BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002D17

Length=522
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_002510603.1|  Plastocyanin A, chloroplast precursor, putative    192   1e-58   Ricinus communis
ref|XP_004291323.1|  PREDICTED: plastocyanin                            189   2e-57   Fragaria vesca subsp. vesca
gb|KDP36868.1|  hypothetical protein JCGZ_08159                         187   1e-56   Jatropha curcas
ref|XP_011074720.1|  PREDICTED: plastocyanin-like                       186   4e-56   Sesamum indicum [beniseed]
ref|XP_002893099.1|  DNA-damage-repair/toleration protein 112           185   9e-56   
ref|XP_004238398.1|  PREDICTED: plastocyanin, chloroplastic             183   5e-55   
gb|KJB58028.1|  hypothetical protein B456_009G190800                    182   7e-55   Gossypium raimondii
ref|XP_008387896.1|  PREDICTED: plastocyanin                            182   9e-55   Malus domestica [apple tree]
ref|XP_007017921.1|  Plastocyanin 1                                     182   1e-54   Theobroma cacao [chocolate]
ref|XP_007136129.1|  hypothetical protein PHAVU_009G020300g             182   1e-54   Phaseolus vulgaris [French bean]
ref|XP_010266914.1|  PREDICTED: plastocyanin B'/B''                     181   3e-54   Nelumbo nucifera [Indian lotus]
ref|XP_009620057.1|  PREDICTED: plastocyanin A'/A''                     181   3e-54   
ref|NP_173459.1|  DNA-damage resistance protein DRT112                  181   4e-54   Arabidopsis thaliana [mouse-ear cress]
gb|AAM64356.1|  plastocyanin, putative                                  181   4e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009776940.1|  PREDICTED: plastocyanin A'/A''                     181   4e-54   Nicotiana sylvestris
emb|CAB66894.1|  putative plastocyanin                                  180   5e-54   Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ33832.1|  unnamed protein product                                180   5e-54   Eutrema halophilum
ref|XP_009334523.1|  PREDICTED: plastocyanin                            180   7e-54   Pyrus x bretschneideri [bai li]
gb|ACV32157.1|  chloroplast plastocyanin precursor                      180   8e-54   Nicotiana benthamiana
emb|CDP07338.1|  unnamed protein product                                180   8e-54   Coffea canephora [robusta coffee]
ref|XP_002285904.1|  PREDICTED: plastocyanin                            180   8e-54   Vitis vinifera
ref|XP_011083419.1|  PREDICTED: plastocyanin                            179   1e-53   Sesamum indicum [beniseed]
ref|XP_006416411.1|  hypothetical protein EUTSA_v10008749mg             181   1e-53   
gb|AFK36672.1|  unknown                                                 178   3e-53   Lotus japonicus
gb|AFK44580.1|  unknown                                                 178   3e-53   Lotus japonicus
ref|XP_006303780.1|  hypothetical protein CARUB_v10012022mg             178   4e-53   Capsella rubella
ref|XP_006390238.1|  hypothetical protein EUTSA_v10019237mg             177   6e-53   Eutrema salsugineum [saltwater cress]
ref|XP_007223602.1|  hypothetical protein PRUPE_ppa012521mg             177   6e-53   Prunus persica
ref|XP_010459715.1|  PREDICTED: plastocyanin major isoform, chlor...    177   8e-53   Camelina sativa [gold-of-pleasure]
emb|CDY31897.1|  BnaC07g15470D                                          177   9e-53   Brassica napus [oilseed rape]
ref|XP_009771635.1|  PREDICTED: plastocyanin                            177   1e-52   Nicotiana sylvestris
gb|KFK44150.1|  hypothetical protein AALP_AA1G221700                    177   1e-52   Arabis alpina [alpine rockcress]
sp|P07030.1|PLAS_SILPR  RecName: Full=Plastocyanin, chloroplastic...    177   1e-52   Silene latifolia subsp. alba [white campion]
gb|KHN33826.1|  Plastocyanin, chloroplastic                             176   1e-52   Glycine soja [wild soybean]
ref|XP_008221199.1|  PREDICTED: plastocyanin                            176   2e-52   Prunus mume [ume]
gb|AAA32787.1|  DRT112                                                  176   2e-52   Arabidopsis thaliana [mouse-ear cress]
gb|AEK78855.1|  DNA damage repair protein/transcription factor          176   3e-52   Lepidium latifolium
sp|P16002.1|PLAS_PEA  RecName: Full=Plastocyanin, chloroplastic; ...    176   3e-52   Pisum sativum [garden pea]
ref|XP_009630159.1|  PREDICTED: plastocyanin B'/B''                     176   3e-52   
ref|NP_001236653.1|  uncharacterized protein LOC100306554               176   3e-52   
ref|XP_011034955.1|  PREDICTED: plastocyanin B, chloroplastic           176   3e-52   Populus euphratica
ref|XP_003603843.1|  Plastocyanin                                       175   4e-52   Medicago truncatula
ref|XP_008466451.1|  PREDICTED: plastocyanin                            175   4e-52   Cucumis melo [Oriental melon]
emb|CDY71912.1|  BnaAnng39280D                                          175   4e-52   Brassica napus [oilseed rape]
ref|XP_010539825.1|  PREDICTED: plastocyanin                            175   5e-52   Tarenaya hassleriana [spider flower]
ref|XP_010498467.1|  PREDICTED: plastocyanin major isoform, chlor...    174   2e-51   Camelina sativa [gold-of-pleasure]
ref|XP_002300679.1|  Plastocyanin family protein                        174   2e-51   Populus trichocarpa [western balsam poplar]
prf||1111289A  plastocyanin precursor                                   173   3e-51
emb|CAN64704.1|  hypothetical protein VITISV_038998                     173   4e-51   Vitis vinifera
ref|XP_002307754.1|  Plastocyanin family protein                        173   4e-51   Populus trichocarpa [western balsam poplar]
sp|P11970.2|PLAS2_POPNI  RecName: Full=Plastocyanin B, chloroplas...    172   5e-51   Populus nigra [black poplar]
gb|AAF17650.1|AC009978_26  T23E18.3                                     173   1e-50   Arabidopsis thaliana [mouse-ear cress]
emb|CDY67120.1|  BnaA06g38550D                                          172   1e-50   Brassica napus [oilseed rape]
gb|ABK96651.1|  unknown                                                 172   1e-50   Populus trichocarpa x Populus deltoides
ref|XP_004500905.1|  PREDICTED: plastocyanin, chloroplastic-like        171   1e-50   Cicer arietinum [garbanzo]
gb|ACJ84091.1|  unknown                                                 171   1e-50   Medicago truncatula
emb|CAJ19272.1|  plastocyanin precursor                                 171   1e-50   Solanum commersonii
ref|XP_009106261.1|  PREDICTED: plastocyanin                            171   3e-50   Brassica rapa
ref|XP_010534011.1|  PREDICTED: plastocyanin-like                       171   3e-50   Tarenaya hassleriana [spider flower]
emb|CDX96643.1|  BnaA08g21860D                                          170   3e-50   
gb|ABK96770.1|  unknown                                                 171   4e-50   Populus trichocarpa x Populus deltoides
ref|XP_009110234.1|  PREDICTED: plastocyanin                            170   4e-50   Brassica rapa
ref|XP_010100113.1|  Plastocyanin                                       170   4e-50   Morus notabilis
gb|AAA32834.1|  plastocyanin                                            170   6e-50   Arabidopsis thaliana [mouse-ear cress]
emb|CDX87641.1|  BnaA07g32320D                                          170   6e-50   
ref|NP_177737.1|  plastocyanin 1                                        170   7e-50   Arabidopsis thaliana [mouse-ear cress]
emb|CDX73229.1|  BnaC06g36770D                                          170   7e-50   
ref|XP_004136366.1|  PREDICTED: plastocyanin, chloroplastic-like        169   1e-49   Cucumis sativus [cucumbers]
emb|CDY54325.1|  BnaCnng26710D                                          169   1e-49   Brassica napus [oilseed rape]
ref|XP_009149518.1|  PREDICTED: LOW QUALITY PROTEIN: plastocyanin       169   2e-49   
ref|XP_002889058.1|  plastocyanin                                       167   5e-49   Arabidopsis lyrata subsp. lyrata
emb|CDY57565.1|  BnaCnng32150D                                          167   5e-49   Brassica napus [oilseed rape]
sp|O22646.1|PLAS_FRIAG  RecName: Full=Plastocyanin, chloroplastic...    166   3e-48   Fritillaria agrestis
gb|AFW90573.1|  plastocyanin precursor                                  166   3e-48   Solanum tuberosum [potatoes]
ref|XP_008357114.1|  PREDICTED: plastocyanin                            165   4e-48   Malus domestica [apple tree]
ref|NP_001238695.1|  uncharacterized protein LOC100499708               165   6e-48   Glycine max [soybeans]
ref|XP_006342088.1|  PREDICTED: plastocyanin, chloroplastic-like        164   1e-47   Solanum tuberosum [potatoes]
ref|XP_011003094.1|  PREDICTED: plastocyanin A, chloroplastic           163   3e-47   Populus euphratica
ref|XP_010666739.1|  PREDICTED: plastocyanin, chloroplastic             162   8e-47   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008806153.1|  PREDICTED: plastocyanin                            160   5e-46   Phoenix dactylifera
ref|XP_009401380.1|  PREDICTED: plastocyanin-like                       159   9e-46   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010063287.1|  PREDICTED: plastocyanin                            159   1e-45   Eucalyptus grandis [rose gum]
sp|P00289.2|PLAS_SPIOL  RecName: Full=Plastocyanin, chloroplastic...    159   1e-45   Spinacia oleracea
gb|KFK34454.1|  hypothetical protein AALP_AA5G147400                    158   3e-45   Arabis alpina [alpine rockcress]
ref|XP_010935182.1|  PREDICTED: plastocyanin B'/B''                     157   7e-45   Elaeis guineensis
ref|XP_006435266.1|  hypothetical protein CICLE_v10002698mg             156   1e-44   Citrus clementina [clementine]
ref|XP_010941357.1|  PREDICTED: plastocyanin B'/B''-like                154   9e-44   Elaeis guineensis
ref|XP_006828829.1|  hypothetical protein AMTR_s00001p00142570          150   2e-42   Amborella trichopoda
gb|ACC59118.1|  At1G20340-like protein                                  147   2e-41   Arabidopsis lyrata subsp. lyrata
gb|ACC59112.1|  At1G20340-like protein                                  147   2e-41   Arabidopsis lyrata subsp. petraea
ref|XP_009418692.1|  PREDICTED: plastocyanin-like                       147   4e-41   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAJ34813.1|  plastocyanine                                          147   9e-41   Plantago major [cart-track plant]
prf||0512262B  plastocyanin                                             143   2e-40
gb|ACC59110.1|  At1G20340-like protein                                  144   3e-40   Arabidopsis lyrata subsp. petraea
gb|ACC59120.1|  At1G20340-like protein                                  144   3e-40   Arabidopsis lyrata subsp. lyrata
gb|ACC59114.1|  At1G20340-like protein                                  142   1e-39   Arabidopsis lyrata subsp. petraea
gb|ACC59116.1|  At1G20340-like protein                                  142   2e-39   Arabidopsis lyrata subsp. petraea
prf||0512260A  plastocyanin                                             140   2e-39
pdb|1AG6|A  Chain A, Plastocyanin From Spinach                          140   2e-39   Spinacia oleracea
sp|P00290.1|PLAS_LACSA  RecName: Full=Plastocyanin                      140   3e-39   Lactuca sativa [cultivated lettuce]
sp|P00298.1|PLAS_RUMOB  RecName: Full=Plastocyanin                      139   7e-39   Rumex obtusifolius
sp|P00297.1|PLAS_SOLCR  RecName: Full=Plastocyanin                      139   9e-39   Solanum crispum
gb|ACC59126.1|  At1G20340-like protein                                  139   1e-38   Arabidopsis lyrata subsp. petraea
sp|P35477.1|PLAS2_TOBAC  RecName: Full=Plastocyanin B'/B''              138   2e-38   Nicotiana tabacum [American tobacco]
sp|P00292.1|PLAS_CUCPE  RecName: Full=Plastocyanin                      138   2e-38   Cucurbita pepo
pdb|2PCF|A  Chain A, The Complex Of Cytochrome F And Plastocyanin...    137   3e-38   Brassica rapa
sp|P00295.1|PLAS_MERPE  RecName: Full=Plastocyanin                      137   3e-38   Mercurialis perennis
pdb|1OOW|A  Chain A, The Crystal Structure Of The Spinach Plastoc...    137   3e-38   Spinacia oleracea
pdb|1TEF|A  Chain A, Crystal Structure Of The Spinach Plastocyani...    137   6e-38   Spinacia oleracea
pdb|1BYO|A  Chain A, Wild-Type Plastocyanin From Silene                 134   7e-37   Silene latifolia subsp. alba [white campion]
ref|WP_039311023.1|  hypothetical protein                               135   7e-37   
sp|P00291.1|PLAS_SAMNI  RecName: Full=Plastocyanin                      134   9e-37   Sambucus nigra
pdb|1TEG|A  Chain A, Crystal Structure Of The Spinach Plastocyani...    134   1e-36   Spinacia oleracea
sp|P00293.1|PLAS_CUCSA  RecName: Full=Plastocyanin                      133   1e-36   Cucumis sativus [cucumbers]
gb|AAR85968.1|  ERT10                                                   134   1e-36   Nicotiana tabacum [American tobacco]
gb|ABK21367.1|  unknown                                                 135   2e-36   Picea sitchensis
gb|ACN40088.1|  unknown                                                 135   2e-36   Picea sitchensis
sp|P35476.1|PLAS1_TOBAC  RecName: Full=Plastocyanin A'/A''              132   3e-36   Nicotiana tabacum [American tobacco]
sp|P00288.1|PLAS_VICFA  RecName: Full=Plastocyanin                      132   3e-36   Vicia faba [broad bean]
sp|P00287.1|PLAS_PHAVU  RecName: Full=Plastocyanin                      131   1e-35   Phaseolus vulgaris [French bean]
pdb|9PCY|A  Chain A, High-Resolution Solution Structure Of Reduce...    131   1e-35   Phaseolus vulgaris [French bean]
gb|EYU17553.1|  hypothetical protein MIMGU_mgv1a020878mg                133   1e-35   Erythranthe guttata [common monkey flower]
sp|P00294.1|PLAS_CAPBU  RecName: Full=Plastocyanin                      130   1e-35   Capsella bursa-pastoris
ref|WP_017428787.1|  hypothetical protein                               130   2e-35   Vibrio vulnificus
pdb|1BYP|A  Chain A, E43k,D44k Double Mutant Plastocyanin From Si...    130   2e-35   Silene latifolia subsp. alba [white campion]
gb|KHN20135.1|  Plastocyanin, chloroplastic                             130   3e-35   Glycine soja [wild soybean]
sp|P00296.1|PLAS_SOLTU  RecName: Full=Plastocyanin                      130   3e-35   Solanum tuberosum [potatoes]
gb|ACC59111.1|  At1G20340-like protein                                  128   4e-34   Arabidopsis lyrata subsp. petraea
pdb|1TKW|A  Chain A, The Transient Complex Of Poplar Plastocyanin...    126   9e-34   Populus nigra [black poplar]
pdb|4DP0|X  Chain X, The 1.5 Angstrom Crystal Structure Of Oxidiz...    124   7e-33   Populus nigra [black poplar]
pdb|1JXG|A  Chain A, The 1.6 A Resolution Crystal Structure Of A ...    123   2e-32   Populus nigra [black poplar]
ref|NP_001131447.1|  uncharacterized protein LOC100192779               124   2e-32   Zea mays [maize]
ref|XP_008648719.1|  PREDICTED: plastocyanin, chloroplastic-like        122   1e-31   Zea mays [maize]
sp|P17341.1|PLAS_PETCR  RecName: Full=Plastocyanin A/B                  119   6e-31   Petroselinum crispum
sp|P84338.1|PLAS_GINBI  RecName: Full=Plastocyanin                      117   2e-30   Ginkgo biloba [ginkgo]
gb|ACN31203.1|  unknown                                                 117   2e-30   Zea mays [maize]
gb|ACF87788.1|  unknown                                                 117   3e-30   Zea mays [maize]
ref|XP_004964252.1|  PREDICTED: plastocyanin, chloroplastic-like        117   1e-29   Setaria italica
emb|CAA68696.1|  plastocyanin precursor                                 115   4e-29   Hordeum vulgare [barley]
sp|P20422.1|PLAS_DAUCA  RecName: Full=Plastocyanin                      114   6e-29   Daucus carota [carrots]
ref|XP_002436310.1|  hypothetical protein SORBIDRAFT_10g000230          113   3e-28   Sorghum bicolor [broomcorn]
sp|P08248.1|PLAS_HORVU  RecName: Full=Plastocyanin, chloroplastic...    113   4e-28   Hordeum vulgare [barley]
ref|XP_003557292.1|  PREDICTED: plastocyanin, chloroplastic-like        113   5e-28   Brachypodium distachyon [annual false brome]
ref|XP_002965646.1|  hypothetical protein SELMODRAFT_167855             113   5e-28   Selaginella moellendorffii
gb|EPS65917.1|  plastocyanin major isoform, chloroplastic               112   1e-27   Genlisea aurea
ref|XP_004964214.1|  PREDICTED: LOW QUALITY PROTEIN: plastocyanin...    112   2e-27   
gb|KIZ00519.1|  Plastocyanin                                            111   2e-27   Monoraphidium neglectum
gb|EMT10023.1|  Plastocyanin, chloroplastic                             108   5e-27   
ref|NP_001056530.1|  Os06g0101600                                       110   5e-27   
gb|EAZ35518.1|  hypothetical protein OsJ_19799                          110   5e-27   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001752342.1|  plastocyanin, chloroplast precursor, isoform 2     110   5e-27   
ref|XP_001702952.1|  plastocyanin, chloroplast precursor                108   2e-26   Chlamydomonas reinhardtii
gb|ABA01106.1|  chloroplast plastocyanin                                107   6e-26   Chlamydomonas incerta
pdb|2PLT|A  Chain A, Structure Determination Of Plastocyanin From...    106   6e-26   Chlamydomonas reinhardtii
prf||1402235A  plastocyanin precursor                                   107   1e-25
gb|AAB63590.1|  plastocyanin precursor                                  106   2e-25   Oryza sativa Indica Group [Indian rice]
gb|EMS54647.1|  Plastocyanin, chloroplastic                             105   2e-25   Triticum urartu
ref|XP_002946937.1|  hypothetical protein VOLCADRAFT_79339              106   2e-25   Volvox carteri f. nagariensis
ref|XP_001757279.1|  plastocyanin, chloroplast precursor, isoform 1     106   2e-25   
ref|XP_006655671.1|  PREDICTED: plastocyanin, chloroplastic-like        106   2e-25   Oryza brachyantha
ref|XP_002946905.1|  hypothetical protein VOLCADRAFT_72905              105   3e-25   Volvox carteri f. nagariensis
ref|XP_005844862.1|  hypothetical protein CHLNCDRAFT_48299            99.4    2e-23   Chlorella variabilis
emb|CEF99226.1|  Blue (type 1) copper protein                           100   5e-23   Ostreococcus tauri
ref|XP_001779258.1|  plastocyanin, chloroplast precursor              99.8    1e-22   
gb|AAT45616.1|  plastocyanin precursor                                97.8    2e-22   Ulva pertusa
dbj|BAA77274.1|  plastocyanin precursor                               98.6    3e-22   Physcomitrella patens
sp|P13133.1|PLAS_ULVAR  RecName: Full=Plastocyanin                    96.7    3e-22   Ulva arasakii
sp|P56274.1|PLAS_ULVPE  RecName: Full=Plastocyanin                    96.3    4e-22   Ulva pertusa
sp|P00300.1|PLAS_SCEFU  RecName: Full=Plastocyanin                    95.5    6e-22   [Chlorella] fusca
dbj|BAE00064.1|  plastocyanin precursor                               95.9    2e-21   Pediastrum duplex
sp|P07465.1|PLAS_ULVPR  RecName: Full=Plastocyanin                    93.6    3e-21   Ulva prolifera
ref|XP_010497972.1|  PREDICTED: plastocyanin major isoform, chlor...  91.7    9e-21   
ref|XP_011397318.1|  Plastocyanin, chloroplastic                      91.7    7e-20   Auxenochlorella protothecoides
ref|XP_009617205.1|  PREDICTED: plastocyanin A'/A''-like              89.4    8e-20   
ref|XP_005642864.1|  Plastocyanin, chloroplastic                      90.1    2e-19   Coccomyxa subellipsoidea C-169
ref|XP_007510659.1|  predicted protein                                89.4    5e-19   Bathycoccus prasinos
sp|P26956.2|PLAS_ACUOB  RecName: Full=Plastocyanin, chloroplastic...  89.4    5e-19   Tetradesmus obliquus
ref|XP_003059601.1|  plastocyanin, chloroplast precursor              88.6    1e-18   Micromonas pusilla CCMP1545
gb|ACI87811.1|  putative plastocyanin chloroplast precursor           87.8    1e-18   Cupressus sempervirens
ref|XP_002504072.1|  plastocyanin, chloroplast precursor              88.6    1e-18   Micromonas commoda
dbj|BAA84778.1|  pre-apoplastocyanin                                  87.8    2e-18   Pseudopediastrum boryanum
dbj|BAI53540.1|  plastocyanin                                         86.3    2e-18   Thalassiosira oceanica
gb|EJK51127.1|  hypothetical protein THAOC_29732                      86.7    5e-18   Thalassiosira oceanica
ref|XP_003081409.1|  Plastocyanin (ISS)                               85.1    7e-18   
gb|EJK71623.1|  plastocyanin                                          86.7    2e-17   Thalassiosira oceanica
ref|XP_001419657.1|  plastocyanin, chloroplast precursor              83.6    3e-17   Ostreococcus lucimarinus CCE9901
ref|XP_005769827.1|  hypothetical protein EMIHUDRAFT_65950            82.4    8e-17   Emiliania huxleyi CCMP1516
ref|XP_002946904.1|  hypothetical protein VOLCADRAFT_86971            79.7    2e-15   Volvox carteri f. nagariensis
ref|WP_036020768.1|  plastocyanin                                     78.2    4e-15   
gb|EKV01958.1|  plastocyanin                                          78.6    4e-15   Leptolyngbya sp. PCC 7375
gb|AAR15395.1|  plastocyanin                                          76.3    5e-15   Arabidopsis thaliana [mouse-ear cress]
ref|WP_031292772.1|  plastocyanin                                     77.0    1e-14   Leptolyngbya sp. Heron Island J
gb|ESA36208.1|  plastocyanin                                          77.0    1e-14   Leptolyngbya sp. Heron Island J
ref|WP_013321254.1|  plasmid stabilization protein                    75.9    3e-14   Cyanothece sp. PCC 7822
ref|WP_015956505.1|  plasmid stabilization protein                    74.7    9e-14   Cyanothece sp. PCC 7424
ref|WP_015225957.1|  plastocyanin                                     75.5    1e-13   Halothece sp. PCC 7418
gb|KGN60067.1|  hypothetical protein Csa_3G875435                     72.8    3e-13   Cucumis sativus [cucumbers]
ref|WP_008317432.1|  plastocyanin                                     73.2    4e-13   Leptolyngbya sp. PCC 6406
pdb|1PCS|A  Chain A, The 2.15 A Crystal Structure Of A Triple Mut...  71.6    5e-13   Synechocystis sp. PCC 6803
ref|WP_038018851.1|  plastocyanin                                     71.2    1e-12   
gb|EDX87188.1|  plastocyanin                                          71.6    1e-12   Synechococcus sp. PCC 7335
ref|WP_027402710.1|  plasmid stabilization protein                    71.6    1e-12   Aphanizomenon flos-aquae
ref|WP_015225956.1|  plastocyanin                                     71.2    1e-12   Halothece sp. PCC 7418
ref|WP_015192812.1|  Plastocyanin                                     71.2    2e-12   Stanieria cyanosphaera
ref|WP_015230620.1|  plastocyanin                                     71.6    3e-12   Dactylococcopsis salina
ref|WP_039728071.1|  MULTISPECIES: hypothetical protein               69.7    7e-12   Lyngbya confervoides
ref|WP_017300201.1|  hypothetical protein                             69.3    1e-11   Nodosilinea nodulosa
ref|WP_006040850.1|  plasmid stabilization protein                    67.8    2e-11   Synechococcus sp. WH 7805
ref|WP_011932662.1|  plasmid stabilization protein                    67.8    2e-11   Synechococcus sp. WH 7803
ref|WP_011125233.1|  MULTISPECIES: plasmid stabilization protein      67.8    3e-11   Prochlorococcus
gb|ABF73014.1|  plastocyanin protein precursor                        68.9    3e-11   Karenia brevis
ref|WP_011826461.1|  plasmid stabilization protein                    67.4    3e-11   
ref|WP_036909788.1|  plastocyanin                                     67.4    3e-11   Prochlorococcus marinus
ref|WP_035985880.1|  plastocyanin                                     67.0    5e-11   Leptolyngbya sp. KIOST-1
ref|WP_019505408.1|  hypothetical protein                             66.6    6e-11   Pleurocapsa sp. PCC 7319
ref|WP_006853238.1|  plasmid stabilization protein                    66.2    7e-11   Synechococcus
ref|WP_009790047.1|  plasmid stabilization protein                    66.2    7e-11   Synechococcus sp. BL107
ref|WP_011619806.1|  plasmid stabilization protein                    66.2    8e-11   Synechococcus sp. CC9311
ref|WP_038001227.1|  plastocyanin                                     66.2    9e-11   Synechococcus sp. RS9917
gb|EAQ69854.1|  Plastocyanin, PetE                                    65.9    9e-11   Synechococcus sp. RS9917
ref|WP_009631096.1|  plastocyanin                                     66.2    9e-11   Synechocystis sp. PCC 7509
ref|WP_032517727.1|  plastocyanin                                     65.9    1e-10   Prochlorococcus marinus
ref|WP_011129826.1|  plasmid stabilization protein                    65.9    1e-10   Prochlorococcus marinus
gb|KGG19418.1|  Plastocyanin                                          65.1    1e-10   Prochlorococcus marinus str. PAC1
ref|WP_025971905.1|  plastocyanin                                     65.5    1e-10   
ref|WP_015144857.1|  plastocyanin                                     65.5    1e-10   Pleurocapsa minor
ref|WP_025953606.1|  plastocyanin                                     65.1    1e-10   
ref|WP_026722374.1|  plasmid stabilization protein                    65.9    2e-10   Fischerella sp. PCC 9431
ref|WP_007097487.1|  plasmid stabilization protein                    65.5    2e-10   Synechococcus sp. RS9916
ref|WP_042850028.1|  plastocyanin                                     65.1    2e-10   Prochlorococcus sp. MIT 0604
ref|WP_011376137.1|  plasmid stabilization protein                    65.1    2e-10   Prochlorococcus marinus
ref|WP_025880926.1|  MULTISPECIES: plastocyanin                       65.1    2e-10   
ref|WP_032522556.1|  plastocyanin                                     65.1    2e-10   Prochlorococcus marinus
ref|WP_029967456.1|  MULTISPECIES: plastocyanin                       65.1    2e-10   
ref|WP_015219275.1|  Plastocyanin                                     65.5    2e-10   Cyanobacterium aponinum
gb|EAQ74137.1|  plastocyanin precursor                                65.5    2e-10   Synechococcus sp. WH 5701
ref|WP_032514940.1|  plastocyanin                                     65.1    2e-10   Prochlorococcus marinus
ref|WP_029976914.1|  plastocyanin                                     65.1    2e-10   Prochlorococcus
ref|WP_012007398.1|  plasmid stabilization protein                    65.1    2e-10   Prochlorococcus marinus
ref|WP_011818085.1|  plasmid stabilization protein                    65.1    2e-10   Prochlorococcus marinus
ref|WP_036907020.1|  plastocyanin                                     65.1    2e-10   Prochlorococcus marinus
ref|WP_037980572.1|  plastocyanin                                     65.1    2e-10   
ref|WP_025894221.1|  MULTISPECIES: plastocyanin                       65.1    2e-10   Prochlorococcus
ref|WP_032518600.1|  plastocyanin                                     65.1    2e-10   Prochlorococcus marinus
gb|ERT07823.1|  plastocyanin                                          65.1    2e-10   Lyngbya aestuarii BL J
ref|WP_011823363.1|  plasmid stabilization protein                    65.1    2e-10   Prochlorococcus marinus
ref|WP_025928216.1|  plastocyanin                                     64.7    2e-10   
ref|WP_032526878.1|  plastocyanin                                     64.7    2e-10   Prochlorococcus marinus
ref|WP_011293551.1|  MULTISPECIES: plasmid stabilization protein      64.7    2e-10   Prochlorococcus
ref|WP_011862597.1|  plasmid stabilization protein                    64.7    2e-10   Prochlorococcus marinus
ref|WP_036897626.1|  plastocyanin                                     64.7    3e-10   
pdb|1BAW|A  Chain A, Plastocyanin From Phormidium Laminosum           64.3    3e-10   Phormidium laminosum
ref|WP_040483857.1|  plastocyanin                                     65.1    3e-10   Lyngbya aestuarii
sp|Q51883.1|PLAS_PHOLA  RecName: Full=Plastocyanin; Flags: Precursor  65.1    3e-10   Phormidium laminosum
ref|WP_015157412.1|  MULTISPECIES: plastocyanin                       64.7    3e-10   Cyanobacteria [blue-green bacteria]
pdb|2W88|A  Chain A, Plastocyanin Variant With N-Terminal Methion...  64.3    3e-10   Phormidium laminosum
ref|WP_011359718.1|  plasmid stabilization protein                    64.3    3e-10   Synechococcus sp. CC9902
ref|WP_029979790.1|  plastocyanin                                     64.3    4e-10   
ref|WP_029973799.1|  MULTISPECIES: plastocyanin                       64.3    4e-10   
ref|WP_036902685.1|  plastocyanin                                     64.3    4e-10   Prochlorococcus sp. MIT 0601
ref|WP_017315087.1|  hypothetical protein                             64.7    4e-10   Mastigocladopsis repens
ref|WP_017321616.1|  hypothetical protein                             64.3    4e-10   cyanobacterium PCC 7702
ref|WP_036921917.1|  plastocyanin                                     63.9    4e-10   
ref|WP_035997141.1|  hypothetical protein                             64.3    4e-10   [Leptolyngbya] sp. JSC-1
ref|WP_011819960.1|  plasmid stabilization protein                    63.9    5e-10   Prochlorococcus marinus
ref|WP_016874133.1|  hypothetical protein                             64.3    5e-10   Chlorogloeopsis fritschii
pdb|1M9W|A  Chain A, Study Of Electrostatic Potential Surface Dis...  63.5    5e-10   Synechocystis sp.
ref|WP_025930004.1|  plastocyanin                                     63.9    5e-10   
ref|WP_016859453.1|  hypothetical protein                             64.3    5e-10   Fischerella muscicola
ref|WP_011132215.1|  plasmid stabilization protein                    63.9    5e-10   Prochlorococcus marinus
ref|WP_010873453.1|  plasmid stabilization protein                    63.9    5e-10   Synechocystis
ref|YP_002049485.1|  plastocyanin precursor                           63.9    5e-10   Paulinella chromatophora
pdb|1JXD|A  Chain A, Solution Structure Of Reduced Cu(i) Plastocy...  63.2    6e-10   Synechocystis sp. PCC 6803
pdb|1JXF|A  Chain A, Solution Structure Of Reduced Cu(I) Plastocy...  63.2    6e-10   Synechocystis sp. PCC 6803
ref|WP_009458210.1|  MULTISPECIES: plasmid stabilization protein      63.9    6e-10   Fischerella
ref|WP_015222944.1|  plastocyanin                                     63.5    7e-10   
ref|WP_017746015.1|  hypothetical protein                             63.9    7e-10   Scytonema hofmannii
ref|WP_002767959.1|  plasmid stabilization protein                    63.5    7e-10   Microcystis aeruginosa
ref|WP_016867973.1|  hypothetical protein                             63.9    7e-10   Fischerella muscicola
ref|WP_043690568.1|  plastocyanin                                     63.5    7e-10   
ref|WP_019480558.1|  hypothetical protein                             63.5    8e-10   
ref|WP_036480972.1|  plastocyanin                                     63.5    8e-10   
gb|KIE13022.1|  plasmid stabilization protein                         63.5    8e-10   
ref|WP_036917902.1|  plastocyanin                                     63.2    8e-10   
ref|WP_036915640.1|  MULTISPECIES: plastocyanin                       63.2    9e-10   
gb|KGG17684.1|  Plastocyanin                                          63.2    9e-10   
pdb|3CVB|A  Chain A, Regulation Of Protein Function: Crystal Pack...  62.8    9e-10   
ref|WP_039201212.1|  plasmid stabilization protein                    63.5    1e-09   
gb|KGG25074.1|  Plastocyanin                                          63.2    1e-09   
ref|WP_032513837.1|  plastocyanin                                     62.8    1e-09   
pdb|1BXU|A  Chain A, Oxidized Plastocyanin From Synechococcus Sp      62.4    1e-09   
ref|WP_011128361.1|  plasmid stabilization protein                    62.4    2e-09   
ref|WP_002746902.1|  plastocyanin                                     62.4    2e-09   
ref|WP_011242773.1|  MULTISPECIES: plasmid stabilization protein      62.4    2e-09   
ref|WP_002807474.1|  plasmid stabilization protein                    62.4    2e-09   
ref|WP_002762125.1|  plasmid stabilization protein                    62.4    2e-09   
ref|WP_008203920.1|  plasmid stabilization protein                    62.4    2e-09   
ref|WP_002788485.1|  plasmid stabilization protein                    62.4    2e-09   
ref|WP_038545450.1|  plastocyanin                                     62.4    2e-09   
dbj|GAL92755.1|  plastocyanin                                         62.4    2e-09   
ref|WP_016514269.1|  Plastocyanin precursor                           62.4    2e-09   
ref|WP_041391543.1|  plastocyanin                                     62.4    2e-09   
ref|WP_002731857.1|  plastocyanin                                     62.4    2e-09   
ref|WP_036946790.1|  plastocyanin                                     62.4    2e-09   
ref|WP_041245007.1|  plasmid stabilization protein                    62.0    2e-09   
gb|ABX09002.1|  plastocyanin                                          62.4    2e-09   
gb|AGY58719.1|  plastocyanin                                          62.4    2e-09   
ref|WP_009546669.1|  MULTISPECIES: plasmid stabilization protein      62.0    2e-09   
ref|WP_028948639.1|  plastocyanin                                     62.0    2e-09   
ref|WP_041243922.1|  plasmid stabilization protein                    62.4    2e-09   
ref|WP_025938088.1|  plastocyanin                                     62.0    3e-09   
ref|WP_009784787.1|  plasmid stabilization protein                    62.0    3e-09   
ref|WP_041036691.1|  plasmid stabilization protein                    62.4    3e-09   
ref|WP_015122289.1|  plastocyanin                                     62.0    3e-09   
ref|WP_027841742.1|  plasmid stabilization protein                    62.0    3e-09   
ref|WP_028952387.1|  plastocyanin                                     61.6    3e-09   
gb|AGY59982.1|  plastocyanin                                          62.4    3e-09   
ref|WP_017663445.1|  hypothetical protein                             61.6    3e-09   
ref|WP_015214000.1|  Plastocyanin                                     62.0    4e-09   
ref|WP_012267898.1|  plasmid stabilization protein                    61.6    4e-09   
ref|WP_002782424.1|  Plastocyanin                                     61.2    5e-09   
ref|WP_015183589.1|  plastocyanin                                     61.6    5e-09   
ref|WP_002796335.1|  plasmid stabilization protein                    61.2    5e-09   
ref|WP_035827577.1|  plastocyanin                                     60.8    5e-09   
ref|WP_017310502.1|  MULTISPECIES: hypothetical protein               61.2    5e-09   
ref|WP_007306494.1|  plasmid stabilization protein                    61.2    5e-09   
ref|WP_011142337.1|  plastocyanin                                     60.8    6e-09   
ref|WP_002800865.1|  plasmid stabilization protein                    60.8    6e-09   
ref|WP_009556596.1|  plastocyanin                                     61.2    6e-09   
ref|WP_002753994.1|  plasmid stabilization protein                    60.8    7e-09   
ref|WP_002794567.1|  plasmid stabilization protein                    60.8    7e-09   
ref|WP_015208361.1|  plastocyanin                                     60.8    7e-09   
ref|WP_028084748.1|  plasmid stabilization protein                    60.8    7e-09   
ref|WP_039747464.1|  plasmid stabilization protein                    60.8    8e-09   
pdb|3BQV|A  Chain A, Crystal Structure Of The Double Mutant D44a ...  60.1    8e-09   
ref|WP_011319499.1|  plasmid stabilization protein                    60.8    9e-09   
ref|WP_017652446.1|  hypothetical protein                             60.8    9e-09   
ref|WP_015078369.1|  plastocyanin                                     60.5    1e-08   
ref|WP_026733473.1|  plasmid stabilization protein                    60.5    1e-08   
ref|WP_006511449.1|  plastocyanin                                     60.1    1e-08   
ref|WP_006196305.1|  plasmid stabilization protein                    60.5    1e-08   
ref|WP_036931477.1|  plastocyanin                                     60.1    1e-08   
pdb|2JXM|A  Chain A, Ensemble Of Twenty Structures Of The Prochlo...  59.7    1e-08   
pdb|1B3I|A  Chain A, Nmr Solution Structure Of Plastocyanin From ...  59.7    1e-08   
ref|WP_028089330.1|  plasmid stabilization protein                    60.1    1e-08   
gb|AAD09144.1|  plastocyanin precursor                                60.1    1e-08   
ref|WP_042157162.1|  plasmid stabilization protein                    59.7    1e-08   
ref|WP_017294320.1|  hypothetical protein                             59.7    1e-08   
ref|WP_012595533.1|  MULTISPECIES: plasmid stabilization protein      59.7    1e-08   
ref|WP_016924140.1|  hypothetical protein                             60.1    1e-08   
sp|P50057.2|PLAS_PROHO  RecName: Full=Plastocyanin; Flags: Precursor  59.7    2e-08   
ref|WP_044106143.1|  plastocyanin                                     59.7    2e-08   
gb|KEI66171.1|  hypothetical protein A19Y_1058                        60.1    2e-08   
ref|WP_015189025.1|  Plastocyanin                                     59.7    2e-08   
ref|WP_026079923.1|  plastocyanin                                     58.9    2e-08   
ref|WP_044258939.1|  plasmid stabilization protein                    59.3    2e-08   
ref|WP_018397198.1|  hypothetical protein                             59.3    3e-08   
ref|WP_015131855.1|  Plastocyanin                                     59.3    3e-08   
ref|WP_022604415.1|  plastocyanin                                     59.3    3e-08   
emb|CCH65168.1|  Plastocyanin                                         58.9    3e-08   
ref|WP_010994435.1|  plasmid stabilization protein                    59.3    3e-08   
ref|WP_024969793.1|  plastocyanin                                     58.9    3e-08   
ref|WP_026794242.1|  MULTISPECIES: hypothetical protein               58.9    3e-08   
pdb|2GIM|A  Chain A, 1.6 Angstrom Structure Of Plastocyanin From ...  58.2    4e-08   
sp|P0C178.1|PLAS_ANAVA  RecName: Full=Plastocyanin                    58.2    4e-08   
ref|WP_040054772.1|  plastocyanin                                     58.5    4e-08   
ref|WP_002774547.1|  plasmid stabilization protein                    58.2    5e-08   
ref|WP_016950846.1|  hypothetical protein                             58.5    5e-08   
ref|WP_027249144.1|  hypothetical protein                             58.5    5e-08   
ref|WP_017325438.1|  hypothetical protein                             58.2    5e-08   
ref|WP_043937431.1|  MULTISPECIES: hypothetical protein               58.2    6e-08   
ref|WP_013190370.1|  plasmid stabilization protein                    58.2    6e-08   
ref|WP_041699638.1|  plastocyanin                                     57.8    7e-08   
ref|WP_034937821.1|  plastocyanin                                     57.8    7e-08   
ref|WP_041434573.1|  plastocyanin                                     57.8    7e-08   
ref|WP_037216724.1|  plasmid stabilization protein                    58.2    7e-08   
ref|WP_008274564.1|  plasmid stabilization protein                    57.8    7e-08   
gb|ELR96577.1|  plastocyanin                                          58.2    7e-08   
gb|AFY70659.1|  plastocyanin                                          57.8    8e-08   
ref|WP_044492486.1|  plastocyanin                                     57.8    8e-08   
gb|KIJ81004.1|  plasmid stabilization protein                         57.8    8e-08   
gb|ABB34773.1|  type I copper blue protein: plastocyanin              57.8    8e-08   
ref|WP_015141538.1|  plastocyanin                                     57.8    8e-08   
ref|WP_029638746.1|  plasmid stabilization protein [                  57.8    8e-08   
ref|WP_012953644.1|  plasmid stabilization protein                    57.8    8e-08   
emb|CDP13124.1|  unnamed protein product                              53.5    1e-07   
emb|CDN10551.1|  Plastocyanin                                         57.4    1e-07   
gb|EGJ34187.1|  plastocyanin                                          58.2    2e-07   
ref|WP_015122926.1|  plastocyanin                                     57.0    2e-07   
ref|WP_011142273.1|  plastocyanin                                     57.0    2e-07   
ref|WP_015170323.1|  plastocyanin                                     56.6    2e-07   
ref|WP_038555756.1|  plastocyanin                                     56.2    2e-07   
gb|AHF64031.1|  type I copper blue protein: plastocyanin              56.2    2e-07   
ref|WP_012409315.1|  plasmid stabilization protein                    56.6    2e-07   
ref|WP_008234430.1|  Plastocyanin                                     56.2    3e-07   
ref|WP_015116072.1|  Plastocyanin                                     56.2    3e-07   
ref|WP_035153944.1|  plasmid stabilization protein                    56.2    3e-07   
ref|WP_017306248.1|  hypothetical protein                             55.8    3e-07   
ref|YP_007675147.1|  plastocyanin                                     55.1    6e-07   
ref|WP_040935188.1|  hypothetical protein                             54.3    9e-07   
gb|ABG81099.1|  b-plastocyanin                                        53.1    1e-06   
ref|WP_025781494.1|  plastocyanin                                     53.9    1e-06   
ref|YP_004324253.1|  plastocyanin                                     53.5    2e-06   
gb|ABI14385.1|  chloroplast plastocyanin                              55.5    2e-06   
ref|WP_019476653.1|  hypothetical protein                             53.1    2e-06   
ref|WP_011430443.1|  plasmid stabilization protein                    53.9    2e-06   
ref|WP_011433401.1|  plasmid stabilization protein                    53.9    2e-06   
gb|ABI14389.1|  plastocyanin                                          55.1    2e-06   
ref|XP_010497754.1|  PREDICTED: plastocyanin major isoform, chlor...  52.4    2e-06   
gb|ABV22214.1|  chloroplast plastocyanin                              55.1    2e-06   
ref|WP_040935616.1|  hypothetical protein                             53.9    2e-06   
gb|ACU45258.1|  chloroplast plastocyanin                              53.1    2e-06   
ref|WP_041237905.1|  plastocyanin                                     53.5    3e-06   
ref|WP_015196594.1|  Plastocyanin                                     53.1    3e-06   
gb|ABV22213.1|  chloroplast plastocyanin                              54.7    3e-06   
gb|ACK68622.1|  plastocyanin                                          53.1    4e-06   
ref|WP_040932314.1|  plastocyanin                                     52.8    4e-06   
gb|ABA55542.1|  chloroplast plastocyanin                              53.9    4e-06   
ref|XP_010266913.1|  PREDICTED: plastocyanin, chloroplastic-like      55.1    4e-06   
ref|WP_009628773.1|  plastocyanin                                     52.8    4e-06   
ref|WP_019492696.1|  hypothetical protein                             52.8    5e-06   
ref|WP_004515200.1|  putative copper-binding plastocyanin             52.8    8e-06   
gb|AJF26762.1|  copper-binding protein                                52.8    8e-06   
ref|WP_008309655.1|  putative copper-binding plastocyanin             52.8    8e-06   
ref|WP_009149666.1|  plasmid stabilization protein                    52.0    8e-06   
ref|YP_007673120.1|  plastocyanin                                     51.6    9e-06   
ref|YP_007677291.1|  plastocyanin                                     51.2    1e-05   
ref|WP_007189902.1|  copper-binding plastocyanin like protein         52.0    1e-05   
gb|AGG54475.1|  plastocyanin                                          51.2    1e-05   
ref|WP_004962154.1|  putative copper-binding plastocyanin             52.0    1e-05   
emb|CDP13123.1|  unnamed protein product                              49.7    1e-05   
ref|WP_004593070.1|  putative copper-binding plastocyanin             52.0    2e-05   
ref|WP_015168859.1|  plastocyanin                                     50.8    2e-05   
ref|WP_009344419.1|  plasmid stabilization protein                    51.2    2e-05   
ref|YP_007877748.1|  plastocyanin                                     50.4    3e-05   
ref|WP_014040111.1|  copper-binding protein                           50.8    4e-05   
ref|WP_011222994.1|  copper-binding protein                           50.4    5e-05   
ref|WP_006276583.1|  plasmid stabilization protein                    49.7    6e-05   
ref|YP_007518190.1|  plastocyanin                                     48.9    7e-05   
ref|WP_005534868.1|  putative copper-binding plastocyanin             50.1    7e-05   
ref|YP_004322709.1|  plastocyanin                                     48.9    9e-05   
ref|YP_004323936.1|  plastocyanin                                     48.9    1e-04   
ref|YP_004322382.1|  plastocyanin                                     48.5    1e-04   
ref|WP_012945098.1|  hypothetical protein                             48.9    1e-04   
ref|YP_007675568.1|  plastocyanin                                     48.5    1e-04   
ref|YP_717784.1|  plastocyanin                                        48.5    1e-04   
ref|YP_004324561.1|  plastocyanin                                     48.1    1e-04   
ref|WP_015763084.1|  halocyanin                                       48.5    2e-04   
ref|WP_028827273.1|  hypothetical protein                             48.1    2e-04   
ref|YP_007877958.1|  plastocyanin                                     47.8    2e-04   
ref|YP_007001821.1|  PetE plastocyanine                               47.4    3e-04   
ref|YP_008125631.1|  plastocyanin                                     47.4    3e-04   
pdb|2BZ7|A  Chain A, Oxidized And Reduced Structures Of A Mutant ...  47.4    3e-04   
ref|YP_004323008.1|  plastocyanin                                     47.0    4e-04   
ref|YP_008126407.1|  plastocyanin                                     47.0    4e-04   
ref|YP_009007955.1|  plastocyanine                                    46.2    5e-04   
ref|YP_003097354.1|  plastocyanin                                     46.2    8e-04   
gb|AHG02640.1|  copper-binding protein                                47.0    0.001   



