BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002D16

Length=344
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ABC47163.2|  CDPK1                                                   204   3e-60   Ipomoea nil [qian niu]
ref|XP_009786035.1|  PREDICTED: calcium-dependent protein kinase 3      130   5e-33   Nicotiana sylvestris
ref|XP_009620189.1|  PREDICTED: calcium-dependent protein kinase 3      125   2e-31   Nicotiana tomentosiformis
gb|ACH85192.1|  calcium-dependent protein kinase CDPK5                  125   2e-31   Nicotiana tabacum [American tobacco]
ref|XP_006352261.1|  PREDICTED: calcium-dependent protein kinase ...    118   8e-29   Solanum tuberosum [potatoes]
ref|XP_004244622.1|  PREDICTED: calcium-dependent protein kinase 3      116   3e-28   Solanum lycopersicum
ref|XP_010261434.1|  PREDICTED: calcium-dependent protein kinase ...    116   4e-28   Nelumbo nucifera [Indian lotus]
gb|KEH21166.1|  calmodulin-domain kinase CDPK protein                   114   2e-27   Medicago truncatula
emb|CAN61364.1|  hypothetical protein VITISV_032639                     114   3e-27   Vitis vinifera
ref|XP_006849377.1|  hypothetical protein AMTR_s00158p00082100          114   3e-27   Amborella trichopoda
ref|XP_010251583.1|  PREDICTED: calcium-dependent protein kinase ...    114   3e-27   Nelumbo nucifera [Indian lotus]
gb|KDO76377.1|  hypothetical protein CISIN_1g010013mg                   113   4e-27   Citrus sinensis [apfelsine]
gb|KDP25359.1|  hypothetical protein JCGZ_20515                         113   5e-27   Jatropha curcas
gb|KDO76378.1|  hypothetical protein CISIN_1g010013mg                   112   6e-27   Citrus sinensis [apfelsine]
gb|KDO76380.1|  hypothetical protein CISIN_1g010013mg                   112   7e-27   Citrus sinensis [apfelsine]
gb|KDO76376.1|  hypothetical protein CISIN_1g010013mg                   113   8e-27   Citrus sinensis [apfelsine]
ref|XP_006476469.1|  PREDICTED: calcium-dependent protein kinase ...    113   8e-27   Citrus sinensis [apfelsine]
gb|KDO76379.1|  hypothetical protein CISIN_1g010013mg                   112   9e-27   Citrus sinensis [apfelsine]
ref|XP_006439442.1|  hypothetical protein CICLE_v10019724mg             111   1e-26   
ref|XP_006439440.1|  hypothetical protein CICLE_v10019724mg             111   1e-26   
ref|XP_007160124.1|  hypothetical protein PHAVU_002G294500g             112   1e-26   Phaseolus vulgaris [French bean]
ref|XP_006439441.1|  hypothetical protein CICLE_v10019724mg             111   1e-26   
ref|XP_006439443.1|  hypothetical protein CICLE_v10019724mg             112   1e-26   Citrus clementina [clementine]
ref|XP_003525360.1|  PREDICTED: calcium-dependent protein kinase ...    112   2e-26   Glycine max [soybeans]
gb|AGS15000.1|  calcium-dependent protein kinase 3                      112   2e-26   Vitis amurensis
ref|XP_002272270.1|  PREDICTED: calcium-dependent protein kinase 3      112   2e-26   Vitis vinifera
ref|XP_002298000.1|  calcium-dependent protein kinase 1                 111   3e-26   Populus trichocarpa [western balsam poplar]
gb|KJB52213.1|  hypothetical protein B456_008G251000                    110   6e-26   Gossypium raimondii
ref|XP_007040388.1|  Calcium-dependent protein kinase 6 isoform 2       110   7e-26   
ref|XP_003517491.2|  PREDICTED: calcium-dependent protein kinase ...    110   9e-26   
ref|XP_007040387.1|  Calcium-dependent protein kinase 6 isoform 1       110   1e-25   
ref|NP_001169721.1|  uncharacterized LOC100383602                       110   1e-25   Zea mays [maize]
gb|KHG11508.1|  Calcium-dependent protein kinase 3                      110   1e-25   Gossypium arboreum [tree cotton]
gb|AIU98505.1|  calcium-dependent protein kinase                        109   1e-25   Musa acuminata AAA Group [Cavendish banana]
