BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002D19

Length=550
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009797939.1|  PREDICTED: proteasome subunit alpha type-6         336   1e-113   Nicotiana sylvestris
ref|XP_009631638.1|  PREDICTED: proteasome subunit alpha type-6         335   1e-113   Nicotiana tomentosiformis
gb|EYU19318.1|  hypothetical protein MIMGU_mgv1a012555mg                335   2e-113   Erythranthe guttata [common monkey flower]
ref|XP_011098408.1|  PREDICTED: proteasome subunit alpha type-6         334   3e-113   Sesamum indicum [beniseed]
ref|XP_011099933.1|  PREDICTED: proteasome subunit alpha type-6-like    334   3e-113   Sesamum indicum [beniseed]
ref|XP_004251692.1|  PREDICTED: proteasome subunit alpha type-6         334   4e-113   Solanum lycopersicum
gb|KHG01950.1|  Proteasome subunit alpha type-6                         334   6e-113   Gossypium arboreum [tree cotton]
gb|KJB82986.1|  hypothetical protein B456_013G223200                    333   6e-113   Gossypium raimondii
gb|KJB65226.1|  hypothetical protein B456_010G089600                    333   7e-113   Gossypium raimondii
gb|KJB82987.1|  hypothetical protein B456_013G223200                    333   8e-113   Gossypium raimondii
gb|KJB65225.1|  hypothetical protein B456_010G089600                    333   8e-113   Gossypium raimondii
ref|XP_007012615.1|  20S proteasome subunit PAA2 isoform 1              333   9e-113   Theobroma cacao [chocolate]
gb|KHG04433.1|  Proteasome subunit alpha type-6                         332   1e-112   Gossypium arboreum [tree cotton]
gb|KDP33929.1|  hypothetical protein JCGZ_07500                         332   2e-112   Jatropha curcas
ref|XP_002271929.1|  PREDICTED: proteasome subunit alpha type-6         332   3e-112   Vitis vinifera
ref|XP_010269878.1|  PREDICTED: proteasome subunit alpha type-6-like    332   3e-112   Nelumbo nucifera [Indian lotus]
gb|ACJ11727.1|  20S proteasome subunit alpha-1                          331   5e-112   Gossypium hirsutum [American cotton]
gb|KDP45827.1|  hypothetical protein JCGZ_17434                         331   6e-112   Jatropha curcas
ref|XP_006381605.1|  hypothetical protein POPTR_0006s14260g             330   1e-111   Populus trichocarpa [western balsam poplar]
ref|XP_008228175.1|  PREDICTED: proteasome subunit alpha type-6         330   1e-111   Prunus mume [ume]
ref|XP_007215872.1|  hypothetical protein PRUPE_ppa010523mg             330   1e-111   Prunus persica
ref|XP_009404175.1|  PREDICTED: proteasome subunit alpha type-6-like    330   2e-111   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDP03072.1|  unnamed protein product                                329   3e-111   Coffea canephora [robusta coffee]
ref|XP_010541996.1|  PREDICTED: proteasome subunit alpha type-6-B       328   8e-111   Tarenaya hassleriana [spider flower]
ref|XP_009380029.1|  PREDICTED: proteasome subunit alpha type-6         328   9e-111   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010274570.1|  PREDICTED: proteasome subunit alpha type-6         328   1e-110   Nelumbo nucifera [Indian lotus]
ref|XP_008802476.1|  PREDICTED: proteasome subunit alpha type-6-like    327   2e-110   Phoenix dactylifera
ref|XP_009344472.1|  PREDICTED: proteasome subunit alpha type-6         327   2e-110   Pyrus x bretschneideri [bai li]
ref|XP_008391412.1|  PREDICTED: proteasome subunit alpha type-6         327   2e-110   Malus domestica [apple tree]
gb|EPS63192.1|  proteasome subunit alpha type-6                         327   2e-110   Genlisea aurea
gb|ABK96399.1|  unknown                                                 327   3e-110   Populus trichocarpa x Populus deltoides
ref|XP_010557672.1|  PREDICTED: proteasome subunit alpha type-6-B...    327   3e-110   Tarenaya hassleriana [spider flower]
ref|XP_006592586.1|  PREDICTED: proteasome subunit alpha type-6-like    327   3e-110   Glycine max [soybeans]
gb|ACJ85916.1|  unknown                                                 327   4e-110   Medicago truncatula
ref|XP_004488480.1|  PREDICTED: proteasome subunit alpha type-6-l...    326   5e-110   Cicer arietinum [garbanzo]
ref|XP_007133143.1|  hypothetical protein PHAVU_011G155200g             326   6e-110   Phaseolus vulgaris [French bean]
ref|XP_010937324.1|  PREDICTED: proteasome subunit alpha type-6         326   6e-110   Elaeis guineensis
ref|XP_008782714.1|  PREDICTED: proteasome subunit alpha type-6         325   1e-109   Phoenix dactylifera
ref|XP_003595788.1|  Proteasome subunit alpha type                      325   1e-109   Medicago truncatula
ref|XP_010064020.1|  PREDICTED: proteasome subunit alpha type-6         325   1e-109   Eucalyptus grandis [rose gum]
gb|AFK46801.1|  unknown                                                 325   2e-109   Medicago truncatula
ref|XP_002323091.1|  Proteasome subunit alpha type 6-1 family pro...    325   2e-109   Populus trichocarpa [western balsam poplar]
ref|XP_010533014.1|  PREDICTED: proteasome subunit alpha type-6-B...    325   2e-109   Tarenaya hassleriana [spider flower]
gb|KJB82988.1|  hypothetical protein B456_013G223200                    324   3e-109   Gossypium raimondii
gb|ACB87915.1|  20S proteasome alpha subunit A1                         322   3e-109   Malus domestica [apple tree]
ref|XP_006842706.1|  hypothetical protein AMTR_s00147p00090390          324   3e-109   Amborella trichopoda
ref|XP_010441957.1|  PREDICTED: proteasome subunit alpha type-6-B...    324   3e-109   Camelina sativa [gold-of-pleasure]
ref|XP_011001657.1|  PREDICTED: proteasome subunit alpha type-6-like    324   4e-109   Populus euphratica
ref|XP_006465892.1|  PREDICTED: proteasome subunit alpha type-6-like    324   5e-109   Citrus sinensis [apfelsine]
ref|XP_002308263.1|  Proteasome subunit alpha type 6-1 family pro...    323   7e-109   Populus trichocarpa [western balsam poplar]
gb|ACJ85912.1|  unknown                                                 323   8e-109   Medicago truncatula
gb|ADJ95344.1|  PAA1                                                    323   9e-109   Carica papaya [mamon]
ref|NP_001238251.1|  proteasome subunit alpha type-6                    322   1e-108   
gb|AFK47610.1|  unknown                                                 322   1e-108   Lotus japonicus
ref|NP_001031340.1|  20S proteasome subunit PAA2                        321   2e-108   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008462289.1|  PREDICTED: proteasome subunit alpha type-6         322   2e-108   Cucumis melo [Oriental melon]
ref|XP_011018964.1|  PREDICTED: proteasome subunit alpha type-6-like    322   2e-108   Populus euphratica
gb|KDO64978.1|  hypothetical protein CISIN_1g025897mg                   320   3e-108   Citrus sinensis [apfelsine]
ref|XP_004141710.1|  PREDICTED: proteasome subunit alpha type-6-like    322   3e-108   Cucumis sativus [cucumbers]
ref|XP_002532723.1|  proteasome subunit alpha type, putative            322   3e-108   Ricinus communis
gb|AFK44903.1|  unknown                                                 319   3e-108   Medicago truncatula
gb|ABK95322.1|  unknown                                                 322   3e-108   Populus trichocarpa [western balsam poplar]
ref|NP_178641.1|  20S proteasome subunit PAA2                           322   4e-108   Arabidopsis thaliana [mouse-ear cress]
gb|ACU24622.1|  unknown                                                 321   6e-108   Glycine max [soybeans]
ref|XP_010494382.1|  PREDICTED: proteasome subunit alpha type-6-B       321   6e-108   Camelina sativa [gold-of-pleasure]
ref|XP_006474716.1|  PREDICTED: proteasome subunit alpha type-6-l...    321   6e-108   Citrus sinensis [apfelsine]
ref|XP_009102355.1|  PREDICTED: proteasome subunit alpha type-6-B       320   1e-107   Brassica rapa
ref|XP_010939895.1|  PREDICTED: proteasome subunit alpha type-6-like    320   1e-107   Elaeis guineensis
ref|XP_010435443.1|  PREDICTED: proteasome subunit alpha type-6-A...    320   1e-107   Camelina sativa [gold-of-pleasure]
ref|XP_006396131.1|  hypothetical protein EUTSA_v10002649mg             320   1e-107   Eutrema salsugineum [saltwater cress]
ref|XP_004303706.1|  PREDICTED: proteasome subunit alpha type-6         320   2e-107   Fragaria vesca subsp. vesca
ref|XP_010450390.1|  PREDICTED: proteasome subunit alpha type-6-A       319   3e-107   Camelina sativa [gold-of-pleasure]
ref|NP_198409.1|  proteasome alpha subunit A1                           319   3e-107   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006282775.1|  hypothetical protein CARUB_v10006215mg             319   3e-107   Capsella rubella
gb|KFK32243.1|  hypothetical protein AALP_AA6G216400                    319   4e-107   Arabis alpina [alpine rockcress]
gb|AAC32054.1|  20S proteasome subunit PAA1                             319   5e-107   Arabidopsis thaliana [mouse-ear cress]
gb|ACN66752.1|  PAA1                                                    318   5e-107   Carica papaya [mamon]
ref|XP_010666851.1|  PREDICTED: proteasome subunit alpha type-6         318   7e-107   Beta vulgaris subsp. vulgaris [field beet]
gb|AAM12968.1|  multicatalytic endopeptidase complex alpha subuni...    318   9e-107   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009136197.1|  PREDICTED: proteasome subunit alpha type-6-B...    318   1e-106   Brassica rapa
gb|AFK46380.1|  unknown                                                 317   2e-106   Lotus japonicus
gb|KHN46954.1|  Proteasome subunit alpha type-6                         328   2e-106   Glycine soja [wild soybean]
emb|CAA74025.1|  multicatalytic endopeptidase complex, proteasome...    317   3e-106   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002870436.1|  hypothetical protein ARALYDRAFT_493620             317   4e-106   
ref|XP_006649499.1|  PREDICTED: proteasome subunit alpha type-6-like    315   9e-106   Oryza brachyantha
ref|XP_002516258.1|  proteasome subunit alpha type, putative            315   2e-105   Ricinus communis
gb|AFW89473.1|  hypothetical protein ZEAMMB73_334376                    313   2e-105   
ref|NP_001130062.1|  uncharacterized protein LOC100191154               314   3e-105   Zea mays [maize]
gb|ACN33969.1|  unknown                                                 314   3e-105   Zea mays [maize]
ref|NP_001049162.1|  Os03g0180400                                       313   4e-105   
ref|XP_004985490.1|  PREDICTED: proteasome subunit alpha type-6-like    313   1e-104   Setaria italica
ref|XP_002465753.1|  hypothetical protein SORBIDRAFT_01g045210          313   1e-104   Sorghum bicolor [broomcorn]
gb|ABK22399.1|  unknown                                                 312   1e-104   Picea sitchensis
ref|NP_001105138.1|  maize 20S proteasome alpha subunit                 312   2e-104   Zea mays [maize]
ref|XP_006474717.1|  PREDICTED: proteasome subunit alpha type-6-l...    311   2e-104   
ref|XP_003558667.1|  PREDICTED: proteasome subunit alpha type-6         311   3e-104   Brachypodium distachyon [annual false brome]
emb|CDY50408.1|  BnaC03g45100D                                          310   8e-104   Brassica napus [oilseed rape]
gb|AGO97077.1|  20S proteasome alpha                                    308   8e-103   Saccharum hybrid cultivar GT28
gb|EMT09268.1|  Proteasome subunit alpha type-6                         308   1e-102   
dbj|BAJ85935.1|  predicted protein                                      308   1e-102   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KDO64977.1|  hypothetical protein CISIN_1g025897mg                   307   1e-102   Citrus sinensis [apfelsine]
emb|CDX93103.1|  BnaA03g38250D                                          306   8e-102   
ref|XP_001777426.1|  predicted protein                                  295   1e-97    
ref|XP_001768229.1|  predicted protein                                  294   3e-97    
ref|XP_001782615.1|  predicted protein                                  293   7e-97    
gb|ABF94306.1|  Proteasome subunit alpha type 6, putative, expressed    294   9e-97    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006452821.1|  hypothetical protein CICLE_v10010323mg             292   1e-96    
ref|XP_002989745.1|  hypothetical protein SELMODRAFT_272088             291   5e-96    Selaginella moellendorffii
ref|XP_007012616.1|  20S proteasome subunit PAA2 isoform 2              276   3e-91    
ref|XP_001751730.1|  predicted protein                                  277   1e-90    
gb|KDO64981.1|  hypothetical protein CISIN_1g025897mg                   271   8e-90    Citrus sinensis [apfelsine]
gb|KDO64982.1|  hypothetical protein CISIN_1g025897mg                   273   3e-89    Citrus sinensis [apfelsine]
ref|XP_010111992.1|  Proteasome subunit alpha type-6                    273   3e-88    
tpg|DAA43694.1|  TPA: hypothetical protein ZEAMMB73_913533              264   6e-87    
ref|XP_005648429.1|  proteasome subunit alpha type-6                    266   2e-86    Coccomyxa subellipsoidea C-169
ref|XP_001691723.1|  20S proteasome alpha subunit A                     261   3e-84    Chlamydomonas reinhardtii
ref|XP_002949740.1|  20S proteasome alpha subunit A                     259   1e-83    Volvox carteri f. nagariensis
gb|KDD75255.1|  proteasome subunit protein                              258   2e-83    Helicosporidium sp. ATCC 50920
ref|XP_001418143.1|  predicted protein                                  249   8e-80    Ostreococcus lucimarinus CCE9901
ref|XP_005717620.1|  20S core proteasome subunit alpha 1                249   1e-79    Chondrus crispus [carageen]
ref|XP_003059392.1|  predicted protein                                  247   7e-79    Micromonas pusilla CCMP1545
ref|XP_005843942.1|  hypothetical protein CHLNCDRAFT_27583              246   2e-78    Chlorella variabilis
emb|CEF98211.1|  Proteasome A-type subunit                              244   7e-78    Ostreococcus tauri
ref|XP_007513369.1|  predicted protein                                  243   1e-77    Bathycoccus prasinos
ref|XP_006932865.1|  PREDICTED: proteasome subunit alpha type-6 i...    239   2e-76    Felis catus [cat]
ref|XP_004436462.1|  PREDICTED: proteasome subunit alpha type-6 i...    240   3e-76    Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_009209663.1|  PREDICTED: proteasome subunit alpha type-6 i...    239   4e-76    
ref|XP_005656349.1|  PREDICTED: proteasome subunit alpha type-6 i...    239   4e-76    
gb|EDL36728.1|  proteasome (prosome, macropain) subunit, alpha ty...    240   4e-76    Mus musculus [mouse]
ref|XP_537412.2|  PREDICTED: proteasome subunit alpha type-6 isof...    240   4e-76    Canis lupus familiaris [dogs]
ref|XP_004698589.1|  PREDICTED: proteasome subunit alpha type-6         240   5e-76    Echinops telfairi [lesser hedgehog tenrec]
gb|ABM86477.1|  proteasome (prosome, macropain) subunit, alpha ty...    239   5e-76    synthetic construct
ref|XP_004649175.1|  PREDICTED: proteasome subunit alpha type-6         239   5e-76    Jaculus jaculus
ref|NP_058979.1|  proteasome subunit alpha type-6                       239   5e-76    Rattus norvegicus [brown rat]
ref|XP_004470220.1|  PREDICTED: proteasome subunit alpha type-6         239   5e-76    Dasypus novemcinctus
ref|XP_006835407.1|  PREDICTED: proteasome subunit alpha type-6 i...    239   5e-76    Chrysochloris asiatica
ref|NP_036098.1|  proteasome subunit alpha type-6                       239   5e-76    Mus musculus [mouse]
ref|XP_006172412.1|  PREDICTED: LOW QUALITY PROTEIN: proteasome (...    239   5e-76    Tupaia chinensis
ref|XP_007180773.1|  PREDICTED: proteasome subunit alpha type-6         239   5e-76    Balaenoptera acutorostrata scammoni
ref|XP_003471921.1|  PREDICTED: proteasome subunit alpha type-6         239   5e-76    Cavia porcellus [guinea pig]
gb|ERE72543.1|  proteasome subunit alpha type-6-like protein            239   5e-76    Cricetulus griseus [Chinese hamsters]
ref|XP_001095366.1|  PREDICTED: proteasome subunit alpha type-6-l...    239   8e-76    
ref|XP_005865030.1|  PREDICTED: proteasome subunit alpha type-6         239   9e-76    Myotis brandtii
ref|NP_001088418.1|  uncharacterized protein LOC495277                  239   1e-75    Xenopus laevis [clawed frog]
ref|NP_001132918.1|  proteasome subunit alpha type-6                    239   1e-75    Ovis aries [domestic sheep]
ref|XP_001363110.1|  PREDICTED: proteasome subunit alpha type-6         239   1e-75    Monodelphis domestica
ref|NP_001264372.1|  proteasome subunit alpha type-6                    239   1e-75    Gallus gallus [bantam]
ref|NP_001232198.1|  putative proteasome subunit alpha type 6           238   1e-75    Taeniopygia guttata
ref|NP_989113.1|  proteasome subunit alpha type-6                       238   2e-75    Xenopus tropicalis [western clawed frog]
ref|XP_009901279.1|  PREDICTED: proteasome subunit alpha type-6 i...    238   2e-75    Picoides pubescens
gb|KFW08632.1|  Proteasome subunit alpha type-6                         238   2e-75    Eurypyga helias
ref|XP_010153544.1|  PREDICTED: proteasome subunit alpha type-6 i...    238   2e-75    Eurypyga helias
ref|XP_006793167.1|  PREDICTED: proteasome subunit alpha type-6-like    238   2e-75    Neolamprologus brichardi [lyretail cichlid]
ref|XP_005285405.1|  PREDICTED: proteasome subunit alpha type-6 i...    238   2e-75    Chrysemys picta bellii
ref|XP_003924255.1|  PREDICTED: proteasome subunit alpha type-6         239   2e-75    Saimiri boliviensis boliviensis
ref|XP_008353690.1|  PREDICTED: proteasome subunit alpha type-6         233   2e-75    
ref|XP_010153543.1|  PREDICTED: proteasome subunit alpha type-6 i...    238   3e-75    Eurypyga helias
ref|NP_001132944.1|  proteasome subunit alpha type-6                    238   3e-75    Sus scrofa [pigs]
ref|XP_007530301.1|  PREDICTED: proteasome subunit alpha type-6         238   3e-75    Erinaceus europaeus [common hedgehog]
ref|XP_007436765.1|  PREDICTED: proteasome subunit alpha type-6         238   3e-75    Python bivittatus
ref|XP_006258805.1|  PREDICTED: proteasome subunit alpha type-6         238   3e-75    Alligator mississippiensis
ref|XP_005149366.1|  PREDICTED: proteasome subunit alpha type-6         238   3e-75    
ref|XP_003445487.1|  PREDICTED: proteasome subunit alpha type-6-like    238   3e-75    Oreochromis niloticus
ref|XP_004559366.1|  PREDICTED: proteasome subunit alpha type-6-like    238   3e-75    Maylandia zebra
pdb|4R3O|A  Chain A, Human Constitutive 20s Proteasome                  237   4e-75    Homo sapiens [man]
ref|XP_005842332.1|  20S proteasome subunit alpha type 6                237   6e-75    Guillardia theta CCMP2712
ref|NP_001086785.1|  proteasome alpha 6 subunit                         237   7e-75    Xenopus laevis [clawed frog]
gb|KIY96698.1|  20S proteasome subunit alpha 1                          238   7e-75    Monoraphidium neglectum
ref|XP_008282309.1|  PREDICTED: proteasome subunit alpha type-6         236   9e-75    Stegastes partitus
dbj|BAE36518.1|  unnamed protein product                                236   9e-75    Mus musculus [mouse]
emb|CEG74212.1|  Putative Proteasome subunit alpha type                 236   9e-75    Rhizopus microsporus
ref|XP_006985315.1|  PREDICTED: proteasome subunit alpha type-6         236   9e-75    Peromyscus maniculatus bairdii
ref|XP_001511492.1|  PREDICTED: proteasome subunit alpha type-6 i...    236   1e-74    Ornithorhynchus anatinus [duck-billed platypus]
ref|NP_001002589.1|  proteasome subunit alpha type-6                    236   1e-74    Danio rerio [leopard danio]
gb|ESA18832.1|  hypothetical protein GLOINDRAFT_344383                  236   1e-74    
ref|XP_005703510.1|  20S proteasome subunit alpha 1                     236   1e-74    Galdieria sulphuraria
emb|CAG00121.1|  unnamed protein product                                236   1e-74    Tetraodon nigroviridis
ref|XP_003440740.1|  PREDICTED: proteasome subunit alpha type-6-like    236   1e-74    Oreochromis niloticus
ref|XP_004542308.1|  PREDICTED: proteasome subunit alpha type-6-like    236   2e-74    Maylandia zebra
gb|EIE83838.1|  hypothetical protein RO3G_08543                         236   2e-74    Rhizopus delemar RA 99-880
ref|XP_005798367.1|  PREDICTED: proteasome subunit alpha type-6-like    236   2e-74    Xiphophorus maculatus
ref|XP_010741287.1|  PREDICTED: proteasome subunit alpha type-6         236   2e-74    
ref|XP_010876681.1|  PREDICTED: proteasome subunit alpha type-6         236   2e-74    Esox lucius
ref|NP_001279159.1|  proteasome (prosome, macropain) subunit, alp...    236   2e-74    Callorhinchus milii [Australian ghost shark]
ref|XP_005810950.1|  PREDICTED: proteasome subunit alpha type-6-like    235   2e-74    Xiphophorus maculatus
ref|XP_008396439.1|  PREDICTED: proteasome subunit alpha type-6         235   2e-74    Poecilia reticulata
ref|XP_008300217.1|  PREDICTED: proteasome subunit alpha type-6         235   2e-74    Stegastes partitus
gb|ACI66289.1|  Proteasome subunit alpha type-6                         235   2e-74    Salmo salar
emb|CDQ90937.1|  unnamed protein product                                235   2e-74    Oncorhynchus mykiss
ref|XP_003971508.1|  PREDICTED: proteasome subunit alpha type-6-like    235   3e-74    Takifugu rubripes [tiger puffer]
ref|XP_004141815.1|  PREDICTED: proteasome subunit alpha type-6-like    231   3e-74    
ref|XP_004083706.1|  PREDICTED: proteasome subunit alpha type-6         235   3e-74    Oryzias latipes [Japanese rice fish]
ref|XP_010744453.1|  PREDICTED: proteasome subunit alpha type-6         235   3e-74    
gb|ETE73021.1|  Proteasome subunit alpha type-6                         236   4e-74    Ophiophagus hannah
ref|XP_005158685.1|  PREDICTED: proteasome subunit alpha type-6 i...    235   4e-74    
ref|XP_006632201.1|  PREDICTED: proteasome subunit alpha type-6-like    235   4e-74    Lepisosteus oculatus
ref|XP_007569003.1|  PREDICTED: proteasome subunit alpha type-6         235   4e-74    Poecilia formosa
gb|EPB88050.1|  proteasome subunit alpha type-6                         234   4e-74    Mucor circinelloides f. circinelloides 1006PhL
ref|XP_008398058.1|  PREDICTED: proteasome subunit alpha type-6         234   4e-74    Poecilia reticulata
ref|XP_005562133.1|  PREDICTED: proteasome subunit alpha type-6-like    234   5e-74    
gb|ACO08744.1|  Proteasome subunit alpha type 6                         233   5e-74    Oncorhynchus mykiss
ref|XP_002824717.1|  PREDICTED: proteasome subunit alpha type-6 i...    234   5e-74    
ref|XP_004653726.1|  PREDICTED: proteasome subunit alpha type-6-like    234   5e-74    
emb|CEP12966.1|  hypothetical protein                                   234   5e-74    Parasitella parasitica
emb|CDS07623.1|  Putative Proteasome subunit alpha type                 234   5e-74    Lichtheimia ramosa
ref|XP_007576015.1|  PREDICTED: proteasome subunit alpha type-6         234   5e-74    Poecilia formosa
gb|ACO51961.1|  Proteasome subunit alpha type-6                         234   6e-74    Rana catesbeiana [bullfrog]
dbj|GAN03133.1|  proteasome subunit alpha type-6                        234   8e-74    Mucor ambiguus
ref|XP_007253022.1|  PREDICTED: proteasome subunit alpha type-6-l...    234   9e-74    Astyanax mexicanus [blind cave fish]
ref|XP_005989234.1|  PREDICTED: proteasome subunit alpha type-6         233   1e-73    Latimeria chalumnae
emb|CDH55408.1|  proteasome subunit alpha type-6                        233   2e-73    Lichtheimia corymbifera JMRC:FSU:9682
emb|CDQ78135.1|  unnamed protein product                                233   2e-73    Oncorhynchus mykiss
ref|XP_006015430.1|  PREDICTED: proteasome subunit alpha type-6         237   2e-73    
gb|ACH70967.1|  proteasome (prosome, macropain) subunit, alpha ty...    232   4e-73    Salmo salar
ref|XP_010876973.1|  PREDICTED: proteasome subunit alpha type-6         232   4e-73    Esox lucius
gb|ACO08806.1|  Proteasome subunit alpha type 6                         232   5e-73    Oncorhynchus mykiss
gb|ACM08640.1|  Proteasome subunit alpha type-6                         232   7e-73    Salmo salar
ref|XP_007253021.1|  PREDICTED: proteasome subunit alpha type-6-l...    233   7e-73    
gb|AFK10987.1|  proteasome subunit alpha type-6-like protein            231   9e-73    Callorhinchus milii [Australian ghost shark]
ref|NP_705941.1|  proteasome subunit alpha type-6                       231   9e-73    
gb|ACQ58552.1|  Proteasome subunit alpha type-6                         231   9e-73    Anoplopoma fimbria
gb|ACH70968.1|  proteasome (prosome, macropain) subunit, alpha ty...    231   1e-72    Salmo salar
gb|KFH62604.1|  proteasome subunit alpha type-6                         231   1e-72    Mortierella verticillata NRRL 6337
ref|XP_004637142.1|  PREDICTED: proteasome subunit alpha type-6         231   1e-72    Octodon degus
gb|ACI69778.1|  Proteasome subunit alpha type-6                         231   2e-72    Salmo salar
ref|XP_008311014.1|  PREDICTED: proteasome subunit alpha type-6         230   3e-72    Cynoglossus semilaevis [half-smooth tongue sole]
gb|ACI69799.1|  Proteasome subunit alpha type-6                         228   4e-72    Salmo salar
gb|ACO08382.1|  Proteasome subunit alpha type 6                         229   4e-72    Oncorhynchus mykiss
gb|ACI66670.1|  Proteasome subunit alpha type-6                         228   4e-72    Salmo salar
ref|XP_001640650.1|  predicted protein                                  229   5e-72    Nematostella vectensis
ref|XP_007873808.1|  hypothetical protein PNEG_01835                    229   6e-72    Pneumocystis murina B123
ref|XP_002610620.1|  hypothetical protein BRAFLDRAFT_260512             229   6e-72    Branchiostoma floridae
ref|XP_011419593.1|  PREDICTED: proteasome subunit alpha type-6         227   2e-71    Crassostrea gigas
ref|XP_007068323.1|  PREDICTED: proteasome subunit alpha type-6-like    227   4e-71    Chelonia mydas [green seaturtle]
ref|XP_010777538.1|  PREDICTED: proteasome subunit alpha type-6         227   5e-71    Notothenia coriiceps [yellowbelly rockcod]
ref|XP_006065991.1|  PREDICTED: proteasome subunit alpha type-6-like    226   8e-71    
ref|XP_005293216.1|  PREDICTED: proteasome subunit alpha type-6-l...    226   1e-70    Chrysemys picta bellii
ref|XP_002500811.1|  predicted protein                                  227   2e-70    Micromonas commoda
ref|XP_005350320.1|  PREDICTED: proteasome subunit alpha type-6-like    223   3e-70    
ref|XP_003388491.1|  PREDICTED: proteasome subunit alpha type-6-like    224   4e-70    Amphimedon queenslandica
ref|XP_006678757.1|  hypothetical protein BATDEDRAFT_88011              224   5e-70    Batrachochytrium dendrobatidis JAM81
ref|XP_005987928.1|  PREDICTED: proteasome subunit alpha type-6-l...    224   7e-70    Latimeria chalumnae
ref|XP_004333676.1|  proteasome subunit alpha type6, putative           224   7e-70    Acanthamoeba castellanii str. Neff
emb|CDH55409.1|  proteasome subunit alpha type-6                        224   8e-70    Lichtheimia corymbifera JMRC:FSU:9682
gb|ELU01128.1|  hypothetical protein CAPTEDRAFT_167909                  223   1e-69    Capitella teleta
ref|XP_002679314.1|  predicted protein                                  224   1e-69    Naegleria gruberi strain NEG-M
gb|EIE87129.1|  hypothetical protein RO3G_11840                         224   1e-69    Rhizopus delemar RA 99-880
ref|XP_011314423.1|  PREDICTED: proteasome subunit alpha type-6-like    223   2e-69    Fopius arisanus
ref|XP_008993532.1|  PREDICTED: LOW QUALITY PROTEIN: proteasome s...    223   2e-69    Callithrix jacchus [common marmoset]
ref|XP_007688022.1|  hypothetical protein COCMIDRAFT_5367               223   3e-69    Bipolaris oryzae ATCC 44560
ref|XP_003706429.1|  PREDICTED: proteasome subunit alpha type-6-like    222   3e-69    Megachile rotundata
ref|XP_011151114.1|  PREDICTED: proteasome subunit alpha type-6-like    222   4e-69    Harpegnathos saltator
ref|XP_005762775.1|  hypothetical protein EMIHUDRAFT_446206             222   5e-69    Emiliania huxleyi CCMP1516
ref|XP_005356606.1|  PREDICTED: proteasome subunit alpha type-6-like    221   7e-69    
gb|ELW63324.1|  Proteasome subunit alpha type-6                         219   8e-69    Tupaia chinensis
gb|EHK16557.1|  hypothetical protein TRIVIDRAFT_75344                   221   9e-69    Trichoderma virens Gv29-8
gb|EFX02870.1|  proteasome subunit alpha type 6                         221   1e-68    Grosmannia clavigera kw1407
ref|XP_003303796.1|  hypothetical protein PTT_16156                     221   1e-68    
ref|XP_003393493.1|  PREDICTED: proteasome subunit alpha type-6-like    220   2e-68    Bombus terrestris [large earth bumblebee]
ref|XP_001931683.1|  proteasome subunit alpha type-6                    221   2e-68    Pyrenophora tritici-repentis Pt-1C-BFP
gb|EPS29950.1|  hypothetical protein PDE_04900                          220   3e-68    Penicillium oxalicum 114-2
gb|EMF14550.1|  N-terminal nucleophile aminohydrolase                   220   3e-68    Sphaerulina musiva SO2202
ref|XP_002480335.1|  proteasome component Prs2, putative                220   3e-68    Talaromyces stipitatus ATCC 10500
ref|XP_003740511.1|  PREDICTED: proteasome subunit alpha type-6-like    220   3e-68    Galendromus occidentalis
emb|CDM30570.1|  Probable proteasome subunit alpha type-6               220   3e-68    Penicillium roqueforti FM164
ref|XP_006696698.1|  hypothetical protein CTHT_0063920                  220   3e-68    Chaetomium thermophilum var. thermophilum DSM 1495
ref|XP_011329096.1|  PREDICTED: proteasome subunit alpha type-6-like    219   3e-68    Ooceraea biroi
tpe|CBF76587.1|  TPA: proteasome core alpha 1 component (Eurofung)      220   4e-68    Aspergillus nidulans FGSC A4
ref|XP_002143952.1|  proteasome component Prs2, putative                220   4e-68    Talaromyces marneffei ATCC 18224
ref|XP_006963196.1|  proteasome subunit alpha 6                         220   4e-68    Trichoderma reesei QM6a
ref|XP_009019631.1|  hypothetical protein HELRODRAFT_106545             219   4e-68    Helobdella robusta
gb|ABI13160.1|  putative proteasome alpha subunit                       220   4e-68    Emiliania huxleyi
ref|XP_011167410.1|  PREDICTED: proteasome subunit alpha type-6-like    219   4e-68    Solenopsis invicta [imported red fire ant]
ref|XP_011494157.1|  PREDICTED: proteasome subunit alpha type-6-like    219   4e-68    Ceratosolen solmsi marchali
ref|XP_011054784.1|  PREDICTED: proteasome subunit alpha type-6-like    219   5e-68    Acromyrmex echinatior
gb|EFX71218.1|  proteasome subunit alpha type 6-like protein            219   5e-68    Daphnia pulex
ref|XP_003697298.1|  PREDICTED: proteasome subunit alpha type-6-like    219   5e-68    Apis florea [dwarf honeybee]
ref|XP_001843247.1|  proteasome subunit alpha type 6                    219   5e-68    Culex quinquefasciatus
ref|XP_003844849.1|  similar to proteasome subunit alpha type-6         219   5e-68    Leptosphaeria maculans JN3
gb|EPE09739.1|  proteasome subunit alpha type 6                         219   5e-68    
ref|XP_009063626.1|  hypothetical protein LOTGIDRAFT_229407             219   6e-68    
ref|XP_007731114.1|  proteasome subunit alpha type-6                    219   6e-68    
gb|KGO36960.1|  Proteasome A-type subunit                               219   6e-68    
ref|XP_008712166.1|  hypothetical protein HMPREF1541_09269              219   8e-68    
gb|EHK40697.1|  hypothetical protein TRIATDRAFT_301498                  219   9e-68    
gb|EFZ13292.1|  hypothetical protein SINV_14495                         219   1e-67    
ref|XP_006608469.1|  PREDICTED: proteasome subunit alpha type-6-like    218   1e-67    
ref|XP_002559377.1|  Pc13g09540                                         218   1e-67    
ref|XP_001654091.1|  AAEL009898-PA                                      218   1e-67    
gb|KFM81155.1|  Proteasome subunit alpha type-6                         218   1e-67    
ref|XP_010739538.1|  PREDICTED: proteasome subunit alpha type-6-like    218   2e-67    
ref|XP_001244388.1|  hypothetical protein CIMG_03829                    218   2e-67    
ref|XP_008543695.1|  PREDICTED: proteasome subunit alpha type-6-like    218   2e-67    
ref|XP_009158794.1|  proteasome subunit alpha type-6                    218   2e-67    
ref|XP_002113578.1|  hypothetical protein TRIADDRAFT_27191              218   2e-67    
ref|NP_001150310.1|  proteasome subunit alpha type 6                    219   2e-67    
ref|XP_001749972.1|  hypothetical protein                               218   2e-67    
ref|XP_501500.1|  YALI0C06039p                                          218   2e-67    
gb|KIW08744.1|  hypothetical protein PV09_00682                         218   2e-67    
ref|XP_003216618.1|  PREDICTED: proteasome subunit alpha type-6         217   3e-67    
ref|XP_001271130.1|  predicted protein                                  217   3e-67    
ref|XP_008608969.1|  proteasome subunit alpha type-6                    217   4e-67    
ref|XP_009222727.1|  proteasome subunit alpha type-6                    217   4e-67    
ref|XP_005804586.1|  PREDICTED: proteasome subunit alpha type-6-like    217   4e-67    
ref|XP_008881328.1|  hypothetical protein H310_15130                    216   5e-67    
gb|KIW28395.1|  hypothetical protein PV07_08062                         217   5e-67    
gb|KIW74909.1|  hypothetical protein Z517_11680                         217   5e-67    
gb|KIL96483.1|  hypothetical protein FAVG1_01227                        217   5e-67    
ref|XP_005099053.1|  PREDICTED: proteasome subunit alpha type-6-like    216   5e-67    
ref|XP_006117859.1|  PREDICTED: proteasome subunit alpha type-6         216   5e-67    
gb|KFA67907.1|  hypothetical protein S40285_04100                       217   6e-67    
ref|XP_318387.2|  AGAP003935-PA                                         216   6e-67    
ref|XP_007577895.1|  PREDICTED: proteasome subunit alpha type-6-like    216   6e-67    
ref|XP_007586723.1|  putative proteasome subunit alpha type-6 pro...    217   6e-67    
gb|EKG12338.1|  Proteasome alpha-subunit conserved site                 217   6e-67    
ref|XP_003449352.1|  PREDICTED: proteasome subunit alpha type-6-like    216   6e-67    
gb|KFB46736.1|  AGAP003935-PA-like protein                              216   7e-67    
gb|EGU87091.1|  hypothetical protein FOXB_02485                         216   7e-67    
ref|XP_010755906.1|  hypothetical protein PADG_00615                    216   7e-67    
gb|EEH39752.2|  proteasome component C7-alpha                           216   7e-67    
ref|XP_011319207.1|  proteasome component C7-alpha                      216   7e-67    
ref|XP_007719836.1|  proteasome subunit alpha type-6                    216   7e-67    
gb|KEQ85758.1|  proteasome core particle subunit alpha 1                216   7e-67    
gb|EQL00512.1|  proteasome subunit alpha type 6                         216   7e-67    
ref|XP_002411749.1|  proteasome subunit alpha type, putative            216   8e-67    
gb|KID80249.1|  proteasome subunit alpha type 6                         216   8e-67    
ref|XP_009255010.1|  hypothetical protein FPSE_03616                    216   8e-67    
ref|XP_001607854.1|  PREDICTED: proteasome subunit alpha type-6-like    216   8e-67    
ref|XP_007807465.1|  proteasome subunit alpha type 6                    216   9e-67    
gb|KFG86753.1|  proteasome subunit alpha type 6                         216   9e-67    
gb|KIW87420.1|  hypothetical protein Z519_12056                         217   9e-67    
ref|XP_007821798.1|  Proteasome A-type subunit                          216   9e-67    
ref|XP_002741353.1|  PREDICTED: proteasome subunit alpha type-6-like    216   1e-66    
ref|XP_968655.1|  PREDICTED: proteasome subunit alpha type-6            216   1e-66    
ref|XP_007741776.1|  20S proteasome subunit alpha 1                     217   1e-66    
ref|XP_006801196.1|  PREDICTED: proteasome subunit alpha type-6-l...    216   1e-66    
ref|XP_003051118.1|  predicted protein                                  216   1e-66    
gb|KID99895.1|  proteasome subunit alpha type 6                         216   1e-66    
gb|ETN58251.1|  proteasome subunit alpha type 6                         216   1e-66    
ref|XP_008424335.1|  PREDICTED: proteasome subunit alpha type-6-like    216   1e-66    
ref|XP_009831249.1|  hypothetical protein H257_07425                    216   1e-66    
gb|EFQ28985.1|  proteasome A-type and B-type                            216   1e-66    
gb|KDN66300.1|  putative proteasome A-type and B-type                   216   1e-66    
gb|EPQ67273.1|  hypothetical protein BGT96224_A21417                    216   1e-66    
dbj|GAM85636.1|  hypothetical protein ANO11243_036430                   216   2e-66    
gb|KIX01010.1|  hypothetical protein Z518_10076                         216   2e-66    
gb|KFY28594.1|  hypothetical protein V493_02857                         216   2e-66    
ref|XP_002841029.1|  hypothetical protein                               215   2e-66    
ref|XP_001819832.1|  proteasome subunit alpha type-6                    216   2e-66    
ref|XP_003717769.1|  proteasome subunit alpha type-6                    216   2e-66    
dbj|GAD99016.1|  predicted protein                                      218   2e-66    
ref|XP_003649967.1|  hypothetical protein THITE_2109162                 216   2e-66    
gb|KFH45227.1|  Proteasome subunit alpha-like protein                   215   2e-66    
ref|XP_002850566.1|  proteasome subunit alpha type 6                    216   2e-66    
gb|KEQ92672.1|  hypothetical protein AUEXF2481DRAFT_31918               215   2e-66    
ref|XP_001796064.1|  hypothetical protein SNOG_05667                    216   2e-66    
gb|KDB16148.1|  proteasome subunit alpha type 6                         215   2e-66    
ref|XP_003662349.1|  hypothetical protein MYCTH_2302907                 215   2e-66    
ref|XP_007796832.1|  putative proteasome subunit alpha type 6 pro...    215   2e-66    
ref|XP_005751769.1|  PREDICTED: proteasome subunit alpha type-6-like    215   2e-66    
emb|CCF38339.1|  proteasome A-type and B-type                           215   2e-66    
emb|CEJ93046.1|  Putative Proteasome subunit alpha type                 215   2e-66    
emb|CCA15401.1|  proteasome subunit alpha type6 putative                215   2e-66    
ref|XP_004562835.1|  PREDICTED: proteasome subunit alpha type-6-like    215   2e-66    
gb|KIW69429.1|  hypothetical protein PV04_05306                         215   2e-66    
ref|XP_007601883.1|  proteasome A-type and B-type                       215   2e-66    
ref|XP_001912148.1|  hypothetical protein                               215   3e-66    
gb|AAK40123.1|AF354751_1  proteasome subunit alpha Type 6-B             215   3e-66    
gb|KEQ62212.1|  proteasome core particle subunit alpha 1                215   3e-66    
emb|CEF75633.1|  unnamed protein product                                215   3e-66    
gb|KEQ76497.1|  proteasome core particle subunit alpha 1                215   3e-66    
ref|XP_004075507.1|  PREDICTED: proteasome subunit alpha type-6-like    214   3e-66    
emb|CDQ77351.1|  unnamed protein product                                214   3e-66    
ref|XP_011259025.1|  PREDICTED: proteasome subunit alpha type-6-like    214   3e-66    
gb|KEY66092.1|  hypothetical protein S7711_09211                        216   3e-66    
gb|EME46261.1|  hypothetical protein DOTSEDRAFT_70305                   215   3e-66    
gb|ACI70015.1|  Proteasome subunit alpha type-6                         214   4e-66    
emb|CDQ88726.1|  unnamed protein product                                214   4e-66    
gb|KIV96436.1|  hypothetical protein PV10_00308                         214   4e-66    
ref|XP_007295783.1|  proteasome subunit alpha type 6                    214   4e-66    
ref|XP_001224606.1|  conserved hypothetical protein                     214   4e-66    
ref|XP_002623465.1|  proteasome component C7-alpha                      214   4e-66    
gb|KGR10582.1|  20S proteasome subunit alpha 1                          214   4e-66    
ref|XP_009649783.1|  proteasome subunit alpha type-6-A                  214   4e-66    
gb|KFA73659.1|  hypothetical protein S40288_07644                       215   5e-66    
ref|XP_002551204.1|  proteasome component C7-alpha                      215   5e-66    
ref|NP_986577.1|  AGL089Wp                                              214   5e-66    
gb|EQB51932.1|  proteasome A-type and B-type                            214   5e-66    
emb|CCE29503.1|  probable SCL1-20S proteasome subunit YC7ALPHA/Y8...    214   6e-66    
ref|XP_004997606.1|  proteasome subunit alpha type-6                    214   6e-66    
ref|XP_008724612.1|  hypothetical protein G647_10399                    214   6e-66    
gb|ADO27866.1|  proteasome subunit alpha type-6                         214   6e-66    
gb|ENH81729.1|  proteasome subunit alpha type 6                         214   6e-66    
ref|XP_007756206.1|  proteasome subunit alpha type-6                    214   6e-66    
emb|CCI48184.1|  unnamed protein product                                214   6e-66    
ref|XP_005177054.1|  PREDICTED: proteasome subunit alpha type-6         214   7e-66    
gb|KFY99093.1|  hypothetical protein V500_01465                         214   7e-66    
ref|XP_007912348.1|  putative proteasome subunit alpha type 6 pro...    214   7e-66    
gb|ERS99418.1|  hypothetical protein HMPREF1624_04618                   214   7e-66    
emb|CAG06433.1|  unnamed protein product                                214   7e-66    
gb|ACM09335.1|  Proteasome subunit alpha type-6                         214   8e-66    
gb|KFY37296.1|  hypothetical protein V495_07258                         214   8e-66    
ref|NP_001187798.1|  proteasome subunit alpha type-6                    213   8e-66    
emb|CCD44572.1|  similar to proteasome subunit alpha type 6             213   1e-65    
emb|CCU98368.1|  unnamed protein product                                214   1e-65    
ref|XP_002553818.1|  KLTH0E07788p                                       213   1e-65    
ref|XP_007926644.1|  hypothetical protein MYCFIDRAFT_188442             213   1e-65    
ref|XP_003857582.1|  proteasome core particle subunit alpha 1           213   1e-65    
ref|XP_003647896.1|  hypothetical protein Ecym_7233                     213   1e-65    
ref|XP_662473.1|  hypothetical protein AN4869.2                         213   1e-65    
ref|XP_008599361.1|  proteasome A-type and B-type                       213   1e-65    
gb|ELR02822.1|  20S proteasome subunit alpha 1                          213   1e-65    
gb|KGQ11560.1|  Proteasome subunit alpha type-6                         213   1e-65    
ref|XP_002127869.1|  PREDICTED: proteasome subunit alpha type-6-l...    213   2e-65    
gb|KFY66093.1|  hypothetical protein V496_02185                         213   2e-65    
gb|KFX91072.1|  hypothetical protein V490_06088                         213   2e-65    
gb|KFY13879.1|  hypothetical protein V492_03002                         213   2e-65    
gb|EEH04842.1|  proteasome subunit alpha                                213   2e-65    
ref|XP_717661.1|  hypothetical protein CaO19.12833                      213   2e-65    
ref|XP_004349345.1|  proteasome subunit iota                            213   2e-65    
ref|XP_002796053.1|  proteasome component C7-alpha                      215   2e-65    
gb|AGM32386.1|  proteasome subunit alpha type-6                         213   2e-65    
gb|KDQ65121.1|  hypothetical protein JAAARDRAFT_28780                   213   2e-65    
ref|XP_002419018.1|  alpha subunit of the 20S core complex of the...    213   2e-65    
ref|XP_717755.1|  hypothetical protein CaO19.5378                       213   2e-65    
ref|XP_003008821.1|  proteasome subunit alpha type-6-B                  213   2e-65    
emb|CCC12323.1|  unnamed protein product                                213   2e-65    
ref|XP_001730989.1|  hypothetical protein MGL_1988                      213   2e-65    
gb|KIN06410.1|  hypothetical protein OIDMADRAFT_141988                  213   2e-65    
gb|KIW43338.1|  hypothetical protein PV06_04450                         213   2e-65    
ref|XP_003177216.1|  proteasome subunit alpha type-6                    213   2e-65    
gb|EZG02619.1|  hypothetical protein H106_07457                         213   3e-65    
gb|KHC64481.1|  20S proteasome subunit alpha 1                          212   3e-65    
ref|XP_008290377.1|  PREDICTED: proteasome subunit alpha type-6-like    212   3e-65    
ref|XP_957907.1|  proteasome subunit alpha type 6                       213   3e-65    
emb|CDR38830.1|  CYFA0S02e06568g1_1                                     212   3e-65    
ref|XP_001383008.1|  hypothetical protein PICST_41423                   212   3e-65    
gb|EPS95905.1|  hypothetical protein FOMPIDRAFT_1131639                 213   3e-65    
gb|EMG46214.1|  Proteasome component C7-alpha                           212   4e-65    
ref|XP_009860960.1|  PREDICTED: proteasome subunit alpha type-6-l...    212   4e-65    
ref|XP_007833194.1|  Proteasome subunit alpha type-6                    212   4e-65    
gb|KGK38890.1|  hypothetical protein JL09_g1926                         212   4e-65    
gb|KDB22734.1|  hypothetical protein H109_05356                         212   4e-65    
gb|KHC80025.1|  20S proteasome subunit alpha 1                          212   4e-65    
ref|XP_008307633.1|  PREDICTED: proteasome subunit alpha type-6-like    211   5e-65    
ref|NP_571870.2|  proteasome alpha 6b subunit                           212   5e-65    
gb|EZF34225.1|  hypothetical protein H101_02239                         212   5e-65    
ref|XP_003323788.2|  proteasome subunit alpha type-6                    211   6e-65    
ref|XP_001548586.1|  conserved hypothetical protein                     211   7e-65    
emb|CCG84721.1|  protein of unknown function                            211   7e-65    
ref|XP_007417761.1|  hypothetical protein MELLADRAFT_79569              211   8e-65    
gb|KII96075.1|  hypothetical protein PLICRDRAFT_35036                   211   8e-65    
ref|XP_001213840.1|  proteasome subunit alpha type 6                    221   8e-65    
gb|KDO64983.1|  hypothetical protein CISIN_1g025897mg                   209   9e-65    
gb|AGO13780.1|  AaceriAGL089Wp                                          211   9e-65    
gb|KHN94324.1|  proteasome subunit alpha type 6                         211   1e-64    
gb|KDR14657.1|  Proteasome subunit alpha type-6                         211   1e-64    
ref|XP_007680618.1|  hypothetical protein BAUCODRAFT_126149             212   1e-64    
ref|XP_007315239.1|  hypothetical protein SERLADRAFT_460060             211   1e-64    
ref|XP_003026186.1|  hypothetical protein SCHCODRAFT_79949              211   2e-64    
ref|XP_010896958.1|  PREDICTED: proteasome subunit alpha type-6-l...    210   2e-64    
ref|XP_456708.1|  DEHA2A08734p                                          210   2e-64    
ref|XP_568975.1|  hypothetical protein                                  210   2e-64    
gb|AFR93501.1|  20S proteasome subunit alpha 1                          210   2e-64    
ref|XP_003191167.1|  20S proteasome subunit alpha 1                     210   2e-64    
gb|KIR85438.1|  20S proteasome subunit alpha 1                          210   2e-64    
ref|XP_001841217.1|  proteasome subunit iota                            210   3e-64    
gb|KHJ35771.1|  putative proteasome subunit alpha type 6                210   3e-64    
gb|KGB79631.1|  20S proteasome subunit                                  210   3e-64    
ref|XP_008085140.1|  N-terminal nucleophile aminohydrolases (Ntn ...    209   4e-64    
ref|XP_006128209.1|  PREDICTED: proteasome subunit alpha type-6-like    210   4e-64    
ref|XP_006665767.1|  proteasome subunit alpha type 6                    209   4e-64    
emb|CDK28281.1|  unnamed protein product                                209   5e-64    
ref|XP_007003851.1|  hypothetical protein TREMEDRAFT_29712              209   5e-64    
emb|CAK44248.1|  unnamed protein product                                209   5e-64    
ref|XP_011120711.1|  hypothetical protein AOL_s00075g98                 209   6e-64    
ref|XP_002470366.1|  predicted protein                                  207   7e-64    
ref|XP_006658809.1|  PREDICTED: proteasome subunit alpha type-6-like    209   7e-64    
gb|EMD31810.1|  20S proteasome subunit                                  209   7e-64    
gb|ACQ58422.1|  Proteasome subunit alpha type-6                         208   9e-64    
gb|ABM55423.1|  proteasome subunit alpha type 6-like protein            208   9e-64    
gb|KEZ38816.1|  hypothetical protein SAPIO_CDS10856                     208   9e-64    
emb|CDO78061.1|  hypothetical protein BN946_scf184826.g6                209   1e-63    
gb|EWM25954.1|  proteasome subunit alpha type-6                         208   1e-63    
ref|XP_007861673.1|  hypothetical protein GLOTRDRAFT_33056              209   1e-63    
ref|XP_004535732.1|  PREDICTED: proteasome subunit alpha type-6-l...    208   1e-63    
ref|XP_002463176.1|  hypothetical protein SORBIDRAFT_02g039140          207   1e-63    
ref|XP_001399838.2|  proteasome subunit alpha type-6                    208   1e-63    
gb|KIR59797.1|  20S proteasome subunit alpha 1                          208   1e-63    
gb|KIM84053.1|  hypothetical protein PILCRDRAFT_6893                    208   2e-63    
gb|AEE63435.1|  unknown                                                 207   2e-63    
ref|XP_007767850.1|  20S proteasome subunit                             208   2e-63    
gb|EEE67584.1|  hypothetical protein OsJ_25116                          207   2e-63    
ref|XP_003869616.1|  Scl1 proteasome subunit YC7alpha                   207   2e-63    
ref|XP_007234010.1|  PREDICTED: proteasome subunit alpha type-6-like    207   2e-63    
ref|XP_007305514.1|  proteasome subunit iota                            208   2e-63    
ref|XP_009526410.1|  hypothetical protein PHYSODRAFT_285915             207   2e-63    
gb|KIM60812.1|  hypothetical protein SCLCIDRAFT_1216527                 207   2e-63    
dbj|GAA88851.1|  proteasome subunit alpha type 6                        207   3e-63    
gb|ETI45522.1|  hypothetical protein F443_09944                         207   3e-63    