>ref|XP_002510603.1| Plastocyanin A, chloroplast precursor, putative [Ricinus communis]
 gb|EEF52790.1| Plastocyanin A, chloroplast precursor, putative [Ricinus communis]
Length=168

 Score =   192 bits (487),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 130/152 (86%), Gaps = 1/152 (1%)
 Frame = +2

Query  68   MASVTSAAVAIPSFTGLKAAGASSSSRTAVKLAAAPT-PKLAIKASLKNFGaaviataas  244
            MA+VTSAAVAIPSFTGLKAA A+S+   A    AAP+ P+++IKAS+K  G AV+ATAAS
Sbjct  1    MATVTSAAVAIPSFTGLKAASAASTKVNASAKVAAPSLPRMSIKASMKEVGVAVMATAAS  60

Query  245  allatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVD  424
            A+LA+NA+A E+ LGSDDGGLAFVP+  SVA GE IVFKNNAGFPH ++FDEDE+PSGVD
Sbjct  61   AMLASNAMAIEILLGSDDGGLAFVPNSFSVAPGEKIVFKNNAGFPHNIVFDEDEVPSGVD  120

Query  425  AAKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
            A KISM+E DLLN PGETY+VTLTEKGTYS+Y
Sbjct  121  AGKISMSEEDLLNGPGETYAVTLTEKGTYSFY  152



>ref|XP_004291323.1| PREDICTED: plastocyanin [Fragaria vesca subsp. vesca]
Length=167

 Score =   189 bits (480),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 110/151 (73%), Positives = 131/151 (87%), Gaps = 0/151 (0%)
 Frame = +2

Query  68   MASVTSAAVAIPSFTGLKAAGASSSSRTAVKLAAAPTPKLAIKASLKNFGaaviataasa  247
            MA+VT AAVAIPSFTGLK+AGA+    T+VK++AA  P+++IK+SLKN G AV ATAASA
Sbjct  1    MATVTPAAVAIPSFTGLKSAGATKLVPTSVKVSAASVPRMSIKSSLKNVGVAVAATAASA  60

Query  248  llatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDA  427
            LLA+NALA E+ LG+ DG LAFVP++ SV++G+ IVFKNNAGFPH V+FDEDEIP GVDA
Sbjct  61   LLASNALAIEILLGASDGSLAFVPNDFSVSAGDKIVFKNNAGFPHNVVFDEDEIPGGVDA  120

Query  428  AKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
             KISM+E DLLNAPGETYSVTLTEKGTYS+Y
Sbjct  121  GKISMSEEDLLNAPGETYSVTLTEKGTYSFY  151



>gb|KDP36868.1| hypothetical protein JCGZ_08159 [Jatropha curcas]
Length=168

 Score =   187 bits (475),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 130/152 (86%), Gaps = 1/152 (1%)
 Frame = +2

Query  68   MASVTSAAVAIPSFTGLKAA-GASSSSRTAVKLAAAPTPKLAIKASLKNFGaaviataas  244
            MA+VTSAAV IPSFTGLKAA G ++    +VK AA P P+L++KAS+K+ G AV+ATAAS
Sbjct  1    MAAVTSAAVGIPSFTGLKAANGTTAKVNASVKPAACPVPRLSVKASMKDVGVAVVATAAS  60

Query  245  allatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVD  424
            A+LA+NA+A EV LG DDG LAFVPS+ SVA GETIVFKNNAGFPH VIFDEDEIP GVD
Sbjct  61   AILASNAMAVEVLLGGDDGSLAFVPSDFSVAPGETIVFKNNAGFPHNVIFDEDEIPGGVD  120

Query  425  AAKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
            A+KISM+E DLLNAPGETY VTLTEKG+Y++Y
Sbjct  121  ASKISMSEEDLLNAPGETYKVTLTEKGSYAFY  152



>ref|XP_011074720.1| PREDICTED: plastocyanin-like [Sesamum indicum]
Length=166

 Score =   186 bits (471),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 108/151 (72%), Positives = 127/151 (84%), Gaps = 1/151 (1%)
 Frame = +2

Query  68   MASVTSAAVAIPSFTGLKAAGASSSSRTAVKLAAAPTPKLAIKASLKNFGaaviataasa  247
            MA+VTSAAV+IPSFTGLKA  ++S+  T V++AAA  PKLA+KASLK+FG AV ATAASA
Sbjct  1    MAAVTSAAVSIPSFTGLKAGASASNKPTTVRVAAA-APKLAVKASLKDFGVAVAATAASA  59

Query  248  llatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDA  427
            +LA+NALA E+ LG DDG LAF+P    VA+GE IVF NNAGFPH ++FDEDE+PSGVD 
Sbjct  60   ILASNALAIEITLGGDDGSLAFIPQNFEVAAGEKIVFTNNAGFPHNIVFDEDEVPSGVDV  119

Query  428  AKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
            AKISM E DLLNA GETY+VTLTEKGTYS+Y
Sbjct  120  AKISMAEEDLLNAKGETYAVTLTEKGTYSFY  150



>ref|XP_002893099.1| DNA-damage-repair/toleration protein 112 [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH69358.1| DNA-damage-repair/toleration protein 112 [Arabidopsis lyrata 
subsp. lyrata]
Length=167

 Score =   185 bits (469),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 103/151 (68%), Positives = 118/151 (78%), Gaps = 0/151 (0%)
 Frame = +2

Query  68   MASVTSAAVAIPSFTGLKAAGASSSSRTAVKLAAAPTPKLAIKASLKNFGaaviataasa  247
            MASVTSA VAIPSFTGLKA+   SS+   ++ AA  +PKL +K+SLKNFG A +A  AS 
Sbjct  1    MASVTSATVAIPSFTGLKASTIKSSATVRIQTAAVASPKLTVKSSLKNFGVAAVAAVASI  60

Query  248  llatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDA  427
             LA NA+A EV LG  DG LAF+P++ SVA GE IVFKNNAGFPH V+FDEDEIPSGVD 
Sbjct  61   SLAGNAMAIEVLLGGGDGALAFIPNDFSVAKGEKIVFKNNAGFPHNVVFDEDEIPSGVDV  120

Query  428  AKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
            AKISM+E DLLNA GETY V LTE GTYS+Y
Sbjct  121  AKISMDEQDLLNAAGETYEVALTEPGTYSFY  151



>ref|XP_004238398.1| PREDICTED: plastocyanin, chloroplastic [Solanum lycopersicum]
 sp|P17340.1|PLAS_SOLLC RecName: Full=Plastocyanin, chloroplastic; Flags: Precursor [Solanum 
lycopersicum]
 emb|CAA32121.1| unnamed protein product [Solanum lycopersicum]
Length=170

 Score =   183 bits (464),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 110/155 (71%), Positives = 129/155 (83%), Gaps = 5/155 (3%)
 Frame = +2

Query  68   MASVTSAAVAIPSFTGLKAAGASSSSRTAV----KLAAAPTPKLAIKASLKNFGaaviat  235
            MA+VTSAAVAIPSFTGLKA GASSSSR +     K+AAAP  +L +KASLK+ GA V AT
Sbjct  1    MATVTSAAVAIPSFTGLKA-GASSSSRVSTGASAKVAAAPVARLTVKASLKDVGAVVAAT  59

Query  236  aasallatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPS  415
            A SA+LA+NA+A EV LG DDG LAF+P   SV++GE I FKNNAGFPH V+FDEDEIP+
Sbjct  60   AVSAMLASNAMALEVLLGGDDGSLAFIPGNFSVSAGEKITFKNNAGFPHNVVFDEDEIPA  119

Query  416  GVDAAKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
            GVDA+KISM+E DLLNA GETYSVTL+EKGTY++Y
Sbjct  120  GVDASKISMSEEDLLNAAGETYSVTLSEKGTYTFY  154



>gb|KJB58028.1| hypothetical protein B456_009G190800 [Gossypium raimondii]
Length=167

 Score =   182 bits (463),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 106/151 (70%), Positives = 126/151 (83%), Gaps = 0/151 (0%)
 Frame = +2

Query  68   MASVTSAAVAIPSFTGLKAAGASSSSRTAVKLAAAPTPKLAIKASLKNFGaaviataasa  247
            MA++TSAAVAIPSFTGLKA   ++      K+AA+P P+++IKASLK+ G AV ATAASA
Sbjct  1    MATITSAAVAIPSFTGLKAGATAAKVSATAKVAASPVPRVSIKASLKDVGVAVAATAASA  60

Query  248  llatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDA  427
            +LA+NA+A EV LGSDDGGLAF+P E SV+ GE IVFKNNAGFPH V+FDEDEIPSGVD 
Sbjct  61   ILASNAMAIEVLLGSDDGGLAFIPQEFSVSPGEKIVFKNNAGFPHNVVFDEDEIPSGVDV  120

Query  428  AKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
            +KISM E +LLNA  ETY+VTLTEKGTYS+Y
Sbjct  121  SKISMPEEELLNAKDETYAVTLTEKGTYSFY  151



>ref|XP_008387896.1| PREDICTED: plastocyanin [Malus domestica]
Length=166

 Score =   182 bits (462),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 108/151 (72%), Positives = 128/151 (85%), Gaps = 1/151 (1%)
 Frame = +2

Query  68   MASVTSAAVAIPSFTGLKAAGASSSSRTAVKLAAAPTPKLAIKASLKNFGaaviataasa  247
            MASVT AAV IPSFTGLK++GA+  S  AVK++A+P     +K+SLK+ G AV ATAASA
Sbjct  1    MASVTPAAVTIPSFTGLKSSGAAKVS-AAVKVSASPRQMCVVKSSLKDVGVAVAATAASA  59

Query  248  llatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDA  427
            +LA+NA+A EV LGSDDGGLAFVP+  SVA GE IVFKNNAGFPH ++FDEDE+PSGVDA
Sbjct  60   ILASNAMAIEVLLGSDDGGLAFVPNSFSVAPGEKIVFKNNAGFPHNIVFDEDEVPSGVDA  119

Query  428  AKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
             KISM+E DLLNAPGETY+VTLTEKG+YS+Y
Sbjct  120  GKISMSEEDLLNAPGETYAVTLTEKGSYSFY  150



>ref|XP_007017921.1| Plastocyanin 1 [Theobroma cacao]
 gb|EOY15146.1| Plastocyanin 1 [Theobroma cacao]
Length=167

 Score =   182 bits (461),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 109/151 (72%), Positives = 127/151 (84%), Gaps = 0/151 (0%)
 Frame = +2

Query  68   MASVTSAAVAIPSFTGLKAAGASSSSRTAVKLAAAPTPKLAIKASLKNFGaaviataasa  247
            MA+VTSAAVAIPSFTGLKA    + +    K+A +  P L+IKASLK+ G AV ATAASA
Sbjct  1    MAAVTSAAVAIPSFTGLKAGATPAKASATTKVATSSGPMLSIKASLKDVGVAVAATAASA  60

Query  248  llatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDA  427
            +LA+NALA EVKLG DDG LAFVPS+ SV++GE IVFKNNAGFPH VIFDEDEIPSGVDA
Sbjct  61   ILASNALAIEVKLGGDDGELAFVPSDFSVSAGEKIVFKNNAGFPHNVIFDEDEIPSGVDA  120

Query  428  AKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
            +KISM++ +LLNAPGE Y+VTLTEKGTYS+Y
Sbjct  121  SKISMSDEELLNAPGEVYAVTLTEKGTYSFY  151



>ref|XP_007136129.1| hypothetical protein PHAVU_009G020300g [Phaseolus vulgaris]
 gb|AGZ15420.1| plastocyanin A [Phaseolus vulgaris]
 gb|ESW08123.1| hypothetical protein PHAVU_009G020300g [Phaseolus vulgaris]
Length=167

 Score =   182 bits (461),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 109/151 (72%), Positives = 124/151 (82%), Gaps = 0/151 (0%)
 Frame = +2

Query  68   MASVTSAAVAIPSFTGLKAAGASSSSRTAVKLAAAPTPKLAIKASLKNFGaaviataasa  247
            MA+VTSAAVAIPSFTGLKA+G +  S  AVK++    P+  IKASLK+ GAAV+ATAASA
Sbjct  1    MAAVTSAAVAIPSFTGLKASGPTKVSAAAVKVSVPQAPRFGIKASLKDLGAAVVATAASA  60

Query  248  llatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDA  427
            +LA+NA+A EV LGS DG L FVPSE SV SGE IVFKNNAGFPH V+FDEDEIP+GVDA
Sbjct  61   VLASNAMALEVLLGSGDGSLVFVPSEFSVPSGEKIVFKNNAGFPHNVVFDEDEIPAGVDA  120

Query  428  AKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
             KISM E +LLNAPGETY VTL  KGTYS+Y
Sbjct  121  VKISMPEEELLNAPGETYVVTLDTKGTYSFY  151



>ref|XP_010266914.1| PREDICTED: plastocyanin B'/B'' [Nelumbo nucifera]
Length=166

 Score =   181 bits (459),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 110/151 (73%), Positives = 127/151 (84%), Gaps = 1/151 (1%)
 Frame = +2

Query  68   MASVTSAAVAIPSFTGLKAAGASSSSRTAVKLAAAPTPKLAIKASLKNFGaaviataasa  247
            MA+VTSAAVAIPSFTGLKA GA++    A K+AA+P P + +KASLK  G AV+ATAASA
Sbjct  1    MATVTSAAVAIPSFTGLKA-GATAKICGASKVAASPAPMVGVKASLKEVGVAVVATAASA  59

Query  248  llatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDA  427
            +LA+NA+A EV LGSDDGGLAFVPS  SV+ GE IVFKNNAGFPH V+FDEDEIPSGVDA
Sbjct  60   VLASNAMAIEVLLGSDDGGLAFVPSNFSVSVGEKIVFKNNAGFPHNVVFDEDEIPSGVDA  119

Query  428  AKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
              ISM+E +LLN PGETYSVTL EKGTY++Y
Sbjct  120  GAISMSEDNLLNGPGETYSVTLREKGTYTFY  150



>ref|XP_009620057.1| PREDICTED: plastocyanin A'/A'' [Nicotiana tomentosiformis]
Length=169

 Score =   181 bits (459),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 112/154 (73%), Positives = 132/154 (86%), Gaps = 4/154 (3%)
 Frame = +2

Query  68   MASVTSAAVAIPSFTGLKAAGASSSSR--TAVKLAAA-PTPKLAIKASLKNFGaaviata  238
            MA+VTSAAVAIPSFTGLKA GASS+SR  T  K+AA+ P  KLA+KASLK+ GA V+ATA
Sbjct  1    MATVTSAAVAIPSFTGLKA-GASSASRVSTTAKVAASTPATKLAVKASLKDVGAVVVATA  59

Query  239  asallatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSG  418
            ASA+LA+NA+A EV LGSDDGGLAFVP   SV++GE I FKNNAGFPH V+FDEDEIP+G
Sbjct  60   ASAMLASNAMAIEVLLGSDDGGLAFVPGNFSVSAGEKITFKNNAGFPHNVVFDEDEIPAG  119

Query  419  VDAAKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
            VD +KISM+E + LN PGETYSVTL+EKGTY++Y
Sbjct  120  VDVSKISMSEEEYLNGPGETYSVTLSEKGTYTFY  153



>ref|NP_173459.1| DNA-damage resistance protein DRT112 [Arabidopsis thaliana]
 sp|P42699.2|PLAS2_ARATH RecName: Full=Plastocyanin major isoform, chloroplastic; AltName: 
Full=DNA-damage-repair/toleration protein DRT112; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAF88155.1|AC026234_6 Contains similarity to a DNA-damage-repair/toleration protein 
DRT112 precursor from Arabidopsis thaliana gi|1169201 and is 
a member of the copper binding proteins family PF|00127. ESTs 
gb|BE039446, gb|T46296, gb|N64992, gb|T21043, gb|BE039361, 
gb|T41789, gb|AA728654, gb|T22293, gb|T42572, gb|R65100, 
gb|N65354, gb|N37323, gb|R90003, gb|BE039026, gb|BE038950, gb|AA713227 
come from this gene [Arabidopsis thaliana]
 gb|AAG40053.1|AF324702_1 At1g20340 [Arabidopsis thaliana]
 gb|AAG41461.1|AF326879_1 putative plastocyanin [Arabidopsis thaliana]
 gb|AAG50089.1|AF334383_1 putative plastocyanin [Arabidopsis thaliana]
 gb|AAK32865.1|AF361853_1 At1g20340/F14O10_4 [Arabidopsis thaliana]
 gb|AAN46784.1| At1g20340/F14O10_4 [Arabidopsis thaliana]
 gb|AEE29963.1| DNA-damage resistance protein DRT112 [Arabidopsis thaliana]
Length=167

 Score =   181 bits (458),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 101/151 (67%), Positives = 118/151 (78%), Gaps = 0/151 (0%)
 Frame = +2

Query  68   MASVTSAAVAIPSFTGLKAAGASSSSRTAVKLAAAPTPKLAIKASLKNFGaaviataasa  247
            MASVTSA VAIPSFTGLKA+   SS+   ++ AA  +PKL +K+SLKNFG A +A AAS 
Sbjct  1    MASVTSATVAIPSFTGLKASTIKSSATVRIQTAAVASPKLTVKSSLKNFGVAAVAAAASI  60

Query  248  llatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDA  427
             LA NA+A EV LG  DG LAF+P++ S+A GE IVFKNNAG+PH V+FDEDEIPSGVD 
Sbjct  61   ALAGNAMAIEVLLGGGDGSLAFIPNDFSIAKGEKIVFKNNAGYPHNVVFDEDEIPSGVDV  120

Query  428  AKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
            AKISM+E DLLN  GETY V LTE GTYS+Y
Sbjct  121  AKISMDEQDLLNGAGETYEVALTEPGTYSFY  151



>gb|AAM64356.1| plastocyanin, putative [Arabidopsis thaliana]
Length=167

 Score =   181 bits (458),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 101/151 (67%), Positives = 118/151 (78%), Gaps = 0/151 (0%)
 Frame = +2

Query  68   MASVTSAAVAIPSFTGLKAAGASSSSRTAVKLAAAPTPKLAIKASLKNFGaaviataasa  247
            MASVTSA VAIPSFTGLKA+   SS+   ++ AA  +PKL +K+SLKNFG A +A AAS 
Sbjct  1    MASVTSATVAIPSFTGLKASTIKSSATVRIQTAAVASPKLTVKSSLKNFGVAAVAAAASI  60

Query  248  llatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDA  427
             LA NA+A EV LG  DG LAF+P++ S+A GE IVFKNNAG+PH V+FDEDEIPSGVD 
Sbjct  61   ALAGNAMAIEVLLGGGDGSLAFIPNDFSIAKGEKIVFKNNAGYPHNVVFDEDEIPSGVDV  120

Query  428  AKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
            AKISM+E DLLN  GETY V LTE GTYS+Y
Sbjct  121  AKISMDEQDLLNGAGETYEVALTEPGTYSFY  151



>ref|XP_009776940.1| PREDICTED: plastocyanin A'/A'' [Nicotiana sylvestris]
Length=169

 Score =   181 bits (458),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 113/154 (73%), Positives = 131/154 (85%), Gaps = 4/154 (3%)
 Frame = +2

Query  68   MASVTSAAVAIPSFTGLKAAGASSSSR--TAVKLAAA-PTPKLAIKASLKNFGaaviata  238
            MA+VTSAAVAIPSFTGLKA GASS+SR  T  K+AAA P  KLA+KASLK+ GA V+ATA
Sbjct  1    MATVTSAAVAIPSFTGLKA-GASSTSRVSTTAKVAAATPATKLAVKASLKDVGAVVVATA  59

Query  239  asallatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSG  418
            ASA+LA+NA+A EV LGSDDGGLAFVP   SV++GE I FKNNAGFPH V+FDEDEIP+G
Sbjct  60   ASAMLASNAMAIEVLLGSDDGGLAFVPGNFSVSAGEKITFKNNAGFPHNVVFDEDEIPAG  119

Query  419  VDAAKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
            VD +KISM E + LN PGETYSVTL+EKGTY++Y
Sbjct  120  VDVSKISMPEEEYLNGPGETYSVTLSEKGTYTFY  153



>emb|CAB66894.1| putative plastocyanin [Arabidopsis thaliana]
Length=167

 Score =   180 bits (457),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 101/151 (67%), Positives = 118/151 (78%), Gaps = 0/151 (0%)
 Frame = +2

Query  68   MASVTSAAVAIPSFTGLKAAGASSSSRTAVKLAAAPTPKLAIKASLKNFGaaviataasa  247
            MASVTSA VAIPSFTGLKA+   SS+   ++ AA  +PKL +K+SLKNFG A +A AAS 
Sbjct  1    MASVTSATVAIPSFTGLKASTIKSSATVRIQTAAVASPKLTVKSSLKNFGVAAVAAAASI  60

Query  248  llatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDA  427
             LA NA+A EV LG  DG LAF+P++ S+A GE IVFKNNAG+PH V+FDEDEIPSGVD 
Sbjct  61   ALAGNAMAIEVLLGGGDGSLAFIPNDFSIAKGEKIVFKNNAGYPHNVVFDEDEIPSGVDV  120

Query  428  AKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
            AKISM+E DLLN  GETY V LTE GTYS+Y
Sbjct  121  AKISMDEQDLLNGAGETYEVALTEPGTYSFY  151



>dbj|BAJ33832.1| unnamed protein product [Thellungiella halophila]
Length=167

 Score =   180 bits (457),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 102/151 (68%), Positives = 120/151 (79%), Gaps = 0/151 (0%)
 Frame = +2

Query  68   MASVTSAAVAIPSFTGLKAAGASSSSRTAVKLAAAPTPKLAIKASLKNFGaaviataasa  247
            MASVTSA VAIPSFTGLK+  +  S+   +  AAA +PKL +K+SLK+FG A +A AAS 
Sbjct  1    MASVTSATVAIPSFTGLKSTISKPSAVVRIPTAAAASPKLTVKSSLKDFGVAAVAAAASI  60

Query  248  llatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDA  427
             LA NA+A ++ LGS DG LAFVP++ SVA GE IVFKNNAGFPH V+FDEDEIPSGVDA
Sbjct  61   ALAGNAMAIDILLGSGDGALAFVPNDFSVAKGEKIVFKNNAGFPHNVVFDEDEIPSGVDA  120

Query  428  AKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
            +KISM+E DLLN PGETY V LTE GTYS+Y
Sbjct  121  SKISMDEQDLLNGPGETYEVALTEPGTYSFY  151



>ref|XP_009334523.1| PREDICTED: plastocyanin [Pyrus x bretschneideri]
Length=166

 Score =   180 bits (456),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 106/151 (70%), Positives = 127/151 (84%), Gaps = 1/151 (1%)
 Frame = +2

Query  68   MASVTSAAVAIPSFTGLKAAGASSSSRTAVKLAAAPTPKLAIKASLKNFGaaviataasa  247
            MASVT AAV IPSFTGLK++GA+     AVK++A+P     +K+SLK+ G AV ATAASA
Sbjct  1    MASVTPAAVTIPSFTGLKSSGAAKVG-AAVKVSASPRQMCVVKSSLKDVGVAVAATAASA  59

Query  248  llatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDA  427
            +LA+NA+A EV LGSDDGGLAFVP+  S+A GE IVFKNNAGFPH ++FDEDE+PSGVDA
Sbjct  60   ILASNAMAIEVLLGSDDGGLAFVPNSFSIAPGEKIVFKNNAGFPHNIVFDEDEVPSGVDA  119

Query  428  AKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
             KISM+E DLLNAPGETY+VTLTEKG+YS+Y
Sbjct  120  GKISMSEEDLLNAPGETYAVTLTEKGSYSFY  150



>gb|ACV32157.1| chloroplast plastocyanin precursor [Nicotiana benthamiana]
Length=169

 Score =   180 bits (456),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 113/154 (73%), Positives = 129/154 (84%), Gaps = 4/154 (3%)
 Frame = +2

Query  68   MASVTSAAVAIPSFTGLKAAGASSSSR--TAVKLAAA-PTPKLAIKASLKNFGaaviata  238
            MA+VTSAAVAIPSFTGLKA GA S+SR  T  K+AA+ P  KLA+KASLK+ GA V+ATA
Sbjct  1    MATVTSAAVAIPSFTGLKA-GACSTSRVSTTAKVAASTPATKLAVKASLKDVGAVVVATA  59

Query  239  asallatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSG  418
            ASA+LA+NA+A EV LGSDDGGLAFVP   SV+SGE I FKNNAGFPH V+FDEDEIP+G
Sbjct  60   ASAMLASNAMAIEVLLGSDDGGLAFVPGNFSVSSGEKITFKNNAGFPHNVVFDEDEIPAG  119

Query  419  VDAAKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
            VD +KISM E + LN PGETYSVTL EKGTYS+Y
Sbjct  120  VDVSKISMPEEEYLNGPGETYSVTLNEKGTYSFY  153



>emb|CDP07338.1| unnamed protein product [Coffea canephora]
Length=167

 Score =   180 bits (456),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 129/151 (85%), Gaps = 0/151 (0%)
 Frame = +2

Query  68   MASVTSAAVAIPSFTGLKAAGASSSSRTAVKLAAAPTPKLAIKASLKNFGaaviataasa  247
            MA+VTSAAV+IPSFTGLKA+GA +S  ++     A +PKLA+KASLK  GAAV+ATAASA
Sbjct  1    MATVTSAAVSIPSFTGLKASGAPASRVSSTVKVFAASPKLAVKASLKEVGAAVVATAASA  60

Query  248  llatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDA  427
            +LATNALAAEV LGS  G L FVPSE SVASGE IVFKNNAGFPH V+FDED +PSGVDA
Sbjct  61   MLATNALAAEVLLGSSGGELIFVPSEFSVASGEKIVFKNNAGFPHNVVFDEDGVPSGVDA  120

Query  428  AKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
             KISM+E DLLNAPGETYSV+LTEKGTY++Y
Sbjct  121  TKISMSEEDLLNAPGETYSVSLTEKGTYTFY  151



>ref|XP_002285904.1| PREDICTED: plastocyanin [Vitis vinifera]
 emb|CBI18910.3| unnamed protein product [Vitis vinifera]
Length=168

