BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002D18

Length=184
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009770890.1|  PREDICTED: chlorophyll a-b binding protein C...  47.4    2e-04   Nicotiana sylvestris
ref|XP_009613269.1|  PREDICTED: chlorophyll a-b binding protein C...  46.2    4e-04   Nicotiana tomentosiformis



>ref|XP_009770890.1| PREDICTED: chlorophyll a-b binding protein CP24 10A, chloroplastic-like 
[Nicotiana sylvestris]
 gb|ABG73416.1| chloroplast pigment-binding protein CP24 [Nicotiana tabacum]
Length=257

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +3

Query  93   MATTSAAVLHGLSYSFLTXGKNTQTLLXAP  182
            MATTSAAVL+GLS SFLT GKN+Q LL AP
Sbjct  1    MATTSAAVLNGLSSSFLTGGKNSQALLGAP  30



>ref|XP_009613269.1| PREDICTED: chlorophyll a-b binding protein CP24 10A, chloroplastic 
[Nicotiana tomentosiformis]
Length=257

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +3

Query  93   MATTSAAVLHGLSYSFLTXGKNTQTLLXAP  182
            MATTSAAVL+GLS SFLT GKN+Q  L AP
Sbjct  1    MATTSAAVLNGLSSSFLTGGKNSQAFLGAP  30



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 551690658990