ref|XP_010676387.1|  PREDICTED: calcium-dependent protein kinase 3      109   1e-25   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010106587.1|  Calcium-dependent protein kinase 3                 110   1e-25   
ref|XP_009386326.1|  PREDICTED: calcium-dependent protein kinase ...    109   1e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004511540.1|  PREDICTED: calcium-dependent protein kinase ...    109   1e-25   Cicer arietinum [garbanzo]
ref|XP_004503656.1|  PREDICTED: calcium-dependent protein kinase ...    108   3e-25   Cicer arietinum [garbanzo]
ref|XP_002304529.2|  hypothetical protein POPTR_0003s13380g             108   4e-25   
ref|XP_006655639.1|  PREDICTED: calcium-dependent protein kinase ...    107   5e-25   
ref|XP_004969206.1|  PREDICTED: calcium-dependent protein kinase ...    108   5e-25   Setaria italica
ref|XP_002509886.1|  calcium-dependent protein kinase, putative         107   7e-25   Ricinus communis
ref|XP_010055801.1|  PREDICTED: calcium-dependent protein kinase 3      108   7e-25   Eucalyptus grandis [rose gum]
ref|XP_003538256.1|  PREDICTED: calcium-dependent protein kinase ...    107   7e-25   Glycine max [soybeans]
ref|NP_001152509.1|  calcium-dependent protein kinase, isoform 2        107   8e-25   Zea mays [maize]
ref|XP_011073451.1|  PREDICTED: calcium-dependent protein kinase ...    107   1e-24   Sesamum indicum [beniseed]
gb|KJB19075.1|  hypothetical protein B456_003G084000                    106   1e-24   Gossypium raimondii
gb|AFW83320.1|  putative calcium-dependent protein kinase family ...    105   2e-24   
ref|XP_009416404.1|  PREDICTED: calcium-dependent protein kinase ...    106   3e-24   Musa acuminata subsp. malaccensis [pisang utan]
gb|AIU98501.1|  calcium-dependent protein kinase                        106   3e-24   Musa acuminata AAA Group [Cavendish banana]
gb|KHN16772.1|  Calcium-dependent protein kinase 3                      101   4e-24   Glycine soja [wild soybean]
ref|XP_011022588.1|  PREDICTED: calcium-dependent protein kinase ...    105   4e-24   Populus euphratica
gb|KHG03431.1|  Calcium-dependent protein kinase 3                      106   4e-24   Gossypium arboreum [tree cotton]
ref|XP_003569386.1|  PREDICTED: calcium-dependent protein kinase ...    105   5e-24   Brachypodium distachyon [annual false brome]
gb|EEC71113.1|  hypothetical protein OsI_02910                          105   5e-24   Oryza sativa Indica Group [Indian rice]
gb|EAZ12734.1|  hypothetical protein OsJ_02652                          105   5e-24   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ95679.1|  predicted protein                                      105   6e-24   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABY59010.1|  calcium-dependent protein kinase                        105   6e-24   Triticum aestivum [Canadian hard winter wheat]
emb|CAF18446.1|  putative calcium-dependent protein kinase              105   6e-24   Triticum aestivum [Canadian hard winter wheat]
gb|ACA63885.1|  calcium-dependent protein kinase                        105   7e-24   Hordeum vulgare [barley]
ref|XP_011026960.1|  PREDICTED: calcium-dependent protein kinase 3      105   7e-24   Populus euphratica
ref|XP_007209903.1|  hypothetical protein PRUPE_ppa004162mg             104   9e-24   Prunus persica
ref|XP_010529626.1|  PREDICTED: calcium-dependent protein kinase ...    104   1e-23   Tarenaya hassleriana [spider flower]
ref|XP_004961071.1|  PREDICTED: calcium-dependent protein kinase ...    103   2e-23   Setaria italica
ref|NP_001056455.1|  Os05g0585500                                       103   3e-23   
gb|KJB39672.1|  hypothetical protein B456_007G025000                    102   3e-23   Gossypium raimondii
ref|XP_006283520.1|  hypothetical protein CARUB_v10004572mg             103   3e-23   Capsella rubella