 Score =   180 bits (456),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 109/152 (72%), Positives = 126/152 (83%), Gaps = 1/152 (1%)
 Frame = +2

Query  68   MASVTSAAVAIPSFTGLKAAGASSSSRTA-VKLAAAPTPKLAIKASLKNFGaaviataas  244
            MA VTSAAVAIPSFTGLKA+GA+ +   A VK   AP P+L  KA+LK+ G AV+ATAAS
Sbjct  1    MAIVTSAAVAIPSFTGLKASGATMTRAAATVKTITAPAPRLVAKAALKDVGVAVVATAAS  60

Query  245  allatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVD  424
            ALLA+NA+A EV LGS DGGL FVPS ++V +GE I FKNNAGFPH V+FDEDE+PSGVD
Sbjct  61   ALLASNAMAMEVLLGSSDGGLVFVPSTITVPAGEKITFKNNAGFPHNVVFDEDEVPSGVD  120

Query  425  AAKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
             +KISM+E DLLNAPGE YSVTLTEKGTYS+Y
Sbjct  121  VSKISMSEEDLLNAPGEVYSVTLTEKGTYSFY  152



>ref|XP_011083419.1| PREDICTED: plastocyanin [Sesamum indicum]
Length=167

 Score =   179 bits (455),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 125/152 (82%), Gaps = 2/152 (1%)
 Frame = +2

Query  68   MASVTSAAVAIPSFTGLKAAGASSSSRTAVKLAAAPT-PKLAIKASLKNFGaaviataas  244
            MA+VTSAAV IPSFTGLKA GA+ S+    ++A  P  PKLA+KASLK+FG AV ATAAS
Sbjct  1    MATVTSAAVTIPSFTGLKA-GATPSNLAMQRVAVTPAAPKLAVKASLKDFGVAVAATAAS  59

Query  245  allatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVD  424
            A+LA+NALA E+ LG DDG LAF+P    VA+GE IVF NNAGFPH ++FDEDEIP+GVD
Sbjct  60   AMLASNALAIEITLGGDDGSLAFIPQNFEVAAGEKIVFTNNAGFPHNIVFDEDEIPAGVD  119

Query  425  AAKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
            A+KISM E DLLNA GETY+VTLTEKGTYS+Y
Sbjct  120  ASKISMAEEDLLNAKGETYAVTLTEKGTYSFY  151



>ref|XP_006416411.1| hypothetical protein EUTSA_v10008749mg [Eutrema salsugineum]
 gb|ESQ34764.1| hypothetical protein EUTSA_v10008749mg [Eutrema salsugineum]
Length=216

 Score =   181 bits (458),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 102/151 (68%), Positives = 120/151 (79%), Gaps = 0/151 (0%)
 Frame = +2

Query  68   MASVTSAAVAIPSFTGLKAAGASSSSRTAVKLAAAPTPKLAIKASLKNFGaaviataasa  247
            MASVTSA VAIPSFTGLK+  +  S+   +  AAA +PKL +K+SLK+FG A +A AAS 
Sbjct  50   MASVTSATVAIPSFTGLKSTISKPSAVVRIPTAAAASPKLTVKSSLKDFGVAAVAAAASI  109

Query  248  llatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDA  427
             LA NA+A ++ LGS DG LAFVP++ SVA GE IVFKNNAGFPH V+FDEDEIPSGVDA
Sbjct  110  ALAGNAMAIDILLGSGDGALAFVPNDFSVAKGEKIVFKNNAGFPHNVVFDEDEIPSGVDA  169

Query  428  AKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
            +KISM+E DLLN PGETY V LTE GTYS+Y
Sbjct  170  SKISMDEQDLLNGPGETYEVALTEPGTYSFY  200



>gb|AFK36672.1| unknown [Lotus japonicus]
 gb|AFK36804.1| unknown [Lotus japonicus]
Length=167

 Score =   178 bits (452),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 104/151 (69%), Positives = 126/151 (83%), Gaps = 0/151 (0%)
 Frame = +2

Query  68   MASVTSAAVAIPSFTGLKAAGASSSSRTAVKLAAAPTPKLAIKASLKNFGaaviataasa  247
            MA+VTS AVAIPSFTGLK+AG+  S+   V  + +  P+L++KASLK+FG AV+ATAASA
Sbjct  1    MATVTSTAVAIPSFTGLKSAGSKVSASAKVSSSPSQMPRLSVKASLKDFGVAVVATAASA  60

Query  248  llatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDA  427
            +LA+NA+A E+ LGSDDGGLAFVP+  SVA GE I FKNNAGFPH V+FDEDE+P GVDA
Sbjct  61   VLASNAMAIEILLGSDDGGLAFVPNSFSVAPGEKITFKNNAGFPHNVVFDEDEVPGGVDA  120

Query  428  AKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
            +KISM++ DLLNAPGETYSVTL  KGTY +Y
Sbjct  121  SKISMSDEDLLNAPGETYSVTLDAKGTYKFY  151



>gb|AFK44580.1| unknown [Lotus japonicus]
Length=167

 Score =   178 bits (452),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 104/151 (69%), Positives = 126/151 (83%), Gaps = 0/151 (0%)
 Frame = +2

Query  68   MASVTSAAVAIPSFTGLKAAGASSSSRTAVKLAAAPTPKLAIKASLKNFGaaviataasa  247
            MA+VTS AVAIPSFTGLK+AG+  S+   V  + +  P+L++KASLK+FG AV+ATAASA
Sbjct  1    MATVTSTAVAIPSFTGLKSAGSKVSASAKVSSSPSQMPRLSVKASLKDFGVAVVATAASA  60

Query  248  llatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDA  427
            +LA+NA+A E+ LGSDDGGLAFVP+  SVA GE I FKNNAGFPH V+FDEDE+P GVDA
Sbjct  61   VLASNAMAIEILLGSDDGGLAFVPNSFSVAPGEKITFKNNAGFPHNVVFDEDEVPGGVDA  120

Query  428  AKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
            +KISM++ DLLNAPGETYSVTL  KGTY +Y
Sbjct  121  SKISMSDEDLLNAPGETYSVTLDAKGTYKFY  151



>ref|XP_006303780.1| hypothetical protein CARUB_v10012022mg [Capsella rubella]
 gb|EOA36678.1| hypothetical protein CARUB_v10012022mg [Capsella rubella]
Length=167

 Score =   178 bits (451),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 102/151 (68%), Positives = 118/151 (78%), Gaps = 0/151 (0%)
 Frame = +2

Query  68   MASVTSAAVAIPSFTGLKAAGASSSSRTAVKLAAAPTPKLAIKASLKNFGaaviataasa  247
            MASVTSA VAIPSFTGLKA+   SS+   +  A A +PKL +K+SLK+FG A +A AAS 
Sbjct  1    MASVTSATVAIPSFTGLKASTIKSSASVRINTAVAASPKLTVKSSLKDFGVAAVAAAASI  60

Query  248  llatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDA  427
             LA NA+A EV LG  DG LAFVP++ S+A GE IVFKNNAGFPH V+FDEDEIPSGVDA
Sbjct  61   ALAGNAMAIEVLLGGGDGSLAFVPNDFSIAKGEKIVFKNNAGFPHNVVFDEDEIPSGVDA  120

Query  428  AKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
            AKISM+E  LLNA GET+ V LTE GTYS+Y
Sbjct  121  AKISMDEQALLNAAGETFEVALTEPGTYSFY  151



>ref|XP_006390238.1| hypothetical protein EUTSA_v10019237mg [Eutrema salsugineum]
 gb|ESQ27524.1| hypothetical protein EUTSA_v10019237mg [Eutrema salsugineum]
Length=166

 Score =   177 bits (450),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 106/152 (70%), Positives = 118/152 (78%), Gaps = 3/152 (2%)
 Frame = +2

Query  68   MASVT-SAAVAIPSFTGLKAAGASSSSRTAVKLAAAPTPKLAIKASLKNFGaaviataas  244
            MASVT SA VAIP+FTGLK A   SS  T V  A A  PKLA+K+SLK+FG   +ATAAS
Sbjct  1    MASVTTSATVAIPTFTGLKLA--FSSKSTTVSAATAKLPKLAVKSSLKDFGVIAVATAAS  58

Query  245  allatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVD  424
              LA NA+A EV LGSDDGGL F P E +VA GE IVFKNNAGFPH V+FDEDEIPSGVD
Sbjct  59   IALAGNAMAIEVLLGSDDGGLVFEPKEFTVAKGEKIVFKNNAGFPHNVVFDEDEIPSGVD  118

Query  425  AAKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
            A+KISM+E  LLN PGETY VTLTE G+YS+Y
Sbjct  119  ASKISMDEQALLNGPGETYEVTLTEPGSYSFY  150



>ref|XP_007223602.1| hypothetical protein PRUPE_ppa012521mg [Prunus persica]
 gb|EMJ24801.1| hypothetical protein PRUPE_ppa012521mg [Prunus persica]
Length=166

 Score =   177 bits (450),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 107/151 (71%), Positives = 124/151 (82%), Gaps = 1/151 (1%)
 Frame = +2

Query  68   MASVTSAAVAIPSFTGLKAAGASSSSRTAVKLAAAPTPKLAIKASLKNFGaaviataasa  247
            MA+VT AAVAIPSF GLK+AGAS     AVK AA+P    AIK+SLK+ G AV ATAASA
Sbjct  1    MATVTPAAVAIPSFAGLKSAGASKVCSAAVKFAASPR-MCAIKSSLKDVGVAVAATAASA  59

Query  248  llatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDA  427
            +LA+NALA EV LG DDG LAF+P+  SV+ GE IVFKNNAGFPH ++FDEDEIPSGVDA
Sbjct  60   ILASNALAIEVLLGGDDGSLAFIPNSFSVSPGEKIVFKNNAGFPHNIVFDEDEIPSGVDA  119

Query  428  AKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
             KISM E DLLNAPGETY++TLTEKG+Y++Y
Sbjct  120  GKISMGEEDLLNAPGETYAITLTEKGSYAFY  150



>ref|XP_010459715.1| PREDICTED: plastocyanin major isoform, chloroplastic [Camelina 
sativa]
 ref|XP_010477267.1| PREDICTED: plastocyanin major isoform, chloroplastic [Camelina 
sativa]
Length=167

 Score =   177 bits (449),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 100/151 (66%), Positives = 118/151 (78%), Gaps = 0/151 (0%)
 Frame = +2

Query  68   MASVTSAAVAIPSFTGLKAAGASSSSRTAVKLAAAPTPKLAIKASLKNFGaaviataasa  247
            MASVTSA VAIPSFTGLKA+    S+   +  A A +PKL +K+SLK+FG A +A AAS 
Sbjct  1    MASVTSATVAIPSFTGLKASTIKPSASVRINTAVAASPKLTVKSSLKDFGVAAVAAAASI  60

Query  248  llatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDA  427
             LA NA+A EV LG  DG LAF+P++ S++ GE IVFKNNAGFPH V+FDEDEIPSGVD 
Sbjct  61   ALAGNAMAIEVLLGGGDGSLAFIPNDFSISKGEKIVFKNNAGFPHNVVFDEDEIPSGVDV  120

Query  428  AKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
            AKISM+E  LLNAPGETY V+LTE GTYS+Y
Sbjct  121  AKISMSEEALLNAPGETYEVSLTEPGTYSFY  151



>emb|CDY31897.1| BnaC07g15470D [Brassica napus]
Length=167

 Score =   177 bits (449),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 98/151 (65%), Positives = 118/151 (78%), Gaps = 0/151 (0%)
 Frame = +2

Query  68   MASVTSAAVAIPSFTGLKAAGASSSSRTAVKLAAAPTPKLAIKASLKNFGaaviataasa  247
            MAS+TSA VAIPSFTGLK+  +  S+   +   A+ +PKL +K+SLKNFG A +A AAS 
Sbjct  1    MASITSATVAIPSFTGLKSTSSKPSAVVRIPTVASTSPKLTVKSSLKNFGVAAVAAAASI  60

Query  248  llatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDA  427
             LA NA+A +V LGS DG LAFVP++ ++A GE IVFKNNAGFPH V+FDEDEIPSG DA
Sbjct  61   ALAGNAMAIDVLLGSGDGALAFVPNDFTIAKGEKIVFKNNAGFPHNVVFDEDEIPSGFDA  120

Query  428  AKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
            +KISM+E DLLN PGETY V LTE GTYS+Y
Sbjct  121  SKISMDEQDLLNGPGETYEVALTEPGTYSFY  151



>ref|XP_009771635.1| PREDICTED: plastocyanin [Nicotiana sylvestris]
Length=167

 Score =   177 bits (448),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 106/151 (70%), Positives = 124/151 (82%), Gaps = 0/151 (0%)
 Frame = +2

Query  68   MASVTSAAVAIPSFTGLKAAGASSSSRTAVKLAAAPTPKLAIKASLKNFGaaviataasa  247
            MASVTSAAV IPSFTGLK+  +S  S  A  ++   T K+ +KASLK+ GA V+ATAASA
Sbjct  1    MASVTSAAVTIPSFTGLKSGTSSKISNVAKMVSTNQTSKMVVKASLKDVGAVVVATAASA  60

Query  248  llatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDA  427
            +LA+NALA EV LG DDG LAFVP   SV++GE I FKNNAGFPH V+FDEDEIP+GVDA
Sbjct  61   ILASNALAIEVLLGGDDGSLAFVPGNFSVSAGEKITFKNNAGFPHNVVFDEDEIPAGVDA  120

Query  428  AKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
            +KISM+E DLLNAPGETYSVTL+EKGTYS+Y
Sbjct  121  SKISMSEEDLLNAPGETYSVTLSEKGTYSFY  151



>gb|KFK44150.1| hypothetical protein AALP_AA1G221700 [Arabis alpina]
Length=166

 Score =   177 bits (448),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 103/151 (68%), Positives = 118/151 (78%), Gaps = 1/151 (1%)
 Frame = +2

Query  68   MASVTSAAVAIPSFTGLKAAGASSSSRTAVKLAAAPTPKLAIKASLKNFGaaviataasa  247
            MAS+TSA VAIPSFTGLK+A   SSS   V  A A TPKL +K+SLK+FG A +A AAS 
Sbjct  1    MASITSATVAIPSFTGLKSATTKSSSIVRVHTAVA-TPKLTVKSSLKDFGVAAVAAAASF  59

Query  248  llatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDA  427
             L  NA+A +V LGS DG LAFVP++ +VA GE IVFKNNAGFPH V+FDEDEIPSGVDA
Sbjct  60   ALVGNAMAIDVLLGSGDGALAFVPNDFTVAKGEKIVFKNNAGFPHNVVFDEDEIPSGVDA  119

Query  428  AKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
            +KISM+E  LLNA GETY V LTE GTYS+Y
Sbjct  120  SKISMDEQALLNAAGETYEVALTEPGTYSFY  150



>sp|P07030.1|PLAS_SILPR RecName: Full=Plastocyanin, chloroplastic; Flags: Precursor [Silene 
latifolia subsp. alba]
 emb|CAA26709.1| unnamed protein product [Silene latifolia subsp. alba]
Length=165

 Score =   177 bits (448),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 123/152 (81%), Gaps = 4/152 (3%)
 Frame = +2

Query  68   MASVTS-AAVAIPSFTGLKAAGASSSSRTAVKLAAAPTPKLAIKASLKNFGaaviataas  244
            MA+VTS AAVAIPSF GLKA   SS++R A    A  TP+++IKASLK+ G  V ATAA+
Sbjct  1    MATVTSSAAVAIPSFAGLKA---SSTTRAATVKVAVATPRMSIKASLKDVGVVVAATAAA  57

Query  245  allatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVD  424
             +LA NA+AAEV LGS DGGLAFVPS+LS+ASGE I FKNNAGFPH V+FDEDE+P+GVD
Sbjct  58   GILAGNAMAAEVLLGSSDGGLAFVPSDLSIASGEKITFKNNAGFPHNVVFDEDEVPAGVD  117

Query  425  AAKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
              KISM E DLLNAPGE YSVTLTEKGTY +Y
Sbjct  118  VTKISMPEEDLLNAPGEEYSVTLTEKGTYKFY  149



>gb|KHN33826.1| Plastocyanin, chloroplastic [Glycine soja]
Length=165

 Score =   176 bits (447),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 109/151 (72%), Positives = 126/151 (83%), Gaps = 2/151 (1%)
 Frame = +2

Query  68   MASVTSAAVAIPSFTGLKAAGASSSSRTAVKLAAAPTPKLAIKASLKNFGaaviataasa  247
            MA+VTSAAVAIPSFTGLKA+    S+  AVK++A    +L IKASLK+ G AV+ATAASA
Sbjct  1    MATVTSAAVAIPSFTGLKASAGKVSA--AVKVSAPQATRLGIKASLKDVGVAVVATAASA  58

Query  248  llatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDA  427
            +LA+NA+A EV LG DDG LAFVP+  SVASGE IVFKNNAGFPH V+FDEDEIPSGVDA
Sbjct  59   VLASNAMAIEVLLGGDDGSLAFVPNNFSVASGEKIVFKNNAGFPHNVVFDEDEIPSGVDA  118

Query  428  AKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
             KISM++ DLLNAPGETYSVTL  KGTYS++
Sbjct  119  GKISMSDEDLLNAPGETYSVTLDAKGTYSFF  149



>ref|XP_008221199.1| PREDICTED: plastocyanin [Prunus mume]
Length=166

 Score =   176 bits (446),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 108/151 (72%), Positives = 125/151 (83%), Gaps = 1/151 (1%)
 Frame = +2

Query  68   MASVTSAAVAIPSFTGLKAAGASSSSRTAVKLAAAPTPKLAIKASLKNFGaaviataasa  247
            MA+VT AAVAIPSFTGLK+AGAS  S  AVK+A +P    AIK+SLK+ G AV ATAASA
Sbjct  1    MATVTPAAVAIPSFTGLKSAGASKVSSAAVKVATSPR-MCAIKSSLKDVGVAVAATAASA  59

Query  248  llatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDA  427
            +LA+NALA EV LG DDG LAFVP+  SV+ GE IVFKNNAGFPH ++FDED IPSGVDA
Sbjct  60   ILASNALAVEVLLGGDDGSLAFVPNSFSVSPGEKIVFKNNAGFPHNIVFDEDGIPSGVDA  119

Query  428  AKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
             KISM+E DLLNAPGETY++TLTEKG Y++Y
Sbjct  120  GKISMSEEDLLNAPGETYAITLTEKGDYAFY  150



>gb|AAA32787.1| DRT112 [Arabidopsis thaliana]
Length=167

 Score =   176 bits (446),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 99/151 (66%), Positives = 115/151 (76%), Gaps = 0/151 (0%)
 Frame = +2

Query  68   MASVTSAAVAIPSFTGLKAAGASSSSRTAVKLAAAPTPKLAIKASLKNFGaaviataasa  247
            MASVTS  V IPSFTGLKA+   SS+    + AA  +PKL +K+SLKNFG A +A AAS 
Sbjct  1    MASVTSTTVPIPSFTGLKASTTKSSATVRTQTAAVASPKLTVKSSLKNFGVAAVAPAASI  60

Query  248  llatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDA  427
             LA NA+A EV LG  DG LAF+P++ S+A GE IVFKNNAG+PH V+FDEDEIPSGVD 
Sbjct  61   ALAGNAMAIEVLLGGGDGSLAFIPNDFSIAKGEKIVFKNNAGYPHNVVFDEDEIPSGVDV  120

Query  428  AKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
            AKISM+E DLLN  GETY V LTE GTYS+Y
Sbjct  121  AKISMDEQDLLNGAGETYEVALTEPGTYSFY  151



>gb|AEK78855.1| DNA damage repair protein/transcription factor [Lepidium latifolium]
Length=167

 Score =   176 bits (446),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 100/151 (66%), Positives = 116/151 (77%), Gaps = 0/151 (0%)
 Frame = +2

Query  68   MASVTSAAVAIPSFTGLKAAGASSSSRTAVKLAAAPTPKLAIKASLKNFGaaviataasa  247
            MASVTSAAVAIPSFTGLKAA   SS+   ++ AA  +PKL +K+SLK+FG   +A AAS 
Sbjct  1    MASVTSAAVAIPSFTGLKAASIKSSATVRIQTAAVASPKLTVKSSLKDFGVVAVAAAASI  60

Query  248  llatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDA  427
             LA NA+A EV LGS DG LAFVP++ +VA GET   KNNAGFPH V+FDEDEIPSGVDA
Sbjct  61   ALAGNAMAMEVLLGSGDGALAFVPNDFTVAKGETKELKNNAGFPHNVVFDEDEIPSGVDA  120

Query  428  AKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
            +KISM+E D  N PGE Y V LTE GTYS+Y
Sbjct  121  SKISMDEQDTRNDPGEKYEVALTEPGTYSFY  151



>sp|P16002.1|PLAS_PEA RecName: Full=Plastocyanin, chloroplastic; Flags: Precursor [Pisum 
sativum]
 emb|CAA34212.1| unnamed protein product [Pisum sativum]
 prf||1611464A plastocyanin
Length=168

 Score =   176 bits (446),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 102/152 (67%), Positives = 124/152 (82%), Gaps = 1/152 (1%)
 Frame = +2

Query  68   MASVTSAAVAIPSFTGLKAAGASSSSRTA-VKLAAAPTPKLAIKASLKNFGaaviataas  244
            MA+VTS  VAIPSF+GLK   A+  S  A +  + + +P+L ++ASLK+FG A++ATAAS
Sbjct  1    MATVTSTTVAIPSFSGLKTNAATKVSAMAKIPTSTSQSPRLCVRASLKDFGVALVATAAS  60

Query  245  allatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVD  424
            A+LA+NALA EV LG+ DGGLAFVPS L V++GETIVFKNNAGFPH V+FDEDEIP+GVD
Sbjct  61   AVLASNALAVEVLLGASDGGLAFVPSSLEVSAGETIVFKNNAGFPHNVVFDEDEIPAGVD  120

Query  425  AAKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
            A+KISM E DLLNAPGETYSV L  KGTY +Y
Sbjct  121  ASKISMPEEDLLNAPGETYSVKLDAKGTYKFY  152



>ref|XP_009630159.1| PREDICTED: plastocyanin B'/B'' [Nicotiana tomentosiformis]
Length=167

 Score =   176 bits (445),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 104/151 (69%), Positives = 124/151 (82%), Gaps = 0/151 (0%)
 Frame = +2

Query  68   MASVTSAAVAIPSFTGLKAAGASSSSRTAVKLAAAPTPKLAIKASLKNFGaaviataasa  247
            MASVTSAAV IPSF+GLK+   S  S  A  ++   T K+ +KAS+K+ GA V+ATAASA
Sbjct  1    MASVTSAAVTIPSFSGLKSGTCSKISNVAKMVSTNQTSKMVVKASVKDVGAVVVATAASA  60

Query  248  llatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDA  427
            +LA+NALA EV LGSDDGGLAFVP   SV++GE I FKNNAGFPH V+FDEDEIP+GVDA
Sbjct  61   ILASNALAIEVLLGSDDGGLAFVPGNFSVSAGEKITFKNNAGFPHNVVFDEDEIPAGVDA  120

Query  428  AKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
            +KISM+E DLLN PGETYSVTL+EKGTY++Y
Sbjct  121  SKISMSEEDLLNGPGETYSVTLSEKGTYTFY  151



>ref|NP_001236653.1| uncharacterized protein LOC100306554 [Glycine max]
 gb|ACU14777.1| unknown [Glycine max]
Length=165

 Score =   176 bits (445),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 109/151 (72%), Positives = 126/151 (83%), Gaps = 2/151 (1%)
 Frame = +2

Query  68   MASVTSAAVAIPSFTGLKAAGASSSSRTAVKLAAAPTPKLAIKASLKNFGaaviataasa  247
            MA+VTSAAVAIPSFTGLKA+    S+  AVK++A    +L IKASLK+ G AV+ATAASA
Sbjct  1    MATVTSAAVAIPSFTGLKASAGIVSA--AVKVSAPQATRLGIKASLKDVGVAVVATAASA  58

Query  248  llatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDA  427
            +LA+NA+A EV LG DDG LAFVP+  SVASGE IVFKNNAGFPH V+FDEDEIPSGVDA
Sbjct  59   VLASNAMAIEVLLGGDDGSLAFVPNNFSVASGEKIVFKNNAGFPHNVVFDEDEIPSGVDA  118

Query  428  AKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
             KISM++ DLLNAPGETYSVTL  KGTYS++
Sbjct  119  GKISMSDEDLLNAPGETYSVTLDAKGTYSFF  149



>ref|XP_011034955.1| PREDICTED: plastocyanin B, chloroplastic [Populus euphratica]
Length=168

 Score =   176 bits (445),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 129/153 (84%), Gaps = 3/153 (2%)
 Frame = +2

Query  68   MASVTSAAVAIPSFTGLKAAGASSSSRTAV--KLAAAPTPKLAIKASLKNFGaaviataa  241
            MA+VTSAAV+IPSFTGLKAA AS++ R +V  K++A+P P+L+IKASLK  GAA +ATAA
Sbjct  1    MATVTSAAVSIPSFTGLKAASASNA-RVSVSAKVSASPLPRLSIKASLKEVGAAAVATAA  59

Query  242  sallatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGV  421
            SA++A+NA+A +V LG DDG LAFVPSE SV +GE IVFKNNAGFPH V+FDED +PSGV
Sbjct  60   SAMIASNAMAIDVLLGGDDGSLAFVPSEFSVPAGEKIVFKNNAGFPHNVLFDEDAVPSGV  119

Query  422  DAAKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
            D +KISM+E DLLNA GETY V L++KG Y++Y
Sbjct  120  DVSKISMSEEDLLNAKGETYEVALSDKGEYTFY  152



>ref|XP_003603843.1| Plastocyanin [Medicago truncatula]
 gb|AES74094.1| plastocyanin [Medicago truncatula]
 gb|AFK42192.1| unknown [Medicago truncatula]
 gb|AFK43930.1| unknown [Medicago truncatula]
Length=167

 Score =   175 bits (444),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 105/151 (70%), Positives = 122/151 (81%), Gaps = 0/151 (0%)
 Frame = +2

Query  68   MASVTSAAVAIPSFTGLKAAGASSSSRTAVKLAAAPTPKLAIKASLKNFGaaviataasa  247
            MA+VTS  VAIPSFTGLKA  +  S+   V  + +  P+L ++ASLK+FG AV+ATAASA
Sbjct  1    MATVTSTTVAIPSFTGLKANASKVSAIAKVPTSNSQLPRLCVRASLKDFGVAVVATAASA  60

Query  248  llatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDA  427
            LLA+NALA EV LG+ DGGLAFVP+  +V +G+TI FKNNAGFPH VIFDEDEIPSGVDA
Sbjct  61   LLASNALAVEVLLGASDGGLAFVPNNFTVNAGDTITFKNNAGFPHNVIFDEDEIPSGVDA  120

Query  428  AKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
            AKISM E DLLNAPGETYSVTL  KGTY +Y
Sbjct  121  AKISMPEEDLLNAPGETYSVTLDAKGTYKFY  151



>ref|XP_008466451.1| PREDICTED: plastocyanin [Cucumis melo]
Length=166

 Score =   175 bits (444),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 105/151 (70%), Positives = 129/151 (85%), Gaps = 1/151 (1%)
 Frame = +2

Query  68   MASVTSAAVAIPSFTGLKAAGASSSSRTAVKLAAAPTPKLAIKASLKNFGaaviataasa  247
            MA+VTSAAVAIPSFTGLK++ +S  + +A++L +  +PKL+++ASLK+ G AV ATAASA
Sbjct  1    MAAVTSAAVAIPSFTGLKSSSSSKPT-SAIRLPSPASPKLSVRASLKDVGVAVAATAASA  59

Query  248  llatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDA  427
            LLA+NA+A E+ LG DDG LAFVP+  +VASGETIVFKNNAGFPH V+FDEDEIPSGVDA
Sbjct  60   LLASNAMAIEILLGGDDGSLAFVPNNFTVASGETIVFKNNAGFPHNVVFDEDEIPSGVDA  119

Query  428  AKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
             KISM+E +LLNAPGE Y V LTEKG+YS+Y
Sbjct  120  GKISMDEENLLNAPGEVYEVQLTEKGSYSFY  150



>emb|CDY71912.1| BnaAnng39280D [Brassica napus]
 emb|CDY01378.1| BnaA07g11510D [Brassica napus]
 emb|CDY01381.1| BnaA07g11540D [Brassica napus]
Length=167

 Score =   175 bits (444),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 98/151 (65%), Positives = 118/151 (78%), Gaps = 0/151 (0%)
 Frame = +2

Query  68   MASVTSAAVAIPSFTGLKAAGASSSSRTAVKLAAAPTPKLAIKASLKNFGaaviataasa  247
            MAS+TSA VAIPSFTGLK+  +  S+   +   AA + KL +K+SLK+FG A +A AAS 
Sbjct  1    MASITSATVAIPSFTGLKSTSSKPSTVVKIPTVAAASTKLTVKSSLKDFGVAAVAAAASI  60

Query  248  llatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDA  427
             LA NA+A +V LGS DG LAFVP++ ++A GE IVFKNNAGFPH V+FDEDEIPSGVDA
Sbjct  61   ALAGNAMAIDVLLGSGDGALAFVPNDFTIAKGEKIVFKNNAGFPHNVVFDEDEIPSGVDA  120

Query  428  AKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
            +KISM+E DLLN PGETY V LTE GTYS+Y
Sbjct  121  SKISMDEQDLLNGPGETYEVALTEPGTYSFY  151



>ref|XP_010539825.1| PREDICTED: plastocyanin [Tarenaya hassleriana]
Length=168

 Score =   175 bits (444),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 121/152 (80%), Gaps = 1/152 (1%)
 Frame = +2

Query  68   MASVTSAAVAIPSFTGLKAAGASSSSRTAVKLAAA-PTPKLAIKASLKNFGaaviataas  244
            MA+VTSAA+AIPSFTGLKA   S++  T V ++A   TPKL+++ASLK+ G A +A AAS
Sbjct  1    MATVTSAAIAIPSFTGLKANSVSAAKPTTVTVSAGVRTPKLSVRASLKDVGVAAVAVAAS  60

Query  245  allatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVD  424
              LA NA+A EV LG  DG LAFVP++ SVA GE IVFKNNAGFPH V+FDEDEIPSGVD
Sbjct  61   VALAGNAMAIEVLLGGGDGSLAFVPNDFSVAKGEKIVFKNNAGFPHNVVFDEDEIPSGVD  120

Query  425  AAKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
            A+KISM+E DLLN PGETY V LTE GTYS+Y
Sbjct  121  ASKISMDEQDLLNGPGETYEVALTEPGTYSFY  152



>ref|XP_010498467.1| PREDICTED: plastocyanin major isoform, chloroplastic-like [Camelina 
sativa]
Length=167

 Score =   174 bits (440),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 99/151 (66%), Positives = 117/151 (77%), Gaps = 0/151 (0%)
 Frame = +2

Query  68   MASVTSAAVAIPSFTGLKAAGASSSSRTAVKLAAAPTPKLAIKASLKNFGaaviataasa  247
            MASVTSA VAIPSFTGLKA+    S+   +  A A + KL +K+SLK+FG A +A AAS 
Sbjct  1    MASVTSATVAIPSFTGLKASTIKPSASVRINTAVAASRKLTVKSSLKDFGVAAVAAAASI  60

Query  248  llatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDA  427
             LA NA+A EV LG  DG LAF+P++ S++ GE IVFKNNAGFPH V+FDEDEIPSGVD 
Sbjct  61   ALAGNAMAIEVLLGGGDGSLAFIPNDFSISKGEKIVFKNNAGFPHNVVFDEDEIPSGVDV  120

Query  428  AKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
            AKISM+E  LLNAPGETY V+LTE GTYS+Y
Sbjct  121  AKISMSEEALLNAPGETYEVSLTEPGTYSFY  151



>ref|XP_002300679.1| Plastocyanin family protein [Populus trichocarpa]
 gb|ABK95337.1| unknown [Populus trichocarpa]
 gb|EEE79952.1| Plastocyanin family protein [Populus trichocarpa]
Length=168

 Score =   174 bits (440),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 130/152 (86%), Gaps = 1/152 (1%)
 Frame = +2

Query  68   MASVTSAAVAIPSFTGLKAAGASSSSRTA-VKLAAAPTPKLAIKASLKNFGaaviataas  244
            MA+VTSAAV+IPSFTGLKAA AS++  +A  K++A+P P+L+IKASLK  GAAV+ATAAS
Sbjct  1    MATVTSAAVSIPSFTGLKAASASNAKVSASAKVSASPLPRLSIKASLKEVGAAVVATAAS  60

Query  245  allatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVD  424
            A++A+NA+A +V LGSDDG LAFVPSE SV +GE IVFKNNAGFPH V+FDED +PSGVD
Sbjct  61   AMIASNAMAVDVLLGSDDGSLAFVPSEFSVPAGEKIVFKNNAGFPHNVLFDEDAVPSGVD  120

Query  425  AAKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
             +KISM+E DLLNA GET+ V L++KG Y++Y
Sbjct  121  VSKISMSEEDLLNAKGETFEVALSDKGEYTFY  152



>prf||1111289A plastocyanin precursor
Length=165

 Score =   173 bits (439),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 106/152 (70%), Positives = 122/152 (80%), Gaps = 4/152 (3%)
 Frame = +2

Query  68   MASVTS-AAVAIPSFTGLKAAGASSSSRTAVKLAAAPTPKLAIKASLKNFGaaviataas  244
            MA+VTS AAVAIPSF GLKA   SS++R A    A  TP+++IKASLK+ G  V ATAA+
Sbjct  1    MATVTSSAAVAIPSFAGLKA---SSTTRAATVKVAVATPRMSIKASLKDVGVVVAATAAA  57

Query  245  allatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVD  424
             +LA NA+AAEV LGS DGGLAFVPS+LS+ASGE I FKNNAGFPH  +FDEDE+P+GVD
Sbjct  58   GILAGNAMAAEVLLGSSDGGLAFVPSDLSIASGEKITFKNNAGFPHNDLFDEDEVPAGVD  117

Query  425  AAKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
              KISM E DLLNAPGE YSVTLTEKGTY +Y
Sbjct  118  VTKISMPEEDLLNAPGEEYSVTLTEKGTYKFY  149



>emb|CAN64704.1| hypothetical protein VITISV_038998 [Vitis vinifera]
Length=168

 Score =   173 bits (438),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 108/152 (71%), Positives = 126/152 (83%), Gaps = 1/152 (1%)
 Frame = +2

Query  68   MASVTSAAVAIPSFTGLKAAGAS-SSSRTAVKLAAAPTPKLAIKASLKNFGaaviataas  244
            MA VTSAAVAIPSFTGLKA+GA+ + +   VK   AP P+L  KA+LK+ G AV+ATAAS
Sbjct  1    MAIVTSAAVAIPSFTGLKASGATMTRAAATVKTXTAPAPRLVAKAALKDVGVAVVATAAS  60

Query  245  allatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVD  424
            ALLA+NA+A EV LGS DGGL FVPS ++V +GE I FKNNAGFPH V+FDEDE+PSGVD
Sbjct  61   ALLASNAMAMEVLLGSSDGGLVFVPSTITVPAGEKITFKNNAGFPHNVVFDEDEVPSGVD  120

Query  425  AAKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
             +KISM+E DLLNAPGE YSVTLTEKGTYS+Y
Sbjct  121  VSKISMSEEDLLNAPGEVYSVTLTEKGTYSFY  152



>ref|XP_002307754.1| Plastocyanin family protein [Populus trichocarpa]
 sp|P00299.2|PLAS1_POPNI RecName: Full=Plastocyanin A, chloroplastic; Flags: Precursor 
[Populus nigra]
 emb|CAA90564.1| plastocyanin a [Populus nigra]
 gb|EEE94750.1| Plastocyanin family protein [Populus trichocarpa]
Length=168

 Score =   173 bits (438),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 102/152 (67%), Positives = 130/152 (86%), Gaps = 1/152 (1%)
 Frame = +2

Query  68   MASVTSAAVAIPSFTGLKAAGASSSSRTA-VKLAAAPTPKLAIKASLKNFGaaviataas  244
            MA+VTSAAV+IPSFTGLKA  AS++  +A  K++A+P P+L+IKAS+K+ GAAV+ATAAS
Sbjct  1    MATVTSAAVSIPSFTGLKAGSASNAKVSASAKVSASPLPRLSIKASMKDVGAAVVATAAS  60