>ref|XP_009797939.1| PREDICTED: proteasome subunit alpha type-6 [Nicotiana sylvestris]
 sp|Q9XG77.1|PSA6_TOBAC RecName: Full=Proteasome subunit alpha type-6; AltName: Full=20S 
proteasome alpha subunit A; AltName: Full=20S proteasome 
subunit alpha-1 [Nicotiana tabacum]
 emb|CAB39975.1| PRCI [Nicotiana tabacum]
Length=246

 Score =   336 bits (861),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 156/162 (96%), Positives = 162/162 (100%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LDQTSV+HLFP+TKYLGLLATG+TADARTLVQQARNEAAEFRF+YGYEMPVDVL++WIAD
Sbjct  61   LDQTSVSHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRFKYGYEMPVDVLSKWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG
Sbjct  121  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  162



>ref|XP_009631638.1| PREDICTED: proteasome subunit alpha type-6 [Nicotiana tomentosiformis]
Length=246

 Score =   335 bits (860),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 156/162 (96%), Positives = 162/162 (100%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LDQTSV+HLFP+TKYLGLLATG+TADARTLVQQARNEAAEFRF+YGYEMPVDVL++WIAD
Sbjct  61   LDQTSVSHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRFKYGYEMPVDVLSKWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG
Sbjct  121  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  162



>gb|EYU19318.1| hypothetical protein MIMGU_mgv1a012555mg [Erythranthe guttata]
Length=246

 Score =   335 bits (858),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 157/162 (97%), Positives = 160/162 (99%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSGGGYDRHITIFSPEGRL+QVEYAFKAVKAAGITSIGVRG DSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLYQVEYAFKAVKAAGITSIGVRGADSVCVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LDQTSVTHLFP+TKYLGLLATG+TADARTLVQQARNEAAEFRFRYGYEMP DVLARWIAD
Sbjct  61   LDQTSVTHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRFRYGYEMPADVLARWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG
Sbjct  121  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  162



>ref|XP_011098408.1| PREDICTED: proteasome subunit alpha type-6 [Sesamum indicum]
Length=246

 Score =   334 bits (857),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 156/162 (96%), Positives = 160/162 (99%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSGGGYDRHITIFSPEGRL+QVEYAFKAVKAAGITSIGVRG DSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLYQVEYAFKAVKAAGITSIGVRGADSVCVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LDQTS+THLFP+TKYLGLLATG+TADARTLVQQARNEAAEFRFRYGYEMPVD LARWIAD
Sbjct  61   LDQTSITHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRFRYGYEMPVDALARWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG
Sbjct  121  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  162



>ref|XP_011099933.1| PREDICTED: proteasome subunit alpha type-6-like [Sesamum indicum]
Length=246

 Score =   334 bits (857),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 156/162 (96%), Positives = 160/162 (99%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSGGGYDRHITIFSPEGRL+QVEYAFKAVKAAGITSIGVRG DSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLYQVEYAFKAVKAAGITSIGVRGADSVCVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LDQTS+THLFP+TKYLGLLATG+TADARTLVQQARNEAAEFRFRYGYEMPVD LARWIAD
Sbjct  61   LDQTSITHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRFRYGYEMPVDALARWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG
Sbjct  121  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  162



>ref|XP_004251692.1| PREDICTED: proteasome subunit alpha type-6 [Solanum lycopersicum]
 ref|XP_006345264.1| PREDICTED: proteasome subunit alpha type-6-like [Solanum tuberosum]
Length=246

 Score =   334 bits (857),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 155/162 (96%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LDQTSV+HLFP+TKYLGLLATG+TADARTLVQQARNEAAEFRF+YGYEMP DVL++WIAD
Sbjct  61   LDQTSVSHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRFKYGYEMPADVLSKWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG
Sbjct  121  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  162



>gb|KHG01950.1| Proteasome subunit alpha type-6 [Gossypium arboreum]
Length=246

 Score =   334 bits (856),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 154/162 (95%), Positives = 162/162 (100%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LDQTSVTHLFP+TK+LGLLATG+TADARTLVQQARNEAAEFRFRYGYEMPVDVL++WIAD
Sbjct  61   LDQTSVTHLFPITKFLGLLATGMTADARTLVQQARNEAAEFRFRYGYEMPVDVLSKWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            KSQVYTQHAYMRPLGVVAM+LGIDEEKGPQL+KCDPAGHF+G
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDEEKGPQLYKCDPAGHFYG  162



>gb|KJB82986.1| hypothetical protein B456_013G223200 [Gossypium raimondii]
Length=246

 Score =   333 bits (855),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 154/162 (95%), Positives = 162/162 (100%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LDQTSVTHLFP+TK+LGLLATG+TADARTLVQQARNEAAEFRFRYGYEMPVDVL++WIAD
Sbjct  61   LDQTSVTHLFPITKFLGLLATGMTADARTLVQQARNEAAEFRFRYGYEMPVDVLSKWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            KSQVYTQHAYMRPLGVVAM+LGIDEEKGPQL+KCDPAGHF+G
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDEEKGPQLYKCDPAGHFYG  162



>gb|KJB65226.1| hypothetical protein B456_010G089600 [Gossypium raimondii]
Length=246

 Score =   333 bits (855),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 154/162 (95%), Positives = 162/162 (100%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LDQTSVTHLFP+TK+LGLLATG+TADARTLVQQARNEAAEFRFRYGYEMPVDVL++WIAD
Sbjct  61   LDQTSVTHLFPITKFLGLLATGMTADARTLVQQARNEAAEFRFRYGYEMPVDVLSKWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            KSQVYTQHAYMRPLGVVAM+LGIDEEKGPQL+KCDPAGHF+G
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDEEKGPQLYKCDPAGHFYG  162



>gb|KJB82987.1| hypothetical protein B456_013G223200 [Gossypium raimondii]
Length=247

 Score =   333 bits (855),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 154/162 (95%), Positives = 162/162 (100%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LDQTSVTHLFP+TK+LGLLATG+TADARTLVQQARNEAAEFRFRYGYEMPVDVL++WIAD
Sbjct  61   LDQTSVTHLFPITKFLGLLATGMTADARTLVQQARNEAAEFRFRYGYEMPVDVLSKWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            KSQVYTQHAYMRPLGVVAM+LGIDEEKGPQL+KCDPAGHF+G
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDEEKGPQLYKCDPAGHFYG  162



>gb|KJB65225.1| hypothetical protein B456_010G089600 [Gossypium raimondii]
Length=247

 Score =   333 bits (855),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 154/162 (95%), Positives = 162/162 (100%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LDQTSVTHLFP+TK+LGLLATG+TADARTLVQQARNEAAEFRFRYGYEMPVDVL++WIAD
Sbjct  61   LDQTSVTHLFPITKFLGLLATGMTADARTLVQQARNEAAEFRFRYGYEMPVDVLSKWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            KSQVYTQHAYMRPLGVVAM+LGIDEEKGPQL+KCDPAGHF+G
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDEEKGPQLYKCDPAGHFYG  162



>ref|XP_007012615.1| 20S proteasome subunit PAA2 isoform 1 [Theobroma cacao]
 gb|EOY30234.1| 20S proteasome subunit PAA2 isoform 1 [Theobroma cacao]
Length=246

 Score =   333 bits (854),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 154/162 (95%), Positives = 162/162 (100%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LDQTSVTHLFP+TK+LGLLATG+TADARTLVQQARNEAAEFRFRYGYE+PVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKFLGLLATGMTADARTLVQQARNEAAEFRFRYGYELPVDVLAKWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            KSQVYTQHAYMRPLGVVAM+LGIDEEKGPQL+KCDPAGHF+G
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDEEKGPQLYKCDPAGHFYG  162



