007112592.1| PREDICTED: ORM1-like protein 3 isoform X1 [Physeter catodon]
 ref|XP_007112593.1| PREDICTED: ORM1-like protein 3 isoform X2 [Physeter catodon]
 ref|XP_008843549.1| PREDICTED: ORM1-like protein 3 [Nannospalax galili]
Length=153

 Score =   108 bits (270),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 63/144 (44%), Positives = 84/144 (58%), Gaps = 1/144 (1%)
 Frame = +1

Query  124  TDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMITYHFFHWK  303
            +++N NT      G+W +Y+L +    +V LS+   S    WT+ NL H M  Y F H  
Sbjct  8    SEVNPNTRVMNSRGIWLSYVLAIGLLHVVLLSIPFVSVPVVWTLTNLIHNMGMYIFLHTV  67

Query  304  KGTPFAD-DQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQHPMLFLN  480
            KGTPF   DQG    LT WEQ+D G Q T +RKFLT+ P+VLY + S  T Y      LN
Sbjct  68   KGTPFETPDQGKARLLTHWEQMDYGVQFTASRKFLTITPIVLYFLTSFYTKYDQVHFILN  127

Query  481  TVAVFILVVAKFPHMHKVRIFGIN  552
            TV++  +++ K P +H VRIFGIN
Sbjct  128  TVSLMSVLIPKLPQLHGVRIFGIN  151



>ref|XP_003768309.1| PREDICTED: ORM1-like protein 3 [Sarcophilus harrisii]
 ref|XP_007482356.1| PREDICTED: ORM1-like protein 3 isoform X2 [Monodelphis domestica]
Length=153

 Score =   108 bits (270),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 63/144 (44%), Positives = 84/144 (58%), Gaps = 1/144 (1%)
 Frame = +1

Query  124  TDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMITYHFFHWK  303
            +++N NT      G+W +Y+L +    +V LS+   S    WT+ NL H M  Y F H  
Sbjct  8    SEVNPNTRVMNSRGIWLSYVLAIGLLHVVLLSIPFVSVPVVWTLTNLIHNMGMYIFLHTV  67

Query  304  KGTPFAD-DQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQHPMLFLN  480
            KGTPF   DQG    LT WEQ+D G Q T +RKFLT+ P+VLY + S  T Y      LN
Sbjct  68   KGTPFETPDQGKARLLTHWEQMDYGVQFTASRKFLTITPIVLYFLTSFYTKYDQLHFILN  127