Query  245  allatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVD  424
            A++A+NA+A +V LG+DDG LAFVPSE S++ GE IVFKNNAGFPH ++FDED IPSGVD
Sbjct  61   AMIASNAMAIDVLLGADDGSLAFVPSEFSISPGEKIVFKNNAGFPHNIVFDEDSIPSGVD  120

Query  425  AAKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
            A+KISM+E DLLNA GET+ V L+ KG YS+Y
Sbjct  121  ASKISMSEEDLLNAKGETFEVALSNKGEYSFY  152



>sp|P11970.2|PLAS2_POPNI RecName: Full=Plastocyanin B, chloroplastic; Flags: Precursor 
[Populus nigra]
 emb|CAA90565.1| plastocyanin b precursor [Populus nigra]
Length=168

 Score =   172 bits (437),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 130/152 (86%), Gaps = 1/152 (1%)
 Frame = +2

Query  68   MASVTSAAVAIPSFTGLKAAGASSSSRTA-VKLAAAPTPKLAIKASLKNFGaaviataas  244
            MA+VTSAAV+IPSFTGLKAA AS++  +A  K++A+P P+L+IKASLK  GAAV+ATAAS
Sbjct  1    MAAVTSAAVSIPSFTGLKAASASNAKVSASAKVSASPLPRLSIKASLKEVGAAVVATAAS  60

Query  245  allatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVD  424
            A++A+NA+A +V LG+DDG LAFVPSE SV +GE IVFKNNAGFPH V+FDED +PSGVD
Sbjct  61   AMIASNAMAVDVLLGADDGSLAFVPSEFSVPAGEKIVFKNNAGFPHNVLFDEDAVPSGVD  120

Query  425  AAKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
             +KISM+E DLLNA GET+ V L++KG Y++Y
Sbjct  121  VSKISMSEEDLLNAKGETFEVALSDKGEYTFY  152



>gb|AAF17650.1|AC009978_26 T23E18.3 [Arabidopsis thaliana]
Length=207

 Score =   173 bits (439),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 102/161 (63%), Positives = 123/161 (76%), Gaps = 6/161 (4%)
 Frame = +2

Query  53   QEESEMASVTSAAVAIPSFTGLKAAGASSSSRTAVKLAAAPT-----PKLAIKASLKNFG  217
            Q+  +MA++TSA V IPSFTGLK A  SS  +T   ++ + +     PKLA+K+SLK+FG
Sbjct  32   QKVKKMAAITSATVTIPSFTGLKLA-VSSKPKTLSTISRSTSATRAPPKLALKSSLKDFG  90

Query  218  aaviataasallatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFD  397
               +ATAAS +LA NA+A EV LGSDDG LAFVPSE +VA GE IVFKNNAGFPH V+FD
Sbjct  91   VIAVATAASIVLAGNAMAMEVLLGSDDGSLAFVPSEFTVAKGEKIVFKNNAGFPHNVVFD  150

Query  398  EDEIPSGVDAAKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
            EDEIPSGVDA+KISM+E  LLN  GETY VTLTE G+Y +Y
Sbjct  151  EDEIPSGVDASKISMDETALLNGAGETYEVTLTEPGSYGFY  191



>emb|CDY67120.1| BnaA06g38550D [Brassica napus]
Length=166

 Score =   172 bits (435),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 100/151 (66%), Positives = 119/151 (79%), Gaps = 1/151 (1%)
 Frame = +2

Query  68   MASVTSAAVAIPSFTGLKAAGASSSSRTAVKLAAAPTPKLAIKASLKNFGaaviataasa  247
            MASVTSA VAIPSFTGLK+  +  S+   + +AA  + KL +K+SLK+FG A +A AAS 
Sbjct  1    MASVTSATVAIPSFTGLKSTISKPSAVVRIPMAATSS-KLTVKSSLKDFGVAAVAAAASI  59

Query  248  llatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDA  427
             LA NA+A +V LGS DG LAFVP+E ++A GE IVFKNNAGFPH V+FDEDEIPSGVDA
Sbjct  60   ALAGNAMAIDVLLGSGDGALAFVPNEFTIAKGEKIVFKNNAGFPHNVVFDEDEIPSGVDA  119

Query  428  AKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
            +KISM+E DLLNA GETY V LTE GTYS+Y
Sbjct  120  SKISMDEQDLLNAAGETYEVALTEPGTYSFY  150



>gb|ABK96651.1| unknown [Populus trichocarpa x Populus deltoides]
Length=168

 Score =   172 bits (435),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 129/152 (85%), Gaps = 1/152 (1%)
 Frame = +2

Query  68   MASVTSAAVAIPSFTGLKAAGASSSSRTA-VKLAAAPTPKLAIKASLKNFGaaviataas  244
            MA+VTSAAV+IPSFTGLKAA AS++  +A  K++A+P P+L+IKASLK  GAAV+ATAAS
Sbjct  1    MATVTSAAVSIPSFTGLKAASASNAKVSASAKVSASPLPRLSIKASLKEVGAAVVATAAS  60

Query  245  allatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVD  424
            A++A+NA+A +V LG DDG LAFVPSE SV +GE IVFKNNAGFPH V+FDED +PSGVD
Sbjct  61   AMIASNAMAVDVLLGGDDGSLAFVPSEFSVPAGEKIVFKNNAGFPHNVLFDEDAVPSGVD  120

Query  425  AAKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
             +KISM+E DLLNA GET+ V L++KG Y++Y
Sbjct  121  VSKISMSEEDLLNAKGETFEVALSDKGEYTFY  152



>ref|XP_004500905.1| PREDICTED: plastocyanin, chloroplastic-like [Cicer arietinum]
Length=167

 Score =   171 bits (434),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 101/151 (67%), Positives = 118/151 (78%), Gaps = 0/151 (0%)
 Frame = +2

Query  68   MASVTSAAVAIPSFTGLKAAGASSSSRTAVKLAAAPTPKLAIKASLKNFGaaviataasa  247
            MA+VTS  VAIPSFTGLKA     S+   V  + +  P+L ++ASLK+ G AVIATAASA
Sbjct  1    MATVTSTTVAIPSFTGLKANANKVSAIAKVSNSTSQLPRLGVRASLKDVGVAVIATAASA  60

Query  248  llatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDA  427
            +LA+NA+A EV LG DDG LAFVP+  SV+ GE IVFKNNAGFPH V+FDEDEIPSGVDA
Sbjct  61   VLASNAMAIEVLLGGDDGSLAFVPNSFSVSPGEKIVFKNNAGFPHNVVFDEDEIPSGVDA  120

Query  428  AKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
             KISM+E DLLN PGETY+VTL  KGTY +Y
Sbjct  121  TKISMSEEDLLNGPGETYTVTLDAKGTYKFY  151



>gb|ACJ84091.1| unknown [Medicago truncatula]
Length=167

 Score =   171 bits (434),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 104/151 (69%), Positives = 121/151 (80%), Gaps = 0/151 (0%)
 Frame = +2

Query  68   MASVTSAAVAIPSFTGLKAAGASSSSRTAVKLAAAPTPKLAIKASLKNFGaaviataasa  247
            MA+VTS  VAI SFTGLKA  +  S+   V  + +  P+L ++ASLK+FG AV+ATAASA
Sbjct  1    MATVTSTTVAILSFTGLKANASKVSAIAKVPTSNSQLPRLCVRASLKDFGVAVVATAASA  60

Query  248  llatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDA  427
            LLA+NALA EV LG+ DGGLAFVP+  +V +G+TI FKNNAGFPH VIFDEDEIPSGVDA
Sbjct  61   LLASNALAVEVLLGASDGGLAFVPNNFTVNAGDTITFKNNAGFPHNVIFDEDEIPSGVDA  120

Query  428  AKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
            AKISM E DLLNAPGETYSVTL  KGTY +Y
Sbjct  121  AKISMPEEDLLNAPGETYSVTLDAKGTYKFY  151



>emb|CAJ19272.1| plastocyanin precursor [Solanum commersonii]
Length=171

 Score =   171 bits (434),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 105/155 (68%), Positives = 125/155 (81%), Gaps = 5/155 (3%)
 Frame = +2

Query  68   MASVTSAAVAIPSFTGLKAAGASSSSRTAVKLAAAPTP----KLAIKASLKNFGaaviat  235
            MA+VTSAAVAIPSFTGLKA GASSSSR +   +A        +L +KASLK+ GA V AT
Sbjct  1    MATVTSAAVAIPSFTGLKA-GASSSSRVSTAASAKVAAAPAARLTVKASLKDVGAVVAAT  59

Query  236  aasallatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPS  415
            A SA+LA+NA+A +V LG DDG LAF+P   SV++GE I FKNNAGFPH ++FDEDEIP+
Sbjct  60   AVSAMLASNAMALDVLLGGDDGSLAFIPGNFSVSAGEKITFKNNAGFPHNIVFDEDEIPA  119

Query  416  GVDAAKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
            GVDA+KISM E DLLNAPGETYSVTL+EKGTY++Y
Sbjct  120  GVDASKISMAEEDLLNAPGETYSVTLSEKGTYTFY  154



>ref|XP_009106261.1| PREDICTED: plastocyanin [Brassica rapa]
Length=170

 Score =   171 bits (432),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 101/156 (65%), Positives = 119/156 (76%), Gaps = 7/156 (4%)
 Frame = +2

Query  68   MASVTSAAVAIPSFTGLKAAGASSSSRTAVKLAAAPTP-----KLAIKASLKNFGaavia  232
            MASVTSA VA P FTGLK A   +S  TAV +AA  +P     KL++K+SLK+FG   +A
Sbjct  1    MASVTSATVAFPCFTGLKLA--VNSKPTAVSIAAIKSPSKAAPKLSVKSSLKDFGVMAVA  58

Query  233  taasallatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIP  412
             AAS  LA NA+A E+ LGSDDGGL FVPS+ +VA GE IVFKNNAG+PH V+FDEDEIP
Sbjct  59   AAASIALAGNAMAIEILLGSDDGGLVFVPSDFTVAKGEKIVFKNNAGYPHNVVFDEDEIP  118

Query  413  SGVDAAKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
            SGVDA+KISM+E  LLN  GETY VTLTE G+YS+Y
Sbjct  119  SGVDASKISMDEQALLNGAGETYEVTLTEPGSYSFY  154



>ref|XP_010534011.1| PREDICTED: plastocyanin-like [Tarenaya hassleriana]
Length=170

 Score =   171 bits (432),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 96/154 (62%), Positives = 116/154 (75%), Gaps = 3/154 (2%)
 Frame = +2

Query  68   MASVTSAAVAIPSFTGLKAAGASSSSRTAVKLAAAPTPKLAIKASLKNFGaaviataasa  247
            MA+V S AVAIPSFTGL+A  +++   T     A  TPKL +KASLK+ G   +A AA+A
Sbjct  1    MATVASTAVAIPSFTGLRANSSAAKPTTVSVSTAVKTPKLTVKASLKDIGVTTVAVAAAA  60

Query  248  llat---nalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSG  418
             +A    N++A EV LG DDG LAFVP++ +VA GE IVFKNNAGFPH V+FDEDE+PSG
Sbjct  61   SVALAAGNSMAMEVLLGGDDGSLAFVPNDFTVAKGEKIVFKNNAGFPHNVVFDEDEVPSG  120

Query  419  VDAAKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
            VDA+KISM+E DLLN PGETY V LTE GTYS+Y
Sbjct  121  VDASKISMDEQDLLNGPGETYEVALTEPGTYSFY  154



>emb|CDX96643.1| BnaA08g21860D [Brassica napus]
Length=165

 Score =   170 bits (431),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 100/151 (66%), Positives = 117/151 (77%), Gaps = 2/151 (1%)
 Frame = +2

Query  68   MASVTSAAVAIPSFTGLKAAGASSSSRTAVKLAAAPTPKLAIKASLKNFGaaviataasa  247
            MASVTSA VAIPSFTGLK+  +  S+   V+L    +  L +KASLK+FG A +A AAS 
Sbjct  1    MASVTSATVAIPSFTGLKSTISKPSA--VVRLPTTTSRNLTVKASLKDFGVAAVAAAASI  58

Query  248  llatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDA  427
             LA NA+A +V LGS DG LAFVP+E ++A GE IVFKNNAGFPH V+FDEDEIPSGVDA
Sbjct  59   ALAGNAMAIDVLLGSGDGALAFVPNEFTIAKGEKIVFKNNAGFPHNVVFDEDEIPSGVDA  118

Query  428  AKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
            +KISM+E DLLNA GETY V LTE GTYS+Y
Sbjct  119  SKISMDEQDLLNAAGETYEVALTEPGTYSFY  149



>gb|ABK96770.1| unknown [Populus trichocarpa x Populus deltoides]
Length=168

 Score =   171 bits (432),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 101/152 (66%), Positives = 129/152 (85%), Gaps = 1/152 (1%)
 Frame = +2

Query  68   MASVTSAAVAIPSFTGLKAAGASSSSRTA-VKLAAAPTPKLAIKASLKNFGaaviataas  244
            MA+VTSAAV+IPSFTGLKA  AS++  +A  K++A+P P+L+IKAS+K+ GAAV+ATAAS
Sbjct  1    MATVTSAAVSIPSFTGLKAGSASNAKVSASAKVSASPLPRLSIKASMKDVGAAVVATAAS  60

Query  245  allatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVD  424
            A++A+NA+A +V LG+DDG LAFVPSE S++ GE IVFKNNAGFPH ++FDED IPSGVD
Sbjct  61   AMIASNAMAIDVLLGADDGSLAFVPSEFSISPGEKIVFKNNAGFPHNIVFDEDSIPSGVD  120

Query  425  AAKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
            A+KISM+E DLLNA GET+ V L+ KG Y +Y
Sbjct  121  ASKISMSEEDLLNAKGETFEVALSNKGEYIFY  152



>ref|XP_009110234.1| PREDICTED: plastocyanin [Brassica rapa]
Length=165

 Score =   170 bits (431),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 100/151 (66%), Positives = 117/151 (77%), Gaps = 2/151 (1%)
 Frame = +2

Query  68   MASVTSAAVAIPSFTGLKAAGASSSSRTAVKLAAAPTPKLAIKASLKNFGaaviataasa  247
            MASVTSA VAIPSFTGLK+  +  S+   V+L    +  L +KASLK+FG A +A AAS 
Sbjct  1    MASVTSATVAIPSFTGLKSTISKPSA--VVRLPTTASRNLTVKASLKDFGVAAVAAAASI  58

Query  248  llatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDA  427
             LA NA+A +V LGS DG LAFVP+E ++A GE IVFKNNAGFPH V+FDEDEIPSGVDA
Sbjct  59   ALAGNAMAIDVLLGSGDGALAFVPNEFTIAKGEKIVFKNNAGFPHNVVFDEDEIPSGVDA  118

Query  428  AKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
            +KISM+E DLLNA GETY V LTE GTYS+Y
Sbjct  119  SKISMDEQDLLNAAGETYEVALTEPGTYSFY  149



>ref|XP_010100113.1| Plastocyanin [Morus notabilis]
 gb|EXB81496.1| Plastocyanin [Morus notabilis]
Length=165

 Score =   170 bits (431),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 104/151 (69%), Positives = 124/151 (82%), Gaps = 2/151 (1%)
 Frame = +2

Query  68   MASVTSAAVAIPSFTGLKAAGASSSSRTAVKLAAAPTPKLAIKASLKNFGaaviataasa  247
            MA+VTSAAVAIPSFTGLKAAG++  S  A    AAPTP+  +KASLK+ G AV ATAASA
Sbjct  1    MATVTSAAVAIPSFTGLKAAGSAKVSAAAK--VAAPTPRFGVKASLKDVGIAVAATAASA  58

Query  248  llatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDA  427
            +LA+NA+A +V LG  DG L F P+  +V SGE IVFKNNAGFPH V+FDEDEIP+GVDA
Sbjct  59   MLASNAMAIDVLLGGSDGSLVFEPNNFTVGSGEKIVFKNNAGFPHNVVFDEDEIPAGVDA  118

Query  428  AKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
            +KISM+E DLLN PGE+YSVTLTEKG+Y++Y
Sbjct  119  SKISMSEEDLLNGPGESYSVTLTEKGSYAFY  149



>gb|AAA32834.1| plastocyanin [Arabidopsis thaliana]
Length=171

 Score =   170 bits (430),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 101/156 (65%), Positives = 120/156 (77%), Gaps = 6/156 (4%)
 Frame = +2

Query  68   MASVTSAAVAIPSFTGLKAAGASSSSRTAVKLAAAPT-----PKLAIKASLKNFGaavia  232
            MA++TSA V IPSFTGLK A  SS  +T   ++ + +     PKLA+K+SLK+FG   +A
Sbjct  1    MAAITSATVTIPSFTGLKLA-VSSKPKTLSTISRSSSATRAPPKLALKSSLKDFGVIAVA  59

Query  233  taasallatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIP  412
            TAAS +LA NA+A EV LGSDDG LAFVPSE +VA GE IVFKNNAGFPH V+FDEDEIP
Sbjct  60   TAASIVLAGNAMAMEVLLGSDDGSLAFVPSEFTVAKGEKIVFKNNAGFPHNVVFDEDEIP  119

Query  413  SGVDAAKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
            SGVDA+KISM+E  LLN  GETY VTLTE G+Y +Y
Sbjct  120  SGVDASKISMDETALLNGAGETYEVTLTEPGSYGFY  155



>emb|CDX87641.1| BnaA07g32320D [Brassica napus]
Length=170

 Score =   170 bits (430),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 98/154 (64%), Positives = 117/154 (76%), Gaps = 3/154 (2%)
 Frame = +2

Query  68   MASVTSAAVAIPSFTGLKAA---GASSSSRTAVKLAAAPTPKLAIKASLKNFGaaviata  238
            MASVTSA VA P FTGLK A     ++ S  A+K  +   PKL++K+SLK+FG   +A A
Sbjct  1    MASVTSATVAFPCFTGLKLAVNAKPTAVSTAAIKSPSKAAPKLSVKSSLKDFGVMAVAAA  60

Query  239  asallatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSG  418
            AS  LA NA+A E+ LGSDDGGL FVPS+ +VA GE IVFKNNAG+PH V+FDEDEIPSG
Sbjct  61   ASIALAGNAMAIEILLGSDDGGLVFVPSDFTVAKGEKIVFKNNAGYPHNVVFDEDEIPSG  120

Query  419  VDAAKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
            VDA+KISM+E  LLN  GETY VTLTE G+YS+Y
Sbjct  121  VDASKISMDEQALLNGAGETYEVTLTEPGSYSFY  154



>ref|NP_177737.1| plastocyanin 1 [Arabidopsis thaliana]
 sp|P11490.2|PLAS1_ARATH RecName: Full=Plastocyanin minor isoform, chloroplastic; Flags: 
Precursor [Arabidopsis thaliana]
 emb|CAB05911.1| plastocyanin [Arabidopsis thaliana]
 gb|AAY17414.1| At1g76100 [Arabidopsis thaliana]
 gb|ABF58943.1| At1g76100 [Arabidopsis thaliana]
 dbj|BAE98359.1| plastocyanin [Arabidopsis thaliana]
 gb|AEE35796.1| plastocyanin 1 [Arabidopsis thaliana]
Length=171

 Score =   170 bits (430),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 101/156 (65%), Positives = 120/156 (77%), Gaps = 6/156 (4%)
 Frame = +2

Query  68   MASVTSAAVAIPSFTGLKAAGASSSSRTAVKLAAAPT-----PKLAIKASLKNFGaavia  232
            MA++TSA V IPSFTGLK A  SS  +T   ++ + +     PKLA+K+SLK+FG   +A
Sbjct  1    MAAITSATVTIPSFTGLKLA-VSSKPKTLSTISRSTSATRAPPKLALKSSLKDFGVIAVA  59

Query  233  taasallatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIP  412
            TAAS +LA NA+A EV LGSDDG LAFVPSE +VA GE IVFKNNAGFPH V+FDEDEIP
Sbjct  60   TAASIVLAGNAMAMEVLLGSDDGSLAFVPSEFTVAKGEKIVFKNNAGFPHNVVFDEDEIP  119

Query  413  SGVDAAKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
            SGVDA+KISM+E  LLN  GETY VTLTE G+Y +Y
Sbjct  120  SGVDASKISMDETALLNGAGETYEVTLTEPGSYGFY  155



>emb|CDX73229.1| BnaC06g36770D [Brassica napus]
Length=170

 Score =   170 bits (430),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 99/154 (64%), Positives = 117/154 (76%), Gaps = 3/154 (2%)
 Frame = +2

Query  68   MASVTSAAVAIPSFTGLKAAGAS---SSSRTAVKLAAAPTPKLAIKASLKNFGaaviata  238
            MASVTSA VA P FTGLK A  S   + S  A+K  +   PKL++K+SLK+FG   +A A
Sbjct  1    MASVTSATVAFPCFTGLKLAVNSKPTAVSTAAIKSPSKAAPKLSVKSSLKDFGVMAVAAA  60

Query  239  asallatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSG  418
            AS  LA NA+A E+ LGSDDGGL FVPS+ +VA GE IVFKNNAGFPH V+FDEDEIPSG
Sbjct  61   ASIALAGNAMAIEILLGSDDGGLVFVPSDFTVAKGEKIVFKNNAGFPHNVVFDEDEIPSG  120

Query  419  VDAAKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
            V+A+KISM+E  LLN  GETY VTLTE G+YS+Y
Sbjct  121  VNASKISMDEQALLNGAGETYEVTLTEPGSYSFY  154



>ref|XP_004136366.1| PREDICTED: plastocyanin, chloroplastic-like [Cucumis sativus]
 gb|KGN60068.1| Plastocyanin A, chloroplast [Cucumis sativus]
Length=166

 Score =   169 bits (428),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 104/151 (69%), Positives = 123/151 (81%), Gaps = 1/151 (1%)
 Frame = +2

Query  68   MASVTSAAVAIPSFTGLKAAGASSSSRTAVKLAAAPTPKLAIKASLKNFGaaviataasa  247
            MA+VTSAAVAIPSFTGLK+  +SS   + ++L +  +PKL IKASLK+ G AV ATAASA
Sbjct  1    MAAVTSAAVAIPSFTGLKST-SSSKPTSLIRLPSPASPKLCIKASLKDVGVAVAATAASA  59

Query  248  llatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDA  427
            LLA+NA+A E+ LG DDG LAFVP+  +VASGE I FKNNAGFPH V+FDEDEIPSGVD 
Sbjct  60   LLASNAMAIEILLGGDDGSLAFVPNNFTVASGEKITFKNNAGFPHNVVFDEDEIPSGVDV  119

Query  428  AKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
             KISM+E +LLNAPGE Y V LTEKG+YS+Y
Sbjct  120  GKISMDEENLLNAPGEVYEVQLTEKGSYSFY  150



>emb|CDY54325.1| BnaCnng26710D [Brassica napus]
Length=165

 Score =   169 bits (427),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 99/151 (66%), Positives = 119/151 (79%), Gaps = 2/151 (1%)
 Frame = +2

Query  68   MASVTSAAVAIPSFTGLKAAGASSSSRTAVKLAAAPTPKLAIKASLKNFGaaviataasa  247
            MASVTSA VAIPSFTGLK+  + +S+   V+L    +  L +K+SLK+FG AV+A AAS 
Sbjct  1    MASVTSATVAIPSFTGLKSTISKTSA--VVRLPTTTSRNLTVKSSLKDFGVAVVAAAASI  58

Query  248  llatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDA  427
             LA NA+A +V LGS DG LAFVP+E ++A GE IVFKNNAGFPH V+FDEDEIPSGV+A
Sbjct  59   ALAGNAMAIDVLLGSGDGALAFVPNEFTIAKGEKIVFKNNAGFPHNVVFDEDEIPSGVEA  118

Query  428  AKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
            +KISM+E DLLNA GETY V LTE GTYS+Y
Sbjct  119  SKISMDEQDLLNAAGETYEVALTEPGTYSFY  149



>ref|XP_009149518.1| PREDICTED: LOW QUALITY PROTEIN: plastocyanin [Brassica rapa]
Length=166

 Score =   169 bits (427),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 98/151 (65%), Positives = 117/151 (77%), Gaps = 1/151 (1%)
 Frame = +2

Query  68   MASVTSAAVAIPSFTGLKAAGASSSSRTAVKLAAAPTPKLAIKASLKNFGaaviataasa  247
            MA VTSA VAIPSFTGLK+  +  S+   + +AA  + KL +K+SLK+FG A +A AAS 
Sbjct  1    MAXVTSATVAIPSFTGLKSTISKPSAVVRIPMAATSS-KLTVKSSLKDFGVAAVAAAASI  59

Query  248  llatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDA  427
             LA NA+A +V LGS DG LAFVP+E ++A GE IVFKNNAGFPH V+FDEDEIP GVDA
Sbjct  60   ALAGNAMAIDVLLGSGDGALAFVPNEFTIAKGEKIVFKNNAGFPHNVVFDEDEIPRGVDA  119

Query  428  AKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
            +KISM+E DLLNA GETY V LTE GTYS+Y
Sbjct  120  SKISMDEQDLLNAAGETYEVALTEPGTYSFY  150



>ref|XP_002889058.1| plastocyanin [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65317.1| plastocyanin [Arabidopsis lyrata subsp. lyrata]
Length=171

 Score =   167 bits (424),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 96/155 (62%), Positives = 117/155 (75%), Gaps = 4/155 (3%)
 Frame = +2

Query  68   MASVTSAAVAIPSFTGLKAAGASSSSRTAVKL----AAAPTPKLAIKASLKNFGaaviat  235
            MA++TSA V IPSFTGLK A +S  +  +  +    A    PKL++K+SLK+ G   +AT
Sbjct  1    MAAITSATVTIPSFTGLKLAVSSKPTTVSTTIRSSSATRTAPKLSVKSSLKDIGVIAVAT  60

Query  236  aasallatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPS  415
            AAS +LA NA+A EV LGSDDG L FVPSE +VA GE IVFKNNAGFPH V+FDEDEIPS
Sbjct  61   AASIVLAGNAMAMEVLLGSDDGSLVFVPSEFTVAKGEKIVFKNNAGFPHNVVFDEDEIPS  120

Query  416  GVDAAKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
            GVD +KISM+E +LLN  GE+Y VTLTE G+YS+Y
Sbjct  121  GVDTSKISMDETELLNGAGESYEVTLTEPGSYSFY  155



>emb|CDY57565.1| BnaCnng32150D [Brassica napus]
Length=168

 Score =   167 bits (424),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 99/152 (65%), Positives = 117/152 (77%), Gaps = 1/152 (1%)
 Frame = +2

Query  68   MASVTSAAVAIPSFTGLKAAGASSSSRTAVKL-AAAPTPKLAIKASLKNFGaaviataas  244
            MASVTSA VAIPSFTGLK+  +  S+   +   AA  + KL +K+SLK FG A +A AAS
Sbjct  1    MASVTSATVAIPSFTGLKSTISKPSAVVRIPTKAATSSSKLTVKSSLKRFGVAAVAAAAS  60

Query  245  allatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVD  424
              LA NA+A +V LGS +G LAFVP+E ++A GE IVFKNNAGFPH V+FDEDEIPSGVD
Sbjct  61   IALAGNAMAIDVLLGSGEGALAFVPNEFTIAKGEKIVFKNNAGFPHNVVFDEDEIPSGVD  120

Query  425  AAKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
            A+KISM+E DLLNA GETY V LTE GTYS+Y
Sbjct  121  ASKISMDEQDLLNAAGETYEVALTEPGTYSFY  152



>sp|O22646.1|PLAS_FRIAG RecName: Full=Plastocyanin, chloroplastic; Flags: Precursor [Fritillaria 
agrestis]
 gb|AAB86855.1| plastocyanin [Fritillaria agrestis]
Length=166

 Score =   166 bits (419),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 102/153 (67%), Positives = 119/153 (78%), Gaps = 5/153 (3%)
 Frame = +2

Query  68   MASVTSAAVAIPSFTGLKAAGASSSSRTAVKLAAAPTP-KLAIKASLKN-FGaaviataa  241
            MAS+TSAAV IPSFTGLKA  A ++  T++K    PTP   ++KAS K   G A++ATAA
Sbjct  1    MASLTSAAVTIPSFTGLKAGRAPTTPSTSIK---PPTPMSFSVKASFKEAIGTALVATAA  57

Query  242  sallatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGV  421
             A+LA+NALA EV LG  DG LAFVPS + VA+GET+VFKNNAGFPH V+FDEDE+P GV
Sbjct  58   GAVLASNALAVEVLLGGSDGSLAFVPSNIEVAAGETVVFKNNAGFPHNVLFDEDEVPKGV  117

Query  422  DAAKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
            DA  ISM E DLLNAPGET+SVTL EKGTYS Y
Sbjct  118  DAGAISMKEEDLLNAPGETFSVTLKEKGTYSIY  150



>gb|AFW90573.1| plastocyanin precursor [Solanum tuberosum]
Length=170

 Score =   166 bits (419),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 104/155 (67%), Positives = 123/155 (79%), Gaps = 5/155 (3%)
 Frame = +2

Query  68   MASVTSAAVAIPSFTGLKAAGASSSSRTAVKLAAAPTP----KLAIKASLKNFGaaviat  235
            MA+VTSAAVAIPSFTGLKA GASSSSR +   +A        +L +KASLK+ GA V AT
Sbjct  1    MATVTSAAVAIPSFTGLKA-GASSSSRVSTAASAKVAAAPAARLTVKASLKDVGAVVAAT  59

Query  236  aasallatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPS  415
            A SA+LA+NA+A +V LG DDG LAF+P   SV++GE I FKNNAG PH V+FDEDEIP+
Sbjct  60   AVSAMLASNAMALDVLLGGDDGSLAFIPGNFSVSAGEKITFKNNAGSPHNVVFDEDEIPA  119

Query  416  GVDAAKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
            GVDA+KISM E DLLNA GETYSVTL+EKGTY++Y
Sbjct  120  GVDASKISMAEEDLLNAAGETYSVTLSEKGTYTFY  154



>ref|XP_008357114.1| PREDICTED: plastocyanin [Malus domestica]
Length=166

 Score =   165 bits (417),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 103/151 (68%), Positives = 124/151 (82%), Gaps = 1/151 (1%)
 Frame = +2

Query  68   MASVTSAAVAIPSFTGLKAAGASSSSRTAVKLAAAPTPKLAIKASLKNFGaaviataasa  247
            MA V  AAVAIPSFTGLK+A  ++    A K++A+P     +K+SLK+ G AV ATAASA
Sbjct  1    MAFVNPAAVAIPSFTGLKSA-GAAKVNAAAKVSASPRQMCIVKSSLKDVGVAVAATAASA  59

Query  248  llatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDA  427
            +LA+NA+A EV LGSDDGGLAFVP+  S+A GE IVFKNNAGFPH V+FDEDE+PSGVDA
Sbjct  60   ILASNAMAIEVLLGSDDGGLAFVPNSFSIAPGEKIVFKNNAGFPHNVLFDEDEVPSGVDA  119

Query  428  AKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
             KISM+E DLLNAPGETY++TLTEKG+YS+Y
Sbjct  120  GKISMSEEDLLNAPGETYAITLTEKGSYSFY  150



>ref|NP_001238695.1| uncharacterized protein LOC100499708 [Glycine max]
 gb|ACU13333.1| unknown [Glycine max]
Length=167

 Score =   165 bits (417),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 106/152 (70%), Positives = 122/152 (80%), Gaps = 2/152 (1%)
 Frame = +2

Query  68   MASVTSAAVAIPSFTGLKAAGASSSSRTAVKLAAAPTPKLA-IKASLKNFGaaviataas  244
            MA+VTSAAV+IPSFTGLKA+ A   S  AVK++A    +   IKASLK+ G AV+ATAAS
Sbjct  1    MATVTSAAVSIPSFTGLKAS-AGKVSAAAVKVSAPQATRFCGIKASLKDVGVAVVATAAS  59

Query  245  allatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVD  424
            A+LA+NA+A EV LG+DDG L F P+  SVA GE IVFKNNAGFPH V+FDEDEIPSGVD
Sbjct  60   AVLASNAMAIEVLLGTDDGSLVFSPNSFSVAPGEKIVFKNNAGFPHNVVFDEDEIPSGVD  119

Query  425  AAKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
            A KISM+E DLLNA GETYSVTL  KGTYS+Y
Sbjct  120  AGKISMSEEDLLNAAGETYSVTLDAKGTYSFY  151



>ref|XP_006342088.1| PREDICTED: plastocyanin, chloroplastic-like [Solanum tuberosum]
Length=170

 Score =   164 bits (415),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 100/154 (65%), Positives = 119/154 (77%), Gaps = 3/154 (2%)
 Frame = +2

Query  68   MASVTSAAVAIPSFTGLKAAGASSSSRTAVKLAAAPTP---KLAIKASLKNFGaaviata  238
            MA+VTSAAVAIPSFTGLKA  +SSS  +    A        +L +KASLK+ GA V AT 
Sbjct  1    MATVTSAAVAIPSFTGLKAGASSSSRVSTGSSAKVAAAPAARLTVKASLKDVGAVVAATT  60

Query  239  asallatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSG  418
             SA+LA+NA+A +V LG DDG LAF+P   SV++GE I FKNNAGFPH V+FDEDEIP+G
Sbjct  61   VSAMLASNAMALDVLLGGDDGSLAFIPGNFSVSAGEKITFKNNAGFPHNVVFDEDEIPAG  120

Query  419  VDAAKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
            VDA+KISM E DLLNA GETYSVTL+EKGTY++Y
Sbjct  121  VDASKISMAEEDLLNAAGETYSVTLSEKGTYTFY  154



>ref|XP_011003094.1| PREDICTED: plastocyanin A, chloroplastic [Populus euphratica]
Length=168

 Score =   163 bits (412),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 102/152 (67%), Positives = 127/152 (84%), Gaps = 1/152 (1%)
 Frame = +2

Query  68   MASVTSAAVAIPSFTGLKAAGASSSSRTAVKLAAA-PTPKLAIKASLKNFGaaviataas  244
            MA+VTSAAV+IPSFTGLKA  ASS+  +A    +A P P+L+IKAS+K+ G AV+ATAAS
Sbjct  1    MATVTSAAVSIPSFTGLKAGSASSAKVSASAKVSASPLPRLSIKASMKDVGVAVVATAAS  60

Query  245  allatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVD  424
            A++A+NA+A +V LG+DDG LAFVPSE S++SGE IVFKNNAGFPH ++FDED IPSGVD
Sbjct  61   AMIASNAMAIDVLLGADDGSLAFVPSEFSISSGEKIVFKNNAGFPHNIVFDEDSIPSGVD  120

Query  425  AAKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
            A+KISM+E DLLNA GET+ V L+ KG YS+Y
Sbjct  121  ASKISMSEEDLLNAKGETFEVALSNKGEYSFY  152



>ref|XP_010666739.1| PREDICTED: plastocyanin, chloroplastic [Beta vulgaris subsp. 
vulgaris]
Length=168

 Score =   162 bits (409),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 97/152 (64%), Positives = 117/152 (77%), Gaps = 1/152 (1%)
 Frame = +2

Query  68   MASVTS-AAVAIPSFTGLKAAGASSSSRTAVKLAAAPTPKLAIKASLKNFGaaviataas  244
            MA+VTS AAVA+PSFTGLKAAG +  +   +       P+L++KASLKN G AV ATAA+
Sbjct  1    MATVTSSAAVAVPSFTGLKAAGPAKPTIAKMIPTTTAVPRLSVKASLKNVGVAVAATAAA  60

Query  245  allatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVD  424
             +LA NA+A E+ LG + G LAFVP + +VA+GE IVFKNNAG+PH V+FDEDEIPSGVD
Sbjct  61   GILAGNAMAIEILLGGEGGVLAFVPQDFNVAAGEEIVFKNNAGYPHNVVFDEDEIPSGVD  120

Query  425  AAKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
            A KISM E DLLN PGETY V LTEKG+Y +Y
Sbjct  121  AGKISMPEEDLLNGPGETYKVVLTEKGSYKFY  152



>ref|XP_008806153.1| PREDICTED: plastocyanin [Phoenix dactylifera]
Length=169

 Score =   160 bits (404),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 103/159 (65%), Positives = 122/159 (77%), Gaps = 14/159 (9%)
 Frame = +2

Query  68   MASVTSAAVAIPSFTGLKA--------AGASSSSRTAVKLAAAPTPKLAIKASLKNFGaa  223
            MAS+T+AAV IPSFTGLKA        + A++ S+  V +A +P      +ASLK  G A
Sbjct  1    MASLTAAAVTIPSFTGLKAGTAAARVGSSAAAGSKAPVAMAVSP------RASLKEVGVA  54