>gb|KHG04433.1| Proteasome subunit alpha type-6 [Gossypium arboreum]
Length=226

 Score =   332 bits (851),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 154/162 (95%), Positives = 162/162 (100%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LDQTSVTHLFP+TK+LGLLATG+TADARTLVQQARNEAAEFRFRYGYEMPVDVL++WIAD
Sbjct  61   LDQTSVTHLFPITKFLGLLATGMTADARTLVQQARNEAAEFRFRYGYEMPVDVLSKWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            KSQVYTQHAYMRPLGVVAM+LGIDEEKGPQL+KCDPAGHF+G
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDEEKGPQLYKCDPAGHFYG  162



>gb|KDP33929.1| hypothetical protein JCGZ_07500 [Jatropha curcas]
Length=246

 Score =   332 bits (851),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 154/162 (95%), Positives = 160/162 (99%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAA ITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAAITSIGVRGKDSVCVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LDQTSVTHLFP+TKYLGLLATG+TADARTLVQQARNEAAEFRFRYGYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRFRYGYEMPVDVLAKWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            KSQVYTQHAYMRPLGVVAM+LGIDEE GPQL+KCDPAGHF+G
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDEENGPQLYKCDPAGHFYG  162



>ref|XP_002271929.1| PREDICTED: proteasome subunit alpha type-6 [Vitis vinifera]
 emb|CAN73517.1| hypothetical protein VITISV_005460 [Vitis vinifera]
 emb|CBI35851.3| unnamed protein product [Vitis vinifera]
Length=246

 Score =   332 bits (851),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 155/162 (96%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKA+GITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKASGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LDQTSVTHLFP+TK+LGLLATG+TADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD
Sbjct  61   LDQTSVTHLFPITKFLGLLATGMTADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            KSQVYTQHAYMRPLGVVAMILGID+E GP+LFKCDPAGHFFG
Sbjct  121  KSQVYTQHAYMRPLGVVAMILGIDDENGPRLFKCDPAGHFFG  162



>ref|XP_010269878.1| PREDICTED: proteasome subunit alpha type-6-like [Nelumbo nucifera]
Length=246

 Score =   332 bits (850),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 154/162 (95%), Positives = 159/162 (98%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKA+GITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKASGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LDQTSVTHLFP+TKYLGLLATG+TADARTLVQQARNEAAEFRFRYGYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRFRYGYEMPVDVLAKWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            KSQ+YTQHAYMRP GV AMILGIDEE GPQLFKCDPAGHFFG
Sbjct  121  KSQIYTQHAYMRPFGVAAMILGIDEENGPQLFKCDPAGHFFG  162



>gb|ACJ11727.1| 20S proteasome subunit alpha-1 [Gossypium hirsutum]
Length=246

 Score =   331 bits (849),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 153/162 (94%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVC VTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCFVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LDQTSVTHLFP+TK+LGLLATG+TADARTLVQQARNEAAEFRFRYGYEMPVDVL++WIAD
Sbjct  61   LDQTSVTHLFPITKFLGLLATGMTADARTLVQQARNEAAEFRFRYGYEMPVDVLSKWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            KSQVYTQHAYMRPLGVVAM+LGIDEEKGPQL+KCDPAGHF+G
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDEEKGPQLYKCDPAGHFYG  162



>gb|KDP45827.1| hypothetical protein JCGZ_17434 [Jatropha curcas]
Length=246

 Score =   331 bits (849),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 154/162 (95%), Positives = 160/162 (99%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAA ITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAAITSIGVRGKDSVCVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LDQTSVT+LFP+TKYLGLLATG+TADARTLVQQARNEAAEFRFRYGYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTNLFPITKYLGLLATGMTADARTLVQQARNEAAEFRFRYGYEMPVDVLAKWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            KSQVYTQHAYMRPLGVVAM+LGIDEE GPQL+KCDPAGHFFG
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDEENGPQLYKCDPAGHFFG  162



>ref|XP_006381605.1| hypothetical protein POPTR_0006s14260g [Populus trichocarpa]
 ref|XP_011039970.1| PREDICTED: proteasome subunit alpha type-6 [Populus euphratica]
 gb|ERP59402.1| hypothetical protein POPTR_0006s14260g [Populus trichocarpa]
Length=246

 Score =   330 bits (847),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 153/162 (94%), Positives = 157/162 (97%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAA  TSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAATTSIGVRGKDSVCVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LDQTSVTHLFP+TKYLGLLATG+TADAR LVQQARNEAAEFRFRYGYEMPVD LARWIAD
Sbjct  61   LDQTSVTHLFPITKYLGLLATGMTADARNLVQQARNEAAEFRFRYGYEMPVDALARWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            KSQVYTQHAYMRPLGVVAM+LGIDEE GPQL+KCDPAGHFFG
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDEENGPQLYKCDPAGHFFG  162



>ref|XP_008228175.1| PREDICTED: proteasome subunit alpha type-6 [Prunus mume]
Length=246

 Score =   330 bits (846),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 153/162 (94%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LDQTSVTHLFP+TK+LGLLATG+TADARTLVQQARNEAAEFRF+YGYEMPVDVLARWIAD
Sbjct  61   LDQTSVTHLFPITKFLGLLATGMTADARTLVQQARNEAAEFRFKYGYEMPVDVLARWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            KSQ+YTQHAYMRPLGVVAM+LGIDEE GPQL+KCDPAGH+FG
Sbjct  121  KSQIYTQHAYMRPLGVVAMVLGIDEEFGPQLYKCDPAGHYFG  162



>ref|XP_007215872.1| hypothetical protein PRUPE_ppa010523mg [Prunus persica]
 gb|EMJ17071.1| hypothetical protein PRUPE_ppa010523mg [Prunus persica]
Length=246

 Score =   330 bits (846),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 153/162 (94%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LDQTSVTHLFP+TK+LGLLATG+TADARTLVQQARNEAAEFRF+YGYEMPVDVLARWIAD
Sbjct  61   LDQTSVTHLFPITKFLGLLATGMTADARTLVQQARNEAAEFRFKYGYEMPVDVLARWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            KSQ+YTQHAYMRPLGVVAM+LGIDEE GPQL+KCDPAGH+FG
Sbjct  121  KSQIYTQHAYMRPLGVVAMVLGIDEEFGPQLYKCDPAGHYFG  162



>ref|XP_009404175.1| PREDICTED: proteasome subunit alpha type-6-like [Musa acuminata 
subsp. malaccensis]
Length=246

 Score =   330 bits (845),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 151/162 (93%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRG+G GYDRHITIFSPEGRL+QVEYAFKAVKA+GITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGTGAGYDRHITIFSPEGRLYQVEYAFKAVKASGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LDQTSVTHLFP+TKYLGLLATGITADAR+LVQQARNEAAEFRF++GYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKYLGLLATGITADARSLVQQARNEAAEFRFKWGYEMPVDVLAKWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            KSQ+YTQHAYMRPLG+VAMILGIDEEKGPQLFKCDPAGHFFG
Sbjct  121  KSQIYTQHAYMRPLGIVAMILGIDEEKGPQLFKCDPAGHFFG  162



>emb|CDP03072.1| unnamed protein product [Coffea canephora]
Length=247

 Score =   329 bits (844),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 153/161 (95%), Positives = 159/161 (99%), Gaps = 0/161 (0%)
 Frame = +1

Query  67   SRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKLL  246
            SRGSGGGYDRHITIFSPEGRL+QVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKLL
Sbjct  3    SRGSGGGYDRHITIFSPEGRLYQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKLL  62

Query  247  DQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIADK  426
            DQTSVTHLFP+TKYLGLLATG+TADARTLVQQARNEAAEFRF++GYEMPVD LA+WIADK
Sbjct  63   DQTSVTHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRFKFGYEMPVDTLAKWIADK  122

Query  427  SQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            SQVYTQHAYMRPLGVVAMILGIDEE GPQLFKCDPAGHFFG
Sbjct  123  SQVYTQHAYMRPLGVVAMILGIDEEAGPQLFKCDPAGHFFG  163



>ref|XP_010541996.1| PREDICTED: proteasome subunit alpha type-6-B [Tarenaya hassleriana]
Length=246

 Score =   328 bits (841),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 151/162 (93%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LDQ+SVTHLFP+TKYLGLLATG+TADAR+LVQQARNEAA+FRFRYGYEMPVD+LA+WIAD
Sbjct  61   LDQSSVTHLFPITKYLGLLATGMTADARSLVQQARNEAADFRFRYGYEMPVDILAKWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            KSQVYTQHAYMRPLGVVAM+LGIDEEKGP L+KCDPAGHF+G
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDEEKGPLLYKCDPAGHFYG  162



>ref|XP_009380029.1| PREDICTED: proteasome subunit alpha type-6 [Musa acuminata subsp. 
malaccensis]
Length=246

 Score =   328 bits (841),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 150/162 (93%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRG+G GYDRHITIFSPEGRL+QVEYAFKAVKA+GITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGTGAGYDRHITIFSPEGRLYQVEYAFKAVKASGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LDQTSVTHLFP+TKYLGLLATG+TADAR+LVQQARNEAAEFRF++GYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKYLGLLATGMTADARSLVQQARNEAAEFRFKWGYEMPVDVLAKWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            KSQ+YTQHAYMRPLGVVAM+LGIDEEKGPQLFKCDPAGHFFG
Sbjct  121  KSQIYTQHAYMRPLGVVAMVLGIDEEKGPQLFKCDPAGHFFG  162



>ref|XP_010274570.1| PREDICTED: proteasome subunit alpha type-6 [Nelumbo nucifera]
Length=246

 Score =   328 bits (840),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 151/162 (93%), Positives = 158/162 (98%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSG GYDRHITIFSPEGRLFQVEYAFKAVKA+GITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGSGYDRHITIFSPEGRLFQVEYAFKAVKASGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LDQTSVTHLF +TKYLGLLATG+TADARTLVQQARNEAAEFRFRYGYEMPVDVL++WIAD
Sbjct  61   LDQTSVTHLFAITKYLGLLATGMTADARTLVQQARNEAAEFRFRYGYEMPVDVLSKWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            KSQ+YTQHAYMRPLGV AM+LGIDEE GPQLFKCDPAGHFFG
Sbjct  121  KSQIYTQHAYMRPLGVAAMVLGIDEENGPQLFKCDPAGHFFG  162



>ref|XP_008802476.1| PREDICTED: proteasome subunit alpha type-6-like [Phoenix dactylifera]
Length=246

 Score =   327 bits (839),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 151/162 (93%), Positives = 160/162 (99%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRG+G GYDRHITIFSPEGRL+QVEYAFKAVKA+GITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGTGAGYDRHITIFSPEGRLYQVEYAFKAVKASGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LDQTSVTHLFP+TKYLGLLATG+TADAR+LV QARNEAAEFRF++GYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKYLGLLATGMTADARSLVHQARNEAAEFRFKWGYEMPVDVLAKWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG
Sbjct  121  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  162



>ref|XP_009344472.1| PREDICTED: proteasome subunit alpha type-6 [Pyrus x bretschneideri]
 ref|XP_009344473.1| PREDICTED: proteasome subunit alpha type-6 [Pyrus x bretschneideri]
Length=246

 Score =   327 bits (839),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 151/162 (93%), Positives = 160/162 (99%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LDQTSVTHLFP+TK+LGLLATG+TADARTLV QARNEAAEFRF+YGYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKFLGLLATGMTADARTLVSQARNEAAEFRFKYGYEMPVDVLAKWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            KSQ+YTQHAYMRPLGVVAM+LGIDEE GPQL+KCDPAGH+FG
Sbjct  121  KSQIYTQHAYMRPLGVVAMVLGIDEELGPQLYKCDPAGHYFG  162



>ref|XP_008391412.1| PREDICTED: proteasome subunit alpha type-6 [Malus domestica]
Length=246

 Score =   327 bits (839),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 151/162 (93%), Positives = 160/162 (99%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LDQTSVTHLFP+TK+LGLLATG+TADARTLV QARNEAAEFRF+YGYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKFLGLLATGMTADARTLVSQARNEAAEFRFKYGYEMPVDVLAKWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            KSQ+YTQHAYMRPLGVVAM+LGIDEE GPQL+KCDPAGH+FG
Sbjct  121  KSQIYTQHAYMRPLGVVAMVLGIDEEVGPQLYKCDPAGHYFG  162



>gb|EPS63192.1| proteasome subunit alpha type-6 [Genlisea aurea]
Length=246

 Score =   327 bits (839),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 152/162 (94%), Positives = 159/162 (98%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSGGGYDRHITIFSPEGRL+QVEYAFKAVKA+GITSIGVRG DSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLYQVEYAFKAVKASGITSIGVRGADSVCVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LDQTSVTHLF VTKYLGLL TGITADARTLVQQARN+AA+FRFRYGYEMPVDVLARWIAD
Sbjct  61   LDQTSVTHLFHVTKYLGLLTTGITADARTLVQQARNKAADFRFRYGYEMPVDVLARWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            KSQVYTQHAYMRPLG++AM+LGIDEEKGPQLFKCDPAGHFFG
Sbjct  121  KSQVYTQHAYMRPLGIIAMVLGIDEEKGPQLFKCDPAGHFFG  162



>gb|ABK96399.1| unknown [Populus trichocarpa x Populus deltoides]
Length=246

 Score =   327 bits (838),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 152/162 (94%), Positives = 156/162 (96%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAA  TSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAATTSIGVRGKDSVCVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LDQTSVTHLFP+TKYLGLLATG+TADAR LVQQARNEAAEFRFRYGYEMPVD LARWIAD
Sbjct  61   LDQTSVTHLFPITKYLGLLATGMTADARNLVQQARNEAAEFRFRYGYEMPVDALARWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            KSQVYTQHAYMRPLGVVAM+LGIDEE GPQL+K DPAGHFFG
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDEENGPQLYKSDPAGHFFG  162



>ref|XP_010557672.1| PREDICTED: proteasome subunit alpha type-6-B-like [Tarenaya hassleriana]
 ref|XP_010557673.1| PREDICTED: proteasome subunit alpha type-6-B-like [Tarenaya hassleriana]
Length=246

 Score =   327 bits (838),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 150/162 (93%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LDQ+SV+HLFP+TKYLGLLATG+TADAR+LVQQARNEAA+FRFRYGYEMPVD+LA+WIAD
Sbjct  61   LDQSSVSHLFPITKYLGLLATGMTADARSLVQQARNEAADFRFRYGYEMPVDILAKWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            KSQVYTQHAYMRPLGVVAM+LGIDEEKGP L+KCDPAGHF+G
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDEEKGPLLYKCDPAGHFYG  162



>ref|XP_006592586.1| PREDICTED: proteasome subunit alpha type-6-like [Glycine max]
 gb|KHN16010.1| Proteasome subunit alpha type-6 [Glycine soja]
Length=246

 Score =   327 bits (838),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 151/162 (93%), Positives = 159/162 (98%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDS+CVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSICVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD TSVTHLFP+TKYLGLLATG+TADARTLVQQARNEAAEFRF YGYEMPVDVLA+WIAD
Sbjct  61   LDNTSVTHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRFTYGYEMPVDVLAKWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            KSQVYTQHAYMRPLGVVAM+LGID+E GPQL+KCDPAGH+FG
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDDEYGPQLYKCDPAGHYFG  162



>gb|ACJ85916.1| unknown [Medicago truncatula]
 gb|AFK46669.1| unknown [Medicago truncatula]
 gb|KEH19590.1| proteasome subunit alpha type-6-A protein [Medicago truncatula]
Length=246

 Score =   327 bits (837),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 150/162 (93%), Positives = 160/162 (99%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVK+AGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKSAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD TSVTHLFP+TKYLGLLATGITADARTLVQQARNEAAE+RFRYGYEMPVDVL++W+AD
Sbjct  61   LDHTSVTHLFPITKYLGLLATGITADARTLVQQARNEAAEYRFRYGYEMPVDVLSKWVAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            KSQVYTQHAYMRPLGVVAM+LGID+E GPQL+KCDPAGH+FG
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDDELGPQLYKCDPAGHYFG  162



>ref|XP_004488480.1| PREDICTED: proteasome subunit alpha type-6-like isoform X1 [Cicer 
arietinum]
 ref|XP_004488481.1| PREDICTED: proteasome subunit alpha type-6-like isoform X2 [Cicer 
arietinum]
 ref|XP_004488482.1| PREDICTED: proteasome subunit alpha type-6-like isoform X3 [Cicer 
arietinum]
Length=246

 Score =   326 bits (836),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 150/162 (93%), Positives = 159/162 (98%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRG DSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGNDSVCVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LDQTSVTHLFP+TKYLGLLATG+TADARTLVQQARNEAAEFR +YGYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRHKYGYEMPVDVLAKWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            KSQVYTQHAYMRPLGVVAM+LGID+E GPQL+KCDPAGH++G
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDDENGPQLYKCDPAGHYYG  162



>ref|XP_007133143.1| hypothetical protein PHAVU_011G155200g [Phaseolus vulgaris]
 gb|ESW05137.1| hypothetical protein PHAVU_011G155200g [Phaseolus vulgaris]
Length=246

 Score =   326 bits (835),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 152/162 (94%), Positives = 159/162 (98%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDS+CVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSICVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LDQTSVTHLFP+TKYLGLLATG+TADARTLVQQARNEAAEFRF  GYEMPVDVLARWIAD
Sbjct  61   LDQTSVTHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRFTNGYEMPVDVLARWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            KSQVYTQHAYMRPLGVVAM+LGID+E GPQL+KCDPAGH+FG
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDDEYGPQLYKCDPAGHYFG  162



>ref|XP_010937324.1| PREDICTED: proteasome subunit alpha type-6 [Elaeis guineensis]
Length=246

 Score =   326 bits (835),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 150/162 (93%), Positives = 159/162 (98%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRG+G GYDRHITIFSPEGRL+QVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGTGAGYDRHITIFSPEGRLYQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LDQTSVTHLFP+TKYLGLLATG+TADAR+LV QARNEAAEFRF++GYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKYLGLLATGMTADARSLVHQARNEAAEFRFKWGYEMPVDVLAKWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            KSQ+YTQHAYMRPLGV AMILGIDEEKGPQLFKCDPAGHFFG
Sbjct  121  KSQIYTQHAYMRPLGVAAMILGIDEEKGPQLFKCDPAGHFFG  162



>ref|XP_008782714.1| PREDICTED: proteasome subunit alpha type-6 [Phoenix dactylifera]
Length=246

 Score =   325 bits (834),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 150/162 (93%), Positives = 159/162 (98%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRG+G GYDRHITIFSPEGRL+QVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGTGAGYDRHITIFSPEGRLYQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LDQTSVTHLFP+TKYLGLLATG+TADAR+LV QARNEAAEFRF++GYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPLTKYLGLLATGMTADARSLVHQARNEAAEFRFKWGYEMPVDVLAKWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            KSQ+YTQHAYMRPLGV AMILGIDEEKGPQLFKCDPAGHFFG
Sbjct  121  KSQIYTQHAYMRPLGVAAMILGIDEEKGPQLFKCDPAGHFFG  162



>ref|XP_003595788.1| Proteasome subunit alpha type [Medicago truncatula]
 gb|AES66039.1| proteasome subunit alpha type-6-A protein [Medicago truncatula]
 gb|AFK48993.1| unknown [Medicago truncatula]
Length=246

 Score =   325 bits (833),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 150/162 (93%), Positives = 159/162 (98%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRG DSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGNDSVCVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LDQTSVTHLFP+TKYLGLLATG+TADARTLVQQARNEAAEFR ++GYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRHKFGYEMPVDVLAKWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            KSQVYTQHAYMRPLGVVAM+LGID+E GPQL+KCDPAGH+FG
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDDENGPQLYKCDPAGHYFG  162



>ref|XP_010064020.1| PREDICTED: proteasome subunit alpha type-6 [Eucalyptus grandis]
 gb|KCW71315.1| hypothetical protein EUGRSUZ_F04398 [Eucalyptus grandis]
Length=246

 Score =   325 bits (833),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 151/162 (93%), Positives = 159/162 (98%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LDQTSVTHLFP+TK+LGLLATG+TADARTLVQQARNEAAEFRFR GYEMPVD LA+WIAD
Sbjct  61   LDQTSVTHLFPITKFLGLLATGMTADARTLVQQARNEAAEFRFRNGYEMPVDALAKWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            KSQ+YTQHAYMRPLGVVAM+LGIDEE GP+L+KCDPAGHFFG
Sbjct  121  KSQIYTQHAYMRPLGVVAMVLGIDEEFGPRLYKCDPAGHFFG  162



>gb|AFK46801.1| unknown [Medicago truncatula]
Length=246

 Score =   325 bits (833),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 150/162 (93%), Positives = 159/162 (98%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRG DSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGNDSVCVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LDQTSVTHLFP+TKYLGLLATG+TADARTLVQQARNEAAEFR ++GYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRHKFGYEMPVDVLAKWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            KSQVYTQHAYMRPLGVVAM+LGID+E GPQL+KCDPAGH+FG
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDDENGPQLYKCDPAGHYFG  162



>ref|XP_002323091.1| Proteasome subunit alpha type 6-1 family protein [Populus trichocarpa]
 gb|ABK93034.1| unknown [Populus trichocarpa]
 gb|EEF04852.1| Proteasome subunit alpha type 6-1 family protein [Populus trichocarpa]
Length=246

 Score =   325 bits (832),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 151/162 (93%), Positives = 155/162 (96%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSG GYDRHITIFSPEGRLFQVEYAFKAVKAA  TSIGVRG DSVCVVTQKKVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLFQVEYAFKAVKAASTTSIGVRGSDSVCVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LDQTSVTHLFP+TK+LGLLATGITADAR LVQQARNEAAEFRFRYGYEMPVD LARWIAD
Sbjct  61   LDQTSVTHLFPITKFLGLLATGITADARNLVQQARNEAAEFRFRYGYEMPVDALARWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            KSQVYTQHAYMRPLGVVAMILGIDEE GPQL+KCDPAGHF+G
Sbjct  121  KSQVYTQHAYMRPLGVVAMILGIDEENGPQLYKCDPAGHFYG  162



>ref|XP_010533014.1| PREDICTED: proteasome subunit alpha type-6-B-like [Tarenaya hassleriana]
Length=246

 Score =   325 bits (832),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 149/162 (92%), Positives = 160/162 (99%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAG+TSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGVTSIGVRGKDSVCVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LDQ+SVTHLF +TKYLGLLATG+TADAR+LVQQARNEAA+FRFRYGYEMPVD+LA+WIAD
Sbjct  61   LDQSSVTHLFQITKYLGLLATGMTADARSLVQQARNEAADFRFRYGYEMPVDILAKWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            KSQVYTQHAYMRPLGVVAM+LGIDEEKGP L+KCDPAGHF+G
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDEEKGPLLYKCDPAGHFYG  162



>gb|KJB82988.1| hypothetical protein B456_013G223200 [Gossypium raimondii]
Length=244

 Score =   324 bits (831),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 152/162 (94%), Positives = 160/162 (99%), Gaps = 2/162 (1%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKK  DKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKK--DKL  58

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LDQTSVTHLFP+TK+LGLLATG+TADARTLVQQARNEAAEFRFRYGYEMPVDVL++WIAD
Sbjct  59   LDQTSVTHLFPITKFLGLLATGMTADARTLVQQARNEAAEFRFRYGYEMPVDVLSKWIAD  118

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            KSQVYTQHAYMRPLGVVAM+LGIDEEKGPQL+KCDPAGHF+G
Sbjct  119  KSQVYTQHAYMRPLGVVAMVLGIDEEKGPQLYKCDPAGHFYG  160



>gb|ACB87915.1| 20S proteasome alpha subunit A1 [Malus domestica]
Length=187

 Score =   322 bits (825),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 150/162 (93%), Positives = 160/162 (99%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LDQTSVTHLFP+TK++GLLATG+TADARTLV QARNEAAEFRF+YGYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKFVGLLATGMTADARTLVSQARNEAAEFRFKYGYEMPVDVLAKWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            KSQ+YTQHAYMRPLGVVAM+LGIDEE GPQL+KCDPAGH+FG
Sbjct  121  KSQIYTQHAYMRPLGVVAMVLGIDEELGPQLYKCDPAGHYFG  162



>ref|XP_006842706.1| hypothetical protein AMTR_s00147p00090390 [Amborella trichopoda]
 gb|ERN04381.1| hypothetical protein AMTR_s00147p00090390 [Amborella trichopoda]
Length=246

 Score =   324 bits (831),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 147/162 (91%), Positives = 160/162 (99%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRG+G GYDRHITIFSPEGRL+QVEYAFKAVKAAGITSIGVRGKDS+CVVTQKKVPDKL
Sbjct  1    MSRGTGAGYDRHITIFSPEGRLYQVEYAFKAVKAAGITSIGVRGKDSICVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LDQTSVTHLFP+TKYLGLLATG+TADAR+LVQQAR+EAAEFRF++GYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKYLGLLATGMTADARSLVQQARHEAAEFRFKWGYEMPVDVLAKWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            KSQ+YTQHAYMRPLG+ AM+LGIDEEKGPQLFKCDPAGHFFG
Sbjct  121  KSQIYTQHAYMRPLGIAAMVLGIDEEKGPQLFKCDPAGHFFG  162



>ref|XP_010441957.1| PREDICTED: proteasome subunit alpha type-6-B-like isoform X1 
[Camelina sativa]
 ref|XP_010441958.1| PREDICTED: proteasome subunit alpha type-6-B-like isoform X2 
[Camelina sativa]
Length=246

 Score =   324 bits (831),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 149/162 (92%), Positives = 159/162 (98%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LDQ+SVTHLFPVTKYLGLLATGITAD+R+LV QARNEAAEFRF+YGYEMP D+LA+WIAD
Sbjct  61   LDQSSVTHLFPVTKYLGLLATGITADSRSLVTQARNEAAEFRFQYGYEMPADILAKWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            KSQVYTQHAYMRPLGVVAM+LGIDEE+GP L+KCDPAGHF+G
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDEERGPLLYKCDPAGHFYG  162



>ref|XP_011001657.1| PREDICTED: proteasome subunit alpha type-6-like [Populus euphratica]
 ref|XP_011015647.1| PREDICTED: proteasome subunit alpha type-6-like [Populus euphratica]
Length=246

 Score =   324 bits (830),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 150/162 (93%), Positives = 155/162 (96%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSG GYDRHITIFSPEGRLFQVEYAFKAVKAA  TSIGVRG DSVCVVTQKKVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLFQVEYAFKAVKAASTTSIGVRGSDSVCVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LDQTSVTHLFP+TK+LGLLATG+TADAR LVQQARNEAAEFRFRYGYEMPVD LARWIAD
Sbjct  61   LDQTSVTHLFPITKFLGLLATGMTADARNLVQQARNEAAEFRFRYGYEMPVDALARWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            KSQVYTQHAYMRPLGVVAMILGIDEE GPQL+KCDPAGHF+G
Sbjct  121  KSQVYTQHAYMRPLGVVAMILGIDEENGPQLYKCDPAGHFYG  162



>ref|XP_006465892.1| PREDICTED: proteasome subunit alpha type-6-like [Citrus sinensis]
 gb|KDO64976.1| hypothetical protein CISIN_1g025897mg [Citrus sinensis]
Length=246

 Score =   324 bits (830),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 151/162 (93%), Positives = 158/162 (98%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAG+TSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGVTSIGVRGKDSVCVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD TSVTHLFP+TKYLGLLATG+TADARTLVQQAR EAAEFRF+YGYEMPVDVLA+WIAD
Sbjct  61   LDHTSVTHLFPITKYLGLLATGMTADARTLVQQARYEAAEFRFKYGYEMPVDVLAKWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            KSQVYTQHAYMRPLGVVAM+L IDEE GP+LFKCDPAGHFFG
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLSIDEECGPRLFKCDPAGHFFG  162



>ref|XP_002308263.1| Proteasome subunit alpha type 6-1 family protein [Populus trichocarpa]
 gb|EEE91786.1| Proteasome subunit alpha type 6-1 family protein [Populus trichocarpa]
Length=246

 Score =   323 bits (828),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 150/162 (93%), Positives = 155/162 (96%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAA  TSIGVRG DSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAASTTSIGVRGSDSVCVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LDQTSVTHLF +TK+LGLLATG+TADAR LVQQARNEAAEFRFRYGYEMPVD LARWIAD
Sbjct  61   LDQTSVTHLFSITKFLGLLATGMTADARNLVQQARNEAAEFRFRYGYEMPVDALARWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            KSQVYTQHAYMRPLGVVAMILGIDEE GPQL+KCDPAGH+FG
Sbjct  121  KSQVYTQHAYMRPLGVVAMILGIDEENGPQLYKCDPAGHYFG  162



>gb|ACJ85912.1| unknown [Medicago truncatula]
Length=246

 Score =   323 bits (828),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 149/162 (92%), Positives = 158/162 (98%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRG DSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGNDSVCVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LDQTSV HLFP+TKYLGLLATG+TADARTLVQQARNEAAEFR ++GYEMPVDVLA+WIAD
Sbjct  61   LDQTSVAHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRHKFGYEMPVDVLAKWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            KSQVYTQHAYMRPLGVVAM+LGID+E GPQL+KCDPAGH+FG
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDDENGPQLYKCDPAGHYFG  162



>gb|ADJ95344.1| PAA1 [Carica papaya]
Length=246

 Score =   323 bits (828),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 149/162 (92%), Positives = 158/162 (98%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSGGGYDRHITIFSPEGRL+QVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLYQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LDQ+SVTHLFP+T  LGLLATG+TADARTLVQQARNEAAEFRFRYGYEMPVD LA+WIAD
Sbjct  61   LDQSSVTHLFPITNLLGLLATGMTADARTLVQQARNEAAEFRFRYGYEMPVDALAKWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            KSQ+YTQHAYMRPLGVVAM+LGIDEE+GPQLFKCDPAG F+G
Sbjct  121  KSQIYTQHAYMRPLGVVAMVLGIDEEEGPQLFKCDPAGFFYG  162



>ref|NP_001238251.1| proteasome subunit alpha type-6 [Glycine max]
 sp|O48551.2|PSA6_SOYBN RecName: Full=Proteasome subunit alpha type-6; AltName: Full=20S 
proteasome alpha subunit A; AltName: Full=20S proteasome 
subunit alpha-1; AltName: Full=Proteasome iota subunit [Glycine 
max]
 gb|AAC28135.1| proteasome IOTA subunit [Glycine max]
Length=246

 Score =   322 bits (826),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 149/162 (92%), Positives = 158/162 (98%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSGGGY+RHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDS+CVVT KKVPDKL
Sbjct  1    MSRGSGGGYNRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSICVVTHKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD TSVTHLFP+TKYLGLLATG+TADARTLVQQARNEAAEFRF YGYEMPVDVLA+WIAD
Sbjct  61   LDNTSVTHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRFTYGYEMPVDVLAKWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            KSQVYTQHAYMRPLGVVAM+LGID+E GPQL+KCDPAGH+FG
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDDEYGPQLYKCDPAGHYFG  162