Query  481  TVAVFILVVAKFPHMHKVRIFGIN  552
            TV++  +++ K P +H VRIFGIN
Sbjct  128  TVSLMSVLIPKLPQLHGVRIFGIN  151



>ref|NP_001069835.1| ORM1-like protein 3 [Bos taurus]
 ref|XP_851310.1| PREDICTED: ORM1-like protein 3 isoformX2 [Canis lupus familiaris]
 ref|XP_003131546.1| PREDICTED: ORM1-like protein 3-like isoformX1 [Sus scrofa]
 ref|XP_003131547.1| PREDICTED: ORM1-like protein 3-like isoformX2 [Sus scrofa]
 ref|XP_003786458.1| PREDICTED: ORM1-like protein 3 [Otolemur garnettii]
 ref|XP_003942885.1| PREDICTED: ORM1-like protein 3 isoform X1 [Saimiri boliviensis 
boliviensis]
 ref|XP_003996838.1| PREDICTED: ORM1-like protein 3 [Felis catus]
 ref|XP_003996839.1| PREDICTED: ORM1-like protein 3 [Felis catus]
 ref|XP_004012901.1| PREDICTED: ORM1-like protein 3 [Ovis aries]
 ref|XP_004282789.1| PREDICTED: ORM1-like protein 3 [Orcinus orca]
 ref|XP_004311621.1| PREDICTED: ORM1-like protein 3 [Tursiops truncatus]
 ref|XP_004395093.1| PREDICTED: ORM1-like protein 3 isoform 1 [Odobenus rosmarus divergens]
 ref|XP_004395094.1| PREDICTED: ORM1-like protein 3 isoform 2 [Odobenus rosmarus divergens]
 ref|XP_004450120.1| PREDICTED: ORM1-like protein 3 isoform 1 [Dasypus novemcinctus]
 ref|XP_004450121.1| PREDICTED: ORM1-like protein 3 isoform 2 [Dasypus novemcinctus]
 ref|XP_004450122.1| PREDICTED: ORM1-like protein 3 isoform 3 [Dasypus novemcinctus]
 ref|XP_004450123.1| PREDICTED: ORM1-like protein 3 isoform 4 [Dasypus novemcinctus]
 ref|XP_004450124.1| PREDICTED: ORM1-like protein 3 isoform 5 [Dasypus novemcinctus]
 ref|XP_004591213.1| PREDICTED: ORM1-like protein 3 isoform X1 [Ochotona princeps]
 ref|XP_004684295.1| PREDICTED: ORM1-like protein 3 isoform X1 [Condylura cristata]
 ref|XP_004764685.1| PREDICTED: ORM1-like protein 3 isoform X2 [Mustela putorius furo]
 ref|XP_004764686.1| PREDICTED: ORM1-like protein 3 isoform X3 [Mustela putorius furo]
 ref|XP_004764687.1| PREDICTED: ORM1-like protein 3 isoform X4 [Mustela putorius furo]
 ref|XP_004764688.1| PREDICTED: ORM1-like protein 3 isoform X5 [Mustela putorius furo]
 ref|XP_004799111.1| PREDICTED: ORM1-like protein 3 isoform X3 [Mustela putorius furo]
 ref|XP_004799112.1| PREDICTED: ORM1-like protein 3 isoform X4 [Mustela putorius furo]
 ref|XP_004799113.1| PREDICTED: ORM1-like protein 3 isoform X5 [Mustela putorius furo]
 ref|XP_004799114.1| PREDICTED: ORM1-like protein 3 isoform X6 [Mustela putorius furo]
 ref|XP_005220811.1| PREDICTED: ORM1-like protein 3 isoform X1 [Bos taurus]
 ref|XP_005220812.1| PREDICTED: ORM1-like protein 3 isoform X1 [Bos taurus]
 ref|XP_005321852.1| PREDICTED: ORM1-like protein 3 isoform X1 [Ictidomys tridecemlineatus]
 ref|XP_005321853.1| PREDICTED: ORM1-like protein 3 isoform X2 [Ictidomys tridecemlineatus]
 ref|XP_005321854.1| PREDICTED: ORM1-like protein 3 isoform X3 [Ictidomys tridecemlineatus]
 ref|XP_005321855.1| PREDICTED: ORM1-like protein 3 isoform X4 [Ictidomys tridecemlineatus]
 ref|XP_005624602.1| PREDICTED: ORM1-like protein 3 isoform X3 [Canis lupus familiaris]
 ref|XP_005624603.1| PREDICTED: ORM1-like protein 3 isoform X4 [Canis lupus familiaris]
 ref|XP_005624604.1| PREDICTED: ORM1-like protein 3 isoform X5 [Canis lupus familiaris]
 ref|XP_005653978.1| PREDICTED: ORM1-like protein 3-like isoform X3 [Sus scrofa]
 ref|XP_005693820.1| PREDICTED: ORM1-like protein 3 [Capra hircus]
 ref|XP_005861938.1| PREDICTED: ORM1-like protein 3 isoform X1 [Myotis brandtii]
 ref|XP_005861939.1| PREDICTED: ORM1-like protein 3 isoform X2 [Myotis brandtii]
 ref|XP_005861940.1| PREDICTED: ORM1-like protein 3 isoform X3 [Myotis brandtii]
 ref|XP_005861941.1| PREDICTED: ORM1-like protein 3 isoform X4 [Myotis brandtii]
 ref|XP_005898080.1| PREDICTED: ORM1-like protein 3 isoform X1 [Bos mutus]
 ref|XP_005898081.1| PREDICTED: ORM1-like protein 3 isoform X2 [Bos mutus]
 ref|XP_005964822.1| PREDICTED: ORM1-like protein 3 isoform X1 [Pantholops hodgsonii]
 ref|XP_005964823.1| PREDICTED: ORM1-like protein 3 isoform X2 [Pantholops hodgsonii]
 ref|XP_005964824.1| PREDICTED: ORM1-like protein 3 isoform X3 [Pantholops hodgsonii]
 ref|XP_006100858.1| PREDICTED: ORM1-like protein 3 isoform X1 [Myotis lucifugus]
 ref|XP_006100859.1| PREDICTED: ORM1-like protein 3 isoform X2 [Myotis lucifugus]
 ref|XP_006100860.1| PREDICTED: ORM1-like protein 3 isoform X3 [Myotis lucifugus]
 ref|XP_006100861.1| PREDICTED: ORM1-like protein 3 isoform X4 [Myotis lucifugus]
 ref|XP_006100862.1| PREDICTED: ORM1-like protein 3 isoform X5 [Myotis lucifugus]
 ref|XP_006100863.1| PREDICTED: ORM1-like protein 3 isoform X6 [Myotis lucifugus]
 ref|XP_006100864.1| PREDICTED: ORM1-like protein 3 isoform X7 [Myotis lucifugus]
 ref|XP_006100865.1| PREDICTED: ORM1-like protein 3 isoform X8 [Myotis lucifugus]
 ref|XP_006100866.1| PREDICTED: ORM1-like protein 3 isoform X9 [Myotis lucifugus]
 ref|XP_006100867.1| PREDICTED: ORM1-like protein 3 isoform X10 [Myotis lucifugus]
 ref|XP_006100868.1| PREDICTED: ORM1-like protein 3 isoform X11 [Myotis lucifugus]
 ref|XP_006100869.1| PREDICTED: ORM1-like protein 3 isoform X12 [Myotis lucifugus]
 ref|XP_006100870.1| PREDICTED: ORM1-like protein 3 isoform X13 [Myotis lucifugus]
 ref|XP_006176399.1| PREDICTED: ORM1-like protein 3 isoform X1 [Camelus ferus]
 ref|XP_006214326.1| PREDICTED: ORM1-like protein 3 isoform X1 [Vicugna pacos]
 ref|XP_006155977.1| PREDICTED: ORM1-like protein 3 isoform X1 [Tupaia chinensis]
 ref|XP_006155978.1| PREDICTED: ORM1-like protein 3 isoform X2 [Tupaia chinensis]
 ref|XP_006155979.1| PREDICTED: ORM1-like protein 3 isoform X3 [Tupaia chinensis]
 ref|XP_006155980.1| PREDICTED: ORM1-like protein 3 isoform X4 [Tupaia chinensis]
 ref|XP_006774378.1| PREDICTED: ORM1-like protein 3 isoform X1 [Myotis davidii]
 ref|XP_006774379.1| PREDICTED: ORM1-like protein 3 isoform X2 [Myotis davidii]
 ref|XP_006774380.1| PREDICTED: ORM1-like protein 3 isoform X3 [Myotis davidii]
 ref|XP_006774381.1| PREDICTED: ORM1-like protein 3 isoform X4 [Myotis davidii]
 ref|XP_006774382.1| PREDICTED: ORM1-like protein 3 isoform X5 [Myotis davidii]
 ref|XP_006774383.1| PREDICTED: ORM1-like protein 3 isoform X6 [Myotis davidii]
 ref|XP_006774384.1| PREDICTED: ORM1-like protein 3 isoform X7 [Myotis davidii]
 ref|XP_006774385.1| PREDICTED: ORM1-like protein 3 isoform X8 [Myotis davidii]
 ref|XP_006774386.1| PREDICTED: ORM1-like protein 3 isoform X9 [Myotis davidii]
 ref|XP_006774387.1| PREDICTED: ORM1-like protein 3 isoform X10 [Myotis davidii]
 ref|XP_006774388.1| PREDICTED: ORM1-like protein 3 isoform X11 [Myotis davidii]
 ref|XP_006774389.1| PREDICTED: ORM1-like protein 3 isoform X12 [Myotis davidii]
 ref|XP_006924752.1| PREDICTED: ORM1-like protein 3 isoform X1 [Pteropus alecto]
 ref|XP_006924753.1| PREDICTED: ORM1-like protein 3 isoform X2 [Pteropus alecto]
 ref|XP_006924754.1| PREDICTED: ORM1-like protein 3 isoform X3 [Pteropus alecto]
 ref|XP_006940367.1| PREDICTED: ORM1-like protein 3 [Felis catus]
 ref|XP_006940368.1| PREDICTED: ORM1-like protein 3 [Felis catus]
 ref|XP_007085854.1| PREDICTED: ORM1-like protein 3 isoform X1 [Panthera tigris altaica]
 ref|XP_007085855.1| PREDICTED: ORM1-like protein 3 isoform X2 [Panthera tigris altaica]
 ref|XP_006068647.1| PREDICTED: ORM1-like protein 3 isoform X1 [Bubalus bubalis]
 ref|XP_006068648.1| PREDICTED: ORM1-like protein 3 isoform X2 [Bubalus bubalis]
 ref|XP_006068649.1| PREDICTED: ORM1-like protein 3 isoform X3 [Bubalus bubalis]
 ref|XP_007465239.1| PREDICTED: ORM1-like protein 3 isoform X1 [Lipotes vexillifer]
 ref|XP_008063365.1| PREDICTED: ORM1-like protein 3 [Tarsius syrichta]
 ref|XP_008152046.1| PREDICTED: ORM1-like protein 3 isoform X1 [Eptesicus fuscus]
 ref|XP_008517124.1| PREDICTED: ORM1-like protein 3 isoform X2 [Equus przewalskii]
 ref|XP_008995753.1| PREDICTED: ORM1-like protein 3 isoform X3 [Callithrix jacchus]
 ref|XP_008995754.1| PREDICTED: ORM1-like protein 3 isoform X3 [Callithrix jacchus]
 ref|XP_008995755.1| PREDICTED: ORM1-like protein 3 isoform X3 [Callithrix jacchus]
 ref|XP_010328962.1| PREDICTED: ORM1-like protein 3 isoform X1 [Saimiri boliviensis 
boliviensis]
 ref|XP_010328963.1| PREDICTED: ORM1-like protein 3 isoform X1 [Saimiri boliviensis 
boliviensis]
 ref|XP_010840933.1| PREDICTED: ORM1-like protein 3 [Bison bison bison]
 ref|XP_010840934.1| PREDICTED: ORM1-like protein 3 [Bison bison bison]
 ref|XP_010840935.1| PREDICTED: ORM1-like protein 3 [Bison bison bison]
 ref|XP_010840936.1| PREDICTED: ORM1-like protein 3 [Bison bison bison]
 ref|XP_010958763.1| PREDICTED: ORM1-like protein 3 [Camelus bactrianus]
 ref|XP_010990109.1| PREDICTED: ORM1-like protein 3 [Camelus dromedarius]
 ref|XP_011381338.1| PREDICTED: ORM1-like protein 3 [Pteropus vampyrus]
 ref|XP_011381339.1| PREDICTED: ORM1-like protein 3 [Pteropus vampyrus]
 ref|XP_011381340.1| PREDICTED: ORM1-like protein 3 [Pteropus vampyrus]
 sp|Q0VD15.1|ORML3_BOVIN RecName: Full=ORM1-like protein 3 [Bos taurus]
 gb|AAI19889.1| ORM1-like 3 (S. cerevisiae) [Bos taurus]
 tpg|DAA18487.1| TPA: ORM1-like 3 [Bos taurus]
 gb|ELR54785.1| ORM1-like protein 3 [Bos mutus]
Length=153

 Score =   108 bits (270),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 63/144 (44%), Positives = 84/144 (58%), Gaps = 1/144 (1%)
 Frame = +1

Query  124  TDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMITYHFFHWK  303
            +++N NT      G+W +Y+L +    +V LS+   S    WT+ NL H M  Y F H  
Sbjct  8    SEVNPNTRVMNSRGIWLSYVLAIGLLHVVLLSIPFVSVPVVWTLTNLIHNMGMYIFLHTV  67

Query  304  KGTPFAD-DQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQHPMLFLN  480
            KGTPF   DQG    LT WEQ+D G Q T +RKFLT+ P+VLY + S  T Y      LN
Sbjct  68   KGTPFETPDQGKARLLTHWEQMDYGVQFTASRKFLTITPIVLYFLTSFYTKYDQIHFILN  127

Query  481  TVAVFILVVAKFPHMHKVRIFGIN  552
            TV++  +++ K P +H VRIFGIN
Sbjct  128  TVSLMSVLIPKLPQLHGVRIFGIN  151



>ref|XP_004633771.1| PREDICTED: ORM1-like protein 3 isoform X1 [Octodon degus]
 ref|XP_004707182.1| PREDICTED: ORM1-like protein 3 isoform X1 [Echinops telfairi]
 ref|XP_006889459.1| PREDICTED: ORM1-like protein 3 isoform X1 [Elephantulus edwardii]
 ref|XP_010618321.1| PREDICTED: ORM1-like protein 3 [Fukomys damarensis]
 ref|XP_010618322.1| PREDICTED: ORM1-like protein 3 [Fukomys damarensis]
Length=153