gb|KHG14847.1|  Calcium-dependent protein kinase 3                      103   3e-23   Gossypium arboreum [tree cotton]
gb|KJB39669.1|  hypothetical protein B456_007G025000                    102   3e-23   Gossypium raimondii
ref|XP_008656081.1|  PREDICTED: calcium-dependent protein kinase ...    103   3e-23   Zea mays [maize]
ref|XP_008792394.1|  PREDICTED: calcium-dependent protein kinase ...    103   3e-23   Phoenix dactylifera
gb|EYU40050.1|  hypothetical protein MIMGU_mgv1a011511mg                100   3e-23   Erythranthe guttata [common monkey flower]
gb|KJB39670.1|  hypothetical protein B456_007G025000                    102   5e-23   Gossypium raimondii
ref|XP_004298849.1|  PREDICTED: calcium-dependent protein kinase 3      102   6e-23   Fragaria vesca subsp. vesca
ref|XP_002455974.1|  hypothetical protein SORBIDRAFT_03g028340          102   7e-23   Sorghum bicolor [broomcorn]
gb|KJB39673.1|  hypothetical protein B456_007G025000                    102   7e-23   Gossypium raimondii
ref|XP_009334485.1|  PREDICTED: calcium-dependent protein kinase 3      102   9e-23   Pyrus x bretschneideri [bai li]
ref|XP_008451994.1|  PREDICTED: calcium-dependent protein kinase 3      102   9e-23   Cucumis melo [Oriental melon]
ref|XP_010433881.1|  PREDICTED: calcium-dependent protein kinase ...    102   1e-22   Camelina sativa [gold-of-pleasure]
ref|XP_010439150.1|  PREDICTED: calcium-dependent protein kinase ...    102   1e-22   Camelina sativa [gold-of-pleasure]
ref|XP_010509303.1|  PREDICTED: calcium-dependent protein kinase 3      101   1e-22   Camelina sativa [gold-of-pleasure]
dbj|BAD61167.1|  putative calcium-dependent protein kinase              102   1e-22   Oryza sativa Japonica Group [Japonica rice]
gb|AAL38596.1|AF446863_1  AT4g23650/F9D16_120                           101   1e-22   Arabidopsis thaliana [mouse-ear cress]
ref|NP_194096.1|  calcium-dependent protein kinase 6                    101   1e-22   Arabidopsis thaliana [mouse-ear cress]
gb|AFW81269.1|  putative calcium-dependent protein kinase family ...    100   2e-22   
ref|XP_010541306.1|  PREDICTED: calcium-dependent protein kinase 3      100   3e-22   Tarenaya hassleriana [spider flower]
gb|KFK28919.1|  hypothetical protein AALP_AA7G065000                    100   3e-22   Arabis alpina [alpine rockcress]
ref|XP_010673770.1|  PREDICTED: calcium-dependent protein kinase ...    100   3e-22   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010924783.1|  PREDICTED: calcium-dependent protein kinase ...    100   3e-22   Elaeis guineensis
ref|XP_010924782.1|  PREDICTED: calcium-dependent protein kinase ...    100   4e-22   Elaeis guineensis
ref|XP_002867697.1|  calcium-dependent protein kinase 6                 100   4e-22   
ref|XP_007158545.1|  hypothetical protein PHAVU_002G161200g           99.8    5e-22   Phaseolus vulgaris [French bean]
dbj|BAJ94561.1|  predicted protein                                    99.4    8e-22   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY62741.1|  BnaC07g50270D                                        99.4    1e-21   Brassica napus [oilseed rape]
ref|XP_009414363.1|  PREDICTED: calcium-dependent protein kinase 17   99.0    1e-21   
ref|XP_009137374.1|  PREDICTED: calcium-dependent protein kinase ...  99.0    1e-21   Brassica rapa
gb|AHN16201.1|  CPK3-2.1                                              98.6    2e-21   Brassica napus [oilseed rape]
emb|CDY54853.1|  BnaC01g15460D                                        98.6    2e-21   Brassica napus [oilseed rape]
ref|XP_006413532.1|  hypothetical protein EUTSA_v10024899mg           98.6    2e-21   Eutrema salsugineum [saltwater cress]
ref|XP_002441592.1|  hypothetical protein SORBIDRAFT_09g029950        98.2    2e-21   Sorghum bicolor [broomcorn]
ref|XP_004980140.1|  PREDICTED: calcium-dependent protein kinase ...  98.2    2e-21   Setaria italica