Query  224  viataasallatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDED  403
            V ATAASA+LA NALA +V LG  DG LAFVPS+ SVA GETIVFKNNAGFPH V+FDED
Sbjct  55   VAATAASAVLAGNALAIDVLLGGSDGSLAFVPSDFSVAPGETIVFKNNAGFPHNVVFDED  114

Query  404  EIPSGVDAAKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
            EIPSGVDA+ ISM++ DLLNAPGETY+VTL EKGTY++Y
Sbjct  115  EIPSGVDASAISMSDEDLLNAPGETYTVTLKEKGTYTFY  153



>ref|XP_009401380.1| PREDICTED: plastocyanin-like [Musa acuminata subsp. malaccensis]
Length=170

 Score =   159 bits (403),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 96/154 (62%), Positives = 109/154 (71%), Gaps = 3/154 (2%)
 Frame = +2

Query  68   MASVTSAAVAIPSFTGLKAAGASSSSRTAVKLAAAPTPKLAIKASLKNF---Gaaviata  238
            MAS+T+ AV IPSFTGLKA  A S +  AV    A    ++ +ASLK       A  A A
Sbjct  1    MASMTTTAVTIPSFTGLKATAARSGAIVAVASPRAKVAGVSARASLKEVKVAAVAAAAAA  60

Query  239  asallatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSG  418
            ++ L   NALA EV LG +DG LAFVP E SVA+GE IVFKNN  FPH VIFDEDEIP G
Sbjct  61   SALLATGNALALEVLLGGNDGSLAFVPGEFSVAAGEAIVFKNNQAFPHNVIFDEDEIPKG  120

Query  419  VDAAKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
            VDAA ISM+E DLLNAPGETYSVTL EKGTY++Y
Sbjct  121  VDAAAISMSEEDLLNAPGETYSVTLNEKGTYTFY  154



>ref|XP_010063287.1| PREDICTED: plastocyanin [Eucalyptus grandis]
Length=168

 Score =   159 bits (401),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 93/152 (61%), Positives = 114/152 (75%), Gaps = 1/152 (1%)
 Frame = +2

Query  68   MASVTSAAVAIPSFTGLKAAGASSSSRTAVKLAAAPTPKLAIKASLKNFGaaviataasa  247
            MA+VTSAAVAIPSFTGLKAA  +  + +A   AA   P++A++ASLK+   A     A++
Sbjct  1    MAAVTSAAVAIPSFTGLKAALPAKPAISARVPAAPLAPRMAVRASLKDAVGAAAIATATS  60

Query  248  llat-nalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVD  424
             L   NA+A EV LG++ G L F P+  +V+SGE IVFKN AGFPH V+FDEDEIPSGVD
Sbjct  61   ALLAGNAMAIEVLLGAEGGELVFAPNNFTVSSGEKIVFKNYAGFPHNVVFDEDEIPSGVD  120

Query  425  AAKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
            A KISM E +LLN PGETY+VTLTEKGTYS+Y
Sbjct  121  ATKISMPEEELLNGPGETYAVTLTEKGTYSFY  152



>sp|P00289.2|PLAS_SPIOL RecName: Full=Plastocyanin, chloroplastic; Flags: Precursor [Spinacia 
oleracea]
 emb|CAA28398.1| unnamed protein product [Spinacia oleracea]
Length=168

 Score =   159 bits (401),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 95/138 (69%), Positives = 110/138 (80%), Gaps = 0/138 (0%)
 Frame = +2

Query  107  FTGLKAAGASSSSRTAVKLAAAPTPKLAIKASLKNFGaaviataasallatnalaaEVKL  286
            FTGLKA+G+   +   +       P+L++KASLKN GAAV+ATAA+ LLA NA+A EV L
Sbjct  15   FTGLKASGSIKPTTAKIIPTTTAVPRLSVKASLKNVGAAVVATAAAGLLAGNAMAVEVLL  74

Query  287  GSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXDLLNA  466
            G  DG LAF+P + SVASGE IVFKNNAGFPH V+FDEDEIPSGVDAAKISM+E DLLNA
Sbjct  75   GGGDGSLAFLPGDFSVASGEEIVFKNNAGFPHNVVFDEDEIPSGVDAAKISMSEEDLLNA  134

Query  467  PGETYSVTLTEKGTYSYY  520
            PGETY VTLTEKGTY +Y
Sbjct  135  PGETYKVTLTEKGTYKFY  152



>gb|KFK34454.1| hypothetical protein AALP_AA5G147400 [Arabis alpina]
Length=169

 Score =   158 bits (399),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 94/153 (61%), Positives = 116/153 (76%), Gaps = 2/153 (1%)
 Frame = +2

Query  68   MASVTSAAVAIPSFTGLKAAGASS--SSRTAVKLAAAPTPKLAIKASLKNFGaaviataa  241
            MASVTSA VAIPSFTGLK A  S   S  T ++ +++ T KL +K+SLK+FG   +ATAA
Sbjct  1    MASVTSATVAIPSFTGLKLAAISKPVSVSTTIRSSSSSTAKLTVKSSLKDFGVMAVATAA  60

Query  242  sallatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGV  421
            S  L  NA+A E+ LGSDDGGL FVPS+ +VA GE IVFKNNAGFPH V+FDEDEIPSGV
Sbjct  61   SMALVGNAMAIEILLGSDDGGLVFVPSDFTVAKGEKIVFKNNAGFPHNVVFDEDEIPSGV  120

Query  422  DAAKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
            D +KISM++ +LLN  G+ Y VTLT  G+Y ++
Sbjct  121  DVSKISMDDQELLNGAGDKYEVTLTVPGSYGFF  153



>ref|XP_010935182.1| PREDICTED: plastocyanin B'/B'' [Elaeis guineensis]
Length=170

 Score =   157 bits (396),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 101/154 (66%), Positives = 120/154 (78%), Gaps = 3/154 (2%)
 Frame = +2

Query  68   MASVTSAAVAIPSFTGLKAAGASSSSRTAVKLAAAPTP---KLAIKASLKNFGaaviata  238
            MAS+T+AAV IPSFTGLKA  A+++  +      +  P     + +ASLK  G AV ATA
Sbjct  1    MASLTAAAVTIPSFTGLKAGPAAAARASGSAATGSKAPVAMAASTRASLKEVGVAVAATA  60

Query  239  asallatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSG  418
            ASA+LA+NALA +V LG DDG LAFVPS+ SVA+GETIVFKNNA FPH V+FDEDEIPSG
Sbjct  61   ASAMLASNALAVDVLLGGDDGSLAFVPSDFSVAAGETIVFKNNAAFPHNVVFDEDEIPSG  120

Query  419  VDAAKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
            VDA+ ISM+E DLLN PGETYSVTL EKGTY++Y
Sbjct  121  VDASAISMSEEDLLNGPGETYSVTLKEKGTYTFY  154



>ref|XP_006435266.1| hypothetical protein CICLE_v10002698mg [Citrus clementina]
 ref|XP_006473724.1| PREDICTED: plastocyanin, chloroplastic-like [Citrus sinensis]
 gb|ESR48506.1| hypothetical protein CICLE_v10002698mg [Citrus clementina]
 gb|KDO84976.1| hypothetical protein CISIN_1g030950mg [Citrus sinensis]
Length=168

 Score =   156 bits (395),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 106/153 (69%), Positives = 127/153 (83%), Gaps = 3/153 (2%)
 Frame = +2

Query  68   MASVTSAAVAIPSFTGLKAAGASSSS--RTAVKLAAAPTPKLAIKASLKNFGaaviataa  241
            MA+VTSAAV +P+FTGLKA GA+ +    + +K +A+  PKL+IKA+LK+ G AV ATAA
Sbjct  1    MATVTSAAVTVPTFTGLKA-GATPARVVGSTMKASASAVPKLSIKATLKDVGVAVAATAA  59

Query  242  sallatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGV  421
            SA+LA+NA+A EV LG DDG LAFVPS  SV+SGE IVFKNNAGFPH V+FDEDEIPSGV
Sbjct  60   SAMLASNAMAIEVLLGGDDGSLAFVPSSFSVSSGEKIVFKNNAGFPHNVVFDEDEIPSGV  119

Query  422  DAAKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
            D +KISM+  DLLN PGETY+VTLTEKGTYS+Y
Sbjct  120  DVSKISMSTEDLLNGPGETYAVTLTEKGTYSFY  152



>ref|XP_010941357.1| PREDICTED: plastocyanin B'/B''-like [Elaeis guineensis]
Length=170

 Score =   154 bits (389),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 100/160 (63%), Positives = 119/160 (74%), Gaps = 15/160 (9%)
 Frame = +2

Query  68   MASVTSAAVAIPSFTGLKAAGAS---------SSSRTAVKLAAAPTPKLAIKASLKNFGa  220
            MAS+T+AAV IPSFTGLKA  A+         + S+  V +A +P      +ASLK  G 
Sbjct  1    MASLTAAAVTIPSFTGLKAGTAAARASSSSLGTGSKAPVAMAVSP------RASLKELGV  54

Query  221  aviataasallatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDE  400
            AV ATAASA+LA+NALA +V LG  DG LAFVPS+ SV+SGE IVFKNNAGFPH V+FD 
Sbjct  55   AVAATAASAMLASNALAIDVLLGGSDGSLAFVPSDFSVSSGEKIVFKNNAGFPHNVVFDV  114

Query  401  DEIPSGVDAAKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
            DEIPSGVDA+ ISM+E DLLN PGETY+VTL  KGTY++Y
Sbjct  115  DEIPSGVDASAISMDEEDLLNGPGETYTVTLDAKGTYTFY  154



>ref|XP_006828829.1| hypothetical protein AMTR_s00001p00142570 [Amborella trichopoda]
 gb|ERM96245.1| hypothetical protein AMTR_s00001p00142570 [Amborella trichopoda]
Length=167

 Score =   150 bits (380),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 90/151 (60%), Positives = 108/151 (72%), Gaps = 0/151 (0%)
 Frame = +2

Query  68   MASVTSAAVAIPSFTGLKAAGASSSSRTAVKLAAAPTPKLAIKASLKNFGaaviataasa  247
            MA+  +A   IPSFTGLKA  +  +SR   +    P   L  KASLK  G A +A +AS 
Sbjct  1    MATTVAATATIPSFTGLKAGASVEASRPVSQSKVTPNACLCAKASLKGVGVAAVAASASV  60

Query  248  llatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDA  427
            +L +NA+A +V LGS+DG L FVPS   V +GE IVFKNNAGFPH V+FDEDE+P+GVD 
Sbjct  61   MLGSNAMAFDVLLGSNDGSLNFVPSNFDVPAGEKIVFKNNAGFPHNVVFDEDEVPAGVDV  120

Query  428  AKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
            +KISM E DLLNAPGETYSVTL  KGTYS+Y
Sbjct  121  SKISMPEEDLLNAPGETYSVTLDTKGTYSFY  151



>gb|ACC59118.1| At1G20340-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ACC59119.1| At1G20340-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ACC59121.1| At1G20340-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ACC59122.1| At1G20340-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ACC59123.1| At1G20340-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ACC59124.1| At1G20340-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ACC59125.1| At1G20340-like protein, partial [Arabidopsis lyrata subsp. lyrata]
Length=127

 Score =   147 bits (370),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 82/125 (66%), Positives = 94/125 (75%), Gaps = 0/125 (0%)
 Frame = +2

Query  137  SSSRTAVKLAAAPTPKLAIKASLKNFGaaviataasallatnalaaEVKLGSDDGGLAFV  316
            SS+   ++ AA   PKL +K+SLKNFG A +   AS  LA NA+A EV LG  DG LAF+
Sbjct  3    SSATVRIQTAAVAXPKLTVKSSLKNFGVAAVXAVASISLAGNAMAIEVLLGGGDGALAFI  62

Query  317  PSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXDLLNAPGETYSVTLT  496
            P++ SVA GE IVFKNNAGFPH V+FDEDEIPSGVD AKISM+E DLLNA GETY V LT
Sbjct  63   PNDFSVAKGEKIVFKNNAGFPHNVVFDEDEIPSGVDVAKISMDEQDLLNAAGETYEVALT  122

Query  497  EKGTY  511
            E GTY
Sbjct  123  EPGTY  127



>gb|ACC59112.1| At1G20340-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ACC59113.1| At1G20340-like protein, partial [Arabidopsis lyrata subsp. petraea]
Length=127

 Score =   147 bits (370),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 95/125 (76%), Gaps = 0/125 (0%)
 Frame = +2

Query  137  SSSRTAVKLAAAPTPKLAIKASLKNFGaaviataasallatnalaaEVKLGSDDGGLAFV  316
            SS+   ++ AA   PKL +K+SLKNFG A +  AAS  LA NA+A EV LG  DG LAFV
Sbjct  3    SSATVRIQTAAVAXPKLTVKSSLKNFGVAAVXAAASIALAGNAMAIEVLLGGGDGALAFV  62

Query  317  PSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXDLLNAPGETYSVTLT  496
            P++ SVA GE IVFKNNAGFPH V+FDEDEIPSGVD AKISM+E DLLNA GETY V LT
Sbjct  63   PNDFSVAKGEKIVFKNNAGFPHNVVFDEDEIPSGVDVAKISMDEQDLLNAAGETYEVALT  122

Query  497  EKGTY  511
            E GTY
Sbjct  123  EPGTY  127



>ref|XP_009418692.1| PREDICTED: plastocyanin-like [Musa acuminata subsp. malaccensis]
Length=169

 Score =   147 bits (371),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 99/154 (64%), Positives = 116/154 (75%), Gaps = 4/154 (3%)
 Frame = +2

Query  68   MASVTSAAVAIPSFTGLKAAGASSSSRTA---VKLAAAPTPKLAIKASLKNFGaaviata  238
            MAS+TSAAV IP+FTGL+A G S++ R A      + AP   +  +ASL+  GAA  A A
Sbjct  1    MASLTSAAVTIPTFTGLRA-GTSAARRGASVVAAHSKAPAAAMVARASLREVGAAAAAVA  59

Query  239  asallatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSG  418
            ASA+LA NALA +V LG  DG LAFVP+E SV SGETIVFKNNAGFPH V+FDEDEIP+G
Sbjct  60   ASAVLAGNALAFDVLLGGSDGSLAFVPNEFSVPSGETIVFKNNAGFPHNVVFDEDEIPAG  119

Query  419  VDAAKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
            V+   ISM E DLLNAPGETY VTL EKGTY++Y
Sbjct  120  VNVGSISMPEEDLLNAPGETYQVTLKEKGTYTFY  153



>emb|CAJ34813.1| plastocyanine [Plantago major]
Length=191

 Score =   147 bits (371),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 92/159 (58%), Positives = 113/159 (71%), Gaps = 12/159 (8%)
 Frame = +2

Query  53   QEESEMASVTSAAVAIPSFTGLKAAGASSSSRTAVKLAAA---PTPKLAIKASLKNFGaa  223
             ++++MA+VTSA++ I           S   +T  +L  A   PTPK AIKASLK+FG A
Sbjct  26   NQQTKMATVTSASIKIQ---------LSPLLKTTSRLTTATFKPTPKFAIKASLKDFGVA  76

Query  224  viataasallatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDED  403
            V ATAASAL+A+NA+A +V LG DDG LAF+P    VA+GE I FKNNAGFPH V+FDED
Sbjct  77   VAATAASALIASNAMAIDVLLGGDDGSLAFIPGNFEVAAGEKITFKNNAGFPHNVVFDED  136

Query  404  EIPSGVDAAKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
            E PSGV+   ISM+E D LNA  E YSVTLTEKGTY++Y
Sbjct  137  ECPSGVNTGAISMSEEDYLNAKDEVYSVTLTEKGTYTFY  175



>prf||0512262B plastocyanin
Length=99

 Score =   143 bits (360),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXD  454
            +V LGSDDGGLAFVP+  S+A+GE IVFKNNAGFPH V+FDEDEIPSGVDA+KISM+E D
Sbjct  2    DVLLGSDDGGLAFVPNNFSIAAGEKIVFKNNAGFPHNVVFDEDEIPSGVDASKISMDEAD  61

Query  455  LLNAPGETYSVTLTEKGTYSYY  520
            LLNAPGETY+VTLTEKG+YS+Y
Sbjct  62   LLNAPGETYAVTLTEKGSYSFY  83



>gb|ACC59110.1| At1G20340-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ACC59115.1| At1G20340-like protein, partial [Arabidopsis lyrata subsp. petraea]
Length=127

 Score =   144 bits (362),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 83/125 (66%), Positives = 94/125 (75%), Gaps = 0/125 (0%)
 Frame = +2

Query  137  SSSRTAVKLAAAPTPKLAIKASLKNFGaaviataasallatnalaaEVKLGSDDGGLAFV  316
            SS+   ++ AA   PKL +K+SLKNFG A +  AAS  LA NA+A EV LG  DG LA V
Sbjct  3    SSATVRIQTAAVAXPKLTVKSSLKNFGVAAVXAAASIALAGNAMAIEVLLGGGDGALAXV  62

Query  317  PSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXDLLNAPGETYSVTLT  496
            P++ SVA GE IVFKNNAGFPH V+FDEDEIPSGVD AKISM+E DLLNA GETY V LT
Sbjct  63   PNDFSVAKGEKIVFKNNAGFPHNVVFDEDEIPSGVDVAKISMDEQDLLNAAGETYEVALT  122

Query  497  EKGTY  511
            E GTY
Sbjct  123  EPGTY  127



>gb|ACC59120.1| At1G20340-like protein, partial [Arabidopsis lyrata subsp. lyrata]
Length=127

 Score =   144 bits (362),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 81/125 (65%), Positives = 93/125 (74%), Gaps = 0/125 (0%)
 Frame = +2

Query  137  SSSRTAVKLAAAPTPKLAIKASLKNFGaaviataasallatnalaaEVKLGSDDGGLAFV  316
            SS+   ++ AA   PKL +K+SLKNFG A +   AS  LA NA+A EV LG  DG LA +
Sbjct  3    SSATVRIQTAAVAXPKLTVKSSLKNFGVAAVXAVASISLAGNAMAIEVLLGGGDGALAXI  62

Query  317  PSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXDLLNAPGETYSVTLT  496
            P++ SVA GE IVFKNNAGFPH V+FDEDEIPSGVD AKISM+E DLLNA GETY V LT
Sbjct  63   PNDFSVAKGEKIVFKNNAGFPHNVVFDEDEIPSGVDVAKISMDEQDLLNAAGETYEVALT  122

Query  497  EKGTY  511
            E GTY
Sbjct  123  EPGTY  127



>gb|ACC59114.1| At1G20340-like protein, partial [Arabidopsis lyrata subsp. petraea]
Length=127

 Score =   142 bits (358),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 81/125 (65%), Positives = 92/125 (74%), Gaps = 0/125 (0%)
 Frame = +2

Query  137  SSSRTAVKLAAAPTPKLAIKASLKNFGaaviataasallatnalaaEVKLGSDDGGLAFV  316
            SS+   ++ AA   PKL +K+SLKNFG A +   AS  LA NA+A EV LG  DG LAF 
Sbjct  3    SSATVRIQTAAVAXPKLTVKSSLKNFGVAAVXAXASIXLAGNAMAIEVLLGGGDGALAFX  62

Query  317  PSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXDLLNAPGETYSVTLT  496
            P++ SVA GE IVFKNNAGFPH V+FDEDEIPSGVD AKISM+E  LLNA GETY V LT
Sbjct  63   PNDFSVAKGEKIVFKNNAGFPHNVVFDEDEIPSGVDVAKISMDEQXLLNAAGETYEVALT  122

Query  497  EKGTY  511
            E GTY
Sbjct  123  EPGTY  127



>gb|ACC59116.1| At1G20340-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ACC59117.1| At1G20340-like protein, partial [Arabidopsis lyrata subsp. petraea]
Length=127

 Score =   142 bits (357),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 82/125 (66%), Positives = 93/125 (74%), Gaps = 0/125 (0%)
 Frame = +2

Query  137  SSSRTAVKLAAAPTPKLAIKASLKNFGaaviataasallatnalaaEVKLGSDDGGLAFV  316
            SS+   ++ AA   PKL +K+SLKNFG A +  AAS  LA NA+A EV LG  DG LAF 
Sbjct  3    SSATVRIQTAAVAXPKLTVKSSLKNFGVAAVXAAASIALAGNAMAIEVLLGGGDGALAFX  62

Query  317  PSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXDLLNAPGETYSVTLT  496
            P++ SVA GE IVFKNNAGFPH V+FDEDEIPSGVD AKISM+E  LLNA GETY V LT
Sbjct  63   PNDFSVAKGEKIVFKNNAGFPHNVVFDEDEIPSGVDVAKISMDEQXLLNAAGETYEVALT  122

Query  497  EKGTY  511
            E GTY
Sbjct  123  EPGTY  127



>prf||0512260A plastocyanin
Length=99

 Score =   140 bits (354),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 63/82 (77%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXD  454
            E+KLG DDG LAFVP   +VA+GE IVFKNNAGFPH ++FDEDE+P+GVDAAKISM+E D
Sbjct  2    EIKLGGDDGALAFVPGSFTVAAGEKIVFKNNAGFPHNIVFDEDEVPAGVDAAKISMSEED  61

Query  455  LLNAPGETYSVTLTEKGTYSYY  520
            LLNAPGETY+VTL+EKGTYS+Y
Sbjct  62   LLNAPGETYAVTLSEKGTYSFY  83



>pdb|1AG6|A Chain A, Plastocyanin From Spinach
Length=99

 Score =   140 bits (354),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 67/82 (82%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXD  454
            EV LG DDG LAF+P + SVASGE IVFKNNAGFPH V+FDEDEIPSGVDAAKISM+E D
Sbjct  2    EVLLGGDDGSLAFLPGDFSVASGEEIVFKNNAGFPHNVVFDEDEIPSGVDAAKISMSEED  61

Query  455  LLNAPGETYSVTLTEKGTYSYY  520
            LLNAPGETY VTLTEKGTY +Y
Sbjct  62   LLNAPGETYKVTLTEKGTYKFY  83



>sp|P00290.1|PLAS_LACSA RecName: Full=Plastocyanin [Lactuca sativa]
 prf||765954A plastocyanin
Length=99

 Score =   140 bits (352),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 67/82 (82%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXD  454
            EV LGS DGGL F PS  SVASGE IVFKNNAGFPH V+FDEDEIP+GVDA+KISM+E D
Sbjct  2    EVLLGSSDGGLVFEPSTFSVASGEKIVFKNNAGFPHNVVFDEDEIPAGVDASKISMSEED  61

Query  455  LLNAPGETYSVTLTEKGTYSYY  520
            LLNAPGETY+VTLTEKGTYS+Y
Sbjct  62   LLNAPGETYAVTLTEKGTYSFY  83



>sp|P00298.1|PLAS_RUMOB RecName: Full=Plastocyanin [Rumex obtusifolius]
Length=99

 Score =   139 bits (350),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 62/82 (76%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXD  454
            E+KLG DDG LAFVP   +VA+GE IVFKNNAGFPH ++FDEDE+P+GVDA+KISM+E D
Sbjct  2    EIKLGGDDGALAFVPGSFTVAAGEKIVFKNNAGFPHNIVFDEDEVPAGVDASKISMSEED  61

Query  455  LLNAPGETYSVTLTEKGTYSYY  520
            LLNAPGETY+VTL+EKGTYS+Y
Sbjct  62   LLNAPGETYAVTLSEKGTYSFY  83



>sp|P00297.1|PLAS_SOLCR RecName: Full=Plastocyanin [Solanum crispum]
 prf||0512261A plastocyanin
Length=99

 Score =   139 bits (350),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXD  454
            EV LGSDDGGLAFVP   S+++GE I FKNNAGFPH V+FDEDEIP+GVDA+KISM E D
Sbjct  2    EVLLGSDDGGLAFVPGNFSISAGEKITFKNNAGFPHNVVFDEDEIPAGVDASKISMPEED  61

Query  455  LLNAPGETYSVTLTEKGTYSYY  520
            LLNAPGETYSVTL+EKGTYS+Y
Sbjct  62   LLNAPGETYSVTLSEKGTYSFY  83



>gb|ACC59126.1| At1G20340-like protein, partial [Arabidopsis lyrata subsp. petraea]
Length=127

 Score =   139 bits (351),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 81/125 (65%), Positives = 93/125 (74%), Gaps = 0/125 (0%)
 Frame = +2

Query  137  SSSRTAVKLAAAPTPKLAIKASLKNFGaaviataasallatnalaaEVKLGSDDGGLAFV  316
            SS+   ++ AA   PKL +K+SLKNFG A +  AAS  LA NA+A EV LG  DG LA +
Sbjct  3    SSATVRIQTAAVAXPKLTVKSSLKNFGVAAVXAAASIALAGNAMAIEVLLGGGDGALAXI  62

Query  317  PSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXDLLNAPGETYSVTLT  496
            P++ SVA GE IVFKNNAGFPH V+FDEDEIPSGVD AKISM+E  LLNA GETY V LT
Sbjct  63   PNDFSVAKGEKIVFKNNAGFPHNVVFDEDEIPSGVDVAKISMDEQVLLNAAGETYEVALT  122

Query  497  EKGTY  511
            E GTY
Sbjct  123  EPGTY  127



>sp|P35477.1|PLAS2_TOBAC RecName: Full=Plastocyanin B'/B'' [Nicotiana tabacum]
 gb|AAB29409.1| a-plastocyanin, PCa(I) [Nicotiana tabacum=tobacco, var. Virginia, 
whole leaves, Peptide, 99 aa]
Length=99

 Score =   138 bits (348),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXD  454
            EV LGSDDGGLAFVP   SV++GE I FKNNAGFPH V+FDEDEIP+GVDA+KISM+E D
Sbjct  2    EVLLGSDDGGLAFVPGNFSVSAGEKITFKNNAGFPHNVVFDEDEIPAGVDASKISMSEED  61

Query  455  LLNAPGETYSVTLTEKGTYSYY  520
            LLN PGETYSVTL+EKGTY++Y
Sbjct  62   LLNGPGETYSVTLSEKGTYTFY  83



>sp|P00292.1|PLAS_CUCPE RecName: Full=Plastocyanin [Cucurbita pepo]
Length=99

 Score =   138 bits (348),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXD  454
            EV LG DDG LAF+P++ SVA+GE IVFKNNAGFPH V+FDEDEIPSGVDA KISMNE D
Sbjct  2    EVLLGGDDGSLAFIPNDFSVAAGEKIVFKNNAGFPHNVVFDEDEIPSGVDAGKISMNEED  61

Query  455  LLNAPGETYSVTLTEKGTYSYY  520
            LLNAPGE Y V LTEKG+YS+Y
Sbjct  62   LLNAPGEVYKVNLTEKGSYSFY  83



>pdb|2PCF|A Chain A, The Complex Of Cytochrome F And Plastocyanin Determined 
With Paramagnetic Nmr. Based On The Structures Of Cytochrome 
F And Plastocyanin, 10 Structures
 pdb|1YLB|B Chain B, Nmr Solution Structure Of The Reduced Spinach Plastocyanin
Length=99

 Score =   137 bits (346),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXD  454
            EV LG  DG LAF+P + SVASGE IVFKNNAGFPH V+FDEDEIPSGVDAAKISM+E D
Sbjct  2    EVLLGGGDGSLAFLPGDFSVASGEEIVFKNNAGFPHNVVFDEDEIPSGVDAAKISMSEED  61

Query  455  LLNAPGETYSVTLTEKGTYSYY  520
            LLNAPGETY VTLTEKGTY +Y
Sbjct  62   LLNAPGETYKVTLTEKGTYKFY  83



>sp|P00295.1|PLAS_MERPE RecName: Full=Plastocyanin [Mercurialis perennis]
Length=99

 Score =   137 bits (346),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXD  454
            +V LGSDDG LAFVP+  SV SGE I FKNNAGFPH V+FDEDEIPSGVDA+KISM+E D
Sbjct  2    DVLLGSDDGELAFVPNNFSVPSGEKITFKNNAGFPHNVVFDEDEIPSGVDASKISMDEAD  61

Query  455  LLNAPGETYSVTLTEKGTYSYY  520
            LLNAPGETY+VTLTEKG+YS+Y
Sbjct  62   LLNAPGETYAVTLTEKGSYSFY  83



>pdb|1OOW|A Chain A, The Crystal Structure Of The Spinach Plastocyanin Double 
Mutant G8dL12E GIVES INSIGHT INTO ITS LOW REACTIVITY Towards 
Photosystem 1 And Cytochrome F
Length=99

 Score =   137 bits (346),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXD  454
            EV LG DDG  AF+P + SVASGE IVFKNNAGFPH V+FDEDEIPSGVDAAKISM+E D
Sbjct  2    EVLLGGDDGSEAFLPGDFSVASGEEIVFKNNAGFPHNVVFDEDEIPSGVDAAKISMSEED  61

Query  455  LLNAPGETYSVTLTEKGTYSYY  520
            LLNAPGETY VTLTEKGTY +Y
Sbjct  62   LLNAPGETYKVTLTEKGTYKFY  83



>pdb|1TEF|A Chain A, Crystal Structure Of The Spinach Plastocyanin Mutants 
G8dK30CT69C AND K30CT69C- A Study Of The Effect On Crystal 
Packing And Thermostability From The Introduction Of A Novel 
Disulfide Bond
 pdb|1TEF|B Chain B, Crystal Structure Of The Spinach Plastocyanin Mutants 
G8dK30CT69C AND K30CT69C- A Study Of The Effect On Crystal 
Packing And Thermostability From The Introduction Of A Novel 
Disulfide Bond
Length=99

 Score =   137 bits (344),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXD  454
            EV LG DDG LAF+P + SVASGE IVF NNAGFPH V+FDEDEIPSGVDAAKISM+E D
Sbjct  2    EVLLGGDDGSLAFLPGDFSVASGEEIVFCNNAGFPHNVVFDEDEIPSGVDAAKISMSEED  61

Query  455  LLNAPGETYSVTLTEKGTYSYY  520
            LLNAPGE Y VTLTEKGTY +Y
Sbjct  62   LLNAPGECYKVTLTEKGTYKFY  83



>pdb|1BYO|A Chain A, Wild-Type Plastocyanin From Silene
 pdb|1BYO|B Chain B, Wild-Type Plastocyanin From Silene
Length=99

 Score =   134 bits (337),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXD  454
            EV LGS DGGLAFVPS+LS+ASGE I FKNNAGFPH  +FDEDE+P+GVD  KISM E D
Sbjct  2    EVLLGSSDGGLAFVPSDLSIASGEKITFKNNAGFPHNDLFDEDEVPAGVDVTKISMPEED  61

Query  455  LLNAPGETYSVTLTEKGTYSYY  520
            LLNAPGE YSVTLTEKGTY +Y
Sbjct  62   LLNAPGEEYSVTLTEKGTYKFY  83



>ref|WP_039311023.1| hypothetical protein [Paenibacillus sp. IHB B 3415]
 gb|KHL91164.1| hypothetical protein QW71_36245 [Paenibacillus sp. IHB B 3415]
Length=123

 Score =   135 bits (339),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 63/82 (77%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXD  454
            EV LGS DGGL F PS  SVA+GE IVFKNNAGFPH V+FDEDE+PSGVDA KISM++ D
Sbjct  26   EVLLGSSDGGLVFEPSSFSVAAGEKIVFKNNAGFPHNVVFDEDEVPSGVDATKISMSDED  85

Query  455  LLNAPGETYSVTLTEKGTYSYY  520
            LLNAPGETY+VTLTEKG+Y +Y
Sbjct  86   LLNAPGETYAVTLTEKGSYGFY  107



>sp|P00291.1|PLAS_SAMNI RecName: Full=Plastocyanin [Sambucus nigra]
Length=99

 Score =   134 bits (337),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 62/82 (76%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXD  454
            E+ LG +DG LAF+PS  SV SGE I FKNNAGFPH V+FDEDE+PSGVD+AKISM+E D
Sbjct  2    EILLGGEDGSLAFIPSNFSVPSGEKITFKNNAGFPHNVVFDEDEVPSGVDSAKISMSEDD  61

Query  455  LLNAPGETYSVTLTEKGTYSYY  520
            LLNAPGETYSVTLTE GTY +Y
Sbjct  62   LLNAPGETYSVTLTESGTYKFY  83



>pdb|1TEG|A Chain A, Crystal Structure Of The Spinach Plastocyanin Mutants 
G8dK30CT69C And K30cT69C- A Study Of The Effect On Crystal 
Packing And Thermostability From The Introduction Of A Novel 
Disulfide Bond
 pdb|1TEG|B Chain B, Crystal Structure Of The Spinach Plastocyanin Mutants 
G8dK30CT69C And K30cT69C- A Study Of The Effect On Crystal 
Packing And Thermostability From The Introduction Of A Novel 
Disulfide Bond
Length=99

 Score =   134 bits (336),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXD  454
            EV LG  DG LAF+P + SVASGE IVF NNAGFPH V+FDEDEIPSGVDAAKISM+E D
Sbjct  2    EVLLGGGDGSLAFLPGDFSVASGEEIVFCNNAGFPHNVVFDEDEIPSGVDAAKISMSEED  61

Query  455  LLNAPGETYSVTLTEKGTYSYY  520
            LLNAPGE Y VTLTEKGTY +Y
Sbjct  62   LLNAPGECYKVTLTEKGTYKFY  83



>sp|P00293.1|PLAS_CUCSA RecName: Full=Plastocyanin [Cucumis sativus]
 prf||0911298A plastocyanin
Length=99

 Score =   133 bits (335),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXD  454
            E+ LG DDG LAFVP+  +VASGE I FKNNAGFPH V+FDEDEIPSGVD+ KISMNE D
Sbjct  2    EILLGGDDGSLAFVPNNFTVASGEKITFKNNAGFPHNVVFDEDEIPSGVDSGKISMNEED  61

Query  455  LLNAPGETYSVTLTEKGTYSYY  520
            LL+APG+ Y V LT+KG+YS+Y
Sbjct  62   LLBAPGZVYZVZLTZKGSYSFY  83



>gb|AAR85968.1| ERT10 [Nicotiana tabacum]
Length=106

 Score =   134 bits (336),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXD  454
            EV LGSDDGGLAFVP   SV++GE I FKNNAGFPH V+FDEDEIP+GVD +KISM+E +
Sbjct  10   EVLLGSDDGGLAFVPGNFSVSAGEKITFKNNAGFPHNVVFDEDEIPAGVDVSKISMSEEE  69

Query  455  LLNAPGETYSVTLTEKGTYSYY  520
             LN PGETYSVTL+EKGTY++Y
Sbjct  70   YLNGPGETYSVTLSEKGTYTFY  91



>gb|ABK21367.1| unknown [Picea sitchensis]
 gb|ABR16204.1| unknown [Picea sitchensis]
 gb|ABR16933.1| unknown [Picea sitchensis]
 gb|ACN40109.1| unknown [Picea sitchensis]
 gb|ACN40245.1| unknown [Picea sitchensis]
Length=176

 Score =   135 bits (341),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 82/162 (51%), Positives = 104/162 (64%), Gaps = 13/162 (8%)
 Frame = +2

Query  68   MASV-TSAAVAIPSFTGLKAAGASSSSRTAVKL----------AAAPTPKLAIKASLKNF  214
            MAS  T+AAVAIP+FTGLK   A  +S +   +          A+  T K+ ++ +L   
Sbjct  1    MASTFTAAAVAIPTFTGLKVDSAKPASSSYTPMIPSRVSTGARASLSTTKMDMRRAL--V  58

Query  215  GaaviataasallatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIF  394
                         A NA A EV +GS+ G LAF+P E  VA GE IVFKNNAGFPH VIF
Sbjct  59   AVTASVGVLMGAAAGNANALEVLMGSNGGELAFIPKEFQVAPGEPIVFKNNAGFPHNVIF  118

Query  395  DEDEIPSGVDAAKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
            D++E+PSGVDA+ ISM+E DLLNAPGETY+V L +KGTY++Y
Sbjct  119  DDEEVPSGVDASTISMSEEDLLNAPGETYTVKLDKKGTYNFY  160



>gb|ACN40088.1| unknown [Picea sitchensis]
Length=185

 Score =   135 bits (340),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 82/162 (51%), Positives = 104/162 (64%), Gaps = 13/162 (8%)
 Frame = +2