 Score =   108 bits (270),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 63/144 (44%), Positives = 84/144 (58%), Gaps = 1/144 (1%)
 Frame = +1

Query  124  TDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMITYHFFHWK  303
            +++N NT      G+W +Y+L +    +V LS+   S    WT+ NL H M  Y F H  
Sbjct  8    SEVNPNTRVMNSRGIWLSYVLAIGLLHVVLLSIPFVSVPVVWTLTNLIHNMGMYIFLHTV  67

Query  304  KGTPFAD-DQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQHPMLFLN  480
            KGTPF   DQG    LT WEQ+D G Q T +RKFLT+ P+VLY + S  T Y      LN
Sbjct  68   KGTPFETPDQGKARLLTHWEQMDYGVQFTASRKFLTITPIVLYFLTSFYTKYDQVHFVLN  127

Query  481  TVAVFILVVAKFPHMHKVRIFGIN  552
            TV++  +++ K P +H VRIFGIN
Sbjct  128  TVSLMSVLIPKLPQLHGVRIFGIN  151



>ref|NP_001126832.1| ORM1-like protein 3 [Pongo abelii]
 ref|NP_001180744.1| ORM1-like protein 3 [Macaca mulatta]
 ref|XP_002800500.1| PREDICTED: ORM1-like protein 3-like isoform 2 [Macaca mulatta]
 ref|XP_002800501.1| PREDICTED: ORM1-like protein 3-like isoform 3 [Macaca mulatta]
 ref|XP_003278298.1| PREDICTED: ORM1-like protein 3 isoform 1 [Nomascus leucogenys]
 ref|XP_003278300.1| PREDICTED: ORM1-like protein 3 isoform 3 [Nomascus leucogenys]
 ref|XP_003278301.1| PREDICTED: ORM1-like protein 3 isoform 4 [Nomascus leucogenys]
 ref|XP_003278302.1| PREDICTED: ORM1-like protein 3 isoform 5 [Nomascus leucogenys]
 ref|XP_003414748.1| PREDICTED: ORM1-like protein 3 [Loxodonta africana]
 ref|XP_003912997.1| PREDICTED: ORM1-like protein 3 [Papio anubis]
 ref|XP_004091441.1| PREDICTED: ORM1-like protein 3 [Nomascus leucogenys]
 ref|XP_004378106.1| PREDICTED: ORM1-like protein 3 isoform 1 [Trichechus manatus 
latirostris]
 ref|XP_004899036.1| PREDICTED: ORM1-like protein 3 isoform X2 [Heterocephalus glaber]
 ref|XP_004899037.1| PREDICTED: ORM1-like protein 3 isoform X3 [Heterocephalus glaber]
 ref|XP_004859534.1| PREDICTED: ORM1-like protein 3 isoform X3 [Heterocephalus glaber]
 ref|XP_004859535.1| PREDICTED: ORM1-like protein 3 isoform X4 [Heterocephalus glaber]
 ref|XP_004859536.1| PREDICTED: ORM1-like protein 3 isoform X5 [Heterocephalus glaber]
 ref|XP_005394386.1| PREDICTED: ORM1-like protein 3 isoform X3 [Chinchilla lanigera]
 ref|XP_005394387.1| PREDICTED: ORM1-like protein 3 isoform X4 [Chinchilla lanigera]
 ref|XP_005394388.1| PREDICTED: ORM1-like protein 3 isoform X5 [Chinchilla lanigera]
 ref|XP_005584110.1| PREDICTED: ORM1-like protein 3 isoform X6 [Macaca fascicularis]
 ref|XP_005584111.1| PREDICTED: ORM1-like protein 3 isoform X7 [Macaca fascicularis]
 ref|XP_005584112.1| PREDICTED: ORM1-like protein 3 isoform X8 [Macaca fascicularis]
 ref|XP_005584113.1| PREDICTED: ORM1-like protein 3 isoform X9 [Macaca fascicularis]
 ref|XP_006832627.1| PREDICTED: ORM1-like protein 3 isoform X1 [Chrysochloris asiatica]
 ref|XP_007940241.1| PREDICTED: ORM1-like protein 3 isoform X1 [Orycteropus afer afer]
 ref|XP_008011020.1| PREDICTED: ORM1-like protein 3 [Chlorocebus sabaeus]
 ref|XP_008011021.1| PREDICTED: ORM1-like protein 3 [Chlorocebus sabaeus]
 ref|XP_008687588.1| PREDICTED: ORM1-like protein 3 isoform X2 [Ursus maritimus]
 ref|XP_009188789.1| PREDICTED: ORM1-like protein 3 [Papio anubis]
 ref|XP_009188790.1| PREDICTED: ORM1-like protein 3 [Papio anubis]
 ref|XP_009250108.1| PREDICTED: ORM1-like protein 3 isoform X1 [Pongo abelii]
 ref|XP_010373822.1| PREDICTED: ORM1-like protein 3 [Rhinopithecus roxellana]
 ref|XP_010373823.1| PREDICTED: ORM1-like protein 3 [Rhinopithecus roxellana]
 sp|Q5R570.1|ORML3_PONAB RecName: Full=ORM1-like protein 3 [Pongo abelii]
 emb|CAH93096.1| hypothetical protein [Pongo abelii]
 gb|EHB12034.1| ORM1-like protein 3 [Heterocephalus glaber]
 gb|EHH24905.1| ORM1-like protein 3 [Macaca mulatta]
 gb|EHH58078.1| ORM1-like protein 3 [Macaca fascicularis]
Length=153

 Score =   108 bits (269),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 63/144 (44%), Positives = 84/144 (58%), Gaps = 1/144 (1%)
 Frame = +1

Query  124  TDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMITYHFFHWK  303
            +++N NT      G+W +Y+L +    +V LS+   S    WT+ NL H M  Y F H  
Sbjct  8    SEVNPNTRVMNSRGIWLSYVLAIGLLHVVLLSIPFVSVPVVWTLTNLIHNMGMYIFLHTV  67

Query  304  KGTPFAD-DQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQHPMLFLN  480
            KGTPF   DQG    LT WEQ+D G Q T +RKFLT+ P+VLY + S  T Y      LN
Sbjct  68   KGTPFETPDQGKARLLTHWEQMDYGVQFTASRKFLTITPIVLYFLTSFYTKYDQIHFVLN  127

Query  481  TVAVFILVVAKFPHMHKVRIFGIN  552
            TV++  +++ K P +H VRIFGIN
Sbjct  128  TVSLMSVLIPKLPQLHGVRIFGIN  151



>ref|NP_644809.1| ORM1-like protein 3 [Homo sapiens]
 ref|XP_003831484.1| PREDICTED: ORM1-like protein 3 isoform X2 [Pan paniscus]
 ref|XP_004041787.1| PREDICTED: ORM1-like protein 3 isoform 1 [Gorilla gorilla gorilla]
 ref|XP_004041788.1| PREDICTED: ORM1-like protein 3 isoform 2 [Gorilla gorilla gorilla]
 ref|XP_004041789.1| PREDICTED: ORM1-like protein 3 isoform 3 [Gorilla gorilla gorilla]
 ref|XP_004041790.1| PREDICTED: ORM1-like protein 3 isoform 4 [Gorilla gorilla gorilla]
 ref|XP_005257884.1| PREDICTED: ORM1-like protein 3 isoform X3 [Homo sapiens]
 ref|XP_008955036.1| PREDICTED: ORM1-like protein 3 isoform X2 [Pan paniscus]
 sp|Q8N138.1|ORML3_HUMAN RecName: Full=ORM1-like protein 3 [Homo sapiens]
 gb|AAM43507.1|AF395708_1 ORMDL3 [Homo sapiens]
 gb|AAN76522.1|AF373102_1 unknown [Homo sapiens]
 dbj|BAC11223.1| unnamed protein product [Homo sapiens]
 dbj|BAC11476.1| unnamed protein product [Homo sapiens]
 gb|AAN76521.1| unknown [Homo sapiens]
 gb|AAH17087.1| ORM1-like 3 (S. cerevisiae) [Homo sapiens]
 gb|AAH71833.1| ORM1-like 3 (S. cerevisiae) [Homo sapiens]
 gb|EAW60617.1| ORM1-like 3 (S. cerevisiae), isoform CRA_b [Homo sapiens]
 gb|EAW60618.1| ORM1-like 3 (S. cerevisiae), isoform CRA_b [Homo sapiens]
 gb|EAW60619.1| ORM1-like 3 (S. cerevisiae), isoform CRA_b [Homo sapiens]
 gb|EAW60620.1| ORM1-like 3 (S. cerevisiae), isoform CRA_b [Homo sapiens]
 dbj|BAG52645.1| unnamed protein product [Homo sapiens]
 gb|ADQ31970.1| ORM1-like 3 (S. cerevisiae) [synthetic construct]
 gb|AIC52803.1| ORMDL3, partial [synthetic construct]
Length=153