ref|XP_004978350.1|  PREDICTED: calcium-dependent protein kinase ...  98.2    3e-21   
gb|EPS70504.1|  calcium dependent protein kinase 25                   97.4    5e-21   Genlisea aurea
ref|NP_001267714.1|  calcium-dependent protein kinase 3-like          97.1    5e-21   Cucumis sativus [cucumbers]
gb|KGN53365.1|  hypothetical protein Csa_4G050200                     97.1    6e-21   Cucumis sativus [cucumbers]
ref|XP_008671573.1|  PREDICTED: calcium-dependent protein kinase ...  96.7    9e-21   Zea mays [maize]
ref|XP_009627412.1|  PREDICTED: calcium-dependent protein kinase ...  96.3    1e-20   Nicotiana tomentosiformis
ref|XP_009773532.1|  PREDICTED: calcium-dependent protein kinase ...  96.3    1e-20   Nicotiana sylvestris
ref|XP_004228884.1|  PREDICTED: calcium-dependent protein kinase ...  95.9    2e-20   Solanum lycopersicum
ref|XP_009419685.1|  PREDICTED: calcium-dependent protein kinase ...  95.9    2e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008788593.1|  PREDICTED: calcium-dependent protein kinase ...  95.9    2e-20   Phoenix dactylifera
ref|XP_004293141.1|  PREDICTED: calcium-dependent protein kinase 34   95.9    2e-20   Fragaria vesca subsp. vesca
ref|XP_009402456.1|  PREDICTED: calcium-dependent protein kinase ...  95.5    2e-20   
ref|XP_011080890.1|  PREDICTED: calcium-dependent protein kinase 3    95.1    2e-20   Sesamum indicum [beniseed]
ref|XP_011080420.1|  PREDICTED: calcium-dependent protein kinase ...  95.5    2e-20   Sesamum indicum [beniseed]
ref|XP_002526062.1|  calcium-dependent protein kinase, putative       95.5    3e-20   Ricinus communis
ref|XP_008449648.1|  PREDICTED: calcium-dependent protein kinase ...  95.1    3e-20   Cucumis melo [Oriental melon]
ref|XP_006349794.1|  PREDICTED: calcium-dependent protein kinase ...  94.7    3e-20   
gb|KJB59358.1|  hypothetical protein B456_009G251300                  90.5    3e-20   Gossypium raimondii
ref|XP_009412989.1|  PREDICTED: calcium-dependent protein kinase ...  95.1    3e-20   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB21813.1|  hypothetical protein B456_004G015100                  95.1    3e-20   Gossypium raimondii
gb|EPS59027.1|  hypothetical protein M569_15783                       94.0    3e-20   Genlisea aurea
ref|XP_002448943.1|  hypothetical protein SORBIDRAFT_05g002110        95.1    4e-20   Sorghum bicolor [broomcorn]
ref|XP_009789543.1|  PREDICTED: calcium-dependent protein kinase ...  94.7    4e-20   Nicotiana sylvestris
ref|XP_006664312.1|  PREDICTED: calcium-dependent protein kinase ...  94.4    4e-20   
ref|XP_009603797.1|  PREDICTED: calcium-dependent protein kinase ...  94.7    4e-20   Nicotiana tomentosiformis
ref|XP_004252886.1|  PREDICTED: calcium-dependent protein kinase ...  94.7    4e-20   Solanum lycopersicum
ref|XP_010099802.1|  Calcium-dependent protein kinase 17              94.7    4e-20   Morus notabilis
ref|XP_008365176.1|  PREDICTED: calcium-dependent protein kinase ...  94.7    5e-20   
ref|XP_004140192.1|  PREDICTED: calcium-dependent protein kinase ...  94.7    5e-20   Cucumis sativus [cucumbers]
ref|XP_010106395.1|  Calcium-dependent protein kinase 17              94.4    6e-20   Morus notabilis
gb|EYU46187.1|  hypothetical protein MIMGU_mgv1a004352mg              94.4    6e-20   Erythranthe guttata [common monkey flower]
ref|XP_009137281.1|  PREDICTED: calcium-dependent protein kinase ...  94.4    6e-20   Brassica rapa
ref|XP_003567831.1|  PREDICTED: calcium-dependent protein kinase ...  94.4    6e-20   Brachypodium distachyon [annual false brome]
emb|CDY44125.1|  BnaA01g13330D                                        94.0    7e-20   Brassica napus [oilseed rape]
gb|AGG35973.1|  calcium-dependent protein kinase 3                    94.0    7e-20   Brassica napus [oilseed rape]