Query  68   MASV-TSAAVAIPSFTGLKAAGASSSSRTAVKL----------AAAPTPKLAIKASLKNF  214
            MAS  T+AAVAIP+FTGLK   A  +S +   +          A+  T K+ ++ +L   
Sbjct  1    MASTFTAAAVAIPTFTGLKVDSAKPASSSYTPMIPSRVSTGARASLSTTKMDMRRAL--V  58

Query  215  GaaviataasallatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIF  394
                         A NA A EV +GS+ G LAF+P E  VA GE IVFKNNAGFPH VIF
Sbjct  59   AVTASVGVLMGAAAGNANALEVLMGSNGGELAFIPKEFQVAPGEPIVFKNNAGFPHNVIF  118

Query  395  DEDEIPSGVDAAKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
            D++E+PSGVDA+ ISM+E DLLNAPGETY+V L +KGTY++Y
Sbjct  119  DDEEVPSGVDASTISMSEEDLLNAPGETYTVKLDKKGTYNFY  160



>sp|P35476.1|PLAS1_TOBAC RecName: Full=Plastocyanin A'/A'' [Nicotiana tabacum]
 gb|AAB29408.1| b-plastocyanin, PCb(II) [Nicotiana tabacum=tobacco, var. Virginia, 
whole leaves, Peptide, 99 aa]
Length=99

 Score =   132 bits (333),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXD  454
            EV LGSDDGGLAFVP   SV++GE I FKNNAGFPH V+FDEDEIP+GVD +KISM+E +
Sbjct  2    EVLLGSDDGGLAFVPGNFSVSAGEKITFKNNAGFPHNVVFDEDEIPAGVDVSKISMSEEE  61

Query  455  LLNAPGETYSVTLTEKGTYSYY  520
             LN PGETYSVTL+EKGTY++Y
Sbjct  62   YLNGPGETYSVTLSEKGTYTFY  83



>sp|P00288.1|PLAS_VICFA RecName: Full=Plastocyanin [Vicia faba]
Length=99

 Score =   132 bits (333),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 63/82 (77%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXD  454
            EV LG+ DGGLAFVP+   V++G+TIVFKNNAGFPH V+FDEDEIPSGVDAAKISM E D
Sbjct  2    EVLLGASDGGLAFVPNSFEVSAGDTIVFKNNAGFPHNVVFDEDEIPSGVDAAKISMPEED  61

Query  455  LLNAPGETYSVTLTEKGTYSYY  520
            LLNAPGETYSV L  KGTY +Y
Sbjct  62   LLNAPGETYSVKLDAKGTYKFY  83



>sp|P00287.1|PLAS_PHAVU RecName: Full=Plastocyanin [Phaseolus vulgaris]
Length=99

 Score =   131 bits (330),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXD  454
            EV LGS DG L FVPSE SV SGE IVFKNNAGFPH V+FDEDEIP+GVDA KISM E +
Sbjct  2    EVLLGSGDGSLVFVPSEFSVPSGEKIVFKNNAGFPHNVVFDEDEIPAGVDAVKISMPEEE  61

Query  455  LLNAPGETYSVTLTEKGTYSYY  520
            LLNAPGETY VTL  KGTYS+Y
Sbjct  62   LLNAPGETYVVTLDTKGTYSFY  83



>pdb|9PCY|A Chain A, High-Resolution Solution Structure Of Reduced French 
Bean Plastocyanin And Comparison With The Crystal Structure 
Of Poplar Plastocyanin
Length=99

 Score =   131 bits (329),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXD  454
            EV LGS DG L FVPSE SV SGE IVFKNNAGFPH V+FDEDEIP+GVDA KISM E +
Sbjct  2    EVLLGSGDGSLVFVPSEFSVPSGEKIVFKNNAGFPHNVVFDEDEIPAGVDAVKISMPEEE  61

Query  455  LLNAPGETYSVTLTEKGTYSYY  520
            LLNAPGETY VTL  KGTYS+Y
Sbjct  62   LLNAPGETYVVTLDTKGTYSFY  83



>gb|EYU17553.1| hypothetical protein MIMGU_mgv1a020878mg [Erythranthe guttata]
Length=169

 Score =   133 bits (335),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 84/152 (55%), Positives = 106/152 (70%), Gaps = 7/152 (5%)
 Frame = +2

Query  86   AAVAIPSFTGLKAAGA---SSSSRTAVKLAAAPTPKLAIKASLKNFGaaviataasalla  256
            A+V IPSF+GLKA G      ++      AA    KLA++ASLK+ G A +A AA+A + 
Sbjct  2    ASVTIPSFSGLKAGGTIPFPKATTAKFAAAALTASKLAVRASLKDLGVAAVAAAAAAGVV  61

Query  257  t----nalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVD  424
                 NA+A ++ LG DDG LAF+P    V +GE IVF NNAGFPH V+FDEDE+P+GVD
Sbjct  62   LAGNGNAMAIQITLGGDDGSLAFIPQNFEVPAGEKIVFFNNAGFPHNVVFDEDEVPAGVD  121

Query  425  AAKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
            A KISM+E DLLNA G+TY VT T+KGTYS+Y
Sbjct  122  ATKISMSEEDLLNAKGDTYVVTSTQKGTYSFY  153



>sp|P00294.1|PLAS_CAPBU RecName: Full=Plastocyanin [Capsella bursa-pastoris]
 prf||0512262A plastocyanin
Length=99

 Score =   130 bits (328),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 62/82 (76%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXD  454
            EV LG  DG LAFVP++ S+A GE IVFKNNAGFPH V+FDEDEIPSGVDA+KISM+E D
Sbjct  2    EVLLGGGDGSLAFVPNDFSIAKGEKIVFKNNAGFPHNVVFDEDEIPSGVDASKISMDEND  61

Query  455  LLNAPGETYSVTLTEKGTYSYY  520
            LLNA GETY V LTE GTYS+Y
Sbjct  62   LLNAAGETYEVALTEAGTYSFY  83



>ref|WP_017428787.1| hypothetical protein, partial [Vibrio vulnificus]
Length=94

 Score =   130 bits (328),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 60/78 (77%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = +2

Query  287  GSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXDLLNA  466
            G  DG LAFVP+E SV+SG+ IVFKNNAGFPH V+FDEDEIP GVDA+ ISM+E DLLNA
Sbjct  1    GGSDGSLAFVPNEFSVSSGDKIVFKNNAGFPHNVVFDEDEIPQGVDASAISMSEEDLLNA  60

Query  467  PGETYSVTLTEKGTYSYY  520
            PGETYSVTLTEKG+Y++Y
Sbjct  61   PGETYSVTLTEKGSYTFY  78



>pdb|1BYP|A Chain A, E43k,D44k Double Mutant Plastocyanin From Silene
Length=99

 Score =   130 bits (327),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/82 (76%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXD  454
            EV LGS DGGLAFVPS+LS+ASGE I FKNNAGFPH  +FD+ E+P+GVD  KISM E D
Sbjct  2    EVLLGSSDGGLAFVPSDLSIASGEKITFKNNAGFPHNDLFDKKEVPAGVDVTKISMPEED  61

Query  455  LLNAPGETYSVTLTEKGTYSYY  520
            LLNAPGE YSVTLTEKGTY +Y
Sbjct  62   LLNAPGEEYSVTLTEKGTYKFY  83



>gb|KHN20135.1| Plastocyanin, chloroplastic [Glycine soja]
Length=101

 Score =   130 bits (327),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 63/82 (77%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXD  454
            EV LG+DDG L F P+  SVA GE IVFKNNAGFPH V+FDEDEIPSGVDA KISM+E D
Sbjct  4    EVLLGTDDGSLVFSPNSFSVAPGEKIVFKNNAGFPHNVVFDEDEIPSGVDAGKISMSEED  63

Query  455  LLNAPGETYSVTLTEKGTYSYY  520
            LLNA GETYSVTL  KGTYS+Y
Sbjct  64   LLNAAGETYSVTLDAKGTYSFY  85



>sp|P00296.1|PLAS_SOLTU RecName: Full=Plastocyanin [Solanum tuberosum]
Length=99

 Score =   130 bits (326),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 60/82 (73%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXD  454
            +V LG DDG LAF+P   SV++GE I FKNNAGFPH V+FDEDEIP+GVDA+KISM E D
Sbjct  2    DVLLGGDDGSLAFIPGNFSVSAGEKITFKNNAGFPHNVVFDEDEIPAGVDASKISMAEED  61

Query  455  LLNAPGETYSVTLTEKGTYSYY  520
            LLNA GETYSVTL+EKGTY++Y
Sbjct  62   LLNAAGETYSVTLSEKGTYTFY  83



>gb|ACC59111.1| At1G20340-like protein, partial [Arabidopsis lyrata subsp. petraea]
Length=127

 Score =   128 bits (321),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 81/125 (65%), Positives = 92/125 (74%), Gaps = 0/125 (0%)
 Frame = +2

Query  137  SSSRTAVKLAAAPTPKLAIKASLKNFGaaviataasallatnalaaEVKLGSDDGGLAFV  316
            SS+   ++ AA   PKL +K+SLKNFG A +   AS  LA NA+A EV LG  DG LA  
Sbjct  3    SSATVRIQTAAVAXPKLTVKSSLKNFGVAAVXAXASIXLAGNAMAIEVLLGGGDGALAXX  62

Query  317  PSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXDLLNAPGETYSVTLT  496
            P++ SVA GE IVFKNNAGFPH V+FDEDEIPSGVD AKISM+E DLLNA GETY V LT
Sbjct  63   PNDFSVAKGEKIVFKNNAGFPHNVVFDEDEIPSGVDVAKISMDEQDLLNAAGETYEVALT  122

Query  497  EKGTY  511
            E GTY
Sbjct  123  EPGTY  127



>pdb|1TKW|A Chain A, The Transient Complex Of Poplar Plastocyanin With Turnip 
Cytochrome F Determined With Paramagnetic Nmr
 pdb|1PLC|A Chain A, Accuracy And Precision In Protein Crystal Structure 
Analysis: Restrained Least-Squares Refinement Of The Crystal 
Structure Of Poplar Plastocyanin At 1.33 Angstroms Resolution
 pdb|1PNC|A Chain A, Accuracy And Precision In Protein Crystal Structure 
Analysis: Two Independent Refinements Of The Structure Of Poplar 
Plastocyanin At 173k
 pdb|1PND|A Chain A, Accuracy And Precision In Protein Crystal Structure 
Analysis: Two Independent Refinements Of The Structure Of Poplar 
Plastocyanin At 173k
 pdb|2PCY|A Chain A, The Crystal Structure Of Poplar Apoplastocyanin At 1.8- 
Angstroms Resolution. The Geometry Of The Copper-Binding 
Site Is Created By The Polypeptide
 pdb|3PCY|A Chain A, The Crystal Structure Of Mercury-Substituted Poplar 
Plastocyanin At 1.9-Angstroms Resolution
 pdb|4PCY|A Chain A, Crystal Structure Analyses Of Reduced (Cui) Poplar Plastocyanin 
At Six Ph Values
 pdb|5PCY|A Chain A, Crystal Structure Analyses Of Reduced (Cui) Poplar Plastocyanin 
At Six Ph Values
 pdb|6PCY|A Chain A, Crystal Structure Analyses Of Reduced (Cui) Poplar Plastocyanin 
At Six Ph Values
 pdb|4DP7|X Chain X, The 1.08 Angstrom Crystal Structure Of Oxidized (cuii) 
Poplar Plastocyanin A At Ph 4.0
 pdb|4DP8|X Chain X, The 1.07 Angstrom Crystal Structure Of Reduced (cui) 
Poplar Plastocyanin A At Ph 4.0
 pdb|4DP9|X Chain X, The 1.00 Angstrom Crystal Structure Of Oxidized (cuii) 
Poplar Plastocyanin A At Ph 6.0
 pdb|4DPA|X Chain X, The 1.05 Angstrom Crystal Structure Of Reduced (cui) 
Poplar Plastocyanin A At Ph 6.0
 pdb|4DPB|X Chain X, The 1.00 Angstrom Crystal Structure Of Oxidized (cuii) 
Poplar Plastocyanin A At Ph 8.0
 pdb|4DPC|X Chain X, The 1.06 Angstrom Crystal Structure Of Reduced (cui) 
Poplar Plastocyanin A At Ph 8.0
Length=99

 Score =   126 bits (316),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXD  454
            +V LG+DDG LAFVPSE S++ GE IVFKNNAGFPH ++FDED IPSGVDA+KISM+E D
Sbjct  2    DVLLGADDGSLAFVPSEFSISPGEKIVFKNNAGFPHNIVFDEDSIPSGVDASKISMSEED  61

Query  455  LLNAPGETYSVTLTEKGTYSYY  520
            LLNA GET+ V L+ KG YS+Y
Sbjct  62   LLNAKGETFEVALSNKGEYSFY  83



>pdb|4DP0|X Chain X, The 1.5 Angstrom Crystal Structure Of Oxidized (cuii) 
Poplar Plastocyanin B At Ph 4.0
 pdb|4DP1|X Chain X, The 1.35 Angstrom Crystal Structure Of Reduced (cui) 
Poplar Plastocyanin B At Ph 4.0
 pdb|4DP2|X Chain X, The 1.8 Angstrom Crystal Structure Of Oxidized (cuii) 
Poplar Plastocyanin B At Ph 6.0
 pdb|4DP4|X Chain X, The 1.54 Angstrom Crystal Structure Of Reduced (cui) 
Poplar Plastocyanin B At Ph 6.0
 pdb|4DP5|X Chain X, The 1.88 Angstrom Crystal Structure Of Oxidized (cuii) 
Poplar Plastocyanin B At Ph 8.0
 pdb|4DP6|X Chain X, The 1.67 Angstrom Crystal Structure Of Reduced (cui) 
Poplar Plastocyanin B At Ph 8.0
 prf||1402239A plastocyanin b
Length=99

 Score =   124 bits (310),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXD  454
            +V LG+DDG LAFVPSE SV +GE IVFKNNAGFPH V+FDED +PSGVD +KISM+E D
Sbjct  2    DVLLGADDGSLAFVPSEFSVPAGEKIVFKNNAGFPHNVLFDEDAVPSGVDVSKISMSEED  61

Query  455  LLNAPGETYSVTLTEKGTYSYY  520
            LLNA GET+ V L++KG Y++Y
Sbjct  62   LLNAKGETFEVALSDKGEYTFY  83



>pdb|1JXG|A Chain A, The 1.6 A Resolution Crystal Structure Of A Mutant Poplar 
Plastocyanin Bearing A 21-25 Engeneered Disulfide Bridge
 pdb|1JXG|B Chain B, The 1.6 A Resolution Crystal Structure Of A Mutant Poplar 
Plastocyanin Bearing A 21-25 Engeneered Disulfide Bridge
Length=100

 Score =   123 bits (308),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXD  454
            +V LG+DDG LAFVPSE S + G  IVFKNNAGFPH ++FDED IPSGVDA+KISM+E D
Sbjct  3    DVLLGADDGSLAFVPSEFSCSPGCKIVFKNNAGFPHNIVFDEDSIPSGVDASKISMSEED  62

Query  455  LLNAPGETYSVTLTEKGTYSYY  520
            LLNA GET+ V L+ KG YS+Y
Sbjct  63   LLNAKGETFEVALSNKGEYSFY  84



>ref|NP_001131447.1| uncharacterized protein LOC100192779 [Zea mays]
 gb|ACF79854.1| unknown [Zea mays]
 gb|ACN30923.1| unknown [Zea mays]
Length=155

 Score =   124 bits (312),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 79/153 (52%), Positives = 99/153 (65%), Gaps = 16/153 (10%)
 Frame = +2

Query  68   MASVTSAAVAIPSFTGLKAAGASSSSRTAVKLAAAPTPKLAIKASLKNFGaaviataasa  247
            MAS++SAA+  PSFT   A  A  S R+             ++ASL+   A      A++
Sbjct  1    MASLSSAAITAPSFTAAPAR-AVVSRRS-----------FTVRASLRKATATAAVAVAAS  48

Query  248  llatn--alaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGV  421
            +L     A+A EV LG+ DGGL F PS+ +V +G+TI FKNNAGFPH V+FDEDE+PSGV
Sbjct  49   VLLAGGGAMAQEVLLGAGDGGLVFEPSQFTVKAGDTITFKNNAGFPHNVVFDEDEVPSGV  108

Query  422  DAAKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
            DA+KIS  E   LNAPGETYSVTLT  GTY +Y
Sbjct  109  DASKISQEE--YLNAPGETYSVTLTVPGTYGFY  139



>ref|XP_008648719.1| PREDICTED: plastocyanin, chloroplastic-like [Zea mays]
 gb|ACG27752.1| plastocyanin [Zea mays]
 gb|ACG30549.1| plastocyanin [Zea mays]
 gb|ACG30566.1| plastocyanin [Zea mays]
 gb|AFW75184.1| plastocyanin isoform 1 [Zea mays]
 gb|AFW75185.1| plastocyanin isoform 2 [Zea mays]
Length=155

 Score =   122 bits (307),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 85/152 (56%), Positives = 101/152 (66%), Gaps = 14/152 (9%)
 Frame = +2

Query  68   MASVTSAAVAIPSFTGLKAAGASSSSRTAVKLAAAPTPKLAIKASLKN-FGaaviataas  244
            MAS++SAAV  PSF     A A    R+             ++ASL+   G A +A AAS
Sbjct  1    MASLSSAAVTAPSFAAPAPARAVVRRRS-----------FTVRASLRKATGTAAVAMAAS  49

Query  245  allatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVD  424
            ALLA  A+A EV LG+ DGGL F PS+ +V +G+TI FKNNAGFPH V+FDEDE+PSGVD
Sbjct  50   ALLAGGAMAQEVLLGAGDGGLVFEPSQFTVKAGDTITFKNNAGFPHNVVFDEDEVPSGVD  109

Query  425  AAKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
            A KIS  E   LNAPGETYSVTLT  GTY +Y
Sbjct  110  ATKISQEE--YLNAPGETYSVTLTVPGTYGFY  139



>sp|P17341.1|PLAS_PETCR RecName: Full=Plastocyanin A/B [Petroselinum crispum]
 pdb|1PLA|A Chain A, High-Resolution Solution Structure Of Reduced Parsley 
Plastocyanin
 pdb|1PLB|A Chain A, High-Resolution Solution Structure Of Reduced Parsley 
Plastocyanin
 prf||1611235A plastocyanin a/b
Length=97

 Score =   119 bits (297),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 65/82 (79%), Gaps = 2/82 (2%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXD  454
            EVKLGSDDGGL F PS  +VA+GE I FKNNAGFPH ++FDEDE+P+GV+A KIS  E  
Sbjct  2    EVKLGSDDGGLVFSPSSFTVAAGEKITFKNNAGFPHNIVFDEDEVPAGVNAEKISQPE--  59

Query  455  LLNAPGETYSVTLTEKGTYSYY  520
             LN  GETY VTLTEKGTY +Y
Sbjct  60   YLNGAGETYEVTLTEKGTYKFY  81



>sp|P84338.1|PLAS_GINBI RecName: Full=Plastocyanin [Ginkgo biloba]
Length=99

 Score =   117 bits (294),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 65/82 (79%), Gaps = 0/82 (0%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXD  454
            EV +G   G LAF+P+EL V +GE IVFKNNAGFPH VIFDED +P+GVD + ISM+E D
Sbjct  2    EVLMGGSGGELAFIPNELQVNAGEQIVFKNNAGFPHNVIFDEDAVPAGVDVSSISMSEED  61

Query  455  LLNAPGETYSVTLTEKGTYSYY  520
            LLNAPGETY V L +KGTY ++
Sbjct  62   LLNAPGETYVVKLDKKGTYRFF  83



>gb|ACN31203.1| unknown [Zea mays]
Length=99

 Score =   117 bits (294),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 66/82 (80%), Gaps = 2/82 (2%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXD  454
            EV LG+ DGGL F PS+ +V +G+TI FKNNAGFPH V+FDEDE+PSGVDA+KIS  E  
Sbjct  4    EVLLGAGDGGLVFEPSQFTVKAGDTITFKNNAGFPHNVVFDEDEVPSGVDASKISQEE--  61

Query  455  LLNAPGETYSVTLTEKGTYSYY  520
             LNAPGETYSVTLT  GTY +Y
Sbjct  62   YLNAPGETYSVTLTVPGTYGFY  83



>gb|ACF87788.1| unknown [Zea mays]
Length=110

 Score =   117 bits (294),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 65/82 (79%), Gaps = 2/82 (2%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXD  454
            EV LG+ DGGL F PS+ +V +G+TI FKNNAGFPH V+FDEDE+PSGVDA KIS  E  
Sbjct  15   EVLLGAGDGGLVFEPSQFTVKAGDTITFKNNAGFPHNVVFDEDEVPSGVDATKISQEE--  72

Query  455  LLNAPGETYSVTLTEKGTYSYY  520
             LNAPGETYSVTLT  GTY +Y
Sbjct  73   YLNAPGETYSVTLTVPGTYGFY  94



>ref|XP_004964252.1| PREDICTED: plastocyanin, chloroplastic-like [Setaria italica]
Length=157

 Score =   117 bits (293),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 66/82 (80%), Gaps = 2/82 (2%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXD  454
            EV LG++ G L F PSE SV +G+TI FKNNAG+PH V+FDEDE+PSGVDAAKIS  E  
Sbjct  62   EVLLGANGGVLVFEPSEFSVKAGDTITFKNNAGYPHNVVFDEDEVPSGVDAAKISQEE--  119

Query  455  LLNAPGETYSVTLTEKGTYSYY  520
             LNAPGETYSVTLT  GTYS+Y
Sbjct  120  YLNAPGETYSVTLTVPGTYSFY  141



>emb|CAA68696.1| plastocyanin precursor [Hordeum vulgare]
 emb|CAA82201.1| plastocyanin [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91116.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92346.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=155

 Score =   115 bits (289),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 76/153 (50%), Positives = 100/153 (65%), Gaps = 16/153 (10%)
 Frame = +2

Query  68   MASVTSAAVAIPSFTGLKAAGASSSSRTAVKLAAAPTPKLAIKASL--KNFGaaviataa  241
            MA+++SAAV++PSF       +S SSR            + ++ASL  K   AAV   A 
Sbjct  1    MAALSSAAVSVPSFAAATPMRSSRSSR------------MVVRASLGKKAASAAVAMAAG  48

Query  242  sallatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGV  421
            + LL  +A+A +V LG++ G L F P++ SV +GETI FKNNAG+PH V+FDED +PSGV
Sbjct  49   AMLLGGSAMAQDVLLGANGGVLVFEPNDFSVKAGETITFKNNAGYPHNVVFDEDAVPSGV  108

Query  422  DAAKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
            D +KIS  E   LNAPGET+SVTLT  GTY +Y
Sbjct  109  DVSKISQEE--YLNAPGETFSVTLTVPGTYGFY  139



>sp|P20422.1|PLAS_DAUCA RecName: Full=Plastocyanin [Daucus carota]
Length=97

 Score =   114 bits (284),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 53/82 (65%), Positives = 65/82 (79%), Gaps = 2/82 (2%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXD  454
            EVKLG+DDG L F PS  SVA GE I FKNNAGFPH ++FDEDE+P+GVD +KIS  + D
Sbjct  2    EVKLGADDGALVFSPSSFSVAKGEGISFKNNAGFPHNIVFDEDEVPAGVDVSKIS--QED  59

Query  455  LLNAPGETYSVTLTEKGTYSYY  520
             L+  GE+++VTLTEKGTY +Y
Sbjct  60   YLDGAGESFTVTLTEKGTYKFY  81



>ref|XP_002436310.1| hypothetical protein SORBIDRAFT_10g000230 [Sorghum bicolor]
 gb|EER87677.1| hypothetical protein SORBIDRAFT_10g000230 [Sorghum bicolor]
Length=155

 Score =   113 bits (283),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 64/82 (78%), Gaps = 2/82 (2%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXD  454
            EV LG++ G L F PSE +V +G+TI FKNNAG+PH V+FDEDE+PSGVDA KIS  E  
Sbjct  60   EVLLGANGGVLVFEPSEFTVKAGDTITFKNNAGYPHNVVFDEDEVPSGVDATKISQEE--  117

Query  455  LLNAPGETYSVTLTEKGTYSYY  520
             LNAPGETYSVTLT  GTY +Y
Sbjct  118  YLNAPGETYSVTLTVPGTYGFY  139



>sp|P08248.1|PLAS_HORVU RecName: Full=Plastocyanin, chloroplastic; Flags: Precursor [Hordeum 
vulgare]
Length=155

 Score =   113 bits (283),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 75/153 (49%), Positives = 99/153 (65%), Gaps = 16/153 (10%)
 Frame = +2

Query  68   MASVTSAAVAIPSFTGLKAAGASSSSRTAVKLAAAPTPKLAIKASL--KNFGaaviataa  241
            MA+++SAAV++PSF       +S SSR            + ++ASL  K   AAV   A 
Sbjct  1    MAALSSAAVSVPSFAAATPMRSSRSSR------------MVVRASLGKKAASAAVAMAAG  48

Query  242  sallatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGV  421
            + LL  +A+A +V LG++ G L F P++ SV +GETI FKNNAG+PH V+FDED +PSGV
Sbjct  49   AMLLGGSAMAQDVLLGANGGVLVFEPNDFSVKAGETITFKNNAGYPHNVVFDEDAVPSGV  108

Query  422  DAAKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
            D +KIS  E   L APGET+SVTLT  GTY +Y
Sbjct  109  DVSKISQEE--YLTAPGETFSVTLTVPGTYGFY  139



>ref|XP_003557292.1| PREDICTED: plastocyanin, chloroplastic-like [Brachypodium distachyon]
Length=156

 Score =   113 bits (282),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 80/150 (53%), Positives = 101/150 (67%), Gaps = 12/150 (8%)
 Frame = +2

Query  71   ASVTSAAVAIPSFTGLKAAGASSSSRTAVKLAAAPTPKLAIKASLKNFGaaviataasal  250
            A ++SAAV +PS   + AA   SSSR  V+ +A       +    K  GAA +A AASA+
Sbjct  3    AQLSSAAVTLPS---MVAAAPRSSSRLVVRASA-------VGGFRKAAGAAAVAVAASAM  52

Query  251  latnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAA  430
            LA  A+A +V LG++ G L F P+E SV +GETI FKNNAGFPH ++FDED +PSGVD +
Sbjct  53   LAGGAMAQDVLLGANGGVLVFEPNEFSVKAGETITFKNNAGFPHNIVFDEDAVPSGVDVS  112

Query  431  KISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
            KIS  E   LNAPGET+SVTLT  GTY +Y
Sbjct  113  KISQEE--YLNAPGETFSVTLTVPGTYGFY  140



>ref|XP_002965646.1| hypothetical protein SELMODRAFT_167855 [Selaginella moellendorffii]
 ref|XP_002989267.1| hypothetical protein SELMODRAFT_160028 [Selaginella moellendorffii]
 gb|EFJ09705.1| hypothetical protein SELMODRAFT_160028 [Selaginella moellendorffii]
 gb|EFJ33066.1| hypothetical protein SELMODRAFT_167855 [Selaginella moellendorffii]
Length=173

 Score =   113 bits (283),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 64/81 (79%), Gaps = 2/81 (2%)
 Frame = +2

Query  278  VKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXDL  457
            VK+G DDG LAF+P  +S+ +G+T++F+NNAGFPH +IFDED +PSGV+A  +S    DL
Sbjct  79   VKMGGDDGSLAFIPKNISIGAGDTVIFENNAGFPHNIIFDEDAVPSGVNADALS--HPDL  136

Query  458  LNAPGETYSVTLTEKGTYSYY  520
            LNAPGE+Y VTL  KGTY +Y
Sbjct  137  LNAPGESYKVTLQTKGTYGFY  157



>gb|EPS65917.1| plastocyanin major isoform, chloroplastic, partial [Genlisea 
aurea]
Length=169

 Score =   112 bits (281),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 75/154 (49%), Positives = 94/154 (61%), Gaps = 11/154 (7%)
 Frame = +2

Query  89   AVAIPSFTGLKAAGASSSSRTAV----------KLAAAPTPKLAIKASLKNFGaaviata  238
            +VA PSF GLK  GA +SS ++           +L      +   KASLK    A     
Sbjct  1    SVAFPSFAGLKPGGARASSSSSSSSSKPAAVGGRLRIGNRKRPTAKASLKE-AIAAAVAG  59

Query  239  asallatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSG  418
             + L A NALA EV LG  DG L F P    +++GE IVFKN AGFPH V+FD+DE+PSG
Sbjct  60   TAILAAGNALAIEVALGRPDGSLVFDPQNFEISAGEEIVFKNVAGFPHNVVFDDDEVPSG  119

Query  419  VDAAKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
            V AA+ISM E DLLN+ G+T+S  L EKGTY++Y
Sbjct  120  VKAAEISMAEEDLLNSAGDTFSTKLFEKGTYTFY  153



>ref|XP_004964214.1| PREDICTED: LOW QUALITY PROTEIN: plastocyanin minor isoform, chloroplastic-like 
[Setaria italica]
Length=193

 Score =   112 bits (281),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 63/81 (78%), Gaps = 4/81 (5%)
 Frame = +2

Query  278  VKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXDL  457
            + LG+DDGGLAFVPSE +V SGETI F+     PH V+FD+DE+P GVDAA IS  + +L
Sbjct  79   LMLGTDDGGLAFVPSEFTVTSGETITFRX----PHNVVFDDDEVPGGVDAAAISQGDEEL  134

Query  458  LNAPGETYSVTLTEKGTYSYY  520
            LNAPG+TYSVTLT  GTY +Y
Sbjct  135  LNAPGQTYSVTLTVPGTYGFY  155



>gb|KIZ00519.1| Plastocyanin [Monoraphidium neglectum]
Length=146

 Score =   111 bits (278),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/81 (63%), Positives = 64/81 (79%), Gaps = 2/81 (2%)
 Frame = +2

Query  278  VKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXDL  457
            VKLG+D+G L F PS ++V+SGETI + NNAGFPH ++FDEDE+P+GVDA  IS +  D 
Sbjct  52   VKLGADNGALVFEPSTVTVSSGETITWVNNAGFPHNIVFDEDEVPAGVDADAISRD--DY  109

Query  458  LNAPGETYSVTLTEKGTYSYY  520
            LNAPGETYS+ L+  GTY YY
Sbjct  110  LNAPGETYSLKLSASGTYKYY  130



>gb|EMT10023.1| Plastocyanin, chloroplastic [Aegilops tauschii]
Length=99

 Score =   108 bits (271),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 63/82 (77%), Gaps = 2/82 (2%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXD  454
            +V LG++ G L F P+E SV SGETI FKNNAGFPH V+FDED +PSGVD +KIS  E  
Sbjct  4    DVLLGANGGVLVFEPNEFSVKSGETITFKNNAGFPHNVVFDEDAVPSGVDVSKISQEE--  61

Query  455  LLNAPGETYSVTLTEKGTYSYY  520
             LNAPGET+SVTLT  GTY +Y
Sbjct  62   YLNAPGETFSVTLTVPGTYGFY  83



>ref|NP_001056530.1| Os06g0101600 [Oryza sativa Japonica Group]
 sp|Q0DFC9.1|PLAS_ORYSJ RecName: Full=Plastocyanin, chloroplastic; Flags: Precursor [Oryza 
sativa Japonica Group]
 sp|A2Y886.1|PLAS_ORYSI RecName: Full=Plastocyanin, chloroplastic; Flags: Precursor [Oryza 
sativa Indica Group]
 gb|AAC78108.1| plastocyanin precursor [Oryza sativa Japonica Group]
 dbj|BAD67938.1| plastocyanin, chloroplast precursor [Oryza sativa Japonica Group]
 dbj|BAF18444.1| Os06g0101600 [Oryza sativa Japonica Group]
 gb|EAY99296.1| hypothetical protein OsI_21262 [Oryza sativa Indica Group]
 dbj|BAG91958.1| unnamed protein product [Oryza sativa Japonica Group]
Length=154

 Score =   110 bits (275),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 53/82 (65%), Positives = 63/82 (77%), Gaps = 2/82 (2%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXD  454
            EV LG++ G L F P++ +V SGETI FKNNAGFPH V+FDED +PSGVD +KIS  E  
Sbjct  59   EVLLGANGGVLVFEPNDFTVKSGETITFKNNAGFPHNVVFDEDAVPSGVDVSKISQEE--  116

Query  455  LLNAPGETYSVTLTEKGTYSYY  520
             LNAPGET+SVTLT  GTY +Y
Sbjct  117  YLNAPGETFSVTLTVPGTYGFY  138



>gb|EAZ35518.1| hypothetical protein OsJ_19799 [Oryza sativa Japonica Group]
Length=165

 Score =   110 bits (276),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 53/82 (65%), Positives = 63/82 (77%), Gaps = 2/82 (2%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXD  454
            EV LG++ G L F P++ +V SGETI FKNNAGFPH V+FDED +PSGVD +KIS  E  
Sbjct  59   EVLLGANGGVLVFEPNDFTVKSGETITFKNNAGFPHNVVFDEDAVPSGVDVSKISQEE--  116

Query  455  LLNAPGETYSVTLTEKGTYSYY  520
             LNAPGET+SVTLT  GTY +Y
Sbjct  117  YLNAPGETFSVTLTVPGTYGFY  138



>ref|XP_001752342.1| plastocyanin, chloroplast precursor, isoform 2 [Physcomitrella 
patens]
 gb|EDQ83075.1| plastocyanin, chloroplast precursor, isoform 2 [Physcomitrella 
patens]
Length=166

 Score =   110 bits (276),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 69/155 (45%), Positives = 98/155 (63%), Gaps = 9/155 (6%)
 Frame = +2

Query  68   MASVTSAAVAIPSFTGLKA----AGASSSSRTAVKLAAAPTPKLAIKASLKNFGaaviat  235
            MAS+ +AAV++P+FTGLKA    A A  S+ T V++A  P        +++  G A++A 
Sbjct  1    MASI-AAAVSVPTFTGLKAETRAAPAKVSTNTVVRMA--PVRASVRSDAMETVGKALLAA  57

Query  236  aasallatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPS  415
            ++S LL  +A A  VK+G+DDGGL F PS ++VA+GE + F NN  FPH V+FDED +P+
Sbjct  58   SSSLLLVASANAVTVKMGADDGGLGFYPSNVTVAAGEAVTFVNNKAFPHNVVFDEDAVPA  117

Query  416  GVDAAKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
            GV   +  +N  D LNAP E + +     GTY YY
Sbjct  118  GVKVEE--LNHEDYLNAPNEQFDIVFKTAGTYEYY  150



>ref|XP_001702952.1| plastocyanin, chloroplast precursor [Chlamydomonas reinhardtii]
 sp|P18068.1|PLAS_CHLRE RecName: Full=Plastocyanin, chloroplastic; AltName: Full=PC6-2; 
Flags: Precursor [Chlamydomonas reinhardtii]
 gb|AAA33078.1| apoplastocyanin (PC6-2) precursor [Chlamydomonas reinhardtii]
 gb|AAA33089.1| plastocyanin [Chlamydomonas reinhardtii]
 gb|EDO96805.1| plastocyanin, chloroplast precursor [Chlamydomonas reinhardtii]
Length=145

 Score =   108 bits (271),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 60/81 (74%), Gaps = 2/81 (2%)
 Frame = +2

Query  278  VKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXDL  457
            VKLG+D G L FVP  L++ SGET+ F NNAGFPH ++FDED IPSGV+A  IS +  D 
Sbjct  51   VKLGADSGALEFVPKTLTIKSGETVNFVNNAGFPHNIVFDEDAIPSGVNADAISRD--DY  108

Query  458  LNAPGETYSVTLTEKGTYSYY  520
            LNAPGETYSV LT  G Y YY
Sbjct  109  LNAPGETYSVKLTAAGEYGYY  129



>gb|ABA01106.1| chloroplast plastocyanin [Chlamydomonas incerta]
Length=145

 Score =   107 bits (267),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 60/81 (74%), Gaps = 2/81 (2%)
 Frame = +2

Query  278  VKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXDL  457
            VKLG+D G L FVP  ++V SGETI F NNAGFPH ++FDED IPSGV+A  IS +  D 
Sbjct  51   VKLGADSGALEFVPKTVTVKSGETINFVNNAGFPHNIVFDEDAIPSGVNADAISRD--DY  108

Query  458  LNAPGETYSVTLTEKGTYSYY  520
            LNAPGETYS+ LT  G Y YY
Sbjct  109  LNAPGETYSLKLTTAGEYGYY  129



>pdb|2PLT|A Chain A, Structure Determination Of Plastocyanin From A Crystal 
Specimen With Hemihedral Twinning Fraction Of One-Half
Length=98