>gb|AFK47610.1| unknown [Lotus japonicus]
Length=246

 Score =   322 bits (826),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 149/162 (92%), Positives = 158/162 (98%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDS+CVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSICVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LDQTSV+HLFP+TKYLGLLATG+TADARTLVQQARNEAAEFR  YGYEMPVDVLA+WIAD
Sbjct  61   LDQTSVSHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRHTYGYEMPVDVLAKWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            KSQVYTQHAYMRPLGVVAM+LGID+E G QL+KCDPAGH+FG
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDDENGAQLYKCDPAGHYFG  162



>ref|NP_001031340.1| 20S proteasome subunit PAA2 [Arabidopsis thaliana]
 gb|AEC05980.1| 20S proteasome subunit PAA2 [Arabidopsis thaliana]
Length=220

 Score =   321 bits (823),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 147/162 (91%), Positives = 159/162 (98%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSG GYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LDQ+SV+HLFPVTKYLGLLATG+TAD+R+LVQQARNEAAEFRF+YGYEMP D+LA+WIAD
Sbjct  61   LDQSSVSHLFPVTKYLGLLATGMTADSRSLVQQARNEAAEFRFQYGYEMPADILAKWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            KSQVYTQHAYMRPLGVVAM+LGIDEE+GP L+KCDPAGHF+G
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDEERGPLLYKCDPAGHFYG  162



>ref|XP_008462289.1| PREDICTED: proteasome subunit alpha type-6 [Cucumis melo]
Length=246

 Score =   322 bits (826),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 149/162 (92%), Positives = 159/162 (98%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVK+AG TSIGV+GKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKSAGTTSIGVKGKDSVCVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LDQTSVTHLF +TKYLGLLATGITADAR+LVQQARNEAA+FRFRYGYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFSITKYLGLLATGITADARSLVQQARNEAADFRFRYGYEMPVDVLAKWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            KSQVYTQHAYMRPLGVVAM+LGID+E GP+L+KCDPAGHFFG
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDDEYGPRLYKCDPAGHFFG  162



>ref|XP_011018964.1| PREDICTED: proteasome subunit alpha type-6-like [Populus euphratica]
Length=246

 Score =   322 bits (825),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 149/162 (92%), Positives = 155/162 (96%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAA  TSIGVRG DSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAASTTSIGVRGSDSVCVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LDQTSV+HLF +TK+LGLLATG+TADAR LVQQARNEAAEFRFRYGYEMPVD LARWIAD
Sbjct  61   LDQTSVSHLFSITKFLGLLATGMTADARNLVQQARNEAAEFRFRYGYEMPVDALARWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            KSQVYTQHAYMRPLGVVAMILGIDEE GPQL+KCDPAGH+FG
Sbjct  121  KSQVYTQHAYMRPLGVVAMILGIDEENGPQLYKCDPAGHYFG  162



>gb|KDO64978.1| hypothetical protein CISIN_1g025897mg [Citrus sinensis]
 gb|KDO64979.1| hypothetical protein CISIN_1g025897mg [Citrus sinensis]
 gb|KDO64980.1| hypothetical protein CISIN_1g025897mg [Citrus sinensis]
Length=210

 Score =   320 bits (821),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 151/162 (93%), Positives = 158/162 (98%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAG+TSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGVTSIGVRGKDSVCVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD TSVTHLFP+TKYLGLLATG+TADARTLVQQAR EAAEFRF+YGYEMPVDVLA+WIAD
Sbjct  61   LDHTSVTHLFPITKYLGLLATGMTADARTLVQQARYEAAEFRFKYGYEMPVDVLAKWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            KSQVYTQHAYMRPLGVVAM+L IDEE GP+LFKCDPAGHFFG
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLSIDEECGPRLFKCDPAGHFFG  162



>ref|XP_004141710.1| PREDICTED: proteasome subunit alpha type-6-like [Cucumis sativus]
 ref|XP_004155912.1| PREDICTED: proteasome subunit alpha type-6-like [Cucumis sativus]
 gb|KGN45477.1| hypothetical protein Csa_7G448880 [Cucumis sativus]
Length=246

 Score =   322 bits (824),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 149/162 (92%), Positives = 159/162 (98%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVK+AG TSIGV+G+DSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKSAGTTSIGVKGRDSVCVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LDQTSVTHLF +TKYLGLLATGITADAR+LVQQARNEAAEFRF+YGYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFSITKYLGLLATGITADARSLVQQARNEAAEFRFQYGYEMPVDVLAKWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            KSQVYTQHAYMRPLGVVAM+LGID+E GP+LFKCDPAGHFFG
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDDEYGPRLFKCDPAGHFFG  162



>ref|XP_002532723.1| proteasome subunit alpha type, putative [Ricinus communis]
 gb|EEF29654.1| proteasome subunit alpha type, putative [Ricinus communis]
Length=246

 Score =   322 bits (824),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 148/162 (91%), Positives = 159/162 (98%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKA+G+TSIGV GKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKASGVTSIGVCGKDSVCVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD TSVTHLFP+TKYLGLLATG+TADARTLVQQARNEAAEFRF+YGYEMPVDVLA+WIAD
Sbjct  61   LDHTSVTHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRFKYGYEMPVDVLAKWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            KSQ+YTQHAYMRPLGVVAM+LGID+E GP+L+KCDPAGHFFG
Sbjct  121  KSQIYTQHAYMRPLGVVAMVLGIDDEYGPRLYKCDPAGHFFG  162



>gb|AFK44903.1| unknown [Medicago truncatula]
Length=176

 Score =   319 bits (817),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 149/162 (92%), Positives = 158/162 (98%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRG DSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGNDSVCVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LDQTSVTHLFP+TKYLGLLATG+TADARTLVQQARNEAAEFR ++GYEM VDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRHKFGYEMLVDVLAKWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            KSQVYTQHAYMRPLGVVAM+LGID+E GPQL+KCDPAGH+FG
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDDENGPQLYKCDPAGHYFG  162



>gb|ABK95322.1| unknown [Populus trichocarpa]
Length=246

 Score =   322 bits (824),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 150/162 (93%), Positives = 154/162 (95%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSG GYDRHITIFSPEGRLFQVEYAFKAVKAA  TSIGVRG DSVCVVTQKKVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLFQVEYAFKAVKAASTTSIGVRGSDSVCVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LDQTSVTHLFP+TK+LGLLATGITADAR LVQQARNEAAEFRFRY YEMPVD LARWIAD
Sbjct  61   LDQTSVTHLFPITKFLGLLATGITADARNLVQQARNEAAEFRFRYWYEMPVDALARWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            KSQVYTQHAYMRPLGVVAMILGIDEE GPQL+KCDPAGHF+G
Sbjct  121  KSQVYTQHAYMRPLGVVAMILGIDEENGPQLYKCDPAGHFYG  162



>ref|NP_178641.1| 20S proteasome subunit PAA2 [Arabidopsis thaliana]
 ref|XP_002883713.1| hypothetical protein ARALYDRAFT_899379 [Arabidopsis lyrata subsp. 
lyrata]
 sp|O81147.1|PSA6B_ARATH RecName: Full=Proteasome subunit alpha type-6-B; AltName: Full=20S 
proteasome subunit alpha A-2; AltName: Full=Proteasome 
subunit alpha type-1 [Arabidopsis thaliana]
 gb|AAC32055.1| 20S proteasome subunit PAA2 [Arabidopsis thaliana]
 gb|AAC95161.1| 20S proteasome alpha subunit A2 (PAA2) [Arabidopsis thaliana]
 gb|AAK96583.1| At2g05840/T6P5.4 [Arabidopsis thaliana]
 gb|AAN28768.1| At2g05840/T6P5.4 [Arabidopsis thaliana]
 gb|EFH59972.1| hypothetical protein ARALYDRAFT_899379 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AEC05979.1| 20S proteasome subunit PAA2 [Arabidopsis thaliana]
Length=246

 Score =   322 bits (824),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 147/162 (91%), Positives = 159/162 (98%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSG GYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LDQ+SV+HLFPVTKYLGLLATG+TAD+R+LVQQARNEAAEFRF+YGYEMP D+LA+WIAD
Sbjct  61   LDQSSVSHLFPVTKYLGLLATGMTADSRSLVQQARNEAAEFRFQYGYEMPADILAKWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            KSQVYTQHAYMRPLGVVAM+LGIDEE+GP L+KCDPAGHF+G
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDEERGPLLYKCDPAGHFYG  162



>gb|ACU24622.1| unknown [Glycine max]
Length=246

 Score =   321 bits (823),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 149/162 (92%), Positives = 158/162 (98%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDS+CVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSICVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD TSVTHLFP+TKYLGLLATG+TADARTLVQQARNEAAEFRF YGYE+PVDVLA+WIAD
Sbjct  61   LDNTSVTHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRFTYGYEIPVDVLAKWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            KSQVYTQHAYMRPLGVVAM+LGID+E G QL+KCDPAGH+FG
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDDEYGLQLYKCDPAGHYFG  162



>ref|XP_010494382.1| PREDICTED: proteasome subunit alpha type-6-B [Camelina sativa]
Length=246

 Score =   321 bits (822),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 147/162 (91%), Positives = 158/162 (98%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSG GYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LDQ+SV+HLFPVTKYLGLLATGITAD+R+LV QARNEAAEFRF+YGYEMP D+LA+WIAD
Sbjct  61   LDQSSVSHLFPVTKYLGLLATGITADSRSLVTQARNEAAEFRFQYGYEMPADILAKWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            KSQVYTQHAYMRPLGVVAM+LGIDEE+GP L+KCDPAGHF+G
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDEERGPLLYKCDPAGHFYG  162



>ref|XP_006474716.1| PREDICTED: proteasome subunit alpha type-6-like isoform X1 [Citrus 
sinensis]
 gb|KDO73881.1| hypothetical protein CISIN_1g025892mg [Citrus sinensis]
Length=246

 Score =   321 bits (822),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 148/162 (91%), Positives = 156/162 (96%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSG GYDRHITIFSPEGRLFQVEYAFKAVKA  ITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLFQVEYAFKAVKATAITSIGVRGKDSVCVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LDQT VTHLFP+TKYLGLLATG TADAR+LV QARNEAAE+RF++GYEMPVDVL+RWIAD
Sbjct  61   LDQTCVTHLFPITKYLGLLATGNTADARSLVHQARNEAAEYRFKFGYEMPVDVLSRWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            KSQVYTQHAYMRPLGVVAM+LGIDEEKGPQL+KCDPAGHFFG
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDEEKGPQLYKCDPAGHFFG  162



>ref|XP_009102355.1| PREDICTED: proteasome subunit alpha type-6-B [Brassica rapa]
 emb|CDY33398.1| BnaA07g04410D [Brassica napus]
 emb|CDY18045.1| BnaC07g04250D [Brassica napus]
Length=246

 Score =   320 bits (821),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 146/162 (90%), Positives = 159/162 (98%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LDQ+SV+HLFPVTKYLGLLATG+TAD+R+LV QARNEAAEFRF+YGYEMP D+LA+WIAD
Sbjct  61   LDQSSVSHLFPVTKYLGLLATGMTADSRSLVTQARNEAAEFRFQYGYEMPADILAKWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            KSQVYTQHAYMRPLGVVAM+LG+DEE+GP L+KCDPAGHF+G
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGMDEERGPLLYKCDPAGHFYG  162



>ref|XP_010939895.1| PREDICTED: proteasome subunit alpha type-6-like [Elaeis guineensis]
Length=246

 Score =   320 bits (821),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 147/162 (91%), Positives = 157/162 (97%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRG+G GYDRHITIFSPEGRL+QVEYAFKAVKA GITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGTGAGYDRHITIFSPEGRLYQVEYAFKAVKATGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LDQTSVTHLFP+TKYLGLLATG+TADAR+LV QARNEAAEF F++GYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKYLGLLATGMTADARSLVHQARNEAAEFHFKWGYEMPVDVLAKWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            KSQ+YTQHAYMRPLG+VAMILGIDEEKGPQL KCDPAGHFFG
Sbjct  121  KSQIYTQHAYMRPLGLVAMILGIDEEKGPQLLKCDPAGHFFG  162



>ref|XP_010435443.1| PREDICTED: proteasome subunit alpha type-6-A-like [Camelina sativa]
 ref|XP_010440739.1| PREDICTED: proteasome subunit alpha type-6-A-like [Camelina sativa]
Length=246

 Score =   320 bits (820),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 145/162 (90%), Positives = 157/162 (97%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSG GYDRHITIFSPEGRLFQVEYAFKAVK +GITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLFQVEYAFKAVKTSGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LDQ+SVTHLFP+TKY+GL+ATGITADAR+LVQQARNEAAEFRF YGYEMPVD+LA+WIAD
Sbjct  61   LDQSSVTHLFPITKYIGLVATGITADARSLVQQARNEAAEFRFTYGYEMPVDILAKWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            KSQVYTQHAYMRPLGVVAM+LG+DEE GP L+KCDPAGHF+G
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGVDEENGPLLYKCDPAGHFYG  162



>ref|XP_006396131.1| hypothetical protein EUTSA_v10002649mg [Eutrema salsugineum]
 gb|ESQ36910.1| hypothetical protein EUTSA_v10002649mg [Eutrema salsugineum]
Length=246

 Score =   320 bits (820),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 146/162 (90%), Positives = 158/162 (98%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSG GYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LDQ+SV+HLFPVTKYLGLLATG+TAD+R+LV QARNEAAEFRF+YGYEMP D+LA+WIAD
Sbjct  61   LDQSSVSHLFPVTKYLGLLATGMTADSRSLVTQARNEAAEFRFQYGYEMPADILAKWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            KSQVYTQHAYMRPLGVVAM+LGIDEE+GP L+KCDPAGHF+G
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDEERGPLLYKCDPAGHFYG  162



>ref|XP_004303706.1| PREDICTED: proteasome subunit alpha type-6 [Fragaria vesca subsp. 
vesca]
Length=246

 Score =   320 bits (819),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 146/162 (90%), Positives = 158/162 (98%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVK+AGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKSAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LDQ+SVTHLFP+TK+LGLLATG+TADARTLV QARNEAA+FRF+ GYEMPVDVLA WIA+
Sbjct  61   LDQSSVTHLFPITKFLGLLATGMTADARTLVSQARNEAADFRFKNGYEMPVDVLANWIAN  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            KSQVYTQHAYMRPLGVVAM+LG+DEE GPQL+KCDPAGH+FG
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGVDEETGPQLYKCDPAGHYFG  162



>ref|XP_010450390.1| PREDICTED: proteasome subunit alpha type-6-A [Camelina sativa]
Length=246

 Score =   319 bits (818),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 145/162 (90%), Positives = 157/162 (97%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSG GYDRHITIFSPEGRLFQVEYAFKAVK +GITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLFQVEYAFKAVKTSGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LDQ+SVTHLFP+TKY+GL+ATGITADAR+LVQQARNEAAEFRF YGYEMPVD+LA+WIAD
Sbjct  61   LDQSSVTHLFPITKYVGLVATGITADARSLVQQARNEAAEFRFTYGYEMPVDILAKWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            KSQVYTQHAYMRPLGVVAM+LG+DEE GP L+KCDPAGHF+G
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGVDEENGPLLYKCDPAGHFYG  162



>ref|NP_198409.1| proteasome alpha subunit A1 [Arabidopsis thaliana]
 sp|O81146.2|PSA6A_ARATH RecName: Full=Proteasome subunit alpha type-6-A; AltName: Full=20S 
proteasome subunit alpha A-1; AltName: Full=Proteasome 
component 1; AltName: Full=Proteasome subunit alpha type-1 
[Arabidopsis thaliana]
 dbj|BAB09993.1| multicatalytic endopeptidase complex alpha subunit-like [Arabidopsis 
thaliana]
 dbj|BAF00393.1| multicatalytic endopeptidase complex alpha subunit-like [Arabidopsis 
thaliana]
 gb|AED93984.1| proteasome alpha subunit A1 [Arabidopsis thaliana]
Length=246

 Score =   319 bits (818),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 144/162 (89%), Positives = 157/162 (97%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSG GYDRHITIFSPEGRLFQVEYAFKAVK AGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLFQVEYAFKAVKTAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LDQ+SVTHLFP+TKY+GL+ATGITADAR+LVQQARN+AAEFRF YGYEMPVD+LA+WIAD
Sbjct  61   LDQSSVTHLFPITKYIGLVATGITADARSLVQQARNQAAEFRFTYGYEMPVDILAKWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            KSQVYTQHAYMRPLGVVAM++G+DEE GP L+KCDPAGHF+G
Sbjct  121  KSQVYTQHAYMRPLGVVAMVMGVDEENGPLLYKCDPAGHFYG  162



>ref|XP_006282775.1| hypothetical protein CARUB_v10006215mg [Capsella rubella]
 gb|EOA15673.1| hypothetical protein CARUB_v10006215mg [Capsella rubella]
Length=246

 Score =   319 bits (818),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 144/162 (89%), Positives = 158/162 (98%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVK +GITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKTSGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LDQ+SVTHLFP+TK++GL+ATGITADAR+LVQQARNEAAEFRF YGYEMPVD+LA+WIAD
Sbjct  61   LDQSSVTHLFPITKFIGLVATGITADARSLVQQARNEAAEFRFTYGYEMPVDILAKWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            KSQVYTQHAYMRPLGVVAM++G+DEE GP L+KCDPAGHF+G
Sbjct  121  KSQVYTQHAYMRPLGVVAMVMGVDEENGPLLYKCDPAGHFYG  162



>gb|KFK32243.1| hypothetical protein AALP_AA6G216400 [Arabis alpina]
Length=246

 Score =   319 bits (817),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 145/162 (90%), Positives = 157/162 (97%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVK +GITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKTSGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD +SV+HLFP+TKY+GL+ATGITADAR+LVQQARNEAAEFRF YGYEMPVD+LA+WIAD
Sbjct  61   LDASSVSHLFPITKYIGLVATGITADARSLVQQARNEAAEFRFSYGYEMPVDILAKWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            KSQVYTQHAYMRPLGVVAM+LGIDEE GP L+KCDPAGHF+G
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDEENGPLLYKCDPAGHFYG  162



>gb|AAC32054.1| 20S proteasome subunit PAA1 [Arabidopsis thaliana]
Length=246

 Score =   319 bits (817),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 144/162 (89%), Positives = 157/162 (97%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSG GYDRHITIFSPEGRLFQVEYAFKAVK AGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLFQVEYAFKAVKTAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LDQ+SVTHLFP+TKY+GL+ATGITADAR+LVQQARN+AAEFRF YGYEMPVD+LA+WIAD
Sbjct  61   LDQSSVTHLFPITKYIGLVATGITADARSLVQQARNQAAEFRFTYGYEMPVDILAKWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            KSQVYTQHAYMRPLGVVAM++G+DEE GP L+KCDPAGHF+G
Sbjct  121  KSQVYTQHAYMRPLGVVAMVMGVDEENGPLLYKCDPAGHFYG  162



>gb|ACN66752.1| PAA1 [Carica papaya]
Length=246

 Score =   318 bits (816),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 147/162 (91%), Positives = 156/162 (96%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSGGGYDRHITIFSPEGRL+QVEYAFKAVKAAGITSIGVRGKDSVCVV QKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLYQVEYAFKAVKAAGITSIGVRGKDSVCVVPQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LDQ+SVTHLFP+T  LGLLATG+TADARTLVQQARNEA EFRFRYGYEMPVD LA+WIAD
Sbjct  61   LDQSSVTHLFPITNLLGLLATGMTADARTLVQQARNEATEFRFRYGYEMPVDALAKWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            KSQ+YTQHAYMRPLGVVAM+LGIDEE+GPQLFKCDPAG F+G
Sbjct  121  KSQIYTQHAYMRPLGVVAMVLGIDEEEGPQLFKCDPAGFFYG  162



>ref|XP_010666851.1| PREDICTED: proteasome subunit alpha type-6 [Beta vulgaris subsp. 
vulgaris]
Length=246

 Score =   318 bits (815),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 148/162 (91%), Positives = 156/162 (96%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSG GYDRHITIFSPEGRLFQVEYAFKAVK++GITSI VRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLFQVEYAFKAVKSSGITSIAVRGKDSVCVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LDQTSV+HLF VTKYLGLLATG+TADAR LVQQARNEAAEFR +YGYEMPVDVLARWIAD
Sbjct  61   LDQTSVSHLFQVTKYLGLLATGMTADARNLVQQARNEAAEFRHKYGYEMPVDVLARWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            KSQVYTQHAYMRPLGVVAM+LGIDEE+GP LFKCDPAGHF+G
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDEERGPLLFKCDPAGHFYG  162



>gb|AAM12968.1| multicatalytic endopeptidase complex alpha subunit-like [Arabidopsis 
thaliana]
 gb|AAM47883.1| multicatalytic endopeptidase complex alpha subunit-like [Arabidopsis 
thaliana]
Length=246

 Score =   318 bits (814),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 143/162 (88%), Positives = 157/162 (97%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSG GYDRHITIFSPEGRLFQVEYAFKAVK AGITSIGVRGKDSVCVVTQK+VPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLFQVEYAFKAVKTAGITSIGVRGKDSVCVVTQKEVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LDQ+SVTHLFP+TKY+GL+ATGITADAR+LVQQARN+AAEFRF YGYEMPVD+LA+WIAD
Sbjct  61   LDQSSVTHLFPITKYIGLVATGITADARSLVQQARNQAAEFRFTYGYEMPVDILAKWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            KSQVYTQHAYMRPLGVVAM++G+DEE GP L+KCDPAGHF+G
Sbjct  121  KSQVYTQHAYMRPLGVVAMVMGVDEENGPLLYKCDPAGHFYG  162



>ref|XP_009136197.1| PREDICTED: proteasome subunit alpha type-6-B-like [Brassica rapa]
Length=246

 Score =   318 bits (814),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 144/162 (89%), Positives = 159/162 (98%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKA+GITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKASGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD++SV+HLFPVTKYLGLLATG+TAD+R+LV QARNEAAEFRF+YGYEMP D+LA+WIAD
Sbjct  61   LDESSVSHLFPVTKYLGLLATGMTADSRSLVTQARNEAAEFRFQYGYEMPADILAKWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            KSQVYTQHAYMRPLGVVAM+LG+DEE+GP L+KCDPAGHF+G
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGMDEERGPLLYKCDPAGHFYG  162



>gb|AFK46380.1| unknown [Lotus japonicus]
Length=246

 Score =   317 bits (813),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 147/162 (91%), Positives = 156/162 (96%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGV GKDS+CVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVCGKDSICVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LDQTSV+HLFP+TKYLGLLATG+TADARTL QQARNEAAEFR  YGYEMPVDVLA+WIAD
Sbjct  61   LDQTSVSHLFPITKYLGLLATGMTADARTLAQQARNEAAEFRHTYGYEMPVDVLAKWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            KSQVYTQHAYMRPLGVVAM+LGID+E G QL+KCDPAGH+FG
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDDENGAQLYKCDPAGHYFG  162



>gb|KHN46954.1| Proteasome subunit alpha type-6 [Glycine soja]
Length=560

 Score =   328 bits (840),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 151/162 (93%), Positives = 159/162 (98%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDS+CVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSICVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD TSVTHLFP+TKYLGLLATG+TADARTLVQQARNEAAEFRF YGYEMPVDVLA+WIAD
Sbjct  61   LDNTSVTHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRFTYGYEMPVDVLAKWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            KSQVYTQHAYMRPLGVVAM+LGID+E GPQL+KCDPAGH+FG
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDDEYGPQLYKCDPAGHYFG  162



>emb|CAA74025.1| multicatalytic endopeptidase complex, proteasome component, alpha 
subunit [Arabidopsis thaliana]
Length=245

 Score =   317 bits (811),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 143/161 (89%), Positives = 156/161 (97%), Gaps = 0/161 (0%)
 Frame = +1

Query  67   SRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKLL  246
            SRGSG GYDRHITIFSPEGRLFQVEYAFKAVK AGITSIGVRGKDSVCVVTQKKVPDKLL
Sbjct  1    SRGSGAGYDRHITIFSPEGRLFQVEYAFKAVKTAGITSIGVRGKDSVCVVTQKKVPDKLL  60

Query  247  DQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIADK  426
            DQ+SVTHLFP+TKY+GL+ATGITADAR+LVQQARN+AAEFRF YGYEMPVD+LA+WIADK
Sbjct  61   DQSSVTHLFPITKYIGLVATGITADARSLVQQARNQAAEFRFTYGYEMPVDILAKWIADK  120

Query  427  SQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            SQVYTQHAYMRPLGVVAM++G+DEE GP L+KCDPAGHF+G
Sbjct  121  SQVYTQHAYMRPLGVVAMVMGVDEENGPLLYKCDPAGHFYG  161



>ref|XP_002870436.1| hypothetical protein ARALYDRAFT_493620 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46695.1| hypothetical protein ARALYDRAFT_493620 [Arabidopsis lyrata subsp. 
lyrata]
Length=246

 Score =   317 bits (811),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 144/162 (89%), Positives = 156/162 (96%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSG GYDRHITIFSPEGRLFQVEYAFKAVK AGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLFQVEYAFKAVKTAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LDQ+SVTHLFP+TKY+GL+ATGITADAR+LVQQARN+AAEFRF YGYEMPVD+LA+WIAD
Sbjct  61   LDQSSVTHLFPITKYIGLVATGITADARSLVQQARNQAAEFRFTYGYEMPVDILAKWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            KSQVYTQHAYMRPLGV AM+LG+DEE GP L+KCDPAGHF+G
Sbjct  121  KSQVYTQHAYMRPLGVGAMVLGVDEENGPLLYKCDPAGHFYG  162



>ref|XP_006649499.1| PREDICTED: proteasome subunit alpha type-6-like [Oryza brachyantha]
Length=246

 Score =   315 bits (808),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 144/162 (89%), Positives = 157/162 (97%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRG+G GYDRHITIFSPEGRL+QVEYAFKAVK+AG+TSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGTGAGYDRHITIFSPEGRLYQVEYAFKAVKSAGVTSIGVRGKDSVCVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LDQTSVTHLFP+TKY+GLLATG+TADAR+LV QARNEAAEFRF++GYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKYVGLLATGLTADARSLVYQARNEAAEFRFKWGYEMPVDVLAKWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            K+QVYTQHAYMRPLGVVAM+LG DEEK  QLFKCDPAGHFFG
Sbjct  121  KAQVYTQHAYMRPLGVVAMVLGYDEEKNAQLFKCDPAGHFFG  162



>ref|XP_002516258.1| proteasome subunit alpha type, putative [Ricinus communis]
 gb|EEF46260.1| proteasome subunit alpha type, putative [Ricinus communis]
Length=246

 Score =   315 bits (806),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 154/162 (95%), Positives = 160/162 (99%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAA +TSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAAVTSIGVRGKDSVCVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LDQTSVTHLFP+TKYLGLLATG+TADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD
Sbjct  61   LDQTSVTHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            KSQVYTQHAYMRPLGV+AM+LGIDEE GPQL+KCDPAGHFFG
Sbjct  121  KSQVYTQHAYMRPLGVIAMVLGIDEENGPQLYKCDPAGHFFG  162



>gb|AFW89473.1| hypothetical protein ZEAMMB73_334376 [Zea mays]
Length=214

 Score =   313 bits (803),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 143/162 (88%), Positives = 156/162 (96%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRG+G GYDRHITIFSPEGRL+QVEYAFKAVK+AG+TSIGVRG DSVCVVTQKKVPDKL
Sbjct  1    MSRGTGAGYDRHITIFSPEGRLYQVEYAFKAVKSAGVTSIGVRGADSVCVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LDQTSVTHLFP+TKY+GLLATG+TADAR+LV QARNEAAEFRF++GYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKYVGLLATGLTADARSLVSQARNEAAEFRFKWGYEMPVDVLAKWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            K+QVYTQHAYMRPLGVVAM+LG DEEK  QLFKCDPAGHFFG
Sbjct  121  KAQVYTQHAYMRPLGVVAMVLGYDEEKNAQLFKCDPAGHFFG  162



>ref|NP_001130062.1| uncharacterized protein LOC100191154 [Zea mays]
 gb|ACF78183.1| unknown [Zea mays]
 gb|ACG28463.1| proteasome subunit alpha type 6 [Zea mays]
 gb|ACG40310.1| proteasome subunit alpha type 6 [Zea mays]
 gb|ACL54338.1| unknown [Zea mays]
Length=246

 Score =   314 bits (805),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 143/162 (88%), Positives = 156/162 (96%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRG+G GYDRHITIFSPEGRL+QVEYAFKAVK+AG+TSIGVRG DSVCVVTQKKVPDKL
Sbjct  1    MSRGTGAGYDRHITIFSPEGRLYQVEYAFKAVKSAGVTSIGVRGADSVCVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LDQTSVTHLFP+TKY+GLLATG+TADAR+LV QARNEAAEFRF++GYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKYVGLLATGLTADARSLVSQARNEAAEFRFKWGYEMPVDVLAKWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            K+QVYTQHAYMRPLGVVAM+LG DEEK  QLFKCDPAGHFFG
Sbjct  121  KAQVYTQHAYMRPLGVVAMVLGYDEEKNAQLFKCDPAGHFFG  162



>gb|ACN33969.1| unknown [Zea mays]
 tpg|DAA43695.1| TPA: proteasome subunit alpha type [Zea mays]
Length=246

 Score =   314 bits (804),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 143/162 (88%), Positives = 156/162 (96%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRG+G GYDRHITIFSPEGRL+QVEYAFKAVK+AG+TSIGVRG DSVCVVTQKKVPDKL
Sbjct  1    MSRGTGAGYDRHITIFSPEGRLYQVEYAFKAVKSAGVTSIGVRGADSVCVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LDQTSVTHLFP+TKY+GLLATG+TADAR+LV QARNEAAEFRF++GYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKYVGLLATGLTADARSLVSQARNEAAEFRFKWGYEMPVDVLAKWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            K+QVYTQHAYMRPLGVVAM+LG DEEK  QLFKCDPAGHFFG
Sbjct  121  KAQVYTQHAYMRPLGVVAMVLGYDEEKNAQLFKCDPAGHFFG  162