tpg|DAA58514.1|  TPA: putative calcium-dependent protein kinase f...  93.6    7e-20   
gb|EAY79844.1|  hypothetical protein OsI_35004                        91.7    7e-20   Oryza sativa Indica Group [Indian rice]
ref|NP_001266856.1|  calcium-dependent protein kinase                 94.4    7e-20   Zea mays [maize]
emb|CBX25242.1|  hypothetical_protein                                 94.0    8e-20   Oryza brachyantha
ref|XP_010922091.1|  PREDICTED: calcium-dependent protein kinase ...  94.0    8e-20   Elaeis guineensis
gb|AFW64738.1|  putative calcium-dependent protein kinase family ...  94.4    8e-20   
ref|XP_006361005.1|  PREDICTED: calcium-dependent protein kinase ...  94.0    8e-20   Solanum tuberosum [potatoes]
gb|EEC67625.1|  hypothetical protein OsI_35012                        92.4    9e-20   Oryza sativa Indica Group [Indian rice]
ref|XP_009385897.1|  PREDICTED: calcium-dependent protein kinase ...  93.6    9e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003576346.1|  PREDICTED: calcium-dependent protein kinase ...  93.6    1e-19   Brachypodium distachyon [annual false brome]
ref|XP_006845045.1|  hypothetical protein AMTR_s00269p00011940        93.6    1e-19   Amborella trichopoda
ref|XP_006662719.1|  PREDICTED: calcium-dependent protein kinase ...  93.2    1e-19   Oryza brachyantha
emb|CBX25340.1|  hypothetical_protein                                 93.2    1e-19   Oryza brachyantha
ref|XP_004513232.1|  PREDICTED: calcium-dependent protein kinase ...  93.2    1e-19   
ref|XP_009368734.1|  PREDICTED: calcium-dependent protein kinase ...  93.2    2e-19   Pyrus x bretschneideri [bai li]
gb|EAZ17352.1|  hypothetical protein OsJ_32875                        92.8    2e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010904692.1|  PREDICTED: calcium-dependent protein kinase ...  92.8    2e-19   Elaeis guineensis
ref|XP_003622837.1|  Calcium dependent protein kinase                 92.8    2e-19   
dbj|BAA81749.1|  calcium-dependent protein kinase                     92.8    2e-19   Marchantia polymorpha
dbj|BAA81748.1|  calcium-dependent protein kinase                     92.8    2e-19   Marchantia polymorpha
gb|ABA95733.1|  Calcium-dependent protein kinase, isoform 2, puta...  92.8    2e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010247475.1|  PREDICTED: calcium-dependent protein kinase 34   92.4    2e-19   Nelumbo nucifera [Indian lotus]
ref|XP_008786936.1|  PREDICTED: calcium-dependent protein kinase ...  92.4    2e-19   Phoenix dactylifera
dbj|BAK06838.1|  predicted protein                                    92.8    2e-19   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002442700.1|  hypothetical protein SORBIDRAFT_08g001380        92.8    3e-19   Sorghum bicolor [broomcorn]
ref|NP_001065691.1|  Os11g0136600                                     92.4    3e-19   
ref|NP_001176777.1|  Os12g0133500                                     92.4    3e-19   
ref|XP_008802050.1|  PREDICTED: calcium-dependent protein kinase ...  92.4    3e-19   Phoenix dactylifera
gb|KEH27423.1|  calmodulin-domain kinase CDPK protein                 91.3    3e-19   Medicago truncatula
ref|XP_009630031.1|  PREDICTED: calcium-dependent protein kinase ...  92.0    3e-19   Nicotiana tomentosiformis
gb|AAZ76712.1|  calcium-dependent protein kinase 1                    92.0    4e-19   Petunia integrifolia subsp. inflata
ref|XP_009796949.1|  PREDICTED: calcium-dependent protein kinase ...  92.0    4e-19   Nicotiana sylvestris
ref|XP_003611046.1|  Calcium dependent protein kinase                 92.0    4e-19   Medicago truncatula
gb|ADE76782.1|  unknown                                               89.4    4e-19   Picea sitchensis
gb|KJB83565.1|  hypothetical protein B456_013G253100                  91.7    5e-19   Gossypium raimondii