 Score =   108 bits (269),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 63/144 (44%), Positives = 84/144 (58%), Gaps = 1/144 (1%)
 Frame = +1

Query  124  TDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMITYHFFHWK  303
            +++N NT      G+W +Y+L +    +V LS+   S    WT+ NL H M  Y F H  
Sbjct  8    SEVNPNTRVMNSRGIWLSYVLAIGLLHIVLLSIPFVSVPVVWTLTNLIHNMGMYIFLHTV  67

Query  304  KGTPFAD-DQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQHPMLFLN  480
            KGTPF   DQG    LT WEQ+D G Q T +RKFLT+ P+VLY + S  T Y      LN
Sbjct  68   KGTPFETPDQGKARLLTHWEQMDYGVQFTASRKFLTITPIVLYFLTSFYTKYDQIHFVLN  127

Query  481  TVAVFILVVAKFPHMHKVRIFGIN  552
            TV++  +++ K P +H VRIFGIN
Sbjct  128  TVSLMSVLIPKLPQLHGVRIFGIN  151



>ref|XP_005584109.1| PREDICTED: ORM1-like protein 3 isoform X5 [Macaca fascicularis]
Length=159

 Score =   108 bits (269),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 63/144 (44%), Positives = 84/144 (58%), Gaps = 1/144 (1%)
 Frame = +1

Query  124  TDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMITYHFFHWK  303
            +++N NT      G+W +Y+L +    +V LS+   S    WT+ NL H M  Y F H  
Sbjct  14   SEVNPNTRVMNSRGIWLSYVLAIGLLHVVLLSIPFVSVPVVWTLTNLIHNMGMYIFLHTV  73

Query  304  KGTPFAD-DQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQHPMLFLN  480
            KGTPF   DQG    LT WEQ+D G Q T +RKFLT+ P+VLY + S  T Y      LN
Sbjct  74   KGTPFETPDQGKARLLTHWEQMDYGVQFTASRKFLTITPIVLYFLTSFYTKYDQIHFVLN  133

Query  481  TVAVFILVVAKFPHMHKVRIFGIN  552
            TV++  +++ K P +H VRIFGIN
Sbjct  134  TVSLMSVLIPKLPQLHGVRIFGIN  157



>ref|XP_006638294.1| PREDICTED: ORM1-like protein 3-like [Lepisosteus oculatus]
Length=153

 Score =   108 bits (269),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 60/144 (42%), Positives = 85/144 (59%), Gaps = 1/144 (1%)
 Frame = +1

Query  124  TDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMITYHFFHWK  303
            +++N NT      G+W +Y+L +    ++ LS+   S    WT+ NL H M  Y F H  
Sbjct  8    SEVNPNTRVMNSRGIWLSYVLGIGLLHVILLSIPFVSVPVVWTLTNLIHNMCMYIFLHTV  67

Query  304  KGTPFAD-DQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQHPMLFLN  480
            KGTPF   DQG    LT WEQ+D G Q T +RKFLT+ P++LY++ S  T Y      +N
Sbjct  68   KGTPFETPDQGKARLLTHWEQMDYGVQFTASRKFLTITPIILYILTSFYTKYDRIHFIIN  127

Query  481  TVAVFILVVAKFPHMHKVRIFGIN  552
            TV++  +++ K P +H VRIFGIN
Sbjct  128  TVSLVTVLIPKLPQLHGVRIFGIN  151



>gb|ELK01557.1| ORM1-like protein 3 [Pteropus alecto]
Length=185

 Score =   108 bits (271),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 63/144 (44%), Positives = 84/144 (58%), Gaps = 1/144 (1%)
 Frame = +1

Query  124  TDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMITYHFFHWK  303
            +++N NT      G+W +Y+L +    +V LS+   S    WT+ NL H M  Y F H  
Sbjct  40   SEVNPNTRVMNSRGIWLSYVLAIGLLHVVLLSIPFVSVPVVWTLTNLIHNMGMYIFLHTV  99

Query  304  KGTPFAD-DQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQHPMLFLN  480
            KGTPF   DQG    LT WEQ+D G Q T +RKFLT+ P+VLY + S  T Y      LN
Sbjct  100  KGTPFETPDQGKARLLTHWEQMDYGVQFTASRKFLTITPIVLYFLTSFYTKYDQIHFILN  159

Query  481  TVAVFILVVAKFPHMHKVRIFGIN  552
            TV++  +++ K P +H VRIFGIN
Sbjct  160  TVSLMSVLIPKLPQLHGVRIFGIN  183



>ref|XP_010788227.1| PREDICTED: ORM1-like protein 3 [Notothenia coriiceps]
 ref|XP_010788229.1| PREDICTED: ORM1-like protein 3 [Notothenia coriiceps]
 ref|XP_010788230.1| PREDICTED: ORM1-like protein 3 [Notothenia coriiceps]
Length=153

 Score =   108 bits (269),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 61/144 (42%), Positives = 85/144 (59%), Gaps = 1/144 (1%)
 Frame = +1

Query  124  TDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMITYHFFHWK  303
            +++N NT      G+W TYIL +    ++ LS+   S    WT+ NL H +  Y   H  
Sbjct  8    SEVNPNTRVMNSRGMWLTYILGIGLLHVIILSIPFASVPVVWTLTNLIHNLCMYLLLHTV  67

Query  304  KGTPFAD-DQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQHPMLFLN  480
            KGTPF   DQG    LT+WEQ+D G Q T +RKFLT+ P+VLY++ S  T Y      +N
Sbjct  68   KGTPFETPDQGKARLLTYWEQMDYGVQFTASRKFLTITPIVLYILTSFYTKYDRVHFVVN  127

Query  481  TVAVFILVVAKFPHMHKVRIFGIN  552
            TV++  +++ K P +H VRIFGIN
Sbjct  128  TVSLLTVLIPKLPQLHGVRIFGIN  151



>ref|XP_009911347.1| PREDICTED: ORM1-like protein 3 isoform X2 [Haliaeetus albicilla]
 ref|XP_010583854.1| PREDICTED: ORM1-like protein 3 isoform X2 [Haliaeetus leucocephalus]
Length=187

 Score =   108 bits (271),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 66/162 (41%), Positives = 92/162 (57%), Gaps = 2/162 (1%)
 Frame = +1

Query  70   SSCCLNWMANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAW  249
              C L+  AN+ V  A  +++N NT      G+W +Y+L +    +V LS+   S    W
Sbjct  25   QGCPLDAGANMNVGTA-HSEVNPNTRVMNSRGIWLSYVLGIGLLHVVLLSIPFFSVPVVW  83

Query  250  TIVNLSHFMITYHFFHWKKGTPFAD-DQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVL  426
            T+ N+ H M  Y F H  KGTPF   DQG    LT WEQ+D G Q T +RKFLT++P+VL
Sbjct  84   TLTNIIHNMSMYIFLHTVKGTPFETPDQGKARLLTHWEQMDYGVQFTASRKFLTIMPIVL  143

Query  427  YLIASHTTDYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGIN  552
            Y + S  T Y      +NT+++  +++ K P  H VRIFGIN
Sbjct  144  YFLTSFYTKYDRIHFIINTISLMSVLIPKLPQFHGVRIFGIN  185



>ref|XP_004859533.1| PREDICTED: ORM1-like protein 3 isoform X2 [Heterocephalus glaber]
Length=171

 Score =   108 bits (270),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 63/144 (44%), Positives = 84/144 (58%), Gaps = 1/144 (1%)
 Frame = +1

Query  124  TDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMITYHFFHWK  303
            +++N NT      G+W +Y+L +    +V LS+   S    WT+ NL H M  Y F H  
Sbjct  26   SEVNPNTRVMNSRGIWLSYVLAIGLLHVVLLSIPFVSVPVVWTLTNLIHNMGMYIFLHTV  85

Query  304  KGTPFAD-DQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQHPMLFLN  480
            KGTPF   DQG    LT WEQ+D G Q T +RKFLT+ P+VLY + S  T Y      LN
Sbjct  86   KGTPFETPDQGKARLLTHWEQMDYGVQFTASRKFLTITPIVLYFLTSFYTKYDQIHFVLN  145