>ref|NP_001049162.1| Os03g0180400 [Oryza sativa Japonica Group]
 sp|Q9LSU3.1|PSA6_ORYSJ RecName: Full=Proteasome subunit alpha type-6; AltName: Full=20S 
proteasome alpha subunit A; AltName: Full=20S proteasome 
subunit alpha-1 [Oryza sativa Japonica Group]
 dbj|BAA96829.1| alpha 1 subunit of 20S proteasome [Oryza sativa Japonica Group]
 gb|AAN65435.1| Putative alpha 1 subunit of 20S proteasome [Oryza sativa Japonica 
Group]
 gb|AAO13479.1| Putative alpha 1 subunit of 20S proteasome [Oryza sativa Japonica 
Group]
 gb|ABF94305.1| Proteasome subunit alpha type 6, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11076.1| Os03g0180400 [Oryza sativa Japonica Group]
 gb|EAY88785.1| hypothetical protein OsI_10259 [Oryza sativa Indica Group]
 gb|EAZ25813.1| hypothetical protein OsJ_09653 [Oryza sativa Japonica Group]
 dbj|BAG94887.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87220.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87278.1| unnamed protein product [Oryza sativa Japonica Group]
Length=246

 Score =   313 bits (803),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 143/162 (88%), Positives = 156/162 (96%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRG+G GYDRHITIFSPEGRL+QVEYAFKAVK+AG+TSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGTGAGYDRHITIFSPEGRLYQVEYAFKAVKSAGVTSIGVRGKDSVCVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD TSVTHLFP+TKY+GLLATG+TADAR+LV QARNEAAEFRF++GYEMPVDVLA+WIAD
Sbjct  61   LDHTSVTHLFPITKYIGLLATGLTADARSLVYQARNEAAEFRFKWGYEMPVDVLAKWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            K+QVYTQHAYMRPLGVVAM+LG DEEK  QLFKCDPAGHFFG
Sbjct  121  KAQVYTQHAYMRPLGVVAMVLGYDEEKNAQLFKCDPAGHFFG  162



>ref|XP_004985490.1| PREDICTED: proteasome subunit alpha type-6-like [Setaria italica]
Length=246

 Score =   313 bits (801),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 143/162 (88%), Positives = 156/162 (96%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRG+G GYDRHITIFSPEGRL+QVEYAFKAVK+AG+TSIGVRG DSVCVVTQKKVPDKL
Sbjct  1    MSRGTGAGYDRHITIFSPEGRLYQVEYAFKAVKSAGVTSIGVRGADSVCVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LDQTSVTHLFP+TKY+GLLATG+TADAR+LV QARNEAAEFRF++GYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKYIGLLATGLTADARSLVYQARNEAAEFRFKWGYEMPVDVLAKWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            K+QVYTQHAYMRPLGVVAM+LG DEEK  QLFKCDPAGHFFG
Sbjct  121  KAQVYTQHAYMRPLGVVAMVLGYDEEKKAQLFKCDPAGHFFG  162



>ref|XP_002465753.1| hypothetical protein SORBIDRAFT_01g045210 [Sorghum bicolor]
 gb|EER92751.1| hypothetical protein SORBIDRAFT_01g045210 [Sorghum bicolor]
Length=246

 Score =   313 bits (801),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 142/162 (88%), Positives = 156/162 (96%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRG+G GYDRHITIFSPEGRL+QVEYAFKAVK+AG+TSIGVRG DSVCVVTQKKVPDKL
Sbjct  1    MSRGTGAGYDRHITIFSPEGRLYQVEYAFKAVKSAGVTSIGVRGADSVCVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LDQTSVTHLFP+TK++GLLATG+TADAR+LV QARNEAAEFRF++GYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKFVGLLATGLTADARSLVSQARNEAAEFRFKWGYEMPVDVLAKWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            K+QVYTQHAYMRPLGVVAM+LG DEEK  QLFKCDPAGHFFG
Sbjct  121  KAQVYTQHAYMRPLGVVAMVLGYDEEKNAQLFKCDPAGHFFG  162



>gb|ABK22399.1| unknown [Picea sitchensis]
 gb|ABK25916.1| unknown [Picea sitchensis]
Length=246

 Score =   312 bits (800),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 143/162 (88%), Positives = 156/162 (96%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRG+G GYDRHITIFSPEGRL+QVEYAFKAVKAAGITSIGVRGKDS+CVVTQKKVPDKL
Sbjct  1    MSRGTGAGYDRHITIFSPEGRLYQVEYAFKAVKAAGITSIGVRGKDSICVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LDQTSVTHLFP+TK++GLLATG+TADAR+LVQ ARNEAAEFRF++GYEMPVDVLAR +AD
Sbjct  61   LDQTSVTHLFPITKFIGLLATGMTADARSLVQHARNEAAEFRFKWGYEMPVDVLARRLAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            KSQVYTQHAYMRPLGV A++LGIDEE GPQLFKCDPAGHF G
Sbjct  121  KSQVYTQHAYMRPLGVAAIVLGIDEESGPQLFKCDPAGHFVG  162



>ref|NP_001105138.1| maize 20S proteasome alpha subunit [Zea mays]
 emb|CAC19494.1| maize 20S proteasome alpha subunit [Zea mays]
Length=246

 Score =   312 bits (799),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 142/162 (88%), Positives = 155/162 (96%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRG+G GYDRHITIFSPEGRL+QVEYAFKAVK+AG+TSIGVRG DSVCVVTQKKVPDKL
Sbjct  1    MSRGTGAGYDRHITIFSPEGRLYQVEYAFKAVKSAGVTSIGVRGADSVCVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LDQTSVTHLFP+TKY+GLLATG+TAD R+LV QARNEAAEFRF++GYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKYVGLLATGLTADGRSLVSQARNEAAEFRFKWGYEMPVDVLAKWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            K+QVYTQHAYMRPLGVVAM+LG DEEK  QLFKCDPAGHFFG
Sbjct  121  KAQVYTQHAYMRPLGVVAMVLGYDEEKNAQLFKCDPAGHFFG  162



>ref|XP_006474717.1| PREDICTED: proteasome subunit alpha type-6-like isoform X2 [Citrus 
sinensis]
 gb|KDO73882.1| hypothetical protein CISIN_1g025892mg [Citrus sinensis]
Length=244

 Score =   311 bits (798),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 146/162 (90%), Positives = 154/162 (95%), Gaps = 2/162 (1%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSG GYDRHITIFSPEGRLFQVEYAFKAVKA  ITSIGVRGKDSVCVVTQKK  DKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLFQVEYAFKAVKATAITSIGVRGKDSVCVVTQKK--DKL  58

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LDQT VTHLFP+TKYLGLLATG TADAR+LV QARNEAAE+RF++GYEMPVDVL+RWIAD
Sbjct  59   LDQTCVTHLFPITKYLGLLATGNTADARSLVHQARNEAAEYRFKFGYEMPVDVLSRWIAD  118

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            KSQVYTQHAYMRPLGVVAM+LGIDEEKGPQL+KCDPAGHFFG
Sbjct  119  KSQVYTQHAYMRPLGVVAMVLGIDEEKGPQLYKCDPAGHFFG  160



>ref|XP_003558667.1| PREDICTED: proteasome subunit alpha type-6 [Brachypodium distachyon]
Length=246

 Score =   311 bits (798),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 141/162 (87%), Positives = 156/162 (96%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSG GYDRHITIFSPEGRL+QVEYAFKAVK+AG+TSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLYQVEYAFKAVKSAGVTSIGVRGKDSVCVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD+TSVTHLFP+TKY+GLLATG+TADAR+LV QARNEAAE+R ++GYEMPVDVLA+WIAD
Sbjct  61   LDETSVTHLFPITKYIGLLATGLTADARSLVSQARNEAAEYRKKWGYEMPVDVLAKWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            K+Q+YTQHAYMRPLGVVAM+LG DEEK  QLFKCDPAGHFFG
Sbjct  121  KAQIYTQHAYMRPLGVVAMVLGYDEEKNAQLFKCDPAGHFFG  162



>emb|CDY50408.1| BnaC03g45100D [Brassica napus]
Length=244

 Score =   310 bits (795),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 143/162 (88%), Positives = 157/162 (97%), Gaps = 2/162 (1%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD++SV+HLFPVTKYLGLLATG+TAD+R+LV QARNEAAEFRF+YGYEMP D+LA+WIAD
Sbjct  61   LDESSVSHLFPVTKYLGLLATGMTADSRSLVTQARNEAAEFRFQYGYEMPADILAKWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            KSQVYTQHAYMRPL  VAM+LG+DEE+GP L+KCDPAGHF+G
Sbjct  121  KSQVYTQHAYMRPL--VAMVLGMDEERGPLLYKCDPAGHFYG  160



>gb|AGO97077.1| 20S proteasome alpha [Saccharum hybrid cultivar GT28]
Length=246

 Score =   308 bits (788),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 140/162 (86%), Positives = 154/162 (95%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRG+G GYDRHITIFSPEG L+QVEYAFKAVK+AG+TSIGVRG DSVCVVTQKKVPDKL
Sbjct  1    MSRGTGAGYDRHITIFSPEGHLYQVEYAFKAVKSAGVTSIGVRGADSVCVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LDQTSVTHL P+TK++GLLATG+TADAR+LV QARNEAAEFRF++GYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLLPITKFVGLLATGLTADARSLVSQARNEAAEFRFKWGYEMPVDVLAKWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            K+QVYTQHAYMRPLGVVAM+LG DEEK  QLFKCDPAGHFFG
Sbjct  121  KAQVYTQHAYMRPLGVVAMVLGYDEEKNAQLFKCDPAGHFFG  162



>gb|EMT09268.1| Proteasome subunit alpha type-6 [Aegilops tauschii]
Length=246

 Score =   308 bits (788),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 140/162 (86%), Positives = 153/162 (94%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSG GYDRHITIFSPEGRL+QVEYAFKAVK+AG+TSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLYQVEYAFKAVKSAGVTSIGVRGKDSVCVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD TS+THLF +TKY GLLATG+TADAR+LV QARNEAAEFR ++GYEMPVDVLA+WIAD
Sbjct  61   LDDTSITHLFSITKYTGLLATGLTADARSLVSQARNEAAEFRKKWGYEMPVDVLAKWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            K+Q+YTQHAYMRPLGVVAM+LG DEEK  QLFKCDPAGHFFG
Sbjct  121  KAQIYTQHAYMRPLGVVAMVLGYDEEKNAQLFKCDPAGHFFG  162



>dbj|BAJ85935.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=246

 Score =   308 bits (788),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 140/162 (86%), Positives = 153/162 (94%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSG GYDRHITIFSPEGRL+QVEYAFKAVK+AG+TSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLYQVEYAFKAVKSAGVTSIGVRGKDSVCVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD TS+THLF +TKY GLLATG+TADAR+LV QARNEAAEFR ++GYEMPVDVLA+WIAD
Sbjct  61   LDDTSITHLFSITKYTGLLATGLTADARSLVSQARNEAAEFRKKWGYEMPVDVLAKWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            K+Q+YTQHAYMRPLGVVAM+LG DEEK  QLFKCDPAGHFFG
Sbjct  121  KAQIYTQHAYMRPLGVVAMVLGYDEEKNAQLFKCDPAGHFFG  162



>gb|KDO64977.1| hypothetical protein CISIN_1g025897mg [Citrus sinensis]
Length=241

 Score =   307 bits (787),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 146/162 (90%), Positives = 153/162 (94%), Gaps = 5/162 (3%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSGGGYDRHITIFSPEGRLFQV     AVKAAG+TSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQV-----AVKAAGVTSIGVRGKDSVCVVTQKKVPDKL  55

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD TSVTHLFP+TKYLGLLATG+TADARTLVQQAR EAAEFRF+YGYEMPVDVLA+WIAD
Sbjct  56   LDHTSVTHLFPITKYLGLLATGMTADARTLVQQARYEAAEFRFKYGYEMPVDVLAKWIAD  115

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            KSQVYTQHAYMRPLGVVAM+L IDEE GP+LFKCDPAGHFFG
Sbjct  116  KSQVYTQHAYMRPLGVVAMVLSIDEECGPRLFKCDPAGHFFG  157



>emb|CDX93103.1| BnaA03g38250D [Brassica napus]
Length=263

 Score =   306 bits (784),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 145/179 (81%), Positives = 158/179 (88%), Gaps = 17/179 (9%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD++SVTHLFPVTKYLGLLATG+TAD+R+LV QARNEAAEFRF+YGYEMP D+LA+WIAD
Sbjct  61   LDESSVTHLFPVTKYLGLLATGMTADSRSLVTQARNEAAEFRFQYGYEMPADILAKWIAD  120

Query  424  KSQVYTQHAYMRPLGV-----------------VAMILGIDEEKGPQLFKCDPAGHFFG  549
            KSQVYTQHAYMRPLGV                  AM+LG+DEE+GP L+KCDPAGHF+G
Sbjct  121  KSQVYTQHAYMRPLGVGKFCTHFPTYLHIYTSTFAMVLGMDEERGPLLYKCDPAGHFYG  179



>ref|XP_001777426.1| predicted protein [Physcomitrella patens]
 gb|EDQ57713.1| predicted protein [Physcomitrella patens]
Length=246

 Score =   295 bits (755),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 135/162 (83%), Positives = 152/162 (94%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSG GYDRHITIFSPEGRL+QVEYAFKAVKAAGITSIGVRG DSVC VTQKKVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLYQVEYAFKAVKAAGITSIGVRGNDSVCFVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LDQTSVTHLF VTKY+GLLATG+TADA++L+  ARNEAAEF+F+ GYE+PVD LA+ +AD
Sbjct  61   LDQTSVTHLFAVTKYIGLLATGMTADAKSLLAHARNEAAEFKFKLGYEIPVDYLAKRLAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            KSQVYTQHAYMRPLGV AM++GID+E+GPQL+KCDPAGH+FG
Sbjct  121  KSQVYTQHAYMRPLGVSAMLIGIDDEQGPQLYKCDPAGHYFG  162



>ref|XP_001768229.1| predicted protein [Physcomitrella patens]
 gb|EDQ66843.1| predicted protein [Physcomitrella patens]
Length=246

 Score =   294 bits (752),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 135/162 (83%), Positives = 151/162 (93%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSG GYDRHITIFSPEGRL+QVEYAFKAVKAAGITSIGVRGKDSVC VTQKKVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLYQVEYAFKAVKAAGITSIGVRGKDSVCFVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LDQTSVTHLF VTK++GLLATG+TADA++L+  ARNEAA F+F  GYE+PVD LA+ IAD
Sbjct  61   LDQTSVTHLFAVTKFIGLLATGMTADAKSLIAHARNEAANFKFDLGYEIPVDYLAKRIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            KSQVYTQHAYMRPLGV AM++GID+E+GPQL+KCDPAGH+FG
Sbjct  121  KSQVYTQHAYMRPLGVSAMLIGIDDEQGPQLYKCDPAGHYFG  162



>ref|XP_001782615.1| predicted protein [Physcomitrella patens]
 gb|EDQ52604.1| predicted protein [Physcomitrella patens]
Length=246

 Score =   293 bits (749),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 134/162 (83%), Positives = 151/162 (93%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSG GYDRHITIFSPEGRL+QVEYAFKAVKAAGITSIGVRGKDSVC VTQKKVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLYQVEYAFKAVKAAGITSIGVRGKDSVCFVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LDQ SVTHLF +TKY+GLLATG+TADA++LV  ARNEAAEF+F+ GYE+PVD LA+ +AD
Sbjct  61   LDQASVTHLFAITKYIGLLATGMTADAKSLVAHARNEAAEFKFKLGYEIPVDYLAKRLAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            +SQVYTQHAYMRPLGV AM++GID+E GPQL+KCDPAGH+FG
Sbjct  121  ESQVYTQHAYMRPLGVSAMLIGIDDELGPQLYKCDPAGHYFG  162



>gb|ABF94306.1| Proteasome subunit alpha type 6, putative, expressed [Oryza sativa 
Japonica Group]
Length=286

 Score =   294 bits (752),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 143/202 (71%), Positives = 156/202 (77%), Gaps = 40/202 (20%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVP---  234
            MSRG+G GYDRHITIFSPEGRL+QVEYAFKAVK+AG+TSIGVRGKDSVCVVTQKKVP   
Sbjct  1    MSRGTGAGYDRHITIFSPEGRLYQVEYAFKAVKSAGVTSIGVRGKDSVCVVTQKKVPVSS  60

Query  235  -------------------------------------DKLLDQTSVTHLFPVTKYLGLLA  303
                                                 DKLLD TSVTHLFP+TKY+GLLA
Sbjct  61   LRFDLKRSRLYAVYTAIRDQERRLICLAPCDVILILQDKLLDHTSVTHLFPITKYIGLLA  120

Query  304  TGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMI  483
            TG+TADAR+LV QARNEAAEFRF++GYEMPVDVLA+WIADK+QVYTQHAYMRPLGVVAM+
Sbjct  121  TGLTADARSLVYQARNEAAEFRFKWGYEMPVDVLAKWIADKAQVYTQHAYMRPLGVVAMV  180

Query  484  LGIDEEKGPQLFKCDPAGHFFG  549
            LG DEEK  QLFKCDPAGHFFG
Sbjct  181  LGYDEEKNAQLFKCDPAGHFFG  202



>ref|XP_006452821.1| hypothetical protein CICLE_v10010323mg [Citrus clementina]
 gb|ESR66061.1| hypothetical protein CICLE_v10010323mg [Citrus clementina]
Length=235

 Score =   292 bits (747),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 138/162 (85%), Positives = 145/162 (90%), Gaps = 11/162 (7%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSG GYDRHITIFSPEGRLFQVEYAFKAVKA  ITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLFQVEYAFKAVKATAITSIGVRGKDSVCVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LDQT VTHLFP+TKYLGLLATG TADAR+LV QARNEAAE+RF++GYEMPVDVL+RWIAD
Sbjct  61   LDQTCVTHLFPITKYLGLLATGNTADARSLVHQARNEAAEYRFKFGYEMPVDVLSRWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            KSQVYTQHAYMRPLGV           GPQL+KCDPAGHFFG
Sbjct  121  KSQVYTQHAYMRPLGV-----------GPQLYKCDPAGHFFG  151



>ref|XP_002989745.1| hypothetical protein SELMODRAFT_272088 [Selaginella moellendorffii]
 ref|XP_002991751.1| hypothetical protein SELMODRAFT_272230 [Selaginella moellendorffii]
 gb|EFJ07155.1| hypothetical protein SELMODRAFT_272230 [Selaginella moellendorffii]
 gb|EFJ09222.1| hypothetical protein SELMODRAFT_272088 [Selaginella moellendorffii]
Length=246

 Score =   291 bits (744),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 133/162 (82%), Positives = 148/162 (91%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSG GYDRHITIFSPEGRL+QVEYAFKA K+ GITSIGVRG DSVCVVTQKKVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLYQVEYAFKAAKSPGITSIGVRGADSVCVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LDQ+SVTHL+ +T Y+GLLATG+TADAR+LVQ ARNEAAEFR + GYE+PVD L++ +AD
Sbjct  61   LDQSSVTHLYAITPYIGLLATGMTADARSLVQHARNEAAEFRHKNGYEIPVDFLSKRLAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            KSQVYTQHAYMRPLGV AMI+ IDEEKGPQLFKCDPAGH+ G
Sbjct  121  KSQVYTQHAYMRPLGVAAMIIAIDEEKGPQLFKCDPAGHYVG  162



>ref|XP_007012616.1| 20S proteasome subunit PAA2 isoform 2 [Theobroma cacao]
 gb|EOY30235.1| 20S proteasome subunit PAA2 isoform 2 [Theobroma cacao]
Length=181

 Score =   276 bits (706),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 130/137 (95%), Positives = 137/137 (100%), Gaps = 0/137 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LDQTSVTHLFP+TK+LGLLATG+TADARTLVQQARNEAAEFRFRYGYE+PVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKFLGLLATGMTADARTLVQQARNEAAEFRFRYGYELPVDVLAKWIAD  120

Query  424  KSQVYTQHAYMRPLGVV  474
            KSQVYTQHAYMRPLG++
Sbjct  121  KSQVYTQHAYMRPLGLL  137



>ref|XP_001751730.1| predicted protein [Physcomitrella patens]
 gb|EDQ83165.1| predicted protein [Physcomitrella patens]
Length=246

 Score =   277 bits (708),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 128/162 (79%), Positives = 148/162 (91%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRG+G GYDRHITIFSPEGRL+QVEYAFKAVK++GITSIGVRG+DSVCVVTQKKVPDKL
Sbjct  1    MSRGTGAGYDRHITIFSPEGRLYQVEYAFKAVKSSGITSIGVRGRDSVCVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD++SVTHLF VTK +GLLATG+T DA++LV  AR EAAEFRF+ GYE+PVD LA+ +AD
Sbjct  61   LDRSSVTHLFVVTKRIGLLATGMTGDAKSLVAGARAEAAEFRFKMGYEIPVDYLAKRLAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            KSQVYTQHAYMRPLGV AM +G+D+E GP+L+KCDPAGHF G
Sbjct  121  KSQVYTQHAYMRPLGVSAMFIGMDDEHGPRLYKCDPAGHFVG  162



>gb|KDO64981.1| hypothetical protein CISIN_1g025897mg [Citrus sinensis]
Length=149

 Score =   271 bits (694),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 130/143 (91%), Positives = 137/143 (96%), Gaps = 0/143 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAG+TSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGVTSIGVRGKDSVCVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD TSVTHLFP+TKYLGLLATG+TADARTLVQQAR EAAEFRF+YGYEMPVDVLA+WIAD
Sbjct  61   LDHTSVTHLFPITKYLGLLATGMTADARTLVQQARYEAAEFRFKYGYEMPVDVLAKWIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGI  492
            KSQVYTQHAYMRPLGV   ++ I
Sbjct  121  KSQVYTQHAYMRPLGVGLFLIEI  143



>gb|KDO64982.1| hypothetical protein CISIN_1g025897mg [Citrus sinensis]
Length=225

 Score =   273 bits (697),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 126/141 (89%), Positives = 135/141 (96%), Gaps = 0/141 (0%)
 Frame = +1

Query  127  LFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKLLDQTSVTHLFPVTKYLGLLAT  306
            +  +EYAFKAVKAAG+TSIGVRGKDSVCVVTQKKVPDKLLD TSVTHLFP+TKYLGLLAT
Sbjct  1    MILIEYAFKAVKAAGVTSIGVRGKDSVCVVTQKKVPDKLLDHTSVTHLFPITKYLGLLAT  60

Query  307  GITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMIL  486
            G+TADARTLVQQAR EAAEFRF+YGYEMPVDVLA+WIADKSQVYTQHAYMRPLGVVAM+L
Sbjct  61   GMTADARTLVQQARYEAAEFRFKYGYEMPVDVLAKWIADKSQVYTQHAYMRPLGVVAMVL  120

Query  487  GIDEEKGPQLFKCDPAGHFFG  549
             IDEE GP+LFKCDPAGHFFG
Sbjct  121  SIDEECGPRLFKCDPAGHFFG  141



>ref|XP_010111992.1| Proteasome subunit alpha type-6 [Morus notabilis]
 gb|EXC32303.1| Proteasome subunit alpha type-6 [Morus notabilis]
Length=299

 Score =   273 bits (697),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 127/137 (93%), Positives = 136/137 (99%), Gaps = 0/137 (0%)
 Frame = +1

Query  139  EYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKLLDQTSVTHLFPVTKYLGLLATGITA  318
            +YAFKAVKAAGITSIGV+GKDSVCVVTQKKVPDKLLDQTSVTHLFP+TKYLGLLATG+TA
Sbjct  79   KYAFKAVKAAGITSIGVKGKDSVCVVTQKKVPDKLLDQTSVTHLFPITKYLGLLATGMTA  138

Query  319  DARTLVQQARNEAAEFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDE  498
            DARTLVQQARNEAAEFRFRYGYEMPVDVLA+WIADKSQVYTQHAYMRPLGVVAM+LGID+
Sbjct  139  DARTLVQQARNEAAEFRFRYGYEMPVDVLAKWIADKSQVYTQHAYMRPLGVVAMVLGIDD  198

Query  499  EKGPQLFKCDPAGHFFG  549
            E GP+L+KCDPAGHFFG
Sbjct  199  EFGPRLYKCDPAGHFFG  215



>tpg|DAA43694.1| TPA: hypothetical protein ZEAMMB73_913533 [Zea mays]
Length=146

 Score =   264 bits (674),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 122/137 (89%), Positives = 134/137 (98%), Gaps = 0/137 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRG+G GYDRHITIFSPEGRL+QVEYAFKAVK+AG+TSIGVRG DSVCVVTQKKVPDKL
Sbjct  1    MSRGTGAGYDRHITIFSPEGRLYQVEYAFKAVKSAGVTSIGVRGADSVCVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LDQTSVTHLFP+TKY+GLLATG+TADAR+LV QARNEAAEFRF++GYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKYVGLLATGLTADARSLVSQARNEAAEFRFKWGYEMPVDVLAKWIAD  120

Query  424  KSQVYTQHAYMRPLGVV  474
            K+QVYTQHAYMRPLGVV
Sbjct  121  KAQVYTQHAYMRPLGVV  137



>ref|XP_005648429.1| proteasome subunit alpha type-6 [Coccomyxa subellipsoidea C-169]
 gb|EIE23885.1| proteasome subunit alpha type-6 [Coccomyxa subellipsoidea C-169]
Length=247

 Score =   266 bits (680),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 125/162 (77%), Positives = 144/162 (89%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSI VRGKDSV VVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIAVRGKDSVAVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            +D +SVTH+F +TK++G+LATG  ADAR+LVQ++R+ AAEFR  YGYE+PVD LA  +AD
Sbjct  61   IDPSSVTHMFKITKFIGMLATGQRADARSLVQKSRSIAAEFRHTYGYEIPVDYLAARLAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            ++QVYTQHAYMRPL VV ++ GIDEE GPQLFK DPAG++ G
Sbjct  121  QAQVYTQHAYMRPLAVVLILAGIDEEAGPQLFKVDPAGYYVG  162



>ref|XP_001691723.1| 20S proteasome alpha subunit A [Chlamydomonas reinhardtii]
 gb|EDP04831.1| 20S proteasome alpha subunit A [Chlamydomonas reinhardtii]
Length=249

 Score =   261 bits (666),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 120/162 (74%), Positives = 144/162 (89%), Gaps = 1/162 (1%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRG G GYDRHITIFSPEGRLFQVEYAFKAV+ AG+TSIGVRGKDSV  VTQKKV DKL
Sbjct  1    MSRG-GSGYDRHITIFSPEGRLFQVEYAFKAVRTAGVTSIGVRGKDSVVFVTQKKVQDKL  59

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            +D TSVT LF +TK++G+L TG+ AD R +VQQAR +AA+FRF++GYE+PVD LA+ +AD
Sbjct  60   IDPTSVTRLFKITKFIGMLVTGLPADTRAIVQQARQQAADFRFKFGYEVPVDYLAKVLAD  119

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            K+QVYTQHAYMRPLGVV+M++G+DEE+GPQLFK DPAG++ G
Sbjct  120  KAQVYTQHAYMRPLGVVSMLIGVDEERGPQLFKVDPAGYYVG  161



>ref|XP_002949740.1| 20S proteasome alpha subunit A [Volvox carteri f. nagariensis]
 gb|EFJ49292.1| 20S proteasome alpha subunit A [Volvox carteri f. nagariensis]
Length=249

 Score =   259 bits (662),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 120/162 (74%), Positives = 143/162 (88%), Gaps = 1/162 (1%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRG G GYDRHITIFSPEGRLFQVEYAFKAV+ AG+TSI VRGKDSV  VTQKKV DKL
Sbjct  1    MSRG-GSGYDRHITIFSPEGRLFQVEYAFKAVRTAGVTSIAVRGKDSVVFVTQKKVQDKL  59

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            +D TSVT LF +TKY+G+L TG+ AD R +VQQAR +AA+FRF++GYE+PVD LA+ +AD
Sbjct  60   IDPTSVTRLFKITKYVGMLVTGLPADTRAIVQQARQQAADFRFKFGYEVPVDYLAKVLAD  119

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            K+QVYTQHAYMRPLGV++M++GIDEE+GPQLFK DPAG++ G
Sbjct  120  KAQVYTQHAYMRPLGVISMLIGIDEERGPQLFKVDPAGYYVG  161



>gb|KDD75255.1| proteasome subunit protein [Helicosporidium sp. ATCC 50920]
Length=248

 Score =   258 bits (660),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 115/162 (71%), Positives = 142/162 (88%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSG GYDRHITIFSPEGRL+QVEYAFKA K +G+TS+ VRG DSV  V+QKKVPDK+
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLYQVEYAFKAAKTSGLTSVAVRGADSVVFVSQKKVPDKM  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            +D +S+T+++ +T   GLL TG+  DAR+LV +AR+EAAEFRF+YGYEMPVDVLAR +AD
Sbjct  61   VDASSITNIYKITACTGLLVTGMHGDARSLVHKARSEAAEFRFKYGYEMPVDVLARVLAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            ++QV+TQHAYMRPLGV+A I+G+DEE+GPQLFK DPAG+F G
Sbjct  121  QAQVHTQHAYMRPLGVIATIIGVDEERGPQLFKVDPAGYFVG  162



>ref|XP_001418143.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO96436.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=246

 Score =   249 bits (636),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 108/162 (67%), Positives = 139/162 (86%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRG+G GYDRHIT+FSPEGRL+QVEYAFKA+K+ G+T+IGVRGKDSVCVVTQKK+PDKL
Sbjct  1    MSRGAGAGYDRHITVFSPEGRLYQVEYAFKAIKSVGVTTIGVRGKDSVCVVTQKKIPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            +D + VTH++ +TK +G+ ATG   D R +VQ+AR +AA+F+  YGYE+PVDVLA  +AD
Sbjct  61   IDASDVTHMYKITKTVGMCATGKGPDIRDIVQKARRKAADFKQHYGYEVPVDVLANILAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            + QVYTQHAYMRPL V+ +++ +DE++GP LFKCDPAG+F G
Sbjct  121  EFQVYTQHAYMRPLAVMVILIAVDEDRGPSLFKCDPAGYFVG  162



>ref|XP_005717620.1| 20S core proteasome subunit alpha 1 [Chondrus crispus]
 emb|CDF37749.1| 20S core proteasome subunit alpha 1 [Chondrus crispus]
Length=251