gb|KDO36585.1|  hypothetical protein CISIN_1g042977mg                 91.3    5e-19   Citrus sinensis [apfelsine]
ref|XP_008227265.1|  PREDICTED: calcium-dependent protein kinase ...  91.7    5e-19   Prunus mume [ume]
ref|XP_010536137.1|  PREDICTED: calcium-dependent protein kinase 17   91.7    5e-19   Tarenaya hassleriana [spider flower]
ref|XP_007213195.1|  hypothetical protein PRUPE_ppa026653mg           91.7    5e-19   Prunus persica
emb|CAG27840.1|  calcium-dependent protein kinase 17                  91.7    6e-19   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
gb|KDP43197.1|  hypothetical protein JCGZ_22749                       91.7    6e-19   Jatropha curcas
ref|XP_003617233.1|  Calcium dependent protein kinase                 91.7    6e-19   Medicago truncatula
ref|XP_006356386.1|  PREDICTED: calcium-dependent protein kinase ...  91.7    6e-19   Solanum tuberosum [potatoes]
ref|XP_006470577.1|  PREDICTED: calcium-dependent protein kinase ...  91.7    6e-19   Citrus sinensis [apfelsine]
ref|XP_006446309.1|  hypothetical protein CICLE_v10014854mg           91.3    6e-19   Citrus clementina [clementine]
ref|XP_003545165.1|  PREDICTED: calcium-dependent protein kinase ...  91.3    6e-19   Glycine max [soybeans]
emb|CDP20327.1|  unnamed protein product                              91.3    6e-19   Coffea canephora [robusta coffee]
ref|XP_004250895.1|  PREDICTED: calcium-dependent protein kinase ...  91.3    7e-19   Solanum lycopersicum
ref|XP_007141507.1|  hypothetical protein PHAVU_008G201900g           90.9    8e-19   Phaseolus vulgaris [French bean]
gb|AFW84809.1|  putative calcium-dependent protein kinase family ...  90.5    9e-19   
gb|AFW82380.1|  putative calcium-dependent protein kinase family ...  87.8    1e-18   
gb|KJB09335.1|  hypothetical protein B456_001G135000                  90.5    1e-18   Gossypium raimondii
tpg|DAA57188.1|  TPA: putative calcium-dependent protein kinase f...  90.5    1e-18   
ref|XP_001771902.1|  predicted protein                                90.5    1e-18   
ref|XP_008674922.1|  PREDICTED: calcium-dependent protein kinase 34   90.5    1e-18   Zea mays [maize]
ref|XP_009406794.1|  PREDICTED: calcium-dependent protein kinase ...  90.1    1e-18   
gb|KHN28162.1|  Calcium-dependent protein kinase 17                   90.1    1e-18   Glycine soja [wild soybean]
ref|XP_010031714.1|  PREDICTED: calcium-dependent protein kinase ...  90.5    1e-18   Eucalyptus grandis [rose gum]
ref|XP_008657141.1|  PREDICTED: calcium-dependent protein kinase ...  90.5    1e-18   Zea mays [maize]
gb|EYU35947.1|  hypothetical protein MIMGU_mgv1a004350mg              90.5    1e-18   Erythranthe guttata [common monkey flower]
ref|XP_007015253.1|  Calcium-dependent protein kinase 17              90.5    1e-18   Theobroma cacao [chocolate]
ref|XP_003528592.1|  PREDICTED: calcium-dependent protein kinase ...  90.5    2e-18   Glycine max [soybeans]
ref|XP_006644382.1|  PREDICTED: calcium-dependent protein kinase ...  89.7    2e-18   Oryza brachyantha
ref|XP_003578964.1|  PREDICTED: calcium-dependent protein kinase ...  90.5    2e-18   Brachypodium distachyon [annual false brome]
gb|KHN23929.1|  Calcium-dependent protein kinase 17                   89.7    2e-18   Glycine soja [wild soybean]
ref|XP_003556786.1|  PREDICTED: calcium-dependent protein kinase ...  90.1    2e-18   Glycine max [soybeans]
ref|XP_008798404.1|  PREDICTED: calcium-dependent protein kinase ...  89.7    2e-18   Phoenix dactylifera
ref|XP_004491231.1|  PREDICTED: calcium-dependent protein kinase ...  89.7    3e-18   Cicer arietinum [garbanzo]
ref|XP_002441304.1|  hypothetical protein SORBIDRAFT_09g024100        89.7    3e-18   Sorghum bicolor [broomcorn]
gb|EYU23402.1|  hypothetical protein MIMGU_mgv1a004683mg              89.4    3e-18   Erythranthe guttata [common monkey flower]