Query  481  TVAVFILVVAKFPHMHKVRIFGIN  552
            TV++  +++ K P +H VRIFGIN
Sbjct  146  TVSLMSVLIPKLPQLHGVRIFGIN  169



>ref|XP_003284429.1| hypothetical protein DICPUDRAFT_148200 [Dictyostelium purpureum]
 gb|EGC39079.1| hypothetical protein DICPUDRAFT_148200 [Dictyostelium purpureum]
Length=151

 Score =   107 bits (268),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 71/105 (68%), Gaps = 3/105 (3%)
 Frame = +1

Query  247  WTIVNLSHFMITYHFFHWKKGTPFAD---DQGIYNRLTWWEQIDNGKQLTRNRKFLTVVP  417
            W  + L H +IT+  FHW+KG PF      QG Y+RLT WEQID G+Q T  RKF T++P
Sbjct  45   WLTITLLHAVITFFGFHWQKGIPFFQAGWSQGKYSRLTLWEQIDRGQQYTPTRKFFTIIP  104

Query  418  VVLYLIASHTTDYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGIN  552
            ++L++I  H+  Y+    ++N +A F++V++K P M +VR+FGIN
Sbjct  105  IILFMITLHSNGYKGIPFYINAIASFVIVLSKMPRMDRVRLFGIN  149



>ref|XP_005584108.1| PREDICTED: ORM1-like protein 3 isoform X4 [Macaca fascicularis]
Length=178

 Score =   108 bits (270),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 63/144 (44%), Positives = 84/144 (58%), Gaps = 1/144 (1%)
 Frame = +1

Query  124  TDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMITYHFFHWK  303
            +++N NT      G+W +Y+L +    +V LS+   S    WT+ NL H M  Y F H  
Sbjct  33   SEVNPNTRVMNSRGIWLSYVLAIGLLHVVLLSIPFVSVPVVWTLTNLIHNMGMYIFLHTV  92

Query  304  KGTPFAD-DQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQHPMLFLN  480
            KGTPF   DQG    LT WEQ+D G Q T +RKFLT+ P+VLY + S  T Y      LN
Sbjct  93   KGTPFETPDQGKARLLTHWEQMDYGVQFTASRKFLTITPIVLYFLTSFYTKYDQIHFVLN  152

Query  481  TVAVFILVVAKFPHMHKVRIFGIN  552
            TV++  +++ K P +H VRIFGIN
Sbjct  153  TVSLMSVLIPKLPQLHGVRIFGIN  176



>ref|XP_009250106.1| PREDICTED: ORM1-like protein 3 isoform X2 [Pongo abelii]
Length=171

 Score =   108 bits (270),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 63/144 (44%), Positives = 84/144 (58%), Gaps = 1/144 (1%)
 Frame = +1

Query  124  TDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMITYHFFHWK  303
            +++N NT      G+W +Y+L +    +V LS+   S    WT+ NL H M  Y F H  
Sbjct  26   SEVNPNTRVMNSRGIWLSYVLAIGLLHVVLLSIPFVSVPVVWTLTNLIHNMGMYIFLHTV  85

Query  304  KGTPFAD-DQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQHPMLFLN  480
            KGTPF   DQG    LT WEQ+D G Q T +RKFLT+ P+VLY + S  T Y      LN
Sbjct  86   KGTPFETPDQGKARLLTHWEQMDYGVQFTASRKFLTITPIVLYFLTSFYTKYDQIHFVLN  145

Query  481  TVAVFILVVAKFPHMHKVRIFGIN  552
            TV++  +++ K P +H VRIFGIN
Sbjct  146  TVSLMSVLIPKLPQLHGVRIFGIN  169



>ref|XP_007652017.1| PREDICTED: ORM1-like protein 1 isoform X1 [Cricetulus griseus]
Length=212

 Score =   109 bits (272),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 66/157 (42%), Positives = 90/157 (57%), Gaps = 2/157 (1%)
 Frame = +1

Query  85   NWMANLYVRAAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNL  264
            +W AN+ V  A  +++N NT      G+W TY L +    +V LS+   S   AWT+ N+
Sbjct  55   SWRANMNVGVA-HSEVNPNTRVMNSRGMWLTYALGVGLLHIVLLSIPFFSVSVAWTLTNI  113

Query  265  SHFMITYHFFHWKKGTPFAD-DQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIAS  441
             H +  Y F H  KGTPF   DQG    LT WEQ+D G Q T +RKF T+ P++LY +AS
Sbjct  114  IHNLGMYVFLHAVKGTPFETPDQGRARLLTHWEQLDYGVQFTSSRKFFTISPIILYFLAS  173

Query  442  HTTDYQHPMLFLNTVAVFILVVAKFPHMHKVRIFGIN  552
              T Y      LNT ++  +++ K P +H VRIFGIN
Sbjct  174  FYTKYDPTHFILNTASLLSVLIPKMPQLHGVRIFGIN  210



>ref|XP_004764684.1| PREDICTED: ORM1-like protein 3 isoform X1 [Mustela putorius furo]
 ref|XP_004799110.1| PREDICTED: ORM1-like protein 3 isoform X2 [Mustela putorius furo]
Length=200

 Score =   108 bits (271),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 63/144 (44%), Positives = 84/144 (58%), Gaps = 1/144 (1%)
 Frame = +1

Query  124  TDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMITYHFFHWK  303
            +++N NT      G+W +Y+L +    +V LS+   S    WT+ NL H M  Y F H  
Sbjct  55   SEVNPNTRVMNSRGIWLSYVLAIGLLHVVLLSIPFVSVPVVWTLTNLIHNMGMYIFLHTV  114

Query  304  KGTPFAD-DQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQHPMLFLN  480
            KGTPF   DQG    LT WEQ+D G Q T +RKFLT+ P+VLY + S  T Y      LN
Sbjct  115  KGTPFETPDQGKARLLTHWEQMDYGVQFTASRKFLTITPIVLYFLTSFYTKYDQIHFILN  174

Query  481  TVAVFILVVAKFPHMHKVRIFGIN  552
            TV++  +++ K P +H VRIFGIN
Sbjct  175  TVSLMSVLIPKLPQLHGVRIFGIN  198



>ref|NP_079937.1| ORM1-like protein 3 [Mus musculus]
 sp|Q9CPZ6.1|ORML3_MOUSE RecName: Full=ORM1-like protein 3 [Mus musculus]
 dbj|BAB26397.1| unnamed protein product [Mus musculus]
 dbj|BAB28432.1| unnamed protein product [Mus musculus]
 gb|AAH46594.1| ORM1-like 3 (S. cerevisiae) [Mus musculus]
 dbj|BAE32363.1| unnamed protein product [Mus musculus]
 gb|EDL16151.1| ORM1-like 3 (S. cerevisiae) [Mus musculus]
Length=153

 Score =   107 bits (268),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 84/144 (58%), Gaps = 1/144 (1%)
 Frame = +1

Query  124  TDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMITYHFFHWK  303
            +++N NT      G+W +Y+L +    +V LS+   S    WT+ NL H +  Y F H  
Sbjct  8    SEVNPNTRVMNSRGIWLSYVLAIGLLHVVLLSIPFVSVPVVWTLTNLIHNLGMYIFLHTV  67

Query  304  KGTPFAD-DQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQHPMLFLN  480
            KGTPF   DQG    LT WEQ+D G Q T +RKFLT+ P+VLY + S  T Y      LN
Sbjct  68   KGTPFETPDQGKARLLTHWEQMDYGVQFTASRKFLTITPIVLYFLTSFYTKYDQVHFILN  127

Query  481  TVAVFILVVAKFPHMHKVRIFGIN  552
            TV++  +++ K P +H VRIFGIN
Sbjct  128  TVSLMTVLIPKLPQLHGVRIFGIN  151



>ref|XP_005257882.1| PREDICTED: ORM1-like protein 3 isoform X1 [Homo sapiens]
 ref|XP_003831487.2| PREDICTED: ORM1-like protein 3 isoform X1 [Pan paniscus]
Length=171

 Score =   108 bits (269),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 63/144 (44%), Positives = 84/144 (58%), Gaps = 1/144 (1%)
 Frame = +1

Query  124  TDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMITYHFFHWK  303
            +++N NT      G+W +Y+L +    +V LS+   S    WT+ NL H M  Y F H  
Sbjct  26   SEVNPNTRVMNSRGIWLSYVLAIGLLHIVLLSIPFVSVPVVWTLTNLIHNMGMYIFLHTV  85

Query  304  KGTPFAD-DQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQHPMLFLN  480
            KGTPF   DQG    LT WEQ+D G Q T +RKFLT+ P+VLY + S  T Y      LN
Sbjct  86   KGTPFETPDQGKARLLTHWEQMDYGVQFTASRKFLTITPIVLYFLTSFYTKYDQIHFVLN  145