 Score =   106 bits (264),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 60/81 (74%), Gaps = 2/81 (2%)
 Frame = +2

Query  278  VKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXDL  457
            VKLG+D G L FVP  L++ SGET+ F NNAGFPH ++FDED IPSGV+A  IS +  D 
Sbjct  4    VKLGADSGALEFVPKTLTIKSGETVNFVNNAGFPHNIVFDEDAIPSGVNADAISRD--DY  61

Query  458  LNAPGETYSVTLTEKGTYSYY  520
            LNAPGETYSV LT  G Y YY
Sbjct  62   LNAPGETYSVKLTAAGEYGYY  82



>prf||1402235A plastocyanin precursor
Length=155

 Score =   107 bits (266),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 73/153 (48%), Positives = 97/153 (63%), Gaps = 16/153 (10%)
 Frame = +2

Query  68   MASVTSAAVAIPSFTGLKAAGASSSSRTAVKLAAAPTPKLAIKASL--KNFGaaviataa  241
            MA+++SAAV++PSF       +S SSR            + ++ASL  K   AAV   A 
Sbjct  1    MAALSSAAVSVPSFAAATPMRSSRSSR------------MVVRASLGKKAASAAVAMAAG  48

Query  242  sallatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGV  421
            + LL  +A+A +V LG++ G L F P++ SV +GETI FKNNAG+P  V+FDED +PSGV
Sbjct  49   AMLLGGSAMAQDVLLGANGGVLVFEPNDFSVKAGETITFKNNAGYPGNVVFDEDAVPSGV  108

Query  422  DAAKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
            D + IS  E   L APGET+SVTLT  GTY +Y
Sbjct  109  DVSDISQEE--YLTAPGETFSVTLTVPGTYGFY  139



>gb|AAB63590.1| plastocyanin precursor [Oryza sativa Indica Group]
Length=154

 Score =   106 bits (265),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 63/82 (77%), Gaps = 2/82 (2%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXD  454
            EV LG++ G L F P++ +V SGETI FKNNAGFPH V+FD+D +PSGV+ +KIS  E  
Sbjct  59   EVLLGANGGVLVFEPNDFTVKSGETITFKNNAGFPHNVVFDKDAVPSGVNLSKISQEE--  116

Query  455  LLNAPGETYSVTLTEKGTYSYY  520
             LNAPGET+SVTLT  GTY +Y
Sbjct  117  YLNAPGETFSVTLTVPGTYGFY  138



>gb|EMS54647.1| Plastocyanin, chloroplastic [Triticum urartu]
Length=99

 Score =   105 bits (261),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 63/82 (77%), Gaps = 2/82 (2%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXD  454
            +V LG++ G L F P++ SV +GETI FKNNAG+PH V+FDED +PSGVD +KIS  E  
Sbjct  4    DVLLGANGGVLVFEPNDFSVKAGETITFKNNAGYPHNVVFDEDAVPSGVDVSKISQEE--  61

Query  455  LLNAPGETYSVTLTEKGTYSYY  520
             LNAPGET+SVTLT  GTY +Y
Sbjct  62   YLNAPGETFSVTLTVPGTYGFY  83



>ref|XP_002946937.1| hypothetical protein VOLCADRAFT_79339 [Volvox carteri f. nagariensis]
 gb|EFJ52163.1| hypothetical protein VOLCADRAFT_79339 [Volvox carteri f. nagariensis]
Length=144

 Score =   106 bits (264),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 81/125 (65%), Gaps = 2/125 (2%)
 Frame = +2

Query  146  RTAVKLAAAPTPKLAIKASLKNFGaaviataasallatnalaaEVKLGSDDGGLAFVPSE  325
            R  V  A A  P  ++KA++    +    + AS  +A +A AA VKLG+D G LAF P+ 
Sbjct  6    RAPVSRAGAVRPVASLKAAVSRVASVAGVSIASLAVALSANAATVKLGADSGALAFEPAT  65

Query  326  LSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXDLLNAPGETYSVTLTEKG  505
            L++ +GET+ F NNAGFPH V+FDED +P+GV+A  IS +  DLLNAPGE YSV L   G
Sbjct  66   LTIKAGETVDFVNNAGFPHNVVFDEDAVPAGVNADAISRD--DLLNAPGEKYSVKLDTPG  123

Query  506  TYSYY  520
             Y YY
Sbjct  124  EYGYY  128



>ref|XP_001757279.1| plastocyanin, chloroplast precursor, isoform 1 [Physcomitrella 
patens]
 gb|EDQ77764.1| plastocyanin, chloroplast precursor, isoform 1 [Physcomitrella 
patens]
Length=167

 Score =   106 bits (265),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 103/158 (65%), Gaps = 14/158 (9%)
 Frame = +2

Query  68   MASVTSAAVAIPSFTGLK----AAGASSSSRTAVKLAAAPTPKLAIKAS---LKNFGaav  226
            MAS T+AAV++P+FTGLK    AA A  SS T V++A    P +   AS   L+  G A+
Sbjct  1    MAS-TAAAVSVPTFTGLKSESRAAPAKVSSNTVVRMA----PVVRASASSDALETVGKAL  55

Query  227  iataasallatnalaaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDE  406
            IA ++S LLA +A A  VK+G+DDG L F P+ +SVA+GE+I F NN GFPH V+FDED 
Sbjct  56   IAASSSLLLAASANAVTVKMGADDGTLGFYPNAISVAAGESITFVNNKGFPHNVVFDEDA  115

Query  407  IPSGVDAAKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
            +P+GV   +I  N  +  NA  E++S+ L   GTY +Y
Sbjct  116  VPAGVKVEEI--NHEEYANALNESFSINLKTPGTYEFY  151



>ref|XP_006655671.1| PREDICTED: plastocyanin, chloroplastic-like [Oryza brachyantha]
Length=152

 Score =   106 bits (264),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 62/82 (76%), Gaps = 2/82 (2%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXD  454
            EV LG++ G L F P++ +V SGETI FKNNAG+PH V+FDED +PSGVD +KIS  E  
Sbjct  57   EVLLGANGGVLVFEPNDFTVKSGETITFKNNAGYPHNVVFDEDAVPSGVDVSKISQEE--  114

Query  455  LLNAPGETYSVTLTEKGTYSYY  520
             LNA GET+SVTLT  GTY +Y
Sbjct  115  FLNAAGETFSVTLTVPGTYGFY  136



>ref|XP_002946905.1| hypothetical protein VOLCADRAFT_72905 [Volvox carteri f. nagariensis]
 gb|EFJ52131.1| hypothetical protein VOLCADRAFT_72905 [Volvox carteri f. nagariensis]
Length=144

 Score =   105 bits (262),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 60/125 (48%), Positives = 79/125 (63%), Gaps = 2/125 (2%)
 Frame = +2

Query  146  RTAVKLAAAPTPKLAIKASLKNFGaaviataasallatnalaaEVKLGSDDGGLAFVPSE  325
            R     A A  P  ++KA++    +    + AS  +  +A AA VKLG+D G L F PS 
Sbjct  6    RAPASRAGAVRPVASLKAAVSRVASVAGVSVASLAVTLSAHAATVKLGADSGALVFEPST  65

Query  326  LSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXDLLNAPGETYSVTLTEKG  505
            +++ SG+T+ F NNAGFPH V+FDED +P+GV+   IS +  DLLNAPGETYSV LT  G
Sbjct  66   VTIKSGDTVDFVNNAGFPHNVVFDEDAVPAGVNVDAISRD--DLLNAPGETYSVKLTTPG  123

Query  506  TYSYY  520
             Y YY
Sbjct  124  EYGYY  128



>ref|XP_005844862.1| hypothetical protein CHLNCDRAFT_48299 [Chlorella variabilis]
 gb|EFN52760.1| hypothetical protein CHLNCDRAFT_48299 [Chlorella variabilis]
Length=93

 Score = 99.4 bits (246),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 58/79 (73%), Gaps = 2/79 (3%)
 Frame = +2

Query  284  LGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXDLLN  463
            +G+D+G L F PS +++A GE++ F NNAGFPH V+FDEDE+PSGV+A  IS    D  N
Sbjct  1    MGADNGALVFDPSSVTIAKGESVTFVNNAGFPHNVVFDEDEVPSGVNADAIS--HEDYFN  58

Query  464  APGETYSVTLTEKGTYSYY  520
            APGETYSV L   G YS+Y
Sbjct  59   APGETYSVKLDTAGAYSFY  77



>emb|CEF99226.1| Blue (type 1) copper protein [Ostreococcus tauri]
Length=153

 Score =   100 bits (248),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 58/81 (72%), Gaps = 2/81 (2%)
 Frame = +2

Query  278  VKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXDL  457
            VKLG D+G L F PS L++++G+T+ F NN  FPH V+FDED++PSGV+A K+S    D 
Sbjct  59   VKLGGDNGELGFFPSSLTISAGDTVEFVNNKAFPHNVVFDEDDVPSGVNADKLS--HEDY  116

Query  458  LNAPGETYSVTLTEKGTYSYY  520
            LNAPGE    T  EKGTY YY
Sbjct  117  LNAPGEKRKTTFNEKGTYGYY  137



>ref|XP_001779258.1| plastocyanin, chloroplast precursor [Physcomitrella patens]
 sp|Q9SXW9.2|PLAS_PHYPA RecName: Full=Plastocyanin, chloroplastic; Flags: Precursor [Physcomitrella 
patens]
 gb|EDQ55946.1| plastocyanin, chloroplast precursor [Physcomitrella patens]
Length=168

 Score = 99.8 bits (247),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 90/145 (62%), Gaps = 13/145 (9%)
 Frame = +2

Query  107  FTGLKA----AGASSSSRTAVKLAAAPTPKLAIKAS---LKNFGaaviataasallatna  265
            F+GLKA    A A  SS + V++A    P +   AS   LK  G A++A ++S LL  +A
Sbjct  14   FSGLKAETKAAPARLSSTSVVRMA----PVVRASASSDALKTVGKALLAASSSLLLVASA  69

Query  266  laaEVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMN  445
             AA VK+G DDG L F P ++SVA+GE++ F NN GFPH V+FDED +P+GV    I  N
Sbjct  70   NAATVKMGGDDGALGFYPKDISVAAGESVTFVNNKGFPHNVVFDEDAVPAGVKTEDI--N  127

Query  446  EXDLLNAPGETYSVTLTEKGTYSYY  520
              D LN P E++S+T    GTY +Y
Sbjct  128  HEDYLNGPNESFSITFKTPGTYEFY  152



>gb|AAT45616.1| plastocyanin precursor [Ulva pertusa]
Length=139

 Score = 97.8 bits (242),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 59/81 (73%), Gaps = 2/81 (2%)
 Frame = +2

Query  278  VKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXDL  457
            VKLG DDG LAFVP++++VA+GE I F NNAGFPH ++FDEDE+P+GVDA  IS +E   
Sbjct  45   VKLGGDDGSLAFVPNKITVAAGEAIEFINNAGFPHNIVFDEDEVPAGVDADAISYDE--Y  102

Query  458  LNAPGETYSVTLTEKGTYSYY  520
            LN  G+T    L+  GTY  Y
Sbjct  103  LNGKGQTVVRKLSTAGTYGVY  123



>dbj|BAA77274.1| plastocyanin precursor [Physcomitrella patens]
Length=168

 Score = 98.6 bits (244),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 64/137 (47%), Positives = 86/137 (63%), Gaps = 9/137 (7%)
 Frame = +2

Query  119  KAAGASSSSRTAVKLAAAPTPKLAIKAS---LKNFGaaviataasallatnalaaEVKLG  289
            KAA A  SS + V++A    P +   AS   LK  G A++A ++S LL  +A AA VK+G
Sbjct  22   KAAPARLSSTSVVRMA----PVVRASASSDALKTVGKALLAASSSLLLVASANAATVKMG  77

Query  290  SDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXDLLNAP  469
             DDG L F P ++SVA+GE++ F NN GFPH V+FDED +P+GV    I  N  D LN P
Sbjct  78   GDDGALGFYPKDISVAAGESVTFVNNKGFPHNVVFDEDAVPAGVKTEDI--NHEDYLNGP  135

Query  470  GETYSVTLTEKGTYSYY  520
             E++S+T    GTY +Y
Sbjct  136  NESFSITFKTPGTYEFY  152



>sp|P13133.1|PLAS_ULVAR RecName: Full=Plastocyanin [Ulva arasakii]
Length=98

 Score = 96.7 bits (239),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 58/81 (72%), Gaps = 2/81 (2%)
 Frame = +2

Query  278  VKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXDL  457
            VKLG DDG LAFVPS++SVA+GE I F NNAGFPH ++FDED +P+GVDA  IS +  D 
Sbjct  4    VKLGGDDGALAFVPSKISVAAGEAIEFVNNAGFPHNIVFDEDAVPAGVDADAISYD--DY  61

Query  458  LNAPGETYSVTLTEKGTYSYY  520
            LN+ GET    L+  G Y  Y
Sbjct  62   LNSKGETVVRKLSTPGVYGVY  82



>sp|P56274.1|PLAS_ULVPE RecName: Full=Plastocyanin [Ulva pertusa]
 pdb|1IUZ|A Chain A, Plastocyanin
Length=98

 Score = 96.3 bits (238),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 58/81 (72%), Gaps = 2/81 (2%)
 Frame = +2

Query  278  VKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXDL  457
            VKLG DDG LAFVPS++SVA+GE I F NNAGFPH ++FDED +P+GVDA  IS +  D 
Sbjct  4    VKLGGDDGSLAFVPSKISVAAGEAIEFVNNAGFPHNIVFDEDAVPAGVDADAISYD--DY  61

Query  458  LNAPGETYSVTLTEKGTYSYY  520
            LN+ GET    L+  G Y  Y
Sbjct  62   LNSKGETVVRKLSTPGVYGVY  82



>sp|P00300.1|PLAS_SCEFU RecName: Full=Plastocyanin ['Chlorella' fusca]
Length=98

 Score = 95.5 bits (236),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 57/81 (70%), Gaps = 2/81 (2%)
 Frame = +2

Query  278  VKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXDL  457
            VKLG+D G L F PS +++ +GET+ + NNAGFPH ++FDEDE+PSG +A  +S    D 
Sbjct  4    VKLGADSGALVFEPSSVTIKAGETVTWVNNAGFPHNIVFDEDEVPSGANAEALS--HEDY  61

Query  458  LNAPGETYSVTLTEKGTYSYY  520
            LNAPGE+YS      GTY Y+
Sbjct  62   LNAPGESYSAKFDTAGTYGYF  82



>dbj|BAE00064.1| plastocyanin precursor [Pediastrum duplex]
Length=151

 Score = 95.9 bits (237),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 56/81 (69%), Gaps = 2/81 (2%)
 Frame = +2

Query  278  VKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXDL  457
            VKLG+D G L FVPS +++ +GE++ + NNAGFPH ++FDED IPSG +A  +S    D 
Sbjct  57   VKLGADSGALEFVPSTVTIKAGESVSWTNNAGFPHNIVFDEDAIPSGANADALS--HEDY  114

Query  458  LNAPGETYSVTLTEKGTYSYY  520
            LNAPGET S      GTY YY
Sbjct  115  LNAPGETVSSKFDTAGTYEYY  135



>sp|P07465.1|PLAS_ULVPR RecName: Full=Plastocyanin [Ulva prolifera]
 pdb|7PCY|A Chain A, The Crystal Structure Of Plastocyanin From A Green Alga, 
Enteromorpha Prolifera
Length=98

 Score = 93.6 bits (231),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 57/81 (70%), Gaps = 2/81 (2%)
 Frame = +2

Query  278  VKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXDL  457
            VKLG DDG LAFVP+ ++V +GE+I F NNAGFPH ++FDED +P+GVDA  IS    D 
Sbjct  4    VKLGGDDGSLAFVPNNITVGAGESIEFINNAGFPHNIVFDEDAVPAGVDADAISAE--DY  61

Query  458  LNAPGETYSVTLTEKGTYSYY  520
            LN+ G+T    LT  GTY  Y
Sbjct  62   LNSKGQTVVRKLTTPGTYGVY  82



>ref|XP_010497972.1| PREDICTED: plastocyanin major isoform, chloroplastic-like, partial 
[Camelina sativa]
Length=64

 Score = 91.7 bits (226),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNE  448
            EV LG  DG LAF+P++ S++ GE IVFKNNAGFPH V+FDEDEIPSGVD AKISM+E
Sbjct  6    EVLLGGGDGSLAFIPNDFSISKGEKIVFKNNAGFPHNVVFDEDEIPSGVDVAKISMSE  63



>ref|XP_011397318.1| Plastocyanin, chloroplastic [Auxenochlorella protothecoides]
 gb|KFM24430.1| Plastocyanin, chloroplastic [Auxenochlorella protothecoides]
Length=154

 Score = 91.7 bits (226),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 58/81 (72%), Gaps = 2/81 (2%)
 Frame = +2

Query  278  VKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXDL  457
            VKLG+D GGL F P  ++++ G+++ ++NNAGFPH ++FDED +PSGV+ +  S+N  D 
Sbjct  60   VKLGTDSGGLQFDPETVTISKGDSVTWQNNAGFPHNIVFDEDGVPSGVNVS--SLNHEDY  117

Query  458  LNAPGETYSVTLTEKGTYSYY  520
            LNAPG++ +      G Y+YY
Sbjct  118  LNAPGQSVTSKFDVAGEYNYY  138



>ref|XP_009617205.1| PREDICTED: plastocyanin A'/A''-like [Nicotiana tomentosiformis]
Length=77

 Score = 89.4 bits (220),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +2

Query  365  NAGFPHXVIFDEDEIPSGVDAAKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
            N GFPH V+FDEDEIP+GVD +KISM E + LN PGETYSVTL+EKGTYS+Y
Sbjct  10   NVGFPHNVVFDEDEIPTGVDVSKISMPEEEYLNGPGETYSVTLSEKGTYSFY  61



>ref|XP_005642864.1| Plastocyanin, chloroplastic [Coccomyxa subellipsoidea C-169]
 gb|EIE18320.1| Plastocyanin, chloroplastic [Coccomyxa subellipsoidea C-169]
Length=140

 Score = 90.1 bits (222),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 55/81 (68%), Gaps = 2/81 (2%)
 Frame = +2

Query  278  VKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXDL  457
            VKLG D G L F P+ +++ +GE++ + NN GFPH V+FDED IPSG +A   S++  D 
Sbjct  46   VKLGGDGGALIFDPATITIKAGESVTWTNNVGFPHNVVFDEDAIPSGANAE--SLSHEDY  103

Query  458  LNAPGETYSVTLTEKGTYSYY  520
            LNAPGE+ S   T  G YSYY
Sbjct  104  LNAPGESVSSKFTTPGEYSYY  124



>ref|XP_007510659.1| predicted protein [Bathycoccus prasinos]
 emb|CCO18192.1| predicted protein [Bathycoccus prasinos]
Length=145

 Score = 89.4 bits (220),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 52/81 (64%), Gaps = 2/81 (2%)
 Frame = +2

Query  278  VKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXDL  457
            +KLG D+G L F P  ++V+ GET+ F NN  FPH V+FDED +P+GVDA KIS    D 
Sbjct  51   IKLGGDNGELGFYPPSITVSKGETVEFVNNKAFPHNVVFDEDNVPAGVDADKIS--HEDY  108

Query  458  LNAPGETYSVTLTEKGTYSYY  520
            LN PGE  +      GTY YY
Sbjct  109  LNGPGEKVTNKFDVAGTYGYY  129



>sp|P26956.2|PLAS_ACUOB RecName: Full=Plastocyanin, chloroplastic; Flags: Precursor [Acutodesmus 
obliquus]
 gb|AAD03610.1| plastocyanin [Acutodesmus obliquus]
Length=145

 Score = 89.4 bits (220),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 57/81 (70%), Gaps = 2/81 (2%)
 Frame = +2

Query  278  VKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXDL  457
            VKLG+D G L F P+ +++ +G+++ + NNAGFPH ++FDED +P+GV+A  +S +  D 
Sbjct  51   VKLGADSGALVFEPATVTIKAGDSVTWTNNAGFPHNIVFDEDAVPAGVNADALSHD--DY  108

Query  458  LNAPGETYSVTLTEKGTYSYY  520
            LNAPGE+Y+      G Y Y+
Sbjct  109  LNAPGESYTAKFDTAGEYGYF  129



>ref|XP_003059601.1| plastocyanin, chloroplast precursor [Micromonas pusilla CCMP1545]
 gb|EEH56733.1| plastocyanin, chloroplast precursor [Micromonas pusilla CCMP1545]
Length=152

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 53/81 (65%), Gaps = 2/81 (2%)
 Frame = +2

Query  278  VKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXDL  457
            +KLG D+G L F P+++SVA GET+ F NN  FPH V+FDED +P+GV+A  IS    D 
Sbjct  58   IKLGGDNGELGFFPNKISVAKGETVEFVNNKAFPHNVVFDEDNVPAGVNADAIS--HEDY  115

Query  458  LNAPGETYSVTLTEKGTYSYY  520
            LN PGE  +      GTY YY
Sbjct  116  LNGPGEKVTNKFDVAGTYGYY  136



>gb|ACI87811.1| putative plastocyanin chloroplast precursor [Cupressus sempervirens]
Length=134

 Score = 87.8 bits (216),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 86/119 (72%), Gaps = 5/119 (4%)
 Frame = +2

Query  164  AAAPTPKLAIKASLKNFGaaviataasallatnalaaEVKLGSDDGGLAFVPSELSVASG  343
            +A+P P+L+IKASLK    A +  AASA++A+NA+  +V LG+DDG LA V SE SV +G
Sbjct  6    SASPLPRLSIKASLKE-VGAAVVDAASAVIASNAMDVDVLLGADDGSLA-VRSEFSVPAG  63

Query  344  ETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
            E IVFK NA + H V+FDED +PS VD + I M+E DLLNA GET  V L++ G Y++Y
Sbjct  64   E-IVFKYNAEYAHNVLFDEDAVPSDVDVS-ICMSEEDLLNAIGET-EVALSDIGDYTFY  119



>ref|XP_002504072.1| plastocyanin, chloroplast precursor [Micromonas sp. RCC299]
 gb|ACO65330.1| plastocyanin, chloroplast precursor [Micromonas sp. RCC299]
Length=169

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 53/81 (65%), Gaps = 2/81 (2%)
 Frame = +2

Query  278  VKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXDL  457
            +KLG D+G L F P++++VA GET+ F NN  FPH V+FDED +PSGV+A  IS    D 
Sbjct  75   IKLGGDNGELGFFPNKITVAKGETVEFVNNKAFPHNVVFDEDNVPSGVNADAIS--HEDY  132

Query  458  LNAPGETYSVTLTEKGTYSYY  520
            LN PGE  +      GTY YY
Sbjct  133  LNGPGEKVTNKFDTPGTYGYY  153



>dbj|BAA84778.1| pre-apoplastocyanin [Pediastrum boryanum]
 dbj|BAE00063.1| plastocyanin precursor [Pediastrum boryanum]
Length=151

 Score = 87.8 bits (216),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 54/81 (67%), Gaps = 2/81 (2%)
 Frame = +2

Query  278  VKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXDL  457
            VKLG+D G L F P+ +++ +GE++ + NNAG+PH ++FDED IP G +A  +S    D 
Sbjct  57   VKLGADSGALVFDPATVTIKAGESVSWVNNAGYPHNIVFDEDSIPGGENADALS--HEDY  114

Query  458  LNAPGETYSVTLTEKGTYSYY  520
            LNAPGET S      GTY YY
Sbjct  115  LNAPGETVSSKFATAGTYEYY  135



>dbj|BAI53540.1| plastocyanin [Thalassiosira oceanica]
Length=100

 Score = 86.3 bits (212),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 54/82 (66%), Gaps = 2/82 (2%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXD  454
            EVK+G+D G L F P++++V  G+T+ + NN   PH V+FDED IP GVD  KISM+  D
Sbjct  5    EVKMGADSGLLVFEPAKVTVCKGDTVKWINNKAGPHNVVFDEDNIPDGVDQEKISMD--D  62

Query  455  LLNAPGETYSVTLTEKGTYSYY  520
             L  PG+T+ +     GTY YY
Sbjct  63   QLGEPGDTFEMKFDTAGTYGYY  84



>gb|EJK51127.1| hypothetical protein THAOC_29732 [Thalassiosira oceanica]
Length=149

 Score = 86.7 bits (213),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 54/82 (66%), Gaps = 2/82 (2%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXD  454
            EVK+G+D G L F P++++V  G+T+ + NN   PH V+FDED IP GVD  KISM+  D
Sbjct  54   EVKMGADSGLLVFEPAKVTVCKGDTVKWINNKAGPHNVVFDEDNIPDGVDQEKISMD--D  111

Query  455  LLNAPGETYSVTLTEKGTYSYY  520
             L  PG+T+ +     GTY YY
Sbjct  112  QLGEPGDTFEMKFDTAGTYGYY  133



>ref|XP_003081409.1| Plastocyanin (ISS) [Ostreococcus tauri]
Length=105

 Score = 85.1 bits (209),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 49/68 (72%), Gaps = 2/68 (3%)
 Frame = +2

Query  317  PSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXDLLNAPGETYSVTLT  496
            PS L++++G+T+ F NN  FPH V+FDED++PSGV+A K+S    D LNAPGE    T  
Sbjct  24   PSSLTISAGDTVEFVNNKAFPHNVVFDEDDVPSGVNADKLS--HEDYLNAPGEKRKTTFN  81

Query  497  EKGTYSYY  520
            EKGTY YY
Sbjct  82   EKGTYGYY  89



>gb|EJK71623.1| plastocyanin [Thalassiosira oceanica]
Length=255

 Score = 86.7 bits (213),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 54/82 (66%), Gaps = 2/82 (2%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXD  454
            EVK+G+D G L F P++++V  G+T+ + NN   PH V+FDED IP GVD  KISM+  D
Sbjct  136  EVKMGADSGLLVFEPAKVTVCKGDTVKWINNKAGPHNVVFDEDNIPDGVDQEKISMD--D  193

Query  455  LLNAPGETYSVTLTEKGTYSYY  520
             L  PG+T+ +     GTY YY
Sbjct  194  QLGEPGDTFEMKFDTAGTYGYY  215



>ref|XP_001419657.1| plastocyanin, chloroplast precursor [Ostreococcus lucimarinus 
CCE9901]
 gb|ABO97950.1| plastocyanin, chloroplast precursor [Ostreococcus lucimarinus 
CCE9901]
Length=104

 Score = 83.6 bits (205),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 50/81 (62%), Gaps = 2/81 (2%)
 Frame = +2

Query  278  VKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXDL  457
            +KLG D+G L F P  ++V +GETI F NN  FPH V+FDED +P+GV+   IS    D 
Sbjct  10   IKLGGDNGELGFYPPSITVKAGETIEFVNNKAFPHNVVFDEDNVPAGVNVDAIS--HEDY  67

Query  458  LNAPGETYSVTLTEKGTYSYY  520
            LN PGE  +      GTY YY
Sbjct  68   LNGPGEKVTNKFDTPGTYGYY  88



>ref|XP_005769827.1| hypothetical protein EMIHUDRAFT_65950 [Emiliania huxleyi CCMP1516]
 gb|EOD17398.1| hypothetical protein EMIHUDRAFT_65950 [Emiliania huxleyi CCMP1516]
Length=110

 Score = 82.4 bits (202),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 52/81 (64%), Gaps = 0/81 (0%)
 Frame = +2

Query  278  VKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXDL  457
            VK+G+D G L FVP E+++  G+T+ + NN G PH V FDE+ IP+GVD   ISM++ + 
Sbjct  14   VKMGADSGQLVFVPYEITINKGDTVTWVNNKGGPHNVKFDEEAIPNGVDVESISMDDGEE  73

Query  458  LNAPGETYSVTLTEKGTYSYY  520
            L   G T+S      GTY YY
Sbjct  74   LGDEGATFSKKFDTAGTYRYY  94



>ref|XP_002946904.1| hypothetical protein VOLCADRAFT_86971 [Volvox carteri f. nagariensis]
 gb|EFJ52130.1| hypothetical protein VOLCADRAFT_86971 [Volvox carteri f. nagariensis]
Length=158

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 52/81 (64%), Gaps = 4/81 (5%)
 Frame = +2

Query  278  VKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXDL  457
            VK+GSD G   FVP  L+V  GET+ F  NAGFPH V+F  D +P GVDA  IS  E   
Sbjct  66   VKVGSDSGAPVFVPDTLTVKPGETVDFVGNAGFPHNVVF--DSVPPGVDAKSISRYEP--  121

Query  458  LNAPGETYSVTLTEKGTYSYY  520
            ++  G+T+SV LT  G YSY+
Sbjct  122  MSTHGDTHSVRLTTPGEYSYH  142



>ref|WP_036020768.1| plastocyanin [Leptolyngbya sp. PCC 7375]
Length=127

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 55/82 (67%), Gaps = 1/82 (1%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXD  454
            +VK+GSD G LAF P+ L++ +G+T+ + NN   PH VIFD  ++P G D A  ++++  
Sbjct  31   QVKMGSDAGLLAFEPATLTIKAGDTVTWVNNKMAPHNVIFDAAQVPGGKDVAD-ALSQEQ  89

Query  455  LLNAPGETYSVTLTEKGTYSYY  520
            L  +PGE+YS   TE G YSY+
Sbjct  90   LTFSPGESYSSKFTEPGEYSYF  111



>gb|EKV01958.1| plastocyanin [Leptolyngbya sp. PCC 7375]
Length=134

 Score = 78.6 bits (192),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 55/82 (67%), Gaps = 1/82 (1%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXD  454
            +VK+GSD G LAF P+ L++ +G+T+ + NN   PH VIFD  ++P G D A  ++++  
Sbjct  38   QVKMGSDAGLLAFEPATLTIKAGDTVTWVNNKMAPHNVIFDAAQVPGGKDVAD-ALSQEQ  96

Query  455  LLNAPGETYSVTLTEKGTYSYY  520
            L  +PGE+YS   TE G YSY+
Sbjct  97   LTFSPGESYSSKFTEPGEYSYF  118



>gb|AAR15395.1| plastocyanin [Arabidopsis thaliana]
Length=61

 Score = 76.3 bits (186),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = +2

Query  386  VIFDEDEIPSGVDAAKISMNEXDLLNAPGETYSVTLTEKGTYSYY  520
            V+FDEDEIPSGVD AKISM+E DLLN  GETY V LTE GTYS+Y
Sbjct  1    VVFDEDEIPSGVDVAKISMDEQDLLNGAGETYEVALTEPGTYSFY  45



>ref|WP_031292772.1| plastocyanin [Leptolyngbya sp. Heron Island J]
Length=127

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 55/82 (67%), Gaps = 1/82 (1%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXD  454
            +VK+GSD G LAF P+ L++ +G+T+ + NN   PH VIFD  ++P G + A   +++  
Sbjct  31   QVKMGSDAGLLAFEPATLTIKAGDTVTWVNNKMAPHNVIFDAAQVPGGKEVAD-QLSQEQ  89

Query  455  LLNAPGETYSVTLTEKGTYSYY  520
            L  +PGE+YS T +E G YSY+
Sbjct  90   LTFSPGESYSSTFSEPGEYSYF  111



>gb|ESA36208.1| plastocyanin [Leptolyngbya sp. Heron Island J]
Length=134

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 55/82 (67%), Gaps = 1/82 (1%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXD  454
            +VK+GSD G LAF P+ L++ +G+T+ + NN   PH VIFD  ++P G + A   +++  
Sbjct  38   QVKMGSDAGLLAFEPATLTIKAGDTVTWVNNKMAPHNVIFDAAQVPGGKEVAD-QLSQEQ  96

Query  455  LLNAPGETYSVTLTEKGTYSYY  520
            L  +PGE+YS T +E G YSY+
Sbjct  97   LTFSPGESYSSTFSEPGEYSYF  118



>ref|WP_013321254.1| plasmid stabilization protein [Cyanothece sp. PCC 7822]
 gb|ADN13147.1| plastocyanin [Cyanothece sp. PCC 7822]
Length=127

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 53/81 (65%), Gaps = 2/81 (2%)
 Frame = +2

Query  278  VKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXDL  457
            VK+GSD+G L F P +L++ +G+T+ + NN   PH  +FD  ++P  V A KIS     L
Sbjct  33   VKMGSDNGALKFQPEKLTIKAGDTVKWVNNKLSPHNAVFDSAKVPGDVSATKIS--HKAL  90

Query  458  LNAPGETYSVTLTEKGTYSYY  520
            + APGE+++ T  + GTY+YY
Sbjct  91   VFAPGESFTTTFDQPGTYTYY  111



>ref|WP_015956505.1| plasmid stabilization protein [Cyanothece sp. PCC 7424]
 sp|B7KAE8.1|PLAS_CYAP7 RecName: Full=Plastocyanin; Flags: Precursor [Cyanothece sp. 
PCC 7424]
 gb|ACK72922.1| plastocyanin [Cyanothece sp. PCC 7424]
Length=127

 Score = 74.7 bits (182),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 52/81 (64%), Gaps = 2/81 (2%)
 Frame = +2

Query  278  VKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXDL  457
            VK+GSD G L F P +L++ +G+T+ + NN   PH  +FD  ++P  V A KIS     L
Sbjct  33   VKMGSDQGLLKFDPPQLTIKAGDTVKWVNNKLAPHNAVFDNSKVPDSVSATKIS--HKAL  90

Query  458  LNAPGETYSVTLTEKGTYSYY  520
            + +PGE+++ T  E GTY+YY
Sbjct  91   VFSPGESFTTTFDEPGTYTYY  111



>ref|WP_015225957.1| plastocyanin [Halothece sp. PCC 7418]
 gb|AFZ44082.1| plastocyanin [Halothece sp. PCC 7418]
Length=199

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 55/85 (65%), Gaps = 3/85 (4%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXD  454
            +VK+GSD G L +VPS+L++  G+T+ F  N   PH V+FD + +PSG  A   S+++  
Sbjct  99   QVKMGSDTGQLQYVPSKLTIHPGDTVEFVMNKLAPHNVVFDSNGVPSGAKALASSLSKNK  158

Query  455  LLNAPGETYSVTLTE---KGTYSYY  520
            LL+  GE+++VT  E   KG Y YY
Sbjct  159  LLSGAGESHTVTFPEDAPKGEYKYY  183



>gb|KGN60067.1| hypothetical protein Csa_3G875435 [Cucumis sativus]
Length=110

 Score = 72.8 bits (177),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 56/87 (64%), Gaps = 0/87 (0%)
 Frame = -3

Query  520  VVRVSSLLCQSDRVSLSRCIQQVXLIHGDLGSINSRRNLIFIENHVVREARIVLEHNGLS  341
            V RV+S   + + ++LS  +Q++ LIH DL  INS RN I IE++VV E+R+VLE + L 
Sbjct  24   VERVTSFFSKLNFINLSGSVQKILLIHRDLSHINSARNFILIEHYVVWESRVVLERDFLP  83

Query  340  RSHREFAGDEGKPTVIRAKLNLSSQGV  260
            R HRE   +E + TV+  + +L   GV
Sbjct  84   RRHREIVRNECQRTVVPTQQDLDGHGV  110



>ref|WP_008317432.1| plastocyanin [Leptolyngbya sp. PCC 6406]
Length=137

 Score = 73.2 bits (178),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 53/85 (62%), Gaps = 5/85 (6%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXD  454
            EVK+GSD G L F P+ L++ +G+T+ + NN   PH VIFD + IP    A KIS ++  
Sbjct  38   EVKMGSDSGLLVFEPANLTIQAGDTVTWVNNKMAPHNVIFDGNSIPDKSVADKISHDQ--  95

Query  455  LLNAPGETYSVTLTEK---GTYSYY  520
            L  APGE+YS T T     G Y+YY
Sbjct  96   LTFAPGESYSTTFTADLPAGEYTYY  120



>pdb|1PCS|A Chain A, The 2.15 A Crystal Structure Of A Triple Mutant Plastocyanin 
From The Cyanobacterium Synechocystis Sp. Pcc 6803
Length=98

 Score = 71.6 bits (174),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 53/81 (65%), Gaps = 3/81 (4%)
 Frame = +2

Query  278  VKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXDL  457
            VK+GSD G L F PS +++ +GE + + NN   PH ++FD D +P+   AAK+S     L
Sbjct  5    VKMGSDSGALVFEPSTVTIKAGEEVKWVNNKLSPHNIVFDADGVPADT-AAKLS--HKGL  61