 Score =   249 bits (636),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 112/162 (69%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  GYDRHITIFSPEGRLFQVEYAFKAVK  GIT+I VRGKDSVC VTQKKVPDKL
Sbjct  1    MSRGSSAGYDRHITIFSPEGRLFQVEYAFKAVKGPGITAIAVRGKDSVCAVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            +D +SV+  F +++  G +ATGI  DA+ +VQ+ R+EAAEF+F Y YE+PV+ LAR +AD
Sbjct  61   IDPSSVSSAFRLSENHGCIATGIITDAKAMVQRTRSEAAEFKFNYAYEIPVEYLARRVAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            ++Q+YTQHAYMRPLGV   I+G+DEE+GP L+KCDPAGH+ G
Sbjct  121  ENQIYTQHAYMRPLGVSLTIIGMDEEEGPALYKCDPAGHYVG  162



>ref|XP_003059392.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH56524.1| predicted protein [Micromonas pusilla CCMP1545]
Length=249

 Score =   247 bits (631),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 112/162 (69%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSG GYDRHITIFSPEGRL+QVEYAFKA+K+ G+TSIGVRGKDSVCVVTQKK+PDKL
Sbjct  1    MSRGSGSGYDRHITIFSPEGRLYQVEYAFKAIKSVGVTSIGVRGKDSVCVVTQKKIPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            +D   VTH+F +TK +G+ ATG + D R +VQ+AR++AAEFR  +GYE+PVD L+  +AD
Sbjct  61   VDPADVTHMFKITKVIGMCATGKSPDIRNVVQKARHKAAEFRHEFGYEIPVDFLSTRMAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            + QVYTQHAYMRP+  + M +GIDEEKGP LFK DPAG+  G
Sbjct  121  EFQVYTQHAYMRPMAAMCMFVGIDEEKGPCLFKNDPAGYCVG  162



>ref|XP_005843942.1| hypothetical protein CHLNCDRAFT_27583 [Chlorella variabilis]
 gb|EFN51840.1| hypothetical protein CHLNCDRAFT_27583 [Chlorella variabilis]
Length=246

 Score =   246 bits (627),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 113/162 (70%), Positives = 139/162 (86%), Gaps = 1/162 (1%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MS GSGG YDRHITIFSPEGRL+QVEYAFKA K+ G+T+I VRG DSVC VTQ+KVPDKL
Sbjct  1    MSHGSGG-YDRHITIFSPEGRLYQVEYAFKAAKSNGLTAIAVRGTDSVCFVTQRKVPDKL  59

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
             D +SVT +  +TK +G+L TG+  DAR+L+Q+AR+EAAEFRF++GYEMPV  LAR +AD
Sbjct  60   TDPSSVTQIHSITKNIGMLLTGMHGDARSLMQKARSEAAEFRFKFGYEMPVHYLARVLAD  119

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            ++QVYTQHAYMRPLGV+ +++ IDEE+GPQLFK DPAG+F G
Sbjct  120  QAQVYTQHAYMRPLGVIPILIAIDEERGPQLFKVDPAGYFVG  161



>emb|CEF98211.1| Proteasome A-type subunit [Ostreococcus tauri]
Length=246

 Score =   244 bits (624),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 107/162 (66%), Positives = 138/162 (85%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  GYDRHIT+FSP+GRL+QVEYAFKA+K+ G+TSIGVRGKDSVCVVTQKK+PDKL
Sbjct  1    MSRGSTAGYDRHITVFSPDGRLYQVEYAFKAIKSVGMTSIGVRGKDSVCVVTQKKIPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            +D T VTH++ +TK +G+ ATG   D R +VQ+AR +AA+F+  YGY++PVDVLA  +AD
Sbjct  61   IDPTDVTHMYKITKTVGMCATGKGPDIRDIVQKARRKAADFKQNYGYDVPVDVLANILAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            + QVYTQHAYMRPL V+ +++ +DE++GP LFKCDPAG++ G
Sbjct  121  EFQVYTQHAYMRPLAVMVILVSMDEDRGPSLFKCDPAGYYVG  162



>ref|XP_007513369.1| predicted protein [Bathycoccus prasinos]
 emb|CCO16927.1| predicted protein [Bathycoccus prasinos]
Length=247

 Score =   243 bits (621),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 109/162 (67%), Positives = 134/162 (83%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRG+GGGYDRHITIFSPEGRL+QVEYAFKA+KA GI SI V+GKD V  VTQKK PD L
Sbjct  1    MSRGAGGGYDRHITIFSPEGRLYQVEYAFKAIKAVGINSIAVKGKDCVVAVTQKKCPDVL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            +DQ+++TH+F VTK LG+  TG   D R +VQ+AR +AAEFRF YGYE+PVDVLA  +AD
Sbjct  61   IDQSAMTHMFKVTKTLGMCMTGKDPDIRNVVQKARKQAAEFRFEYGYEIPVDVLANKMAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            + QVYTQHAYMRPL  + +++GIDEE+G  L+KCDP+G++ G
Sbjct  121  EFQVYTQHAYMRPLATMCILMGIDEERGASLYKCDPSGYYAG  162



>ref|XP_006932865.1| PREDICTED: proteasome subunit alpha type-6 isoform X2 [Felis 
catus]
Length=203

 Score =   239 bits (610),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 137/162 (85%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG++ G
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCG  162



>ref|XP_004436462.1| PREDICTED: proteasome subunit alpha type-6 isoform 1 [Ceratotherium 
simum simum]
Length=246

 Score =   240 bits (613),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 106/162 (65%), Positives = 137/162 (85%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD ++VTHLF VT+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKVTENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG++ G
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCG  162



>ref|XP_009209663.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Papio 
anubis]
 gb|EFB18466.1| hypothetical protein PANDA_011892 [Ailuropoda melanoleuca]
Length=228

 Score =   239 bits (611),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 137/162 (85%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG++ G
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCG  162



>ref|XP_005656349.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Sus scrofa]
Length=230

 Score =   239 bits (611),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 137/162 (85%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG++ G
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCG  162



>gb|EDL36728.1| proteasome (prosome, macropain) subunit, alpha type 6, isoform 
CRA_b [Mus musculus]
Length=251

 Score =   240 bits (612),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 137/162 (85%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  6    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  65

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  66   LDSSTVTHLFKITESIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  125

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG++ G
Sbjct  126  ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCG  167



>ref|XP_537412.2| PREDICTED: proteasome subunit alpha type-6 isoformX2 [Canis lupus 
familiaris]
 ref|XP_002922862.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Ailuropoda 
melanoleuca]
 ref|XP_004399857.1| PREDICTED: proteasome subunit alpha type-6 [Odobenus rosmarus 
divergens]
 ref|XP_004773396.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Mustela 
putorius furo]
 ref|XP_004820513.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Mustela 
putorius furo]
 ref|XP_005080563.1| PREDICTED: proteasome subunit alpha type-6 [Mesocricetus auratus]
 ref|XP_005343781.1| PREDICTED: proteasome subunit alpha type-6 [Microtus ochrogaster]
 ref|XP_006732281.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Leptonychotes 
weddellii]
 ref|XP_006891612.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Elephantulus 
edwardii]
 ref|XP_003509963.2| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Cricetulus 
griseus]
 ref|XP_007632099.1| PREDICTED: proteasome subunit alpha type-6 isoform X2 [Cricetulus 
griseus]
 ref|XP_008692325.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Ursus 
maritimus]
 gb|ERE72544.1| proteasome subunit alpha type-6-like protein [Cricetulus griseus]
Length=246

 Score =   240 bits (612),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 137/162 (85%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG++ G
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCG  162



>ref|XP_004698589.1| PREDICTED: proteasome subunit alpha type-6 [Echinops telfairi]
 ref|XP_006085896.1| PREDICTED: proteasome subunit alpha type-6 [Myotis lucifugus]
 ref|XP_006759764.1| PREDICTED: proteasome subunit alpha type-6 [Myotis davidii]
 ref|XP_008157203.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Eptesicus 
fuscus]
 gb|ELK33263.1| Proteasome subunit alpha type-6 [Myotis davidii]
Length=246

 Score =   240 bits (612),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 137/162 (85%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG++ G
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCG  162



>gb|ABM86477.1| proteasome (prosome, macropain) subunit, alpha type, 6 [synthetic 
construct]
Length=246

 Score =   239 bits (611),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 137/162 (85%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG++ G
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCG  162



>ref|XP_004649175.1| PREDICTED: proteasome subunit alpha type-6 [Jaculus jaculus]
Length=246

 Score =   239 bits (611),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 137/162 (85%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG++ G
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCG  162



>ref|NP_058979.1| proteasome subunit alpha type-6 [Rattus norvegicus]
 ref|NP_002782.1| proteasome subunit alpha type-6 isoform a [Homo sapiens]
 ref|NP_001039427.1| proteasome subunit alpha type-6 [Bos taurus]
 ref|NP_001180482.1| proteasome subunit alpha type-6 [Macaca mulatta]
 ref|NP_001233586.1| proteasome subunit alpha type-6 [Pan troglodytes]
 ref|NP_001271993.1| uncharacterized protein LOC101866963 [Macaca fascicularis]
 ref|NP_001272627.1| proteasome (prosome, macropain) subunit, alpha type, 6 [Capra 
hircus]
 ref|XP_001491320.1| PREDICTED: proteasome subunit alpha type-6 isoform 1 [Equus caballus]
 ref|XP_002718187.1| PREDICTED: proteasome subunit alpha type-6 isoform X2 [Oryctolagus 
cuniculus]
 ref|XP_003408905.1| PREDICTED: proteasome subunit alpha type-6 [Loxodonta africana]
 ref|XP_003792017.1| PREDICTED: proteasome subunit alpha type-6 [Otolemur garnettii]
 ref|XP_003821244.1| PREDICTED: proteasome subunit alpha type-6 [Pan paniscus]
 ref|XP_003987590.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Felis 
catus]
 ref|XP_004270016.1| PREDICTED: proteasome subunit alpha type-6 isoform 1 [Orcinus 
orca]
 ref|XP_004319607.1| PREDICTED: proteasome subunit alpha type-6 isoform 1 [Tursiops 
truncatus]
 ref|XP_004376568.1| PREDICTED: proteasome subunit alpha type-6 [Trichechus manatus 
latirostris]
 ref|XP_004681993.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Condylura 
cristata]
 ref|XP_004884716.1| PREDICTED: proteasome subunit alpha type-6 [Heterocephalus glaber]
 ref|XP_004867614.1| PREDICTED: proteasome subunit alpha type-6 [Heterocephalus glaber]
 ref|XP_005376980.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Chinchilla 
lanigera]
 ref|XP_005891864.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Bos mutus]
 ref|XP_006186437.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Camelus 
ferus]
 ref|XP_006212818.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Vicugna 
pacos]
 ref|XP_006913536.1| PREDICTED: proteasome subunit alpha type-6 [Pteropus alecto]
 ref|XP_007073792.1| PREDICTED: proteasome subunit alpha type-6 [Panthera tigris altaica]
 ref|XP_007119012.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Physeter 
catodon]
 ref|XP_006043909.1| PREDICTED: proteasome subunit alpha type-6 [Bubalus bubalis]
 ref|XP_007464884.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Lipotes 
vexillifer]
 ref|XP_007936738.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Orycteropus 
afer afer]
 ref|XP_007984674.1| PREDICTED: proteasome subunit alpha type-6 [Chlorocebus sabaeus]
 ref|XP_008069643.1| PREDICTED: proteasome subunit alpha type-6 [Tarsius syrichta]
 ref|XP_008511175.1| PREDICTED: proteasome subunit alpha type-6 [Equus przewalskii]
 ref|XP_008572098.1| PREDICTED: proteasome subunit alpha type-6 [Galeopterus variegatus]
 ref|XP_008831132.1| PREDICTED: proteasome subunit alpha type-6 [Nannospalax galili]
 ref|XP_010631915.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Fukomys 
damarensis]
 ref|XP_010833601.1| PREDICTED: proteasome subunit alpha type-6 [Bison bison bison]
 ref|XP_010966161.1| PREDICTED: proteasome subunit alpha type-6 [Camelus bactrianus]
 ref|XP_010984427.1| PREDICTED: proteasome subunit alpha type-6 [Camelus dromedarius]
 ref|XP_011374978.1| PREDICTED: proteasome subunit alpha type-6 [Pteropus vampyrus]
 sp|P60901.1|PSA6_RAT RecName: Full=Proteasome subunit alpha type-6; AltName: Full=Macropain 
iota chain; AltName: Full=Multicatalytic endopeptidase 
complex iota chain; AltName: Full=Proteasome iota chain 
[Rattus norvegicus]
 sp|P60900.1|PSA6_HUMAN RecName: Full=Proteasome subunit alpha type-6; AltName: Full=27 
kDa prosomal protein; Short=PROS-27; Short=p27K; AltName: 
Full=Macropain iota chain; AltName: Full=Multicatalytic endopeptidase 
complex iota chain; AltName: Full=Proteasome iota 
chain [Homo sapiens]
 sp|Q2YDE4.1|PSA6_BOVIN RecName: Full=Proteasome subunit alpha type-6 [Bos taurus]
 pdb|1IRU|A Chain A, Crystal Structure Of The Mammalian 20s Proteasome At 
2.75 A Resolution
 pdb|1IRU|O Chain O, Crystal Structure Of The Mammalian 20s Proteasome At 
2.75 A Resolution
 emb|CAA42052.1| prosomal P27K protein [Homo sapiens]
 dbj|BAA01587.1| proteasome subunit R-IOTA [Rattus sp.]
 gb|AAH02979.1| Proteasome (prosome, macropain) subunit, alpha type, 6 [Homo 
sapiens]
 gb|AAH17882.1| Proteasome (prosome, macropain) subunit, alpha type, 6 [Homo 
sapiens]
 gb|AAH22354.1| Proteasome (prosome, macropain) subunit, alpha type, 6 [Homo 
sapiens]
 gb|AAH23659.1| Proteasome (prosome, macropain) subunit, alpha type, 6 [Homo 
sapiens]
 gb|AAH62232.1| Proteasome (prosome, macropain) subunit, alpha type 6 [Rattus 
norvegicus]
 gb|AAH70137.1| Proteasome (prosome, macropain) subunit, alpha type, 6 [Homo 
sapiens]
 emb|CAG33225.1| PSMA6 [Homo sapiens]
 dbj|BAE01337.1| unnamed protein product [Macaca fascicularis]
 gb|AAI10261.1| Proteasome (prosome, macropain) subunit, alpha type, 6 [Bos taurus]
 gb|EAW65877.1| proteasome (prosome, macropain) subunit, alpha type, 6, isoform 
CRA_b [Homo sapiens]
 gb|ABM83272.1| proteasome (prosome, macropain) subunit, alpha type, 6 [synthetic 
construct]
 gb|EDM03426.1| proteasome (prosome, macropain) subunit, alpha type 6 [Rattus 
norvegicus]
 dbj|BAG35846.1| unnamed protein product [Homo sapiens]
 gb|ACM47241.1| proteasome subunit alpha type 6 [Capra hircus]
 dbj|BAI46667.1| proteasome (prosome, macropain) subunit, alpha type, 6 [synthetic 
construct]
 tpg|DAA17455.1| TPA: proteasome subunit alpha type-6 [Bos taurus]
 dbj|BAK63685.1| proteasome subunit alpha type 6 [Pan troglodytes]
 gb|EHB02978.1| Proteasome subunit alpha type-6 [Heterocephalus glaber]
 gb|EHH27823.1| hypothetical protein EGK_18113 [Macaca mulatta]
 gb|EHH63557.1| hypothetical protein EGM_16549 [Macaca fascicularis]
 gb|ELK11320.1| Proteasome subunit alpha type-6 [Pteropus alecto]
 gb|ELR59203.1| Proteasome subunit alpha type-6 [Bos mutus]
 gb|AIC63124.1| PSMA6, partial [synthetic construct]
 gb|KFO29294.1| Proteasome subunit alpha type-6 [Fukomys damarensis]
 prf||1912298A prosomal RNA-binding protein p27K
Length=246

 Score =   239 bits (611),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 137/162 (85%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG++ G
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCG  162



>ref|XP_004470220.1| PREDICTED: proteasome subunit alpha type-6 [Dasypus novemcinctus]
Length=246

 Score =   239 bits (611),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 137/162 (85%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG++ G
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCG  162



>ref|XP_006835407.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Chrysochloris 
asiatica]
Length=246

 Score =   239 bits (611),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 137/162 (85%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG++ G
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCG  162



>ref|NP_036098.1| proteasome subunit alpha type-6 [Mus musculus]
 ref|XP_010383847.1| PREDICTED: proteasome subunit alpha type-6 [Rhinopithecus roxellana]
 sp|Q9QUM9.1|PSA6_MOUSE RecName: Full=Proteasome subunit alpha type-6; AltName: Full=Macropain 
iota chain; AltName: Full=Multicatalytic endopeptidase 
complex iota chain; AltName: Full=Proteasome iota chain 
[Mus musculus]
 pdb|3UNB|G Chain G, Mouse Constitutive 20s Proteasome In Complex With Pr-957
 pdb|3UNB|U Chain U, Mouse Constitutive 20s Proteasome In Complex With Pr-957
 pdb|3UNB|II Chain i, Mouse Constitutive 20s Proteasome In Complex With Pr-957
 pdb|3UNB|WW Chain w, Mouse Constitutive 20s Proteasome In Complex With Pr-957
 pdb|3UNE|G Chain G, Mouse Constitutive 20s Proteasome
 pdb|3UNE|U Chain U, Mouse Constitutive 20s Proteasome
 pdb|3UNE|II Chain i, Mouse Constitutive 20s Proteasome
 pdb|3UNE|WW Chain w, Mouse Constitutive 20s Proteasome
 pdb|3UNF|G Chain G, Mouse 20s Immunoproteasome In Complex With Pr-957
 pdb|3UNF|U Chain U, Mouse 20s Immunoproteasome In Complex With Pr-957
 pdb|3UNH|G Chain G, Mouse 20s Immunoproteasome
 pdb|3UNH|U Chain U, Mouse 20s Immunoproteasome
 gb|AAD50532.1|AF060087_1 proteasome subunit iota [Mus musculus]
 gb|AAF21459.1|U60288_1 proteasome subunit iota [Mus musculus]
 dbj|BAC40169.1| unnamed protein product [Mus musculus]
 dbj|BAE31592.1| unnamed protein product [Mus musculus]
 gb|AAH86685.1| Proteasome (prosome, macropain) subunit, alpha type 6 [Mus musculus]
Length=246

 Score =   239 bits (611),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 137/162 (85%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITESIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG++ G
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCG  162



>ref|XP_006172412.1| PREDICTED: LOW QUALITY PROTEIN: proteasome (prosome, macropain) 
subunit, alpha type, 6 [Tupaia chinensis]
Length=246

 Score =   239 bits (611),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 137/162 (85%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG++ G
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCG  162



>ref|XP_007180773.1| PREDICTED: proteasome subunit alpha type-6 [Balaenoptera acutorostrata 
scammoni]
Length=246

 Score =   239 bits (611),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 137/162 (85%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG++ G
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCG  162



>ref|XP_003471921.1| PREDICTED: proteasome subunit alpha type-6 [Cavia porcellus]
Length=246

 Score =   239 bits (611),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 137/162 (85%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG++ G
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCG  162



>gb|ERE72543.1| proteasome subunit alpha type-6-like protein [Cricetulus griseus]
Length=250

 Score =   239 bits (611),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 137/162 (85%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG++ G
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCG  162



>ref|XP_001095366.1| PREDICTED: proteasome subunit alpha type-6-like isoform 1 [Macaca 
mulatta]
 ref|XP_001095483.1| PREDICTED: proteasome subunit alpha type-6-like isoform 2 [Macaca 
mulatta]
Length=246

 Score =   239 bits (610),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 137/162 (85%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G+DRHITIFSPEGRL+Q+EYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQIEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG++ G
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCG  162



>ref|XP_005865030.1| PREDICTED: proteasome subunit alpha type-6 [Myotis brandtii]
 gb|EPQ06979.1| Proteasome subunit alpha type-6 [Myotis brandtii]
Length=246

 Score =   239 bits (610),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG + G
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGSYCG  162



>ref|NP_001088418.1| uncharacterized protein LOC495277 [Xenopus laevis]
 gb|AAH84423.1| LOC495277 protein [Xenopus laevis]
Length=246

 Score =   239 bits (609),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 135/162 (83%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQ+KVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQRKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD  +VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSNTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A MRPLG   +++G+DEE GPQ+FKCDPAG++ G
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGVDEENGPQVFKCDPAGYYCG  162



>ref|NP_001132918.1| proteasome subunit alpha type-6 [Ovis aries]
 gb|ACI46679.1| proteasome subunit alpha type 6 [Ovis aries]
Length=246

 Score =   239 bits (609),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ A MRPLG   +++GIDEE+GPQ++KCDPAG++ G
Sbjct  121  ISQVYTQSAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCG  162



>ref|XP_001363110.1| PREDICTED: proteasome subunit alpha type-6 [Monodelphis domestica]
Length=246

 Score =   239 bits (609),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 137/162 (85%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFRITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A MRPLG   +++G+DEE+GPQ++KCDPAG++ G
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGVDEEQGPQVYKCDPAGYYCG  162



>ref|NP_001264372.1| proteasome subunit alpha type-6 [Gallus gallus]
 ref|XP_003206625.1| PREDICTED: proteasome subunit alpha type-6 [Meleagris gallopavo]
Length=246

 Score =   239 bits (609),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKDS  +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDSAVIVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD  +VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGY++PVD+L + IAD
Sbjct  61   LDSNTVTHLFSITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYDIPVDMLCKRIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A MRPLG   +++GIDEE GPQ++KCDPAG++ G
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGIDEEHGPQVYKCDPAGYYCG  162



>ref|NP_001232198.1| putative proteasome subunit alpha type 6 [Taeniopygia guttata]
 ref|XP_005479894.1| PREDICTED: proteasome subunit alpha type-6 [Zonotrichia albicollis]
 ref|XP_005520349.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Pseudopodoces 
humilis]
 gb|ACH43691.1| putative proteasome subunit alpha type 6 [Taeniopygia guttata]
Length=246

 Score =   238 bits (608),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKDS  +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDSAVIVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD  +VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGY++PVD+L + IAD
Sbjct  61   LDSNTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYDIPVDMLCKRIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A MRPLG   +++GIDEE GPQ++KCDPAG++ G
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGIDEEHGPQVYKCDPAGYYCG  162



>ref|NP_989113.1| proteasome subunit alpha type-6 [Xenopus (Silurana) tropicalis]
 gb|AAH61438.1| proteasome (prosome, macropain) subunit, alpha type 6 [Xenopus 
(Silurana) tropicalis]
 emb|CAJ81265.1| proteasome (prosome macropain) subunit alpha type 6 [Xenopus 
(Silurana) tropicalis]
Length=246

 Score =   238 bits (608),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 135/162 (83%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQ+KVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQRKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD  +VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSNTVTHLFRITESIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A MRPLG   +++G+DEE GPQ+FKCDPAG++ G
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGVDEENGPQVFKCDPAGYYCG  162



>ref|XP_009901279.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Picoides 
pubescens]
 gb|KFV69230.1| Proteasome subunit alpha type-6 [Picoides pubescens]
Length=246

 Score =   238 bits (608),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 106/162 (65%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKDS  VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDSAVVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD  +VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGY++PVD+L + IAD
Sbjct  61   LDSNTVTHLFRITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYDIPVDMLCKRIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A MRPLG   +++GIDEE GPQ++KCDPAG++ G
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGIDEEHGPQVYKCDPAGYYCG  162



>gb|KFW08632.1| Proteasome subunit alpha type-6, partial [Eurypyga helias]
Length=229

 Score =   238 bits (606),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKDS  +VTQKKVPDKL
Sbjct  2    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDSAVIVTQKKVPDKL  61

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD  +VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGY++PVD+L + IAD
Sbjct  62   LDSNTVTHLFRITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYDIPVDMLCKRIAD  121

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A MRPLG   +++GIDEE GPQ++KCDPAG++ G
Sbjct  122  ISQVYTQNAEMRPLGCCMILIGIDEEHGPQVYKCDPAGYYCG  163



>ref|XP_010153544.1| PREDICTED: proteasome subunit alpha type-6 isoform X2 [Eurypyga 
helias]
Length=230

 Score =   238 bits (606),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKDS  +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDSAVIVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD  +VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGY++PVD+L + IAD
Sbjct  61   LDSNTVTHLFRITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYDIPVDMLCKRIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A MRPLG   +++GIDEE GPQ++KCDPAG++ G
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGIDEEHGPQVYKCDPAGYYCG  162



>ref|XP_006793167.1| PREDICTED: proteasome subunit alpha type-6-like [Neolamprologus 
brichardi]
Length=234

 Score =   238 bits (606),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 105/163 (64%), Positives = 136/163 (83%), Gaps = 0/163 (0%)
 Frame = +1

Query  61   KMSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDK  240
            KMSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDK
Sbjct  36   KMSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDK  95

Query  241  LLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIA  420
            LLD ++VTHLF +T  +G + +G+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IA
Sbjct  96   LLDASTVTHLFRITDNIGCVMSGMTADSRSQVQRARYEAANWQYKYGYEIPVDMLCKRIA  155

Query  421  DKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            D SQVYTQ+A MRPLG   +++G+DEE GPQ++KCDPAG++ G
Sbjct  156  DISQVYTQNAEMRPLGCCMIVIGVDEEYGPQVYKCDPAGYYCG  198



>ref|XP_005285405.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Chrysemys 
picta bellii]
Length=246

 Score =   238 bits (607),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFRITETIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A MRPLG   +++GIDEE GPQ++KCDPAG++ G
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGIDEEHGPQVYKCDPAGYYCG  162



>ref|XP_003924255.1| PREDICTED: proteasome subunit alpha type-6 [Saimiri boliviensis 
boliviensis]
Length=283

 Score =   239 bits (610),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 105/163 (64%), Positives = 137/163 (84%), Gaps = 0/163 (0%)
 Frame = +1

Query  61   KMSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDK  240
             MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDK
Sbjct  37   NMSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDK  96

Query  241  LLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIA  420
            LLD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IA
Sbjct  97   LLDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIA  156

Query  421  DKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            D SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG++ G
Sbjct  157  DISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCG  199



>ref|XP_008353690.1| PREDICTED: proteasome subunit alpha type-6 [Malus domestica]
Length=117

 Score =   233 bits (595),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 110/117 (94%), Positives = 116/117 (99%), Gaps = 0/117 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARW  414
            LDQTSVTHLFP+TK++GLLATG+TADARTLV QARNEAAEFRF+YGYEMPVDVLA+W
Sbjct  61   LDQTSVTHLFPITKFVGLLATGMTADARTLVSQARNEAAEFRFKYGYEMPVDVLAKW  117



>ref|XP_010153543.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Eurypyga 
helias]
 ref|XP_010581956.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Haliaeetus 
leucocephalus]
Length=246

 Score =   238 bits (607),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKDS  +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDSAVIVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD  +VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGY++PVD+L + IAD
Sbjct  61   LDSNTVTHLFRITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYDIPVDMLCKRIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A MRPLG   +++GIDEE GPQ++KCDPAG++ G
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGIDEEHGPQVYKCDPAGYYCG  162



>ref|NP_001132944.1| proteasome subunit alpha type-6 [Sus scrofa]
 gb|ACJ06406.1| proteasome subunit alpha type 6 [Sus scrofa]
Length=246

 Score =   238 bits (607),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGVDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG++ G
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCG  162



>ref|XP_007530301.1| PREDICTED: proteasome subunit alpha type-6 [Erinaceus europaeus]
Length=246

 Score =   238 bits (606),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 137/162 (85%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA +++++GYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITESIGCVMTGMTADSRSQVQRARYEAANWKYKFGYEIPVDMLCKRIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG++ G
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCG  162



>ref|XP_007436765.1| PREDICTED: proteasome subunit alpha type-6 [Python bivittatus]
Length=246

 Score =   238 bits (606),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 135/162 (83%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFRITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A MRPLG   +++GIDEE  PQ++KCDPAG++ G
Sbjct  121  ISQVYTQNAEMRPLGCCMIMIGIDEENNPQVYKCDPAGYYCG  162



>ref|XP_006258805.1| PREDICTED: proteasome subunit alpha type-6 [Alligator mississippiensis]
Length=246

 Score =   238 bits (606),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 137/162 (85%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKDS  +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDSAVIVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGY++PVD+L + IAD
Sbjct  61   LDSSTVTHLFRITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYDIPVDMLCKRIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A MRPLG   +++G+DEE GPQ++KCDPAG++ G
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGVDEEHGPQVYKCDPAGYYCG  162



>ref|XP_005149366.1| PREDICTED: proteasome subunit alpha type-6 [Melopsittacus undulatus]
Length=246

 Score =   238 bits (606),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKDS  +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDSAVIVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD  +VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGY++PVD+L + IAD
Sbjct  61   LDSNTVTHLFRITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYDIPVDMLCKRIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A MRPLG   +++GIDEE GPQ++KCDPAG++ G
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGIDEEHGPQVYKCDPAGYYCG  162



>ref|XP_003445487.1| PREDICTED: proteasome subunit alpha type-6-like [Oreochromis 
niloticus]
 ref|XP_005738779.1| PREDICTED: proteasome subunit alpha type-6-like [Pundamilia nyererei]
 ref|XP_005933943.1| PREDICTED: proteasome subunit alpha type-6-like [Haplochromis 
burtoni]
 ref|XP_006799416.1| PREDICTED: proteasome subunit alpha type-6-like [Neolamprologus 
brichardi]
Length=246

 Score =   238 bits (606),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 107/162 (66%), Positives = 133/162 (82%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD  +VTHLF +T+ +G + TG+TAD R+ VQ+AR EAA + ++YGYE+PVD+L + +AD
Sbjct  61   LDAATVTHLFKITENIGCVMTGMTADGRSQVQRARYEAANWMYKYGYEVPVDMLCKRMAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A MRPLG   +++GIDEE GPQLFKCDPAG++ G
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIGIDEELGPQLFKCDPAGYYCG  162



>ref|XP_004559366.1| PREDICTED: proteasome subunit alpha type-6-like [Maylandia zebra]
Length=246

 Score =   238 bits (606),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 107/162 (66%), Positives = 133/162 (82%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD  +VTHLF +T+ +G + TG+TAD R+ VQ+AR EAA + ++YGYE+PVD+L + +AD
Sbjct  61   LDAATVTHLFKITENIGCVMTGMTADGRSQVQRARYEAANWMYKYGYEVPVDMLCKRMAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A MRPLG   +++GIDEE GPQLFKCDPAG++ G
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIGIDEELGPQLFKCDPAGYYCG  162