Query  481  TVAVFILVVAKFPHMHKVRIFGIN  552
            TV++  +++ K P +H VRIFGIN
Sbjct  146  TVSLMSVLIPKLPQLHGVRIFGIN  169



>ref|NP_001088231.1| ORM1-like protein 1 [Xenopus laevis]
 sp|Q5XH57.1|ORML1_XENLA RecName: Full=ORM1-like protein 1 [Xenopus laevis]
 gb|AAH84216.1| LOC495061 protein [Xenopus laevis]
Length=153

 Score =   107 bits (268),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 85/144 (59%), Gaps = 1/144 (1%)
 Frame = +1

Query  124  TDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMITYHFFHWK  303
            +++N NT      G+W TY L +    +V LS+   S   AWT+ N+ H +  Y F H  
Sbjct  8    SEVNPNTRVMNSRGMWLTYALGVGMLHIVLLSIPFFSVPVAWTLTNVIHNLGMYVFLHAV  67

Query  304  KGTPFAD-DQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQHPMLFLN  480
            KGTPF   DQG    LT WEQ+D G Q T +RKFLT+ P++LY +AS  T Y     F+N
Sbjct  68   KGTPFETPDQGKARLLTHWEQLDYGVQFTSSRKFLTISPIILYFLASFYTKYDPTHFFIN  127

Query  481  TVAVFILVVAKFPHMHKVRIFGIN  552
            T ++  +++ K P +H VRIFGIN
Sbjct  128  TASLLSVLIPKLPQLHGVRIFGIN  151



>ref|XP_005584107.1| PREDICTED: ORM1-like protein 3 isoform X3 [Macaca fascicularis]
Length=181

 Score =   108 bits (270),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 63/144 (44%), Positives = 84/144 (58%), Gaps = 1/144 (1%)
 Frame = +1

Query  124  TDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMITYHFFHWK  303
            +++N NT      G+W +Y+L +    +V LS+   S    WT+ NL H M  Y F H  
Sbjct  36   SEVNPNTRVMNSRGIWLSYVLAIGLLHVVLLSIPFVSVPVVWTLTNLIHNMGMYIFLHTV  95

Query  304  KGTPFAD-DQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQHPMLFLN  480
            KGTPF   DQG    LT WEQ+D G Q T +RKFLT+ P+VLY + S  T Y      LN
Sbjct  96   KGTPFETPDQGKARLLTHWEQMDYGVQFTASRKFLTITPIVLYFLTSFYTKYDQIHFVLN  155

Query  481  TVAVFILVVAKFPHMHKVRIFGIN  552
            TV++  +++ K P +H VRIFGIN
Sbjct  156  TVSLMSVLIPKLPQLHGVRIFGIN  179



>ref|XP_005537992.1| hypothetical protein, conserved [Cyanidioschyzon merolae strain 
10D]
 dbj|BAM81956.1| hypothetical protein, conserved [Cyanidioschyzon merolae strain 
10D]
Length=158

 Score =   107 bits (268),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 82/150 (55%), Gaps = 7/150 (5%)
 Frame = +1

Query  124  TDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMITYHFFHWK  303
            T  +   EW    G W+ YI++L    + F      SP  +WTI+N+ H  +T+  FHW 
Sbjct  8    TRFDVGVEWLRAKGSWTFYIMLLASFRIFFGLGLSLSPMESWTIMNVVHAGVTFIVFHWI  67

Query  304  KGTPF----ADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQHPML  471
            KG PF     D  G   + TWWEQID   Q T +RKFL  V V LYL A H+T ++    
Sbjct  68   KGNPFHTPWVDMMGKGEKQTWWEQIDGSVQNTPSRKFLICVVVFLYLAAVHSTPFERQFF  127

Query  472  F---LNTVAVFILVVAKFPHMHKVRIFGIN  552
            F   +N +A  ++ VAK P MH VRIFGIN
Sbjct  128  FVHAVNLIAFLVVFVAKLPFMHGVRIFGIN  157



>ref|XP_001500871.2| PREDICTED: ORM1-like protein 3 isoform 1 [Equus caballus]
 ref|XP_008517123.1| PREDICTED: ORM1-like protein 3 isoform X1 [Equus przewalskii]
Length=179

 Score =   108 bits (270),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 63/144 (44%), Positives = 84/144 (58%), Gaps = 1/144 (1%)
 Frame = +1

Query  124  TDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMITYHFFHWK  303
            +++N NT      G+W +Y+L +    +V LS+   S    WT+ NL H M  Y F H  
Sbjct  34   SEVNPNTRVMNSRGIWLSYVLAIGLLHVVLLSIPFVSVPVVWTLTNLIHNMGMYIFLHTV  93

Query  304  KGTPFAD-DQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQHPMLFLN  480
            KGTPF   DQG    LT WEQ+D G Q T +RKFLT+ P+VLY + S  T Y      LN
Sbjct  94   KGTPFETPDQGKARLLTHWEQMDYGVQFTASRKFLTITPIVLYFLTSFYTKYDQIHFILN  153

Query  481  TVAVFILVVAKFPHMHKVRIFGIN  552
            TV++  +++ K P +H VRIFGIN
Sbjct  154  TVSLMSVLIPKLPQLHGVRIFGIN  177



>ref|XP_005394385.1| PREDICTED: ORM1-like protein 3 isoform X2 [Chinchilla lanigera]
Length=178

 Score =   108 bits (269),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 63/144 (44%), Positives = 84/144 (58%), Gaps = 1/144 (1%)
 Frame = +1

Query  124  TDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMITYHFFHWK  303
            +++N NT      G+W +Y+L +    +V LS+   S    WT+ NL H M  Y F H  
Sbjct  33   SEVNPNTRVMNSRGIWLSYVLAIGLLHVVLLSIPFVSVPVVWTLTNLIHNMGMYIFLHTV  92

Query  304  KGTPFAD-DQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQHPMLFLN  480
            KGTPF   DQG    LT WEQ+D G Q T +RKFLT+ P+VLY + S  T Y      LN
Sbjct  93   KGTPFETPDQGKARLLTHWEQMDYGVQFTASRKFLTITPIVLYFLTSFYTKYDQIHFVLN  152

Query  481  TVAVFILVVAKFPHMHKVRIFGIN  552
            TV++  +++ K P +H VRIFGIN
Sbjct  153  TVSLMSVLIPKLPQLHGVRIFGIN  176



>ref|XP_005076000.1| PREDICTED: ORM1-like protein 3 isoform X1 [Mesocricetus auratus]
 ref|XP_005368332.1| PREDICTED: ORM1-like protein 3 isoform X1 [Microtus ochrogaster]
 ref|XP_005368333.1| PREDICTED: ORM1-like protein 3 isoform X2 [Microtus ochrogaster]
 ref|XP_006247407.1| PREDICTED: ORM1-like protein 3 isoform X1 [Rattus norvegicus]
 ref|XP_006247408.1| PREDICTED: ORM1-like protein 3 isoform X1 [Rattus norvegicus]
 ref|XP_006971894.1| PREDICTED: ORM1-like protein 3 [Peromyscus maniculatus bairdii]
 ref|XP_007606150.1| PREDICTED: ORM1-like protein 3 [Cricetulus griseus]
 ref|XP_007606151.1| PREDICTED: ORM1-like protein 3 [Cricetulus griseus]
 ref|XP_007618515.1| PREDICTED: ORM1-like protein 3 [Cricetulus griseus]
 ref|XP_007618516.1| PREDICTED: ORM1-like protein 3 [Cricetulus griseus]
 sp|Q6QI25.2|ORML3_RAT RecName: Full=ORM1-like protein 3; AltName: Full=Liver regeneration-related 
protein LRRGT00183 [Rattus norvegicus]
 gb|EGV91581.1| ORM1-like protein 3 [Cricetulus griseus]
Length=153

 Score =   107 bits (267),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 84/144 (58%), Gaps = 1/144 (1%)
 Frame = +1

Query  124  TDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMITYHFFHWK  303
            +++N NT      G+W +Y+L +    +V LS+   S    WT+ NL H +  Y F H  
Sbjct  8    SEVNPNTRVMNSRGIWLSYVLAIGLLHVVLLSIPFVSVPVVWTLTNLIHNLGMYIFLHTV  67

Query  304  KGTPFAD-DQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQHPMLFLN  480
            KGTPF   DQG    LT WEQ+D G Q T +RKFLT+ P+VLY + S  T Y      LN
Sbjct  68   KGTPFETPDQGKARLLTHWEQMDYGVQFTASRKFLTITPIVLYFLTSFYTKYDQVHFILN  127