Query  458  LNAPGETYSVTLTEKGTYSYY  520
            L A GE+++ T TE GTY+YY
Sbjct  62   LFAAGESFTSTFTEPGTYTYY  82



>ref|WP_038018851.1| plastocyanin [Synechococcus sp. PCC 7335]
Length=119

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 51/82 (62%), Gaps = 2/82 (2%)
 Frame = +2

Query  278  VKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXDL  457
            VK+GSD G L F P+ ++V+ G+T+ ++NN   PH VIFD + IP G + A   +    L
Sbjct  23   VKMGSDGGLLVFEPATVTVSKGDTVTWENNKMAPHNVIFDPNNIPGGKEVAD-KLTNKQL  81

Query  458  LNAPGETYSVTL-TEKGTYSYY  520
              APGE+YS T   E G Y+YY
Sbjct  82   TFAPGESYSSTFDVEPGEYTYY  103



>gb|EDX87188.1| plastocyanin [Synechococcus sp. PCC 7335]
Length=135

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 51/82 (62%), Gaps = 2/82 (2%)
 Frame = +2

Query  278  VKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXDL  457
            VK+GSD G L F P+ ++V+ G+T+ ++NN   PH VIFD + IP G + A   +    L
Sbjct  39   VKMGSDGGLLVFEPATVTVSKGDTVTWENNKMAPHNVIFDPNNIPGGKEVAD-KLTNKQL  97

Query  458  LNAPGETYSVTL-TEKGTYSYY  520
              APGE+YS T   E G Y+YY
Sbjct  98   TFAPGESYSSTFDVEPGEYTYY  119



>ref|WP_027402710.1| plasmid stabilization protein [Aphanizomenon flos-aquae]
Length=139

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 53/84 (63%), Gaps = 3/84 (4%)
 Frame = +2

Query  278  VKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXDL  457
            VKLGSD G LAF P +L+V +G+TIV+KNN   PH V+FD  + P+   A   S++   L
Sbjct  39   VKLGSDKGMLAFEPKKLTVKAGDTIVWKNNKVPPHNVVFDPKKNPTADAALAKSLSHKKL  98

Query  458  LNAPGETYSVTL---TEKGTYSYY  520
            L +PG+T +  +      GTY++Y
Sbjct  99   LMSPGQTETTVIPVDAAPGTYTFY  122



>ref|WP_015225956.1| plastocyanin [Halothece sp. PCC 7418]
 gb|AFZ44081.1| plastocyanin [Halothece sp. PCC 7418]
Length=131

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 52/85 (61%), Gaps = 3/85 (4%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXD  454
            +VK+G+D G L +VP +LSV  G+++ F  N   PH V+FD   +PSG  +   S++   
Sbjct  31   QVKMGADTGQLKYVPEKLSVKPGDSVEFVMNKLAPHNVVFDPSNVPSGAKSLASSLSANK  90

Query  455  LLNAPGETYSVTL---TEKGTYSYY  520
            LL +PG++Y+VT      KG Y YY
Sbjct  91   LLFSPGQSYTVTFPADAPKGEYGYY  115



>ref|WP_015192812.1| Plastocyanin [Stanieria cyanosphaera]
 gb|AFZ35141.1| Plastocyanin [Stanieria cyanosphaera PCC 7437]
Length=126

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 52/82 (63%), Gaps = 3/82 (4%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXD  454
            EVK+GSD+G L FVPS L++ SG+T+ + NN   PH V+FD  ++   + A K S     
Sbjct  32   EVKMGSDNGMLQFVPSSLTIKSGDTVKWVNNKMAPHNVVFDSSKVSDDI-ATKAS--HKS  88

Query  455  LLNAPGETYSVTLTEKGTYSYY  520
            L  +PGE+++ T  + G YSYY
Sbjct  89   LAFSPGESFTTTFDQPGEYSYY  110



>ref|WP_015230620.1| plastocyanin [Dactylococcopsis salina]
 gb|AFZ51641.1| plastocyanin [Dactylococcopsis salina PCC 8305]
Length=187

 Score = 71.6 bits (174),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 53/85 (62%), Gaps = 3/85 (4%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXD  454
            +VK+GSD G L +VP +L++  G+T+ F  N   PH V+FD + +PS   A    +++  
Sbjct  87   QVKMGSDTGQLKYVPEKLTIHPGDTVEFVMNKLAPHNVVFDSNGVPSAAKALASDLSKNK  146

Query  455  LLNAPGETYSVTLTE---KGTYSYY  520
            LL+  G+T++VT  E   KG YSYY
Sbjct  147  LLSGAGQTHTVTFPEDAPKGEYSYY  171



>ref|WP_039728071.1| MULTISPECIES: hypothetical protein [Oscillatoriophycideae]
 gb|KIF15820.1| hypothetical protein QP59_36750 [Aphanocapsa montana BDHKU210001]
 gb|KIF40744.1| hypothetical protein QQ91_29690 [Lyngbya confervoides BDU141951]
Length=139

 Score = 69.7 bits (169),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 49/85 (58%), Gaps = 3/85 (4%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXD  454
            EVK+GSD G L F P++L+V  G+T+ + NN   PH VIFD +++P G       ++   
Sbjct  38   EVKMGSDSGLLVFEPAKLTVKPGDTVTWVNNKMAPHNVIFDGNQVPGGDKDLADKISHSQ  97

Query  455  LLNAPGETYSVTLTEK---GTYSYY  520
            L  APGE YS T T     G Y Y+
Sbjct  98   LTFAPGENYSTTFTADMPAGDYGYF  122



>ref|WP_017300201.1| hypothetical protein [Nodosilinea nodulosa]
Length=138

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 50/85 (59%), Gaps = 4/85 (5%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXD  454
            +VK+GSD G L F PS ++V  G+T+ + NN   PH V+FD   +P G  A   S++   
Sbjct  38   DVKMGSDAGLLVFEPSTVTVKPGDTVTWINNKMAPHNVVFDAANVP-GDKALADSISHTQ  96

Query  455  LLNAPGETYSVTLT---EKGTYSYY  520
            L  APGE YS T T     GTY+YY
Sbjct  97   LTFAPGENYSTTFTGDMPAGTYTYY  121



>ref|WP_006040850.1| plasmid stabilization protein [Synechococcus sp. WH 7805]
 gb|EAR17481.1| plastocyanin precursor [Synechococcus sp. WH 7805]
Length=119

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 49/83 (59%), Gaps = 12/83 (14%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFD-EDEIPSGVDAAKISMNEX  451
            EVKLG+D G LAF PS +++ +G+T+ F NN   PH  +FD  DE           ++  
Sbjct  32   EVKLGTDAGMLAFEPSTVTIKAGDTVKFVNNKLAPHNAVFDGHDE-----------LSHS  80

Query  452  DLLNAPGETYSVTLTEKGTYSYY  520
            DL  APGE++  T +E GTY YY
Sbjct  81   DLAFAPGESWEETFSEAGTYDYY  103



>ref|WP_011932662.1| plasmid stabilization protein [Synechococcus sp. WH 7803]
 emb|CAK23179.1| Plastocyanin [Synechococcus sp. WH 7803]
Length=119

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 49/83 (59%), Gaps = 12/83 (14%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFD-EDEIPSGVDAAKISMNEX  451
            EVKLG+D G LAF PS +++ +G+T+ F NN   PH  +FD  DE           ++  
Sbjct  32   EVKLGTDAGMLAFEPSTVTIKAGDTVKFVNNKLAPHNAVFDGHDE-----------LSHS  80

Query  452  DLLNAPGETYSVTLTEKGTYSYY  520
            DL  APGE++  T +E GTY YY
Sbjct  81   DLAFAPGESWEETFSEAGTYDYY  103



>ref|WP_011125233.1| MULTISPECIES: plasmid stabilization protein [Prochlorococcus]
 ref|NP_875473.1| Plastocyanin, PetE [Prochlorococcus marinus subsp. marinus str. 
CCMP1375]
 gb|AAQ00126.1| Plastocyanin, PetE [Prochlorococcus marinus subsp. marinus str. 
CCMP1375]
 gb|KGG13922.1| Plastocyanin [Prochlorococcus marinus str. LG]
 gb|KGG19055.1| Plastocyanin [Prochlorococcus marinus str. SS2]
 gb|KGG32359.1| Plastocyanin [Prochlorococcus marinus str. SS51]
 gb|KGG37009.1| Plastocyanin [Prochlorococcus sp. SS52]
Length=119

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 49/82 (60%), Gaps = 10/82 (12%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXD  454
            EVKLG+D G LAF PS +++++G+++ F NN   PH  +F+  E           ++  D
Sbjct  32   EVKLGTDAGMLAFEPSSVTISTGDSVKFVNNKLAPHNAVFEGHE----------ELSHPD  81

Query  455  LLNAPGETYSVTLTEKGTYSYY  520
            L  APGE++  T TE GTY YY
Sbjct  82   LAFAPGESWQETFTEAGTYDYY  103



>gb|ABF73014.1| plastocyanin protein precursor [Karenia brevis]
Length=239

 Score = 68.9 bits (167),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 52/82 (63%), Gaps = 4/82 (5%)
 Frame = +2

Query  278  VKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXDL  457
            V +G+D G LAF P E +V  G+++ +KNN   PH V+F+ D++PSGVDA+ IS  E   
Sbjct  144  VLMGTDVG-LAFEPKETTVCKGDSVTWKNNRLGPHNVVFNPDDVPSGVDASAISTPE--Y  200

Query  458  LNAPGETYSVTLTE-KGTYSYY  520
            +   GETY+V   +  G Y YY
Sbjct  201  IGGEGETYTVKFDKATGDYGYY  222



>ref|WP_011826461.1| plasmid stabilization protein [Prochlorococcus marinus]
 gb|ABM78576.1| plastocyanin [Prochlorococcus marinus str. MIT 9303]
Length=119

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 48/83 (58%), Gaps = 12/83 (14%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFD-EDEIPSGVDAAKISMNEX  451
            EVKLGSD G LAF PS +++  G+TI F NN   PH  +F+  DE           ++  
Sbjct  32   EVKLGSDSGMLAFEPSSITIQEGDTIKFVNNNLAPHNAVFEGHDE-----------LSHS  80

Query  452  DLLNAPGETYSVTLTEKGTYSYY  520
            DL  APGE++  T T  GTYS+Y
Sbjct  81   DLAFAPGESWEETFTTAGTYSFY  103



>ref|WP_036909788.1| plastocyanin [Prochlorococcus marinus]
 gb|KGG23405.1| Plastocyanin [Prochlorococcus marinus str. SS35]
Length=119

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 49/82 (60%), Gaps = 10/82 (12%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXD  454
            EVKLG+D G LAF PS +++++G+++ F NN   PH  +F+  E           ++  D
Sbjct  32   EVKLGTDAGMLAFEPSSVTISTGDSVEFVNNKLAPHNAVFEGHE----------ELSHPD  81

Query  455  LLNAPGETYSVTLTEKGTYSYY  520
            L  APGE++  T TE GTY YY
Sbjct  82   LAFAPGESWQETFTEAGTYDYY  103



>ref|WP_035985880.1| plastocyanin [Leptolyngbya sp. KIOST-1]
Length=138

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 49/85 (58%), Gaps = 4/85 (5%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXD  454
            +VK+GSD G L F PS ++V  G+T+ + NN   PH V+FD    P G  +   S++   
Sbjct  38   DVKMGSDAGLLVFEPSTITVKPGDTVTWVNNKMAPHNVVFDAANTP-GDKSLADSISHTQ  96

Query  455  LLNAPGETYSVTLTEK---GTYSYY  520
            L  APGE YS T T     GTY+YY
Sbjct  97   LTFAPGENYSTTFTSDMPAGTYTYY  121



>ref|WP_019505408.1| hypothetical protein [Pleurocapsa sp. PCC 7319]
Length=119

 Score = 66.6 bits (161),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 47/82 (57%), Gaps = 10/82 (12%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXD  454
            EVK+GSD+G L FVP  +++ +GET+ + NN   PH V+F+ D   S            +
Sbjct  32   EVKMGSDNGMLKFVPETVTIKAGETVKWANNKMSPHNVVFENDADKS----------HKN  81

Query  455  LLNAPGETYSVTLTEKGTYSYY  520
            L+ +PGE Y  T  E G Y+YY
Sbjct  82   LVFSPGEGYETTFNESGEYNYY  103



>ref|WP_006853238.1| plasmid stabilization protein [Synechococcus sp. WH 8016]
 gb|EHA64055.1| plastocyanin [Synechococcus sp. WH 8016]
Length=119

 Score = 66.2 bits (160),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 49/83 (59%), Gaps = 12/83 (14%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFD-EDEIPSGVDAAKISMNEX  451
            EVKLG+D G LAF P+ L++ +G+T+ F NN   PH  +FD  DE           ++  
Sbjct  32   EVKLGTDSGMLAFEPNTLNIKTGDTVKFVNNKLAPHNAVFDGHDE-----------LSHS  80

Query  452  DLLNAPGETYSVTLTEKGTYSYY  520
            DL  APGE++  T TE GT+ +Y
Sbjct  81   DLAFAPGESWEETFTEAGTFDFY  103



>ref|WP_009790047.1| plasmid stabilization protein [Synechococcus sp. BL107]
 gb|EAU72005.1| plastocyanin precursor [Synechococcus sp. BL107]
Length=119

 Score = 66.2 bits (160),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 49/83 (59%), Gaps = 12/83 (14%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFD-EDEIPSGVDAAKISMNEX  451
            EVKLG+D G LAF PS +++++G+T+ F NN   PH  +FD  DE           ++  
Sbjct  32   EVKLGTDAGMLAFEPSSVTISAGDTVKFVNNKLAPHNAVFDGHDE-----------LSHS  80

Query  452  DLLNAPGETYSVTLTEKGTYSYY  520
            DL   PGE++  T +E GTY YY
Sbjct  81   DLAFNPGESWEETFSEAGTYDYY  103



>ref|WP_011619806.1| plasmid stabilization protein [Synechococcus sp. CC9311]
 gb|ABI47424.1| plastocyanin [Synechococcus sp. CC9311]
Length=119

 Score = 66.2 bits (160),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 49/83 (59%), Gaps = 12/83 (14%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFD-EDEIPSGVDAAKISMNEX  451
            EVKLG+D G LAF P+ L++ +G+T+ F NN   PH  +FD  DE           ++  
Sbjct  32   EVKLGTDSGMLAFEPNTLNIKTGDTVKFVNNKLAPHNAVFDGHDE-----------LSHS  80

Query  452  DLLNAPGETYSVTLTEKGTYSYY  520
            DL  APGE++  T TE GT+ +Y
Sbjct  81   DLAFAPGESWEETFTEAGTFDFY  103



>ref|WP_038001227.1| plastocyanin [Synechococcus sp. RS9917]
Length=119

 Score = 66.2 bits (160),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 47/82 (57%), Gaps = 10/82 (12%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXD  454
            EVKLGSD G LAF PS +++ +G+T+ F NN   PH  +F+  +           ++  D
Sbjct  32   EVKLGSDSGMLAFEPSTVTIKAGDTVKFVNNKMAPHNAVFEGHD----------DLSHSD  81

Query  455  LLNAPGETYSVTLTEKGTYSYY  520
            L  APGE++  T T  GTY YY
Sbjct  82   LAFAPGESWEETFTTAGTYDYY  103



>gb|EAQ69854.1| Plastocyanin, PetE [Synechococcus sp. RS9917]
Length=118

 Score = 65.9 bits (159),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 47/82 (57%), Gaps = 10/82 (12%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXD  454
            EVKLGSD G LAF PS +++ +G+T+ F NN   PH  +F+  +           ++  D
Sbjct  31   EVKLGSDSGMLAFEPSTVTIKAGDTVKFVNNKMAPHNAVFEGHD----------DLSHSD  80

Query  455  LLNAPGETYSVTLTEKGTYSYY  520
            L  APGE++  T T  GTY YY
Sbjct  81   LAFAPGESWEETFTTAGTYDYY  102



>ref|WP_009631096.1| plastocyanin [Synechocystis sp. PCC 7509]
Length=138

 Score = 66.2 bits (160),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 51/85 (60%), Gaps = 4/85 (5%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPS-GVDAAKISMNEX  451
            +VKLGSD G L F P++L++ SG+T+ + NN   PH V+FD    P+   D AK  ++  
Sbjct  38   QVKLGSDKGMLVFDPAKLTIKSGDTVEWVNNKVPPHNVVFDAANNPTKSADVAK-GLSHK  96

Query  452  DLLNAPGETYSVTLTEK--GTYSYY  520
             LL  PG+T   T +E   G YSYY
Sbjct  97   QLLMTPGQTVKTTFSETAPGDYSYY  121



>ref|WP_032517727.1| plastocyanin [Prochlorococcus marinus]
 gb|KGG03571.1| Plastocyanin [Prochlorococcus marinus str. MIT 9321]
Length=116

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 47/82 (57%), Gaps = 10/82 (12%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXD  454
            EVKLG+D G LAF PS +++++G+T+ F NN   PH  +FD  E           ++  D
Sbjct  29   EVKLGTDAGMLAFEPSTVTISAGDTVTFVNNKLAPHNAVFDGHE----------ELSHAD  78

Query  455  LLNAPGETYSVTLTEKGTYSYY  520
            L  APGE++  T    GTY YY
Sbjct  79   LAFAPGESWEETFDTAGTYDYY  100



>ref|WP_011129826.1| plasmid stabilization protein [Prochlorococcus marinus]
 emb|CAE20622.1| Plastocyanin [Prochlorococcus marinus str. MIT 9313]
Length=119

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 47/83 (57%), Gaps = 12/83 (14%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFD-EDEIPSGVDAAKISMNEX  451
            EVKLGSD G LAF PS +++  G+TI F NN   PH  +F+  DE           ++  
Sbjct  32   EVKLGSDSGMLAFEPSSITIQEGDTIKFVNNNLAPHNAVFEGHDE-----------LSHS  80

Query  452  DLLNAPGETYSVTLTEKGTYSYY  520
            DL  APGE++  T T  GTY +Y
Sbjct  81   DLAFAPGESWEETFTTAGTYDFY  103



>gb|KGG19418.1| Plastocyanin [Prochlorococcus marinus str. PAC1]
Length=94

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 49/82 (60%), Gaps = 10/82 (12%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXD  454
            EVKLG+D G LAF PS L++++G+T+ F NN   PH  +FD ++           ++  D
Sbjct  7    EVKLGTDAGMLAFEPSTLNISAGDTVKFVNNKLAPHNAVFDGND----------DLSHPD  56

Query  455  LLNAPGETYSVTLTEKGTYSYY  520
            L  APGE++  T +  GTY +Y
Sbjct  57   LAFAPGESWERTFSTAGTYDFY  78



>ref|WP_025971905.1| plastocyanin [Prochlorococcus sp. scB241_527L22]
Length=116

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 47/82 (57%), Gaps = 10/82 (12%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXD  454
            EVKLG+D G LAF PS +++++G+T+ F NN   PH  +FD  E           ++  D
Sbjct  29   EVKLGTDAGMLAFEPSTITISAGDTVKFVNNKLAPHNAVFDGHE----------ELSHAD  78

Query  455  LLNAPGETYSVTLTEKGTYSYY  520
            L  APGE++  T    GTY YY
Sbjct  79   LAFAPGESWEETFDTAGTYDYY  100



>ref|WP_015144857.1| plastocyanin [Pleurocapsa minor]
 gb|AFY78558.1| plastocyanin [Pleurocapsa sp. PCC 7327]
Length=126

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 49/81 (60%), Gaps = 3/81 (4%)
 Frame = +2

Query  278  VKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXDL  457
            VK+GSD G L F P  L++ +G+T+ + NN   PH V+FD  ++    +A    M+  +L
Sbjct  33   VKMGSDSGLLKFEPDTLTIEAGDTVKWVNNKLAPHNVVFDSSKMD---EAIATKMSHKNL  89

Query  458  LNAPGETYSVTLTEKGTYSYY  520
            + +PGE+Y  T  E G Y+YY
Sbjct  90   VFSPGESYESTFDEPGEYTYY  110



>ref|WP_025953606.1| plastocyanin, partial [Prochlorococcus sp. scB243_497N18]
Length=93

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 47/82 (57%), Gaps = 10/82 (12%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXD  454
            EVKLG+D G LAF PS +++++G+T+ F NN   PH  +FD  E           ++  D
Sbjct  6    EVKLGTDAGMLAFEPSTVTISAGDTVKFVNNKLAPHNAVFDGHE----------ELSHAD  55

Query  455  LLNAPGETYSVTLTEKGTYSYY  520
            L  APGE++  T    GTY YY
Sbjct  56   LAFAPGESWEETFDTAGTYDYY  77



>ref|WP_026722374.1| plasmid stabilization protein [Fischerella sp. PCC 9431]
Length=136

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 51/84 (61%), Gaps = 5/84 (6%)
 Frame = +2

Query  278  VKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXDL  457
            VKLGSD G LAF PS+L+V  G+TI + NN   PH V+FD  +  S  D AK +     L
Sbjct  39   VKLGSDKGMLAFEPSKLTVKPGDTIKWVNNKVPPHNVVFDPAQSKSA-DLAK-AWTHKQL  96

Query  458  LNAPGETYSVTL---TEKGTYSYY  520
            L +PG++Y  T+     KG Y++Y
Sbjct  97   LMSPGQSYETTIPADAPKGNYTFY  120



>ref|WP_007097487.1| plasmid stabilization protein [Synechococcus sp. RS9916]
 gb|EAU73379.1| plastocyanin precursor [Synechococcus sp. RS9916]
Length=119

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 48/83 (58%), Gaps = 12/83 (14%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFD-EDEIPSGVDAAKISMNEX  451
            EVKLGSD G LAF PS +++ +G+T+ F NN   PH  +FD  DE           ++  
Sbjct  32   EVKLGSDSGMLAFEPSTVNIKAGDTVKFVNNKMAPHNAVFDGHDE-----------LSHS  80

Query  452  DLLNAPGETYSVTLTEKGTYSYY  520
            DL  APGE++  T +  GTY +Y
Sbjct  81   DLAFAPGESWEETFSTAGTYDFY  103



>ref|WP_042850028.1| plastocyanin [Prochlorococcus sp. MIT 0604]
 gb|AIQ94649.1| Plastocyanin [Prochlorococcus sp. MIT 0604]
Length=116

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 47/82 (57%), Gaps = 10/82 (12%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXD  454
            EVKLG+D G LAF PS +++++G+T+ F NN   PH  +FD  E           ++  D
Sbjct  29   EVKLGTDAGMLAFEPSTVTISAGDTVKFVNNKLAPHNAVFDGHE----------DLSHAD  78

Query  455  LLNAPGETYSVTLTEKGTYSYY  520
            L  APGE++  T    GTY YY
Sbjct  79   LAFAPGESWEETFDNAGTYDYY  100



>ref|WP_011376137.1| plasmid stabilization protein [Prochlorococcus marinus]
 gb|ABB49642.1| plastocyanin [Prochlorococcus marinus str. MIT 9312]
 gb|KGG02111.1| Plastocyanin [Prochlorococcus marinus str. MIT 9311]
Length=116

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 47/82 (57%), Gaps = 10/82 (12%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXD  454
            EVKLG+D G LAF PS +++++G+T+ F NN   PH  +FD  E           ++  D
Sbjct  29   EVKLGTDAGMLAFEPSTVNISAGDTVKFVNNKLAPHNAVFDGHE----------ELSHAD  78

Query  455  LLNAPGETYSVTLTEKGTYSYY  520
            L  APGE++  T    GTY YY
Sbjct  79   LAFAPGESWEETFNTSGTYDYY  100



>ref|WP_025880926.1| MULTISPECIES: plastocyanin [Prochlorococcus]
Length=116

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 47/82 (57%), Gaps = 10/82 (12%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXD  454
            EVKLG+D G LAF PS +++++G+T+ F NN   PH  +FD  E           ++  D
Sbjct  29   EVKLGTDAGMLAFEPSSVTISAGDTVKFVNNKLAPHNAVFDGHE----------ELSHAD  78

Query  455  LLNAPGETYSVTLTEKGTYSYY  520
            L  APGE++  T    GTY YY
Sbjct  79   LAFAPGESWEETFDTAGTYDYY  100



>ref|WP_032522556.1| plastocyanin [Prochlorococcus marinus]
 gb|KGF95349.1| Plastocyanin [Prochlorococcus marinus str. MIT 9201]
Length=116

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 47/82 (57%), Gaps = 10/82 (12%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXD  454
            EVKLG+D G LAF PS +++++G+T+ F NN   PH  +FD  E           ++  D
Sbjct  29   EVKLGTDAGMLAFEPSTVTISAGDTVKFVNNKLAPHNAVFDGQE----------ELSHAD  78

Query  455  LLNAPGETYSVTLTEKGTYSYY  520
            L  APGE++  T    GTY YY
Sbjct  79   LAFAPGESWEETFDTAGTYDYY  100



>ref|WP_029967456.1| MULTISPECIES: plastocyanin [Prochlorococcus]
Length=116

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 47/82 (57%), Gaps = 10/82 (12%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXD  454
            EVKLG+D G LAF PS +++++G+T+ F NN   PH  +FD  E           ++  D
Sbjct  29   EVKLGTDAGMLAFEPSSVTISAGDTVKFVNNKLAPHNAVFDGHE----------ELSHAD  78

Query  455  LLNAPGETYSVTLTEKGTYSYY  520
            L  APGE++  T    GTY YY
Sbjct  79   LAFAPGESWEETFDTAGTYDYY  100



>ref|WP_015219275.1| Plastocyanin [Cyanobacterium aponinum]
 gb|AFZ53546.1| Plastocyanin [Cyanobacterium aponinum PCC 10605]
Length=122

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 51/82 (62%), Gaps = 6/82 (7%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXD  454
            EVK+G+D G LAF P+++++ +G+T+ + NN   PH V+FD     S  DA K+S     
Sbjct  31   EVKMGADSGMLAFQPAKVTIKAGDTVKWVNNKLAPHNVVFDS----SVKDADKLS--HKG  84

Query  455  LLNAPGETYSVTLTEKGTYSYY  520
            L  +PGE++ VT  E G Y YY
Sbjct  85   LAFSPGESFEVTFNEPGEYPYY  106



>gb|EAQ74137.1| plastocyanin precursor [Synechococcus sp. WH 5701]
Length=130

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 47/82 (57%), Gaps = 10/82 (12%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXD  454
            EVKLG+D G LAF PSE++++ G+T+ F NN   PH  +FD  E           ++   
Sbjct  43   EVKLGTDAGMLAFEPSEITISKGDTVHFVNNKLAPHNAVFDGHE----------ELSHTT  92

Query  455  LLNAPGETYSVTLTEKGTYSYY  520
            L  APGE++  T  + GTY Y+
Sbjct  93   LAFAPGESWDETFDQAGTYDYW  114



>ref|WP_032514940.1| plastocyanin [Prochlorococcus marinus]
 gb|KGG03762.1| Plastocyanin [Prochlorococcus marinus str. MIT 9314]
Length=116

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 47/82 (57%), Gaps = 10/82 (12%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXD  454
            EVKLG+D G LAF PS +++++G+T+ F NN   PH  +FD  E           ++  D
Sbjct  29   EVKLGTDAGMLAFEPSTVTISAGDTVKFVNNKLAPHNAVFDGHE----------ELSHAD  78

Query  455  LLNAPGETYSVTLTEKGTYSYY  520
            L  APGE++  T    GTY YY
Sbjct  79   LAFAPGESWEETFDTAGTYDYY  100



>ref|WP_029976914.1| plastocyanin [Prochlorococcus sp. scB245a_520K10]
Length=116

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 47/82 (57%), Gaps = 10/82 (12%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXD  454
            EVKLG+D G LAF PS +++++G+T+ F NN   PH  +FD  E           ++  D
Sbjct  29   EVKLGTDAGMLAFEPSTVTISAGDTVKFVNNKLAPHNAVFDGHE----------ELSHAD  78

Query  455  LLNAPGETYSVTLTEKGTYSYY  520
            L  APGE++  T    GTY YY
Sbjct  79   LAFAPGESWEETFDAAGTYDYY  100



>ref|WP_012007398.1| plasmid stabilization protein [Prochlorococcus marinus]
 gb|ABV50278.1| plastocyanin [Prochlorococcus marinus str. MIT 9215]
Length=116

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 47/82 (57%), Gaps = 10/82 (12%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXD  454
            EVKLG+D G LAF PS +++++G+T+ F NN   PH  +FD  E           ++  D
Sbjct  29   EVKLGTDAGMLAFEPSTVTISTGDTVKFVNNKLAPHNAVFDGHE----------ELSHAD  78

Query  455  LLNAPGETYSVTLTEKGTYSYY  520
            L  APGE++  T    GTY YY
Sbjct  79   LAFAPGESWEETFDTAGTYDYY  100



>ref|WP_011818085.1| plasmid stabilization protein [Prochlorococcus marinus]
 gb|ABM69923.1| plastocyanin [Prochlorococcus marinus str. AS9601]
Length=116

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 47/82 (57%), Gaps = 10/82 (12%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXD  454
            EVKLG+D G LAF PS +++++G+T+ F NN   PH  +FD  E           ++  D
Sbjct  29   EVKLGTDAGMLAFEPSTVTISAGDTVKFVNNKLAPHNAVFDGHE----------ELSHAD  78

Query  455  LLNAPGETYSVTLTEKGTYSYY  520
            L  APGE++  T    GTY YY
Sbjct  79   LAFAPGESWGETFDTAGTYDYY  100



>ref|WP_036907020.1| plastocyanin [Prochlorococcus marinus]
Length=116

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 49/82 (60%), Gaps = 10/82 (12%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXD  454
            EVKLG+D G LAF PS L++++G+T+ F NN   PH  +FD ++           ++  D
Sbjct  29   EVKLGTDAGMLAFEPSTLNISAGDTVKFVNNKLAPHNAVFDGND----------DLSHPD  78

Query  455  LLNAPGETYSVTLTEKGTYSYY  520
            L  APGE++  T +  GTY +Y
Sbjct  79   LAFAPGESWERTFSTAGTYDFY  100



>ref|WP_037980572.1| plastocyanin [Synechococcus sp. WH 5701]
Length=110

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 47/82 (57%), Gaps = 10/82 (12%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXD  454
            EVKLG+D G LAF PSE++++ G+T+ F NN   PH  +FD  E           ++   
Sbjct  23   EVKLGTDAGMLAFEPSEITISKGDTVHFVNNKLAPHNAVFDGHE----------ELSHTT  72

Query  455  LLNAPGETYSVTLTEKGTYSYY  520
            L  APGE++  T  + GTY Y+
Sbjct  73   LAFAPGESWDETFDQAGTYDYW  94



>ref|WP_025894221.1| MULTISPECIES: plastocyanin [Prochlorococcus]
 gb|KGF88964.1| Plastocyanin [Prochlorococcus marinus str. GP2]
 gb|KGG07947.1| Plastocyanin [Prochlorococcus marinus str. SB]
Length=116

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 47/82 (57%), Gaps = 10/82 (12%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXD  454
            EVKLG+D G LAF PS +++++G+T+ F NN   PH  +FD  E           ++  D
Sbjct  29   EVKLGTDAGMLAFEPSTVTISAGDTVKFVNNKLAPHNAVFDGHE----------ELSHAD  78

Query  455  LLNAPGETYSVTLTEKGTYSYY  520
            L  APGE++  T    GTY YY
Sbjct  79   LAFAPGESWEETFDTAGTYDYY  100



>ref|WP_032518600.1| plastocyanin [Prochlorococcus marinus]
 gb|KGG04711.1| Plastocyanin [Prochlorococcus marinus str. MIT 9322]
 gb|KGG07396.1| Plastocyanin [Prochlorococcus marinus str. MIT 9401]
Length=116

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 47/82 (57%), Gaps = 10/82 (12%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXD  454
            EVKLG+D G LAF PS +++++G+T+ F NN   PH  +FD  E           ++  D
Sbjct  29   EVKLGTDAGMLAFEPSTVTISAGDTVKFVNNKLAPHNAVFDGHE----------ELSHAD  78

Query  455  LLNAPGETYSVTLTEKGTYSYY  520
            L  APGE++  T    GTY YY
Sbjct  79   LAFAPGESWEETFDTAGTYDYY  100



>gb|ERT07823.1| plastocyanin [Lyngbya aestuarii BL J]
Length=112

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 53/85 (62%), Gaps = 5/85 (6%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXD  454
            EVK+G+++G LAF PS +    G+TI F NN   PH V+FD+ + PS   A+K+S     
Sbjct  14   EVKMGANNGMLAFEPSTIKAKPGDTIDFVNNKLPPHNVVFDKSKSPSSEIASKLS--HEG  71

Query  455  LLNAPGETYSVTLTEK---GTYSYY  520
            LL +PG+ + VT+ E    G+Y +Y
Sbjct  72   LLYSPGQDFKVTIPEDAPTGSYEFY  96



>ref|WP_011823363.1| plasmid stabilization protein [Prochlorococcus marinus]
 gb|ABM75199.1| plastocyanin [Prochlorococcus marinus str. NATL1A]
Length=116

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 49/82 (60%), Gaps = 10/82 (12%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXD  454
            EVKLG+D G LAF PS L++++G+T+ F NN   PH  +FD ++           ++  D
Sbjct  29   EVKLGTDAGMLAFEPSTLNISAGDTVKFVNNKLAPHNAVFDGND----------DLSHPD  78

Query  455  LLNAPGETYSVTLTEKGTYSYY  520
            L  APGE++  T +  GTY +Y
Sbjct  79   LAFAPGESWERTFSTAGTYDFY  100



>ref|WP_025928216.1| plastocyanin [Prochlorococcus sp. scB243_495G23]
Length=116

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 47/82 (57%), Gaps = 10/82 (12%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXD  454
            EVKLG+D G LAF PS +++++G+T+ F NN   PH  +FD  E           ++  D
Sbjct  29   EVKLGTDAGMLAFEPSTVTISAGDTVKFVNNKLAPHNAVFDGHE----------ELSHAD  78

Query  455  LLNAPGETYSVTLTEKGTYSYY  520
            L  APGE++  T    GTY YY
Sbjct  79   LAFAPGESWEETFDTAGTYDYY  100



>ref|WP_032526878.1| plastocyanin [Prochlorococcus marinus]
 gb|KGF97527.1| Plastocyanin [Prochlorococcus marinus str. MIT 9302]
Length=116

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 47/82 (57%), Gaps = 10/82 (12%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXD  454
            EVKLG+D G LAF PS +++++G+T+ F NN   PH  +FD  E           ++  D
Sbjct  29   EVKLGTDAGMLAFEPSTVNISAGDTVKFVNNKLAPHNAVFDGHE----------ELSHAD  78

Query  455  LLNAPGETYSVTLTEKGTYSYY  520
            L  APGE++  T    GTY YY
Sbjct  79   LAFAPGESWEETFDTAGTYDYY  100



>ref|WP_011293551.1| MULTISPECIES: plasmid stabilization protein [Prochlorococcus]
 gb|AAZ57509.1| plastocyanin [Prochlorococcus marinus str. NATL2A]
 gb|AIQ96770.1| Plastocyanin [Prochlorococcus sp. MIT 0801]
Length=116

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 49/82 (60%), Gaps = 10/82 (12%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXD  454
            EVKLG+D G LAF PS L++++G+T+ F NN   PH  +FD ++           ++  D
Sbjct  29   EVKLGTDAGMLAFEPSTLNISAGDTVKFVNNKLAPHNAVFDGND----------DLSHPD  78

Query  455  LLNAPGETYSVTLTEKGTYSYY  520
            L  APGE++  T +  GTY +Y
Sbjct  79   LAFAPGESWERTFSTAGTYDFY  100



>ref|WP_011862597.1| plasmid stabilization protein [Prochlorococcus marinus]
 gb|ABO17230.1| plastocyanin [Prochlorococcus marinus str. MIT 9301]
Length=116

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 47/82 (57%), Gaps = 10/82 (12%)
 Frame = +2

Query  275  EVKLGSDDGGLAFVPSELSVASGETIVFKNNAGFPHXVIFDEDEIPSGVDAAKISMNEXD  454
            EVKLG+D G LAF PS +++++G+T+ F NN   PH  +FD  E           ++  D
Sbjct  29   EVKLGTDAGMLAFEPSTVTISAGDTVKFVNNKLAPHNAVFDGHE----------ELSHAD  78

Query  455  LLNAPGETYSVTLTEKGTYSYY  520
            L  APGE++  T    GTY YY
Sbjct  79   LAFAPGESWEETFDTPGTYDYY  100



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 564104274800