>pdb|4R3O|A Chain A, Human Constitutive 20s Proteasome
 pdb|4R3O|O Chain O, Human Constitutive 20s Proteasome
 pdb|4R67|A Chain A, Human Constitutive 20s Proteasome In Complex With Carfilzomib
 pdb|4R67|O Chain O, Human Constitutive 20s Proteasome In Complex With Carfilzomib
 pdb|4R67|CC Chain c, Human Constitutive 20s Proteasome In Complex With Carfilzomib
 pdb|4R67|QQ Chain q, Human Constitutive 20s Proteasome In Complex With Carfilzomib
Length=244

 Score =   237 bits (605),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 104/161 (65%), Positives = 136/161 (84%), Gaps = 0/161 (0%)
 Frame = +1

Query  67   SRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKLL  246
            SRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKLL
Sbjct  1    SRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKLL  60

Query  247  DQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIADK  426
            D ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD 
Sbjct  61   DSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIADI  120

Query  427  SQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG++ G
Sbjct  121  SQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCG  161



>ref|XP_005842332.1| 20S proteasome subunit alpha type 6 [Guillardia theta CCMP2712]
 gb|EKX55352.1| 20S proteasome subunit alpha type 6 [Guillardia theta CCMP2712]
Length=252

 Score =   237 bits (605),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 109/167 (65%), Positives = 135/167 (81%), Gaps = 5/167 (3%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVP---  234
            MSR S  GYDR IT+FSPEGRL+Q+EYAFKAVKAAGIT++GVRG DSVC+VTQKKV    
Sbjct  1    MSRNSSSGYDRLITVFSPEGRLYQIEYAFKAVKAAGITTVGVRGADSVCIVTQKKVAQGH  60

Query  235  --DKLLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLA  408
              DKLLD +SVTH++ VT+ +G + TG  ADAR  +Q+ R EAA+FR++YGY+MP +VLA
Sbjct  61   SQDKLLDPSSVTHMYRVTETIGCVQTGHQADARAQIQRVRQEAAQFRYKYGYDMPPEVLA  120

Query  409  RWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            + +AD +QVYTQHA MRP GV  M+ G+D+EKGPQLF CDPAGH+ G
Sbjct  121  KRVADMNQVYTQHAGMRPYGVTMMLCGMDDEKGPQLFMCDPAGHYLG  167



>ref|NP_001086785.1| proteasome alpha 6 subunit [Xenopus laevis]
 gb|AAH77442.1| Psma6-prov protein [Xenopus laevis]
 dbj|BAD42870.1| 20S proteasome alpha1 subunit [Xenopus laevis]
Length=246

 Score =   237 bits (604),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 135/162 (83%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQ+KVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQRKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD  +VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + +AD
Sbjct  61   LDSNTVTHLFRITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRMAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A MRPLG   +++G+DEE GPQ+FKCDPAG++ G
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGVDEEHGPQVFKCDPAGYYCG  162



>gb|KIY96698.1| 20S proteasome subunit alpha 1 [Monoraphidium neglectum]
Length=290

 Score =   238 bits (607),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 116/199 (58%), Positives = 142/199 (71%), Gaps = 37/199 (19%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSG GYDRHITIFSPEGRLFQVEYAFKAV+ +GITSI +RGKD VC VTQKKV DKL
Sbjct  1    MSRGSGSGYDRHITIFSPEGRLFQVEYAFKAVRQSGITSIAIRGKDCVCFVTQKKVQDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            +D  +VT +F +TKY+G+L TG+ AD+R++VQQAR +AAEFRF YGYE+PVD LA+ +AD
Sbjct  61   IDPGTVTRIFKITKYIGMLVTGLPADSRSVVQQARQQAAEFRFTYGYEVPVDYLAKVLAD  120

Query  424  KSQVYT-------------------------------------QHAYMRPLGVVAMILGI  492
            K+QVYT                                     QHAYMRPLGV++M++ +
Sbjct  121  KAQVYTQVGAGMLAGRGPPPADWGCPLTPPAGARWLAPPTALSQHAYMRPLGVISMLVSV  180

Query  493  DEEKGPQLFKCDPAGHFFG  549
            DEE+GP LFK DPAG++ G
Sbjct  181  DEERGPSLFKVDPAGYYVG  199



>ref|XP_008282309.1| PREDICTED: proteasome subunit alpha type-6 [Stegastes partitus]
Length=246

 Score =   236 bits (603),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 135/162 (83%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD ++VTHLF +T  +G + +G+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDASTVTHLFRITDNIGCVMSGMTADSRSQVQRARYEAANWQYKYGYEIPVDMLCKRIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A MRPLG   +++GIDEE GPQ++KCDPAG++ G
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIGIDEEHGPQVYKCDPAGYYCG  162



>dbj|BAE36518.1| unnamed protein product [Mus musculus]
Length=246

 Score =   236 bits (603),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITESIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A MR LG   +++GIDEE+GPQ++KCDPAG++ G
Sbjct  121  ISQVYTQNAEMRTLGCCMILIGIDEEQGPQVYKCDPAGYYCG  162



>emb|CEG74212.1| Putative Proteasome subunit alpha type [Rhizopus microsporus]
 emb|CEJ00907.1| Putative Proteasome subunit alpha type [Rhizopus microsporus]
 emb|CEI93442.1| Putative Proteasome subunit alpha type [Rhizopus microsporus]
Length=246

 Score =   236 bits (603),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 135/162 (83%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSG GYDRHITIFSPEGRL+QVEYAFKA+  +GITS+GVRG+D   +VTQKK+PDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLYQVEYAFKAISNSGITSVGVRGRDGCVIVTQKKIPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD +++TH+F +T  +G + TG+ ADAR+ V +AR EAAEFR++YGYE+P D+LA+ +A+
Sbjct  61   LDPSTITHVFKLTPKIGCVMTGMIADARSQVTRARQEAAEFRYKYGYEIPTDMLAKRVAN  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             +QVYTQ A MRP GV  +++G D+E GPQL+KCDPAG+F G
Sbjct  121  INQVYTQQAAMRPYGVSMILIGYDDELGPQLYKCDPAGYFVG  162



>ref|XP_006985315.1| PREDICTED: proteasome subunit alpha type-6 [Peromyscus maniculatus 
bairdii]
Length=246

 Score =   236 bits (603),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A MRPLG   +++GID E+GPQ++KCDPAG++ G
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGIDGEQGPQVYKCDPAGYYCG  162



>ref|XP_001511492.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Ornithorhynchus 
anatinus]
Length=246

 Score =   236 bits (602),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 103/162 (64%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD ++VTHLF +T+ +G + TG+TAD+++ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFRITENIGCVMTGMTADSKSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A MRPLG   +++G+DEE GPQ++KCDPAG++ G
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGVDEEHGPQVYKCDPAGYYCG  162



>ref|NP_001002589.1| proteasome subunit alpha type-6 [Danio rerio]
 gb|AAH76196.1| Zgc:92716 [Danio rerio]
Length=246

 Score =   236 bits (602),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAIVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD ++VTHLF +T+ +G + +G+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFRITENIGCVMSGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A MRPLG   +++G+DEE GPQ++KCDPAG++ G
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIGLDEELGPQVYKCDPAGYYCG  162



>gb|ESA18832.1| hypothetical protein GLOINDRAFT_344383 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX71315.1| proteasome core particle subunit alpha 1 [Rhizophagus irregularis 
DAOM 197198w]
Length=245

 Score =   236 bits (602),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 137/162 (85%), Gaps = 1/162 (1%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            M+R S G YDRHITIFSPEGRL+QVEYAFKA+  +G+TS+GVRGKDSV +VTQKK+PDKL
Sbjct  1    MNRSSAG-YDRHITIFSPEGRLYQVEYAFKAISNSGVTSVGVRGKDSVVIVTQKKIPDKL  59

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD ++VTH+F ++ Y+G + TG+ ADAR  V +AR EAAEFR+++GY MP D+LA+ +A+
Sbjct  60   LDPSTVTHMFQLSPYVGCVMTGLIADARAQVTRARQEAAEFRYKFGYYMPSDMLAKRVAN  119

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             +QVYTQHA MRPLGV  +++G D+E+GPQLFKCDPAG++ G
Sbjct  120  INQVYTQHAAMRPLGVSMILIGYDDERGPQLFKCDPAGYYVG  161



>ref|XP_005703510.1| 20S proteasome subunit alpha 1 [Galdieria sulphuraria]
 gb|EME26990.1| 20S proteasome subunit alpha 1 [Galdieria sulphuraria]
Length=247

 Score =   236 bits (602),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 137/162 (85%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  GYDRHITIFSPEGRL+QVEYAFKAVK+ GIT++ V+G DSVC VTQKKVPDKL
Sbjct  1    MSRGSSAGYDRHITIFSPEGRLYQVEYAFKAVKSVGITTVAVKGVDSVCGVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            +D  SVT++F V+ + G + TG+  DAR  +Q+ R+EAA+F+F++GYE+PVD +A+ +AD
Sbjct  61   IDPKSVTNVFRVSDHHGCIFTGLATDARAQLQRTRSEAADFKFKFGYEIPVDQIAKRLAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             +QVYTQHAYMRPLGV  + +G+D+E+GPQL+KCDPAG++ G
Sbjct  121  INQVYTQHAYMRPLGVSLIFIGMDDERGPQLYKCDPAGYYIG  162



>emb|CAG00121.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=246

 Score =   236 bits (602),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 135/162 (83%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD ++VTHLF +T  +G + +G+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDASTVTHLFRITDNIGCVMSGMTADSRSQVQRARYEAANWQYKYGYEIPVDMLCKRIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A MRPLG   +++GIDEE GPQ++KCDPAG++ G
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIGIDEEYGPQVYKCDPAGYYCG  162



>ref|XP_003440740.1| PREDICTED: proteasome subunit alpha type-6-like [Oreochromis 
niloticus]
Length=246

 Score =   236 bits (602),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 135/162 (83%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD ++VTHLF +T  +G + +G+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDASTVTHLFRITDNIGCVMSGMTADSRSQVQRARYEAANWQYKYGYEIPVDMLCKRIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A MRPLG   +++GIDEE GPQ++KCDPAG++ G
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIGIDEEYGPQVYKCDPAGYYCG  162



>ref|XP_004542308.1| PREDICTED: proteasome subunit alpha type-6-like [Maylandia zebra]
 ref|XP_005724902.1| PREDICTED: proteasome subunit alpha type-6-like [Pundamilia nyererei]
 ref|XP_005917154.1| PREDICTED: proteasome subunit alpha type-6-like [Haplochromis 
burtoni]
Length=246

 Score =   236 bits (601),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 135/162 (83%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD ++VTHLF +T  +G + +G+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDASTVTHLFRITDNIGCVMSGMTADSRSQVQRARYEAANWQYKYGYEIPVDMLCKRIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A MRPLG   +++GIDEE GPQ++KCDPAG++ G
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIGIDEEYGPQVYKCDPAGYYCG  162



>gb|EIE83838.1| hypothetical protein RO3G_08543 [Rhizopus delemar RA 99-880]
Length=246

 Score =   236 bits (601),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 134/162 (83%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSG GYDRHITIFSPEGRL+QVEYAFKA+  +GITS+GVRG+D   +VTQ+KVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLYQVEYAFKAISNSGITSVGVRGRDGCVIVTQRKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD +++TH+F +T  +G   TG+ ADAR+ V +AR EAAEFR++YGYE+P D+LAR +A+
Sbjct  61   LDPSTITHVFKLTPKIGCAMTGMIADARSQVTRARQEAAEFRYKYGYEIPTDMLARRVAN  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             +QVYTQ A MRP GV  +++G D+E GPQL+KCDPAG+F G
Sbjct  121  INQVYTQQAAMRPYGVSMILIGYDDEFGPQLYKCDPAGYFVG  162



>ref|XP_005798367.1| PREDICTED: proteasome subunit alpha type-6-like [Xiphophorus 
maculatus]
Length=246

 Score =   236 bits (601),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 134/162 (83%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+G+RGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGMTSVGIRGKDCAVVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD T+VT LF +T  +G + TG+TAD+R+ VQ+AR EAA + ++YGYE+PVD+L + +AD
Sbjct  61   LDDTTVTQLFRITDNIGCVMTGMTADSRSQVQRARYEAANWNYKYGYEVPVDMLCKRMAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A MRPLG   +++G+DEE GPQL+KCDPAG++ G
Sbjct  121  ISQVYTQNAEMRPLGCCMVVIGMDEELGPQLYKCDPAGYYCG  162



>ref|XP_010741287.1| PREDICTED: proteasome subunit alpha type-6 [Larimichthys crocea]
Length=246

 Score =   236 bits (601),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 134/162 (83%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD V VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCVVVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD  +VTHLF +T  +G + TG+TAD+++ VQ+AR EAA + ++YGYE+PVD+L + +AD
Sbjct  61   LDALTVTHLFRITDNIGCVMTGMTADSKSQVQRARYEAANWMYKYGYEIPVDMLCKRMAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A MRPLG   +++G+DEE GPQL+KCDPAG++ G
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIGLDEELGPQLYKCDPAGYYCG  162



>ref|XP_010876681.1| PREDICTED: proteasome subunit alpha type-6 [Esox lucius]
Length=246

 Score =   236 bits (601),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 103/162 (64%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD ++VTHLF +T+ +G + +G+TAD+++ VQ+AR EAA ++++YGYE+PVD+L + +AD
Sbjct  61   LDASTVTHLFRITENIGCVMSGMTADSKSQVQRARYEAANWKYKYGYEIPVDMLCKRMAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A MRPLG   +++G+DEE GPQ+FKCDPAG++ G
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIGVDEECGPQVFKCDPAGYYCG  162



>ref|NP_001279159.1| proteasome (prosome, macropain) subunit, alpha type, 6 [Callorhinchus 
milii]
 gb|AFM88302.1| proteasome subunit alpha type-6-like protein [Callorhinchus milii]
Length=246

 Score =   236 bits (601),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 135/162 (83%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD  +VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDANTVTHLFRITEKIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A MRPLG   +++G+DEE GPQ++KCDPAG++ G
Sbjct  121  ISQVYTQNAEMRPLGCCMILVGVDEELGPQVYKCDPAGYYCG  162



>ref|XP_005810950.1| PREDICTED: proteasome subunit alpha type-6-like [Xiphophorus 
maculatus]
Length=246

 Score =   235 bits (600),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 135/162 (83%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD ++VTHLF +T  +G + +G+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDASTVTHLFRITDNIGCVMSGMTADSRSQVQRARYEAANWQYKYGYEIPVDMLCKRIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A MRPLG   +++G+DEE GPQ++KCDPAG++ G
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIGVDEEYGPQVYKCDPAGYYCG  162



>ref|XP_008396439.1| PREDICTED: proteasome subunit alpha type-6 [Poecilia reticulata]
Length=246

 Score =   235 bits (600),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 135/162 (83%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD ++VTHLF +T  +G + +G+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDASTVTHLFRITDNIGCVMSGMTADSRSQVQRARYEAANWQYKYGYEIPVDMLCKRIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A MRPLG   +++G+DEE GPQ++KCDPAG++ G
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIGVDEEYGPQVYKCDPAGYYCG  162



>ref|XP_008300217.1| PREDICTED: proteasome subunit alpha type-6 [Stegastes partitus]
Length=246

 Score =   235 bits (600),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 135/162 (83%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD V +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCVVIVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD  +VTHLF +T+ +G + TG+TAD R+ VQ+AR EAA ++++YGY++PVD+L + +AD
Sbjct  61   LDAMTVTHLFRITESIGCVMTGMTADGRSQVQRARYEAANWKYKYGYDIPVDMLCKRMAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A MRPLG   +++G+DEE GPQL+KCDPAG++ G
Sbjct  121  ISQVYTQNAEMRPLGCCMIVVGLDEELGPQLYKCDPAGYYCG  162



>gb|ACI66289.1| Proteasome subunit alpha type-6 [Salmo salar]
 gb|ADM16303.1| Proteasome subunit alpha type-6 [Salmo salar]
Length=246

 Score =   235 bits (600),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 103/162 (64%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD ++VTHLF +T+ +G + +G+TAD+++ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDASTVTHLFRITENIGCVMSGMTADSKSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A MRPLG   +++G+DEE GPQ++KCDPAG++ G
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIGVDEECGPQVYKCDPAGYYCG  162



>emb|CDQ90937.1| unnamed protein product [Oncorhynchus mykiss]
Length=246

 Score =   235 bits (600),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 103/162 (64%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD ++VTHLF +T+ +G + +G+TAD+++ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDASTVTHLFRITENIGCVMSGMTADSKSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A MRPLG   +++G+DEE GPQ++KCDPAG++ G
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIGVDEECGPQVYKCDPAGYYCG  162



>ref|XP_003971508.1| PREDICTED: proteasome subunit alpha type-6-like [Takifugu rubripes]
Length=246

 Score =   235 bits (599),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 134/162 (83%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD  +VTHLF +T  +G + +G+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDAATVTHLFRITDNIGCVMSGMTADSRSQVQRARYEAANWQYKYGYEIPVDMLCKRIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A MRPLG   +++GIDEE GPQ++KCDPAG++ G
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIGIDEEYGPQVYKCDPAGYYCG  162



>ref|XP_004141815.1| PREDICTED: proteasome subunit alpha type-6-like [Cucumis sativus]
Length=130

 Score =   231 bits (589),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 109/120 (91%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVK+AG TSIGV+G+DSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKSAGTTSIGVKGRDSVCVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LDQTSVTHLF +TKYLGLLATGITADAR+LVQQARNEAAEFRF+YGYEMPVDVLA+W +D
Sbjct  61   LDQTSVTHLFSITKYLGLLATGITADARSLVQQARNEAAEFRFQYGYEMPVDVLAKWYSD  120



>ref|XP_004083706.1| PREDICTED: proteasome subunit alpha type-6 [Oryzias latipes]
Length=246

 Score =   235 bits (599),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 135/162 (83%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD ++VTHLF +T  +G + +G+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDASTVTHLFRITDNIGCVMSGMTADSRSQVQRARYEAANWQYKYGYEVPVDMLCKRIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A MRPLG   +++GIDEE GPQ++KCDPAG++ G
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIGIDEEFGPQVYKCDPAGYYCG  162



>ref|XP_010744453.1| PREDICTED: proteasome subunit alpha type-6 [Larimichthys crocea]
Length=246

 Score =   235 bits (599),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 134/162 (83%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD  +VTHLF +T  +G + +G+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDAATVTHLFRITDNIGCVMSGMTADSRSQVQRARYEAANWQYKYGYEIPVDMLCKRIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A MRPLG   +++GIDEE GPQ++KCDPAG++ G
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIGIDEEYGPQVYKCDPAGYYCG  162



>gb|ETE73021.1| Proteasome subunit alpha type-6, partial [Ophiophagus hannah]
Length=279

 Score =   236 bits (602),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 134/162 (83%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  34   MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  93

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD  +VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  94   LDSNTVTHLFRITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  153

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A MRPLG   +++GIDEE  PQ++KCDPAG++ G
Sbjct  154  ISQVYTQNAEMRPLGCCMIMIGIDEENNPQVYKCDPAGYYCG  195



>ref|XP_005158685.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Danio 
rerio]
 gb|AAH55520.1| Psma6a protein [Danio rerio]
 gb|AAI64827.1| Psma6a protein [Danio rerio]
Length=246

 Score =   235 bits (599),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 102/162 (63%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   V+TQ+KVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVITQRKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD ++VTHLF +T+ +G + +G+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFRITENIGCVMSGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A MRPLG   +++G+DEE GPQ++KCDPAG++ G
Sbjct  121  ISQVYTQNAEMRPLGCCMIVVGVDEELGPQVYKCDPAGYYCG  162



>ref|XP_006632201.1| PREDICTED: proteasome subunit alpha type-6-like [Lepisosteus 
oculatus]
Length=246

 Score =   235 bits (599),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 135/162 (83%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD  +VTHLF +T+ +G + +G+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSNTVTHLFRITETIGCVMSGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A MRPLG   +++G+DEE GPQ++KCDPAG++ G
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGVDEEFGPQVYKCDPAGYYCG  162



>ref|XP_007569003.1| PREDICTED: proteasome subunit alpha type-6 [Poecilia formosa]
Length=246

 Score =   235 bits (599),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 135/162 (83%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD ++VTHLF +T  +G + +G+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDASTVTHLFRITDNIGCVMSGMTADSRSQVQRARYEAANWQYKYGYEIPVDMLCKRIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A MRPLG   +++G+DEE GPQ++KCDPAG++ G
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIGMDEEYGPQVYKCDPAGYYCG  162



>gb|EPB88050.1| proteasome subunit alpha type-6 [Mucor circinelloides f. circinelloides 
1006PhL]
Length=246

 Score =   234 bits (598),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 103/162 (64%), Positives = 135/162 (83%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSG GYDRHITIFSPEGRL+QVEYAFKA+  +GITS+GVRG+D   +VTQ+KVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLYQVEYAFKAISNSGITSVGVRGRDGCVIVTQRKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD +++TH+F +T  +G + TG+ ADAR+ V +AR EAAEFR++YGYE+P D+LA+ +A+
Sbjct  61   LDPSTITHVFKLTPKIGCVMTGMIADARSQVTRARQEAAEFRYKYGYEIPTDMLAKRVAN  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             +QVYTQ A MRP GV  +++G D+E GPQL+KCDPAG++ G
Sbjct  121  INQVYTQQAAMRPYGVSMILIGYDDELGPQLYKCDPAGYYVG  162



>ref|XP_008398058.1| PREDICTED: proteasome subunit alpha type-6 [Poecilia reticulata]
Length=246

 Score =   234 bits (598),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 103/162 (64%), Positives = 134/162 (83%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+G+RGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGMTSVGIRGKDCAVIVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD ++VT LF +T  +G + TG+TAD+R+ VQ+AR EAA + ++YGYE+PVD+L + +AD
Sbjct  61   LDASTVTQLFKITDNIGCVMTGMTADSRSQVQRARYEAANWNYKYGYEIPVDMLCKRMAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A MRPLG   +++G+DEE GPQL+KCDPAG++ G
Sbjct  121  ISQVYTQNAEMRPLGCCMVVIGMDEELGPQLYKCDPAGYYCG  162



>ref|XP_005562133.1| PREDICTED: proteasome subunit alpha type-6-like [Macaca fascicularis]
Length=245

 Score =   234 bits (598),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 136/162 (84%), Gaps = 1/162 (1%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD ++VTHLF +T+ +G + TG+TAD R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTAD-RSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  119

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG++ G
Sbjct  120  ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCG  161



>gb|ACO08744.1| Proteasome subunit alpha type 6 [Oncorhynchus mykiss]
Length=188

 Score =   233 bits (593),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 102/162 (63%), Positives = 134/162 (83%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD ++VTHLF +T+ +G + +G+TAD ++ VQ+AR EAA + ++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFRITENIGCVMSGMTADGKSQVQRARYEAANWNYKYGYEIPVDMLCKRIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A MRPLG   +++G+D+E GPQ++KCDPAG++ G
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIGVDDECGPQVYKCDPAGYYCG  162



>ref|XP_002824717.1| PREDICTED: proteasome subunit alpha type-6 isoform X2 [Pongo 
abelii]
Length=246

 Score =   234 bits (598),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 101/162 (62%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G+DRHITIFSPEGRL+QV+Y F+++   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVDYCFQSINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG++ G
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCG  162



>ref|XP_004653726.1| PREDICTED: proteasome subunit alpha type-6-like [Jaculus jaculus]
Length=246

 Score =   234 bits (598),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 102/162 (63%), Positives = 134/162 (83%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G+DRHITIFSPEGRL+Q EYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQAEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+  MRPLG   +++G DEE+GPQ++KCDPAG++ G
Sbjct  121  ISQVYTQNTEMRPLGCCMILIGTDEEQGPQVYKCDPAGYYCG  162



>emb|CEP12966.1| hypothetical protein [Parasitella parasitica]
Length=246

 Score =   234 bits (598),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 103/162 (64%), Positives = 135/162 (83%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSG GYDRHITIFSPEGRL+QVEYAFKA+  +GITS+GVRG+D   +VTQ+KVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLYQVEYAFKAISNSGITSVGVRGRDGCVIVTQRKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD +++TH+F +T  +G + TG+ ADAR+ V +AR EAAEFR++YGYE+P D+LA+ +A+
Sbjct  61   LDPSTITHVFKLTPKIGCVMTGMIADARSQVTRARQEAAEFRYKYGYEIPTDMLAKRVAN  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             +QVYTQ A MRP GV  +++G D+E GPQL+KCDPAG++ G
Sbjct  121  INQVYTQQAAMRPYGVSMILIGYDDELGPQLYKCDPAGYYVG  162



>emb|CDS07623.1| Putative Proteasome subunit alpha type [Absidia idahoensis var. 
thermophila]
Length=246

 Score =   234 bits (598),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 134/162 (83%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  GYDRHITIFSPEGRL+QVEYAFKA+  +GITS+GVRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGYDRHITIFSPEGRLYQVEYAFKAISNSGITSVGVRGKDGCVIVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD +++TH+F +T  +G + TG+ ADAR+ V +AR EAAEFR++YGYE+P D+LA+ +A+
Sbjct  61   LDPSTITHVFKLTPKIGCVMTGMIADARSQVTRARQEAAEFRYKYGYEIPADMLAKRVAN  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             +QVYTQ A MRPLGV  +++G D+E GPQLFK DPAG++ G
Sbjct  121  INQVYTQQAAMRPLGVSMILIGYDDEMGPQLFKVDPAGYYVG  162



>ref|XP_007576015.1| PREDICTED: proteasome subunit alpha type-6 [Poecilia formosa]
Length=246

 Score =   234 bits (598),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 134/162 (83%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+G+RGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGMTSVGIRGKDCAVVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD ++VT LF +T  +G + TG+TAD+R+ VQ+AR EAA + ++YGYE+PVD+L + +AD
Sbjct  61   LDASTVTQLFRITDNIGCVMTGMTADSRSQVQRARYEAANWNYKYGYEIPVDMLCKRMAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A MRPLG   +++G+DEE GPQL+KCDPAG++ G
Sbjct  121  ISQVYTQNAEMRPLGCCMVVIGMDEELGPQLYKCDPAGYYCG  162



>gb|ACO51961.1| Proteasome subunit alpha type-6 [Rana catesbeiana]
Length=246

 Score =   234 bits (597),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 103/162 (64%), Positives = 135/162 (83%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDK 
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAIVVTQKKVPDKS  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD ++V+HLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDNSTVSHLFRITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A MRPLG   +++G+DEE GPQ++KCDPAG++ G
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGVDEETGPQVYKCDPAGYYCG  162



>dbj|GAN03133.1| proteasome subunit alpha type-6 [Mucor ambiguus]
Length=246

 Score =   234 bits (597),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 103/162 (64%), Positives = 134/162 (83%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSG GYDRHITIFSPEGRL+QVEYAFKA+  +GITS+GVRG+D   +VTQ+KVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLYQVEYAFKAISNSGITSVGVRGRDGCVIVTQRKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD +++TH+F +T  +G + TG+ ADAR  V +AR EAAEFR++YGYE+P D+LA+ +A+
Sbjct  61   LDPSTITHVFKLTPKIGCVMTGMIADARAQVTKARQEAAEFRYKYGYEIPTDMLAKRVAN  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             +QVYTQ A MRP GV  +++G D+E GPQL+KCDPAG++ G
Sbjct  121  INQVYTQQAAMRPYGVSMILVGYDDELGPQLYKCDPAGYYVG  162



>ref|XP_007253022.1| PREDICTED: proteasome subunit alpha type-6-like isoform X2 [Astyanax 
mexicanus]
Length=246

 Score =   234 bits (596),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 103/162 (64%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD ++VTHLF +T+ +G + +G+TAD+R+ VQ+AR EAA ++++YG+E+PVD+L + IAD
Sbjct  61   LDSSTVTHLFRITESIGCVMSGMTADSRSQVQRARYEAANWQYKYGFEIPVDMLCKRIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A MRPLG   +++G+DEE GPQ++KCDPAG++ G
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIGLDEEYGPQVYKCDPAGYYCG  162



>ref|XP_005989234.1| PREDICTED: proteasome subunit alpha type-6 [Latimeria chalumnae]
Length=246

 Score =   233 bits (595),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 135/162 (83%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD  +VTHLF VT+ +G + TG+TAD+++ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDAGTVTHLFRVTENIGCVMTGMTADSKSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A MRPLG   +++GID+E GPQ++KCDPAG++ G
Sbjct  121  ISQVYTQNAEMRPLGCCMILVGIDQEYGPQVYKCDPAGYYCG  162



>emb|CDH55408.1| proteasome subunit alpha type-6 [Lichtheimia corymbifera JMRC:FSU:9682]
Length=246

 Score =   233 bits (594),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 134/162 (83%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  GYDRHITIFSPEGRL+QVEYAFKA+  +GITS+GVRG+D   +VTQKKVPDKL
Sbjct  1    MSRGSSAGYDRHITIFSPEGRLYQVEYAFKAISNSGITSVGVRGQDGCVIVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD +++TH+F +T  +G + TG+ ADAR+ V +AR EAAEFR++YGYE+P D+LA+ +A+
Sbjct  61   LDPSTITHVFKLTPKIGCVMTGMIADARSQVTRARQEAAEFRYKYGYEIPADMLAKRVAN  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             +QVYTQ A MRPLGV  +++G D+E GPQLFK DPAG++ G
Sbjct  121  INQVYTQQAAMRPLGVSMILIGYDDEMGPQLFKVDPAGYYVG  162



>emb|CDQ78135.1| unnamed protein product [Oncorhynchus mykiss]
Length=246

 Score =   233 bits (594),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 102/162 (63%), Positives = 134/162 (83%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD ++VTHLF +T+ +G + +G+TAD ++ VQ+AR EAA + ++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFRITENIGCVMSGMTADGKSQVQRARYEAANWNYKYGYEIPVDMLCKRIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A MRPLG   +++G+D+E GPQ++KCDPAG++ G
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIGVDDECGPQVYKCDPAGYYCG  162



>ref|XP_006015430.1| PREDICTED: proteasome subunit alpha type-6 [Alligator sinensis]
Length=382

 Score =   237 bits (605),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 137/162 (85%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKDS  +VTQKKVPDKL
Sbjct  137  MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDSAVIVTQKKVPDKL  196

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGY++PVD+L + IAD
Sbjct  197  LDSSTVTHLFRITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYDIPVDMLCKRIAD  256

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A MRPLG   +++G+DEE GPQ++KCDPAG++ G
Sbjct  257  ISQVYTQNAEMRPLGCCMILIGVDEEHGPQVYKCDPAGYYCG  298



>gb|ACH70967.1| proteasome (prosome, macropain) subunit, alpha type 6-1 [Salmo 
salar]
 gb|ACI66033.1| Proteasome subunit alpha type-6 [Salmo salar]
 gb|ACI70006.1| Proteasome subunit alpha type-6 [Salmo salar]
 emb|CDQ70650.1| unnamed protein product [Oncorhynchus mykiss]
Length=246

 Score =   232 bits (592),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ +RG+D   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSLAIRGQDCAVVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD ++VTHLF +T+ +G + +G+TAD+++ VQ+AR EAA ++++YGYE+PVD+L + +AD
Sbjct  61   LDASTVTHLFKITENIGCVMSGMTADSKSQVQRARYEAANWKYKYGYEIPVDMLCKRMAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A MRPLG   +++G+DEE GPQ++KCDPAG++ G
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIGVDEECGPQVYKCDPAGYYCG  162



>ref|XP_010876973.1| PREDICTED: proteasome subunit alpha type-6 [Esox lucius]
Length=246

 Score =   232 bits (592),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ +RG+D   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAIRGQDCAVVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD ++VTHLF +T+ +G + +G+TAD+++ VQ+AR EAA ++++YGYE+PVD+L + +AD
Sbjct  61   LDASTVTHLFRITENIGCVMSGMTADSKSQVQRARYEAANWKYKYGYEIPVDMLCKRMAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A MRPLG   +++G+DEE GPQ++KCDPAG++ G
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIGVDEECGPQVYKCDPAGYYCG  162



>gb|ACO08806.1| Proteasome subunit alpha type 6 [Oncorhynchus mykiss]
Length=246

 Score =   232 bits (591),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 135/162 (83%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ +RG+D   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSLAIRGQDCAVVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD ++VTHLF  T+ +G + +G+TAD+++ VQ+AR EAA ++++YGYE+PVD+L + +AD
Sbjct  61   LDASTVTHLFKTTENIGCVMSGMTADSKSQVQRARCEAANWKYKYGYEIPVDMLCKRMAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A MRPLG   +++G+DEE GPQ++KCDPAG++ G
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIGVDEECGPQVYKCDPAGYYCG  162



>gb|ACM08640.1| Proteasome subunit alpha type-6 [Salmo salar]
Length=246

 Score =   232 bits (591),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 102/162 (63%), Positives = 135/162 (83%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDK 
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKP  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD ++VTHLF +T+ +G + +G+TAD+++ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDASTVTHLFRITENIGCVMSGMTADSKSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A MRPLG   +++G+DEE GPQ++KCDPAG++ G
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIGVDEECGPQVYKCDPAGYYCG  162



>ref|XP_007253021.1| PREDICTED: proteasome subunit alpha type-6-like isoform X1 [Astyanax 
mexicanus]
Length=288

 Score =   233 bits (594),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 103/162 (64%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD ++VTHLF +T+ +G + +G+TAD+R+ VQ+AR EAA ++++YG+E+PVD+L + IAD
Sbjct  61   LDSSTVTHLFRITESIGCVMSGMTADSRSQVQRARYEAANWQYKYGFEIPVDMLCKRIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A MRPLG   +++G+DEE GPQ++KCDPAG++ G
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIGLDEEYGPQVYKCDPAGYYCG  162



>gb|AFK10987.1| proteasome subunit alpha type-6-like protein [Callorhinchus milii]
Length=246

 Score =   231 bits (590),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 102/162 (63%), Positives = 134/162 (83%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPD+L
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDEL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD  +VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDANTVTHLFRITEKIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVY Q+A MRPLG   +++G+DEE GPQ++KCDPAG++ G
Sbjct  121  ISQVYMQNAEMRPLGCCMILVGVDEELGPQVYKCDPAGYYCG  162



>ref|NP_705941.1| proteasome subunit alpha type-6 [Danio rerio]
 gb|AAK40122.1|AF354750_1 proteasome subunit alpha Type 6-A [Danio rerio]
Length=233

 Score =   231 bits (589),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 101/162 (62%), Positives = 135/162 (83%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   V+TQ+KVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVITQRKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD ++VTHLF +T+ +G + +G+TAD+R+ VQ+AR EAA ++++YGYE+PV +L + IAD
Sbjct  61   LDSSTVTHLFRITENIGCVMSGMTADSRSQVQRARYEAANWKYKYGYEIPVGMLCKRIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A MRPLG   +++G+DEE GPQ++KCDPAG++ G
Sbjct  121  ISQVYTQNAEMRPLGCCMIVVGVDEELGPQVYKCDPAGYYCG  162



>gb|ACQ58552.1| Proteasome subunit alpha type-6 [Anoplopoma fimbria]
Length=246

 Score =   231 bits (590),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 103/162 (64%), Positives = 133/162 (82%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAIVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD  +VTHLF +T  +G + +G+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + +AD
Sbjct  61   LDSATVTHLFRITDNIGCVMSGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRLAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A MRPLG   +++GIDEE G Q++KCDPAG++ G
Sbjct  121  ISQVYTQNAEMRPLGCCMIMIGIDEEHGAQVYKCDPAGYYCG  162



>gb|ACH70968.1| proteasome (prosome, macropain) subunit, alpha type 6-2 [Salmo 
salar]
Length=246

 Score =   231 bits (589),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 101/162 (62%), Positives = 133/162 (82%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPD L
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDTL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD ++VTHLF +T+ +G + +G+TAD ++ VQ+AR EAA + ++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFRITENIGCVMSGMTADGKSQVQRARYEAANWNYKYGYEIPVDMLCKRIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A MRPLG   +++G+D+E GPQ++KCDPAG++ G
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIGVDDECGPQVYKCDPAGYYCG  162



>gb|KFH62604.1| proteasome subunit alpha type-6 [Mortierella verticillata NRRL 
6337]
Length=244

 Score =   231 bits (589),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 103/162 (64%), Positives = 138/162 (85%), Gaps = 2/162 (1%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRG+G  YDRHIT+FSPEGRL+QVEYAFKA+  +GITSIGVRGKDS  +VTQ KVPDKL
Sbjct  1    MSRGAG--YDRHITVFSPEGRLYQVEYAFKAISNSGITSIGVRGKDSCVIVTQHKVPDKL  58

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD +++ H++P+T  +G + TG+  DAR+ VQ+A++EAAEFR+++GYE+P D+LA+ +A+
Sbjct  59   LDASTIKHIYPLTPKIGCVMTGLVPDARSAVQRAQSEAAEFRYKFGYEIPPDMLAKRMAN  118

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             +QVYTQHA MRPLGV  +++G+D+E+GPQLFK DPAG+F G
Sbjct  119  INQVYTQHAAMRPLGVSMILIGLDDERGPQLFKVDPAGYFVG  160



>ref|XP_004637142.1| PREDICTED: proteasome subunit alpha type-6 [Octodon degus]
Length=244

 Score =   231 bits (588),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 134/162 (83%), Gaps = 2/162 (1%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA   ++Y YE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAA--NWKYNYEIPVDMLCKRIAD  118

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG++ G
Sbjct  119  ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCG  160



>gb|ACI69778.1| Proteasome subunit alpha type-6 [Salmo salar]
Length=246

 Score =   231 bits (588),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 99/162 (61%), Positives = 135/162 (83%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ +RG+D   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSLAIRGQDCAVVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD ++VTHLF +T+ +G + +G+ AD+++ VQ+AR EAA ++++YGYE+PVD+L + +AD
Sbjct  61   LDASTVTHLFKITENIGCVMSGMAADSKSQVQRARYEAANWKYKYGYEIPVDMLCKRMAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A MRPLG   +++G+DEE GPQ++KCDPAG++ G
Sbjct  121  VSQVYTQNAEMRPLGCCMIVIGVDEECGPQVYKCDPAGYYCG  162



>ref|XP_008311014.1| PREDICTED: proteasome subunit alpha type-6 [Cynoglossus semilaevis]
Length=246

 Score =   230 bits (587),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 102/162 (63%), Positives = 133/162 (82%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD ++VTHLF +T  +G + +G+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDASTVTHLFRITDNIGCVMSGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A  RPLG   +++ +DEE GPQ++KCDPAG++ G
Sbjct  121  ISQVYTQNADKRPLGCCMIVISVDEEYGPQVYKCDPAGYYCG  162



>gb|ACI69799.1| Proteasome subunit alpha type-6 [Salmo salar]
Length=208

 Score =   228 bits (582),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 98/162 (60%), Positives = 135/162 (83%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G+DRHITIFSPE RL+QVEYAFKA+   G+TS+ +RG++   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPESRLYQVEYAFKAINQGGLTSLAIRGQECAVVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD ++VTHLF +T+ +G + +G+TAD+++ VQ+AR EAA ++++YGYE+PVD+L + +AD
Sbjct  61   LDASTVTHLFKITENIGCVMSGMTADSKSQVQRARYEAANWKYKYGYEIPVDMLCKRMAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A MRPLG   +++G+DEE GPQ++KCDPAG++ G
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIGVDEECGPQVYKCDPAGYYCG  162



>gb|ACO08382.1| Proteasome subunit alpha type 6 [Oncorhynchus mykiss]
Length=246

 Score =   229 bits (585),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 99/162 (61%), Positives = 134/162 (83%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ +RG+D   V TQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSLAIRGQDCAVVATQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD ++VTHLF +T+ +G + +G+TAD ++ VQ+AR EAA ++++YGYE+PVD+L + +AD
Sbjct  61   LDASTVTHLFKITENIGCVMSGMTADNKSQVQRARYEAANWKYKYGYEIPVDMLCKRMAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A MRPLG   +++G+DEE GPQ++KCDPAG++ G
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIGVDEECGPQVYKCDPAGYYCG  162



>gb|ACI66670.1| Proteasome subunit alpha type-6 [Salmo salar]
Length=208

 Score =   228 bits (582),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 99/162 (61%), Positives = 134/162 (83%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G+DRHITIF PEGRL+QVEYAFKA    G+TS+ +RG+D   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFPPEGRLYQVEYAFKATNQGGLTSLAIRGQDCAVVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD ++VTHLF +T+ +G + +G+TAD+++ VQ+AR EAA ++++YGYE+PVD+L + +AD
Sbjct  61   LDASTVTHLFKITENIGCVMSGMTADSKSQVQRARYEAANWKYKYGYEIPVDMLCKRMAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A MRPLG   +++G+DEE GPQ++KCDPAG++ G
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIGVDEECGPQVYKCDPAGYYCG  162



>ref|XP_001640650.1| predicted protein [Nematostella vectensis]
 gb|EDO48587.1| predicted protein [Nematostella vectensis]
Length=246

 Score =   229 bits (585),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 103/162 (64%), Positives = 134/162 (83%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRG+  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+G+RG DS  VVTQKKVPDKL
Sbjct  1    MSRGTSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVGIRGADSAVVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD  +VT LF +++ +G + TG+ AD+R+ VQ+AR EAA +++++GYE+PVD+L + IAD
Sbjct  61   LDSNTVTQLFELSERIGCVMTGMVADSRSQVQRARYEAANWKYKFGYEIPVDMLCKRIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A MRPLG   +++GIDEEKGPQL+K DPAG+F G
Sbjct  121  ISQVYTQNAEMRPLGCGMILIGIDEEKGPQLYKTDPAGYFCG  162



>ref|XP_007873808.1| hypothetical protein PNEG_01835 [Pneumocystis murina B123]
 gb|EMR10086.1| hypothetical protein PNEG_01835 [Pneumocystis murina B123]
Length=254

 Score =   229 bits (585),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 103/162 (64%), Positives = 134/162 (83%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  GYDRHITIFSPEGRL+QVEYAFK+V + GITS+ ++GKDSV  ++QKKVPDKL
Sbjct  1    MSRGSSTGYDRHITIFSPEGRLYQVEYAFKSVNSTGITSVAIKGKDSVVFISQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            +DQ SV+++F +T+ +G L TG  ADAR  V +AR EAA+F+++YGYE+PVDVLA+ IA+
Sbjct  61   IDQDSVSYIFRITENIGCLVTGQIADARASVNRARVEAADFKYKYGYEIPVDVLAKRIAN  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             +QV TQ A MRPLG+ ++ + IDEEKGPQ+FKCD AG++ G
Sbjct  121  INQVCTQRAAMRPLGISSIFIAIDEEKGPQIFKCDLAGYYAG  162



>ref|XP_002610620.1| hypothetical protein BRAFLDRAFT_260512 [Branchiostoma floridae]
 gb|EEN66630.1| hypothetical protein BRAFLDRAFT_260512 [Branchiostoma floridae]
Length=246

 Score =   229 bits (584),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 102/162 (63%), Positives = 132/162 (81%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRG+  G+DRHITIFSPEGRL+QVEYAFKAV   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGTSAGFDRHITIFSPEGRLYQVEYAFKAVNQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD  +VTH+F +T Y+G + TG+ AD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDAETVTHIFQITDYIGCVMTGMIADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A MRPLG   +++G D+E GPQ++K DPAG++ G
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGYDDEHGPQVYKTDPAGYYCG  162



>ref|XP_011419593.1| PREDICTED: proteasome subunit alpha type-6 [Crassostrea gigas]
 gb|EKC40404.1| Proteasome subunit alpha type-6 [Crassostrea gigas]
Length=228

 Score =   227 bits (579),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 130/162 (80%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ +RGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAIRGKDCAVVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD  +VTHLF +T+ LG + TG+ AD+R+ VQ+AR EAA++++ YGYE+PVDVL + IAD
Sbjct  61   LDADTVTHLFQLTENLGCVMTGMVADSRSQVQRARYEAAKWKYNYGYEIPVDVLCKRIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ A MRPLG   +++G D E GPQ+FK DPAG+F G
Sbjct  121  ISQVYTQSAEMRPLGCSMIMVGFDAEYGPQVFKADPAGYFSG  162



>ref|XP_007068323.1| PREDICTED: proteasome subunit alpha type-6-like [Chelonia mydas]
 gb|EMP27832.1| Proteasome subunit alpha type-6 [Chelonia mydas]
Length=245

 Score =   227 bits (578),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 102/162 (63%), Positives = 135/162 (83%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+T++ VRG DSV +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAISQGGLTTVAVRGDDSVAMVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD ++VT+L+ +T+ +G   TG++AD R+ VQ+AR+EAAE++++ GYE+PV +L R +AD
Sbjct  61   LDPSTVTNLYRLTETIGCAMTGMSADGRSQVQRARHEAAEWKYKKGYEIPVAMLCRRMAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A MRPLG   +++GID+E GPQLFKCDPAG++ G
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGIDQELGPQLFKCDPAGYYCG  162



>ref|XP_010777538.1| PREDICTED: proteasome subunit alpha type-6 [Notothenia coriiceps]
Length=246

 Score =   227 bits (578),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 101/162 (62%), Positives = 134/162 (83%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ +RGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAIRGKDCAIVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD  +VTHLF +T ++G + +G+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + +AD
Sbjct  61   LDAGTVTHLFRITDHIGCVMSGMTADSRSQVQRARYEAANWQYKYGYEIPVDMLCKRLAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A MRPLG   +++GID+E GPQ++K DPAG++ G
Sbjct  121  ISQVYTQNAEMRPLGCCMIMIGIDDEHGPQVYKNDPAGYYCG  162



>ref|XP_006065991.1| PREDICTED: proteasome subunit alpha type-6-like [Bubalus bubalis]
Length=246

 Score =   226 bits (577),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 101/162 (62%), Positives = 133/162 (82%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G DRHITIFSPEGRL+QVE AFKAV   G+TS+ VRGKD   +V QKKVPDKL
Sbjct  1    MSRGSSAGVDRHITIFSPEGRLYQVEDAFKAVNQGGLTSVAVRGKDCAVIVAQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            L  ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA+++++YGYE+PV +L + IAD
Sbjct  61   LHSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAAKWKYKYGYEIPVHMLCKRIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A MRPLG   +++G+DEE+GPQ++KCDPAG++ G
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGVDEEQGPQVYKCDPAGYYCG  162



>ref|XP_005293216.1| PREDICTED: proteasome subunit alpha type-6-like isoform X1 [Chrysemys 
picta bellii]
Length=245

 Score =   226 bits (575),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 103/162 (64%), Positives = 133/162 (82%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+T++ VRG+DSV VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAISQGGLTTVAVRGEDSVAVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD  +VT+L+ +T+ +G   TG++AD R+ VQ+AR+EAAE++++ GYE+PV  L R +AD
Sbjct  61   LDPGTVTNLYRLTETIGCAMTGMSADGRSQVQRARHEAAEWKYKKGYEIPVATLCRRMAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A MRPLG   +++GID E GPQLFKCDPAG++ G
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGIDHELGPQLFKCDPAGYYCG  162



>ref|XP_002500811.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO62069.1| predicted protein [Micromonas sp. RCC299]
Length=291

 Score =   227 bits (578),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 114/204 (56%), Positives = 135/204 (66%), Gaps = 42/204 (21%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQV-----------------------------------  138
            MSRGSG GYDRHITIFSPEGRL+QV                                   
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLYQVGASRPEPAWRRRPNPPRPIIPSLFTPARIARLTGD  60

Query  139  -------EYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKLLDQTSVTHLFPVTKYLGL  297
                   EYAFKA+K+ G+TSIGVRGKDSVCVVTQKK+PDKLLD T +TH+F +TK +GL
Sbjct  61   PVPFPPSEYAFKAIKSVGVTSIGVRGKDSVCVVTQKKIPDKLLDPTDITHMFKITKTIGL  120

Query  298  LATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVA  477
             ATG   D R +VQ+AR+ AAEFR  YGYE+PVD L+  +AD  QVYTQHAYMRP+  + 
Sbjct  121  CATGKLPDIRNVVQKARHTAAEFRHEYGYEIPVDYLSCKLADWFQVYTQHAYMRPMAAMC  180

Query  478  MILGIDEEKGPQLFKCDPAGHFFG  549
            M +GIDEE+GP L+K DPAG+F G
Sbjct  181  MFVGIDEERGPSLYKNDPAGYFVG  204



>ref|XP_005350320.1| PREDICTED: proteasome subunit alpha type-6-like [Microtus ochrogaster]
Length=202

 Score =   223 bits (569),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 98/162 (60%), Positives = 132/162 (81%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MS GS   +DRHITIFSP+GRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSHGSSASFDRHITIFSPKGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+ R EAA ++++YGYE+PVD+L + +A 
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRTRYEAANWKYKYGYEIPVDMLCKRVAG  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCD AG++ G
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDLAGYYCG  162



>ref|XP_003388491.1| PREDICTED: proteasome subunit alpha type-6-like [Amphimedon queenslandica]
Length=246

 Score =   224 bits (572),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 101/162 (62%), Positives = 132/162 (81%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G+DR ITIFSPEGRL+QVEYAFKA+   G TSIGV+G +S  V+TQKKVPDKL
Sbjct  1    MSRGSSAGFDRFITIFSPEGRLYQVEYAFKAIAQTGSTSIGVKGTNSAVVITQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD  S+THLF +T  +G + TG+TAD+R  V++AR+EAAEF++RYGY+MPVD + + +AD
Sbjct  61   LDPDSITHLFKITDTVGCVMTGMTADSRAQVKRARHEAAEFKYRYGYDMPVDAVCKRMAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             +Q+YTQ+A+MRP G   +++GIDEE+G QLFK DPAG++ G
Sbjct  121  IAQIYTQNAFMRPYGCSMILIGIDEERGIQLFKTDPAGYYCG  162



>ref|XP_006678757.1| hypothetical protein BATDEDRAFT_88011 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF80942.1| hypothetical protein BATDEDRAFT_88011 [Batrachochytrium dendrobatidis 
JAM81]
Length=252

 Score =   224 bits (572),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 102/156 (65%), Positives = 128/156 (82%), Gaps = 0/156 (0%)
 Frame = +1

Query  82   GGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKLLDQTSV  261
             GYDRHITIFSPEGRL+QVEYAFKA+  AG TS+GVRGK S  +VTQKKVPDKLLD ++V
Sbjct  12   AGYDRHITIFSPEGRLYQVEYAFKAISNAGFTSVGVRGKSSCVIVTQKKVPDKLLDPSTV  71

Query  262  THLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIADKSQVYT  441
            TH+F +T  +G + TG+ ADA + V +AR EAAE+R++YGYE+PVD+LA+ IA  +QVYT
Sbjct  72   THMFQLTPKIGCVMTGLIADAHSQVARARMEAAEWRYKYGYEIPVDMLAKRIASINQVYT  131

Query  442  QHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
            Q A MRPLGV  +++  D+E+GPQLFKCDPAG+F G
Sbjct  132  QQAAMRPLGVSMILISYDDERGPQLFKCDPAGYFVG  167



>ref|XP_005987928.1| PREDICTED: proteasome subunit alpha type-6-like isoform X1 [Latimeria 
chalumnae]
Length=246

 Score =   224 bits (570),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 98/160 (61%), Positives = 134/160 (84%), Gaps = 0/160 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+T++ ++G DSV VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTTVAMKGDDSVVVVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            L+ +++T+++ +T  +G + TG+ AD R+ VQ+AR EAAE++++YGY++PVD+L + IAD
Sbjct  61   LEPSTMTNMYRLTDKIGCVMTGMIADGRSQVQRARYEAAEWKYKYGYDIPVDMLCKRIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHF  543
             SQVYTQ+A MRPLG   M++GID+E GPQL+KCDPAG++
Sbjct  121  ISQVYTQNAEMRPLGCCMMLIGIDDEFGPQLYKCDPAGYY  160



>ref|XP_004333676.1| proteasome subunit alpha type6, putative [Acanthamoeba castellanii 
str. Neff]
 gb|ELR11663.1| proteasome subunit alpha type6, putative [Acanthamoeba castellanii 
str. Neff]
Length=242

 Score =   224 bits (570),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 102/162 (63%), Positives = 133/162 (82%), Gaps = 4/162 (2%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSR +G  YDRHITIFSPEGRL+QVEYAFKA+K   +TS+G+RG DS CV+TQKKVP+KL
Sbjct  1    MSRSAG--YDRHITIFSPEGRLYQVEYAFKAIKTENLTSLGIRGADSCCVITQKKVPEKL  58

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            +D TSVTHLF +T  +G + TG+ ADAR+ VQ+AR EAA+F  ++GY++PV  LA+ +AD
Sbjct  59   VDPTSVTHLFNITPTIGCVMTGMIADARSQVQRARKEAADFAHKFGYDIPVSYLAKRMAD  118

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             +Q+YTQHAYMRPL ++  ++ IDEE+GPQL+KCDPAG + G
Sbjct  119  IAQIYTQHAYMRPLAMI--LISIDEEEGPQLYKCDPAGSYAG  158



>emb|CDH55409.1| proteasome subunit alpha type-6 [Lichtheimia corymbifera JMRC:FSU:9682]
Length=244

 Score =   224 bits (570),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 102/162 (63%), Positives = 132/162 (81%), Gaps = 2/162 (1%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  GYDRHITIFSPEGRL+QVEYAFKA+  +GITS+GVRG+D   +VTQKK  DKL
Sbjct  1    MSRGSSAGYDRHITIFSPEGRLYQVEYAFKAISNSGITSVGVRGQDGCVIVTQKK--DKL  58

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD +++TH+F +T  +G + TG+ ADAR+ V +AR EAAEFR++YGYE+P D+LA+ +A+
Sbjct  59   LDPSTITHVFKLTPKIGCVMTGMIADARSQVTRARQEAAEFRYKYGYEIPADMLAKRVAN  118

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             +QVYTQ A MRPLGV  +++G D+E GPQLFK DPAG++ G
Sbjct  119  INQVYTQQAAMRPLGVSMILIGYDDEMGPQLFKVDPAGYYVG  160



>gb|ELU01128.1| hypothetical protein CAPTEDRAFT_167909 [Capitella teleta]
Length=246

 Score =   223 bits (569),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 96/162 (59%), Positives = 132/162 (81%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            M+R S  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ +RGKDS  V TQKKVPDKL
Sbjct  1    MARPSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAIRGKDSAVVATQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD ++V+H++P+T  +G + TG+TAD+R+ VQ+AR EAA ++++YGY++PVD+L + IAD
Sbjct  61   LDASTVSHVYPITDQIGCVMTGMTADSRSQVQRARYEAANWKYKYGYDIPVDMLCQRIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             +QVYTQ A MRPLG + +++  DEE GPQ+++ DPAG+F G
Sbjct  121  INQVYTQSAEMRPLGCIMILIAFDEENGPQVYRTDPAGYFCG  162



>ref|XP_002679314.1| predicted protein [Naegleria gruberi]
 gb|EFC46570.1| predicted protein [Naegleria gruberi]
Length=255

 Score =   224 bits (570),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 106/163 (65%), Positives = 131/163 (80%), Gaps = 1/163 (1%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  GYDR IT+FSPEGRL+QVEYAFKAVK  GIT+IGVRGKDS C+VTQKKVPDKL
Sbjct  1    MSRGSSSGYDRFITVFSPEGRLYQVEYAFKAVKTPGITTIGVRGKDSCCIVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            L   SVTH+F +T  +G + TG  ADAR  VQ+AR EAA F F++GYE+PV  LA+ +AD
Sbjct  61   LKAESVTHVFKITDRIGCVMTGRIADARVNVQRARYEAASFHFKFGYEIPVSYLAKRMAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEE-KGPQLFKCDPAGHFFG  549
             +Q++TQ+A +RP GVV M++G+DEE K PQL+K DPAG++ G
Sbjct  121  NAQLFTQYAGIRPQGVVMMLIGVDEETKEPQLYKIDPAGYYAG  163



>gb|EIE87129.1| hypothetical protein RO3G_11840 [Rhizopus delemar RA 99-880]
Length=269

 Score =   224 bits (571),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 105/185 (57%), Positives = 136/185 (74%), Gaps = 23/185 (12%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGSG GYDRHITIFSPEGRL+QVEYAFKA+  +GITS+GVRG+D   +VTQ+KVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLYQVEYAFKAISNSGITSVGVRGRDGCVIVTQRKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGI-----------------------TADARTLVQQARNE  354
            LD +++TH+F +T  +G + TG+                       TADAR+ V +AR E
Sbjct  61   LDPSTITHVFKLTPKIGCVMTGMIGKCNSFEHERDEIINLKLLNEPTADARSQVTRARQE  120

Query  355  AAEFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPA  534
            AAEFR++YGYE+P D+LA+ +A+ +QVYTQ A MRP GV  +++G D+E GPQL+KCDPA
Sbjct  121  AAEFRYKYGYEIPTDMLAKRVANINQVYTQQAAMRPYGVSMILIGHDDEFGPQLYKCDPA  180

Query  535  GHFFG  549
            G+F G
Sbjct  181  GYFVG  185



>ref|XP_011314423.1| PREDICTED: proteasome subunit alpha type-6-like [Fopius arisanus]
Length=246

 Score =   223 bits (568),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 98/162 (60%), Positives = 130/162 (80%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            M+RGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ V+G D+    TQKKVPDKL
Sbjct  1    MARGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVKGCDTAVFATQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD +SVTH+F +T+Y+G + TG+ AD+++ VQ+AR EAA F+++YGYE+P+D L R IAD
Sbjct  61   LDASSVTHVFQLTEYIGCVMTGMIADSKSQVQRARYEAANFKYKYGYEIPIDTLCRRIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A MRPLG   +++  D+EKGP ++K DPAG+F G
Sbjct  121  ISQVYTQNAEMRPLGCSMILVSYDQEKGPSIYKADPAGYFCG  162



>ref|XP_008993532.1| PREDICTED: LOW QUALITY PROTEIN: proteasome subunit alpha type-6-like 
[Callithrix jacchus]
Length=244

 Score =   223 bits (567),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 132/162 (81%), Gaps = 2/162 (1%)
 Frame = +1

Query  64   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  243
            MSRGS  G++RHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFERHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  244  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  423
            LD ++VTHLF +T+ +G L TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCLMTGMTADSRSQVQRARXEAANWKYKYGYEIPVDMLCKRIAD  120

Query  424  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             SQVYTQ+A    L    +++GIDE +GPQ++KCDPAG++ G
Sbjct  121  ISQVYTQNA--EXLSCCMILIGIDEGQGPQVYKCDPAGYYCG  160



>ref|XP_007688022.1| hypothetical protein COCMIDRAFT_5367 [Bipolaris oryzae ATCC 44560]
 ref|XP_007695112.1| hypothetical protein COCSADRAFT_177576 [Bipolaris sorokiniana 
ND90Pr]
 ref|XP_007714363.1| hypothetical protein COCCADRAFT_6761 [Bipolaris zeicola 26-R-13]
 gb|EMD69927.1| hypothetical protein COCSADRAFT_177576 [Bipolaris sorokiniana 
ND90Pr]
 gb|EMD86199.1| hypothetical protein COCHEDRAFT_1023953 [Bipolaris maydis C5]
 gb|ENI06147.1| hypothetical protein COCC4DRAFT_166277 [Bipolaris maydis ATCC 
48331]
 gb|EUC31307.1| hypothetical protein COCCADRAFT_6761 [Bipolaris zeicola 26-R-13]
 gb|EUC45461.1| hypothetical protein COCMIDRAFT_5367 [Bipolaris oryzae ATCC 44560]
 gb|EUN24279.1| hypothetical protein COCVIDRAFT_18335 [Bipolaris victoriae FI3]
Length=254

 Score =   223 bits (567),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = +1

Query  85   GYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKLLDQTSVT  264
            GYDRHITIFS +GRL+QVEYAFKA+ AA ITS+GVRGKD   V++QKKVPDKL+D +SV+
Sbjct  6    GYDRHITIFSDQGRLYQVEYAFKAITAANITSLGVRGKDCAVVISQKKVPDKLIDPSSVS  65

Query  265  HLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIADKSQVYTQ  444
            H+F ++  +G + TG  ADAR  V +AR EAAEFR++YGYEMP DVLA+ IA+ SQVYTQ
Sbjct  66   HIFRLSPSVGCVMTGSIADARASVSRARGEAAEFRYKYGYEMPCDVLAKRIANISQVYTQ  125

Query  445  HAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFG  549
             AYMRPLGV   ++ +D E GPQL+KCDPAG++ G
Sbjct  126  RAYMRPLGVATTLISLDSEYGPQLYKCDPAGYYVG  160



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 590079713720