Query  481  TVAVFILVVAKFPHMHKVRIFGIN  552
            TV++  +++ K P +H VRIFGIN
Sbjct  128  TVSLMSVLIPKLPQLHGVRIFGIN  151



>ref|XP_004434610.1| PREDICTED: ORM1-like protein 3 [Ceratotherium simum simum]
Length=153

 Score =   107 bits (267),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 84/144 (58%), Gaps = 1/144 (1%)
 Frame = +1

Query  124  TDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMITYHFFHWK  303
            +++N NT      G+W +Y+L +    +V LS+   S    WT+ NL H M  Y F H  
Sbjct  8    SEVNPNTRVMNSRGIWLSYVLAIGLLHIVLLSIPFVSVPVVWTLTNLIHNMGMYIFLHTV  67

Query  304  KGTPFAD-DQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQHPMLFLN  480
            KGTPF   DQG    LT WEQ+D G Q T +RKFLT+ P+VLY + S  T Y      LN
Sbjct  68   KGTPFETPDQGKARLLTHWEQMDYGVQFTASRKFLTITPIVLYFLTSFYTKYDQIHFILN  127

Query  481  TVAVFILVVAKFPHMHKVRIFGIN  552
            T+++  +++ K P +H VRIFGIN
Sbjct  128  TLSLMSVLIPKLPQLHGVRIFGIN  151



>ref|XP_007782865.1| hypothetical protein W97_06916 [Coniosporium apollinis CBS 100218]
 gb|EON67548.1| hypothetical protein W97_06916 [Coniosporium apollinis CBS 100218]
Length=181

 Score =   108 bits (269),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/136 (39%), Positives = 81/136 (60%), Gaps = 0/136 (0%)
 Frame = +1

Query  133  NKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMITYHFFHWKKGT  312
            N N+EW    G W+ +I+++    + +  + G S  T+WT+ N+S+   +Y  FHW +G 
Sbjct  34   NLNSEWVNAKGAWAIHIILILALKIFYDIIPGVSQETSWTLTNISYMFGSYLMFHWVRGV  93

Query  313  PFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQHPMLFLNTVAV  492
            PF  + G Y+ L  WEQIDNG Q T  +KFL  VPVVL+L+++H T Y      +N +A 
Sbjct  94   PFEFNAGAYDNLNMWEQIDNGDQYTPAKKFLLTVPVVLFLVSTHYTHYGVAYFVINFLAT  153

Query  493  FILVVAKFPHMHKVRI  540
              +V+ K P  H++RI
Sbjct  154  MAVVIPKLPASHRLRI  169



>ref|XP_008687583.1| PREDICTED: ORM1-like protein 3 isoform X1 [Ursus maritimus]
Length=167

 Score =   107 bits (268),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 63/144 (44%), Positives = 84/144 (58%), Gaps = 1/144 (1%)
 Frame = +1

Query  124  TDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMITYHFFHWK  303
            +++N NT      G+W +Y+L +    +V LS+   S    WT+ NL H M  Y F H  
Sbjct  22   SEVNPNTRVMNSRGIWLSYVLAIGLLHVVLLSIPFVSVPVVWTLTNLIHNMGMYIFLHTV  81

Query  304  KGTPFAD-DQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQHPMLFLN  480
            KGTPF   DQG    LT WEQ+D G Q T +RKFLT+ P+VLY + S  T Y      LN
Sbjct  82   KGTPFETPDQGKARLLTHWEQMDYGVQFTASRKFLTITPIVLYFLTSFYTKYDQIHFVLN  141

Query  481  TVAVFILVVAKFPHMHKVRIFGIN  552
            TV++  +++ K P +H VRIFGIN
Sbjct  142  TVSLMSVLIPKLPQLHGVRIFGIN  165



>ref|XP_001366081.2| PREDICTED: ORM1-like protein 3 isoform X1 [Monodelphis domestica]
Length=181

 Score =   108 bits (269),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 63/144 (44%), Positives = 84/144 (58%), Gaps = 1/144 (1%)
 Frame = +1

Query  124  TDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMITYHFFHWK  303
            +++N NT      G+W +Y+L +    +V LS+   S    WT+ NL H M  Y F H  
Sbjct  36   SEVNPNTRVMNSRGIWLSYVLAIGLLHVVLLSIPFVSVPVVWTLTNLIHNMGMYIFLHTV  95

Query  304  KGTPFA-DDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQHPMLFLN  480
            KGTPF   DQG    LT WEQ+D G Q T +RKFLT+ P+VLY + S  T Y      LN
Sbjct  96   KGTPFETPDQGKARLLTHWEQMDYGVQFTASRKFLTITPIVLYFLTSFYTKYDQLHFILN  155

Query  481  TVAVFILVVAKFPHMHKVRIFGIN  552
            TV++  +++ K P +H VRIFGIN
Sbjct  156  TVSLMSVLIPKLPQLHGVRIFGIN  179



>gb|AAM43506.1|AF395707_1 ORMDL2 [Homo sapiens]
Length=153

 Score =   107 bits (267),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 87/148 (59%), Gaps = 1/148 (1%)
 Frame = +1

Query  112  AAPTTDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMITYHF  291
             A  +++N NT      G+W  YI+++    +V LS+   S    WT+ N+ H + TY F
Sbjct  4    GAAHSEVNPNTRVMNSRGIWLAYIILVGLLHMVLLSIPFFSIPVVWTLTNVIHNLATYVF  63

Query  292  FHWKKGTPFAD-DQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQHPM  468
             H  KGTPF   DQG    LT WEQ+D G Q T +RKFL++ P+VLYL+AS  T Y    
Sbjct  64   LHTVKGTPFETPDQGKARLLTHWEQMDYGLQFTSSRKFLSISPIVLYLLASFYTKYDAAH  123

Query  469  LFLNTVAVFILVVAKFPHMHKVRIFGIN  552
              +NT ++  +++ K P  H+VR+FGIN
Sbjct  124  FLINTASLLSVLLPKLPQFHRVRVFGIN  151



>ref|NP_001016075.1| ORMDL sphingolipid biosynthesis regulator 2 [Xenopus (Silurana) 
tropicalis]
 gb|AAI70832.1| ORM1-like 1 (S. cerevisiae) [Xenopus (Silurana) tropicalis]
 gb|AAI70729.1| ORM1-like 1 (S. cerevisiae) [Xenopus (Silurana) tropicalis]
Length=153

 Score =   107 bits (267),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 61/144 (42%), Positives = 86/144 (60%), Gaps = 1/144 (1%)
 Frame = +1

Query  124  TDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMITYHFFHWK  303
            +++N NT      G+W  Y++++ F  ++ LS    S    WT+ N+ H ++ Y F H  
Sbjct  8    SEVNPNTRVLNSRGIWLAYVILVGFLHIILLSFPFFSVPVVWTLTNVIHNLVMYLFLHTV  67

Query  304  KGTPFAD-DQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQHPMLFLN  480
            KGTPF   DQG    LT WEQ+D G Q T +RKFLT+ P+VLYL+AS  T Y      +N
Sbjct  68   KGTPFETPDQGKARLLTHWEQMDYGIQFTSSRKFLTISPIVLYLLASFYTKYDPAHFLIN  127

Query  481  TVAVFILVVAKFPHMHKVRIFGIN  552
            TV++  +++ K P  H VRIFGIN
Sbjct  128  TVSLLSVLLPKLPQFHGVRIFGIN  151



>ref|XP_001932714.1| hypothetical protein PTRG_02381 [Pyrenophora tritici-repentis 
Pt-1C-BFP]
 gb|EDU44904.1| hypothetical protein PTRG_02381 [Pyrenophora tritici-repentis 
Pt-1C-BFP]
Length=182

 Score =   107 bits (268),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 82/135 (61%), Gaps = 0/135 (0%)
 Frame = +1

Query  133  NKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMITYHFFHWKKGT  312
            N N EW    G W+ + +++FF  ++F  + G S   +WT+VNLS+   +Y  FH+ +G 
Sbjct  37   NLNAEWVNAKGAWAIHFVLIFFGKILFDIIPGMSQEASWTLVNLSYVAGSYLMFHYVRGV  96

Query  313  PFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQHPMLFLNTVAV  492
            PF  + G Y+ L  WEQIDNG Q T  +KFL  VP+VL+L+++H T+Y      +N VA 
Sbjct  97   PFDFNSGAYDNLNMWEQIDNGDQYTPAKKFLLTVPIVLFLVSTHYTNYHLTYFLINVVAT  156

Query  493  FILVVAKFPHMHKVR  537
              +V+ K P  H++R
Sbjct  157  IAVVIPKLPSFHRIR  171



>ref|XP_005394384.1| PREDICTED: ORM1-like protein 3 isoform X1 [Chinchilla lanigera]
Length=204

 Score =   108 bits (269),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 63/144 (44%), Positives = 84/144 (58%), Gaps = 1/144 (1%)
 Frame = +1

Query  124  TDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMITYHFFHWK  303
            +++N NT      G+W +Y+L +    +V LS+   S    WT+ NL H M  Y F H  
Sbjct  59   SEVNPNTRVMNSRGIWLSYVLAIGLLHVVLLSIPFVSVPVVWTLTNLIHNMGMYIFLHTV  118

Query  304  KGTPFA-DDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQHPMLFLN  480
            KGTPF   DQG    LT WEQ+D G Q T +RKFLT+ P+VLY + S  T Y      LN
Sbjct  119  KGTPFETPDQGKARLLTHWEQMDYGVQFTASRKFLTITPIVLYFLTSFYTKYDQIHFVLN  178

Query  481  TVAVFILVVAKFPHMHKVRIFGIN  552
            TV++  +++ K P +H VRIFGIN
Sbjct  179  TVSLMSVLIPKLPQLHGVRIFGIN  202



>ref|XP_001796982.1| hypothetical protein SNOG_06616 [Phaeosphaeria nodorum SN15]
 gb|EAT86447.1| hypothetical protein SNOG_06616 [Phaeosphaeria nodorum SN15]
Length=181

 Score =   107 bits (268),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 83/135 (61%), Gaps = 0/135 (0%)
 Frame = +1

Query  133  NKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMITYHFFHWKKGT  312
            N N EW    G W+ +I+++F   ++F  + G S  T+WT+VNLS+   +Y  FH+ +G 
Sbjct  36   NLNAEWVNAKGAWAIHIVLIFLGKILFDIMPGMSQETSWTLVNLSYMAGSYLMFHYVRGV  95

Query  313  PFADDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQHPMLFLNTVAV  492
            PF  + G ++ L  WEQIDNG Q T  +KFL  VP+VL+L+++H T Y      +N +A 
Sbjct  96   PFDFNAGAFDNLNMWEQIDNGDQYTPAKKFLLSVPIVLFLVSTHYTHYDSTYFVVNCLAT  155

Query  493  FILVVAKFPHMHKVR  537
              +VV K P +H++R
Sbjct  156  LAVVVPKLPSLHRIR  170



>ref|XP_010643085.1| PREDICTED: ORM1-like protein 2 [Fukomys damarensis]
 ref|XP_010643086.1| PREDICTED: ORM1-like protein 2 [Fukomys damarensis]
 gb|KFO24590.1| ORM1-like protein 2 [Fukomys damarensis]
Length=153

 Score =   107 bits (266),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 60/144 (42%), Positives = 86/144 (60%), Gaps = 1/144 (1%)
 Frame = +1

Query  124  TDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMITYHFFHWK  303
            +++N NT      G+W  YI+++    +V LS+   S    WT+ N+ H +  Y F H  
Sbjct  8    SEVNPNTRVMNSRGIWLAYIILVGLLHMVLLSIPFLSIPVVWTLTNVIHNLAMYVFLHTV  67

Query  304  KGTPFAD-DQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQHPMLFLN  480
            KGTPF   DQG    LT WEQ+D G Q T +RKFL++ P++LYL+AS  T Y     F+N
Sbjct  68   KGTPFETPDQGKARLLTHWEQMDYGLQFTSSRKFLSISPIILYLLASFYTKYDAAHFFVN  127

Query  481  TVAVFILVVAKFPHMHKVRIFGIN  552
            T ++F +++ K P  H VR+FGIN
Sbjct  128  TASLFSVLLPKLPQFHGVRLFGIN  151



>ref|XP_005002473.1| PREDICTED: ORM1-like protein 3 isoform X2 [Cavia porcellus]
 ref|XP_003467128.2| PREDICTED: ORM1-like protein 3 isoform X1 [Cavia porcellus]
Length=153

 Score =   107 bits (266),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 83/144 (58%), Gaps = 1/144 (1%)
 Frame = +1

Query  124  TDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMITYHFFHWK  303
            +++N NT      G+W +Y+L +    +V LS+   S    WT+ NL H M  Y F H  
Sbjct  8    SEVNPNTRVMNSRGIWLSYVLAIGLLHVVLLSIPFVSVPVVWTLTNLIHNMGMYIFLHTV  67

Query  304  KGTPFAD-DQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQHPMLFLN  480
            KGTPF   DQG    LT WEQ+D G Q T +RKFLT+ P+VLY + S  T Y      LN
Sbjct  68   KGTPFETPDQGKARLLTHWEQMDYGVQFTASRKFLTITPIVLYFLTSFYTKYDQVHFVLN  127

Query  481  TVAVFILVVAKFPHMHKVRIFGIN  552
            T ++  +++ K P +H VRIFGIN
Sbjct  128  TASLMSVLIPKLPQLHGVRIFGIN  151



>ref|XP_002748577.2| PREDICTED: ORM1-like protein 3 isoform X1 [Callithrix jacchus]
Length=209

 Score =   108 bits (269),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 63/144 (44%), Positives = 84/144 (58%), Gaps = 1/144 (1%)
 Frame = +1

Query  124  TDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMITYHFFHWK  303
            +++N NT      G+W +Y+L +    +V LS+   S    WT+ NL H M  Y F H  
Sbjct  64   SEVNPNTRVMNSRGIWLSYVLAIGLLHVVLLSIPFVSVPVVWTLTNLIHNMGMYIFLHTV  123

Query  304  KGTPFA-DDQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQHPMLFLN  480
            KGTPF   DQG    LT WEQ+D G Q T +RKFLT+ P+VLY + S  T Y      LN
Sbjct  124  KGTPFETPDQGKARLLTHWEQMDYGVQFTASRKFLTITPIVLYFLTSFYTKYDQIHFILN  183

Query  481  TVAVFILVVAKFPHMHKVRIFGIN  552
            TV++  +++ K P +H VRIFGIN
Sbjct  184  TVSLMSVLIPKLPQLHGVRIFGIN  207



>dbj|BAC39898.1| unnamed protein product [Mus musculus]
Length=153

 Score =   106 bits (265),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 83/144 (58%), Gaps = 1/144 (1%)
 Frame = +1

Query  124  TDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMITYHFFHWK  303
            +++N NT      G+W +Y+L +    +V LS+   S    WT+ NL H    Y F H  
Sbjct  8    SEVNPNTRVMNSRGIWLSYVLAIGLLHVVLLSIPFVSVPVVWTLTNLIHNQGMYIFLHTV  67

Query  304  KGTPFAD-DQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQHPMLFLN  480
            KGTPF   DQG    LT WEQ+D G Q T +RKFLT+ P+VLY + S  T Y      LN
Sbjct  68   KGTPFETPDQGKARLLTHWEQMDYGVQFTASRKFLTITPIVLYFLTSFYTKYDQVHFILN  127

Query  481  TVAVFILVVAKFPHMHKVRIFGIN  552
            TV++  +++ K P +H VRIFGIN
Sbjct  128  TVSLMTVLIPKLPQLHGVRIFGIN  151



>ref|XP_010635146.1| PREDICTED: ORM1-like protein 1 [Fukomys damarensis]
 gb|KFO27969.1| ORM1-like protein 1 [Fukomys damarensis]
Length=153

 Score =   106 bits (265),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 84/144 (58%), Gaps = 1/144 (1%)
 Frame = +1

Query  124  TDLNKNTEWFTYPGVWSTYililffswlvflsvfGCSPGTAWTIVNLSHFMITYHFFHWK  303
            +++N NT      G+W TY L +    +V LS+   S   AWT+ N+ H +  Y FFH  
Sbjct  8    SEVNPNTRVMNSRGMWLTYALGVGLLHIVLLSIPFFSVPVAWTLTNIIHNLGMYVFFHAV  67

Query  304  KGTPFAD-DQGIYNRLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQHPMLFLN  480
            KGTPF   DQG    LT WEQ+D G Q T +RKF T+ P++LY +AS  T Y      LN
Sbjct  68   KGTPFETPDQGKARLLTHWEQLDYGVQFTSSRKFFTISPIILYFLASFYTKYDPTHFILN  127

Query  481  TVAVFILVVAKFPHMHKVRIFGIN  552
            T ++  +++ K P +H VRIFGIN
Sbjct  128  TASLLSVLIPKMPQLHGVRIFGIN  151



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 631248065840