gb|EPS65220.1|  hypothetical protein M569_09555                       89.0    3e-18   Genlisea aurea
ref|XP_010519814.1|  PREDICTED: calcium-dependent protein kinase ...  89.4    4e-18   Tarenaya hassleriana [spider flower]
ref|XP_001781985.1|  predicted protein                                89.0    4e-18   
ref|XP_010519813.1|  PREDICTED: calcium-dependent protein kinase ...  89.4    4e-18   Tarenaya hassleriana [spider flower]
emb|CAD70166.1|  putative calcium-dependent protein kinase            85.9    4e-18   Landoltia punctata
gb|ABV22575.1|  calcium-dependent protein kinase                      89.4    4e-18   Physcomitrella patens
ref|XP_011024983.1|  PREDICTED: calcium-dependent protein kinase 17   89.0    5e-18   Populus euphratica
ref|XP_009120894.1|  PREDICTED: calcium-dependent protein kinase 34   89.0    5e-18   Brassica rapa
emb|CDY13993.1|  BnaC09g38330D                                        89.0    5e-18   Brassica napus [oilseed rape]
ref|XP_002299975.2|  hypothetical protein POPTR_0001s28150g           89.0    5e-18   
ref|XP_009404695.1|  PREDICTED: calcium-dependent protein kinase ...  89.0    5e-18   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAK06618.1|  predicted protein                                    89.0    5e-18   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KHN38392.1|  Calcium-dependent protein kinase 17                   89.0    5e-18   Glycine soja [wild soybean]
ref|NP_001044575.1|  Os01g0808400                                     88.6    5e-18   
gb|EAY76207.1|  hypothetical protein OsI_04143                        88.6    5e-18   Oryza sativa Indica Group [Indian rice]
ref|XP_006575622.1|  PREDICTED: calcium-dependent protein kinase ...  88.6    6e-18   Glycine max [soybeans]
gb|ABV22565.1|  calcium-dependent protein kinase                      88.6    6e-18   Physcomitrella patens
gb|KHN12036.1|  Calcium-dependent protein kinase 17                   89.0    6e-18   Glycine soja [wild soybean]
gb|AGT15898.1|  calcium-dependent protein kinase                      88.6    6e-18   Saccharum hybrid cultivar R570
gb|KJB55472.1|  hypothetical protein B456_009G078000                  88.6    7e-18   Gossypium raimondii
gb|AGT16545.1|  calcium-dependent protein kinase 34                   88.6    7e-18   Saccharum hybrid cultivar R570
gb|AGT17376.1|  calcium-dependent protein kinase                      88.6    7e-18   Saccharum hybrid cultivar R570
gb|AGT17455.1|  hypothetical protein SHCRBa_258_F08_F_40              88.6    7e-18   Saccharum hybrid cultivar R570
ref|XP_010419806.1|  PREDICTED: calcium-dependent protein kinase ...  88.6    7e-18   Camelina sativa [gold-of-pleasure]
ref|XP_010419805.1|  PREDICTED: calcium-dependent protein kinase ...  88.6    7e-18   
ref|XP_010453282.1|  PREDICTED: calcium-dependent protein kinase 17   88.6    7e-18   Camelina sativa [gold-of-pleasure]
ref|XP_006289327.1|  hypothetical protein CARUB_v10002812mg           88.6    8e-18   Capsella rubella
ref|XP_004961659.1|  PREDICTED: calcium-dependent protein kinase ...  88.6    8e-18   
ref|XP_003564438.1|  PREDICTED: calcium-dependent protein kinase 34   88.2    8e-18   Brachypodium distachyon [annual false brome]
ref|XP_010269425.1|  PREDICTED: calcium-dependent protein kinase ...  88.2    8e-18   Nelumbo nucifera [Indian lotus]
ref|XP_010269424.1|  PREDICTED: calcium-dependent protein kinase ...  88.2    8e-18   Nelumbo nucifera [Indian lotus]
ref|XP_006644875.1|  PREDICTED: calcium-dependent protein kinase ...  88.2    9e-18   Oryza brachyantha
ref|XP_007146136.1|  hypothetical protein PHAVU_006G015300g           88.2    9e-18   Phaseolus vulgaris [French bean]
emb|CDX70450.1|  BnaC03g05340D                                        88.2    9e-18   
ref|XP_009121874.1|  PREDICTED: calcium-dependent protein kinase 17   88.2    9e-18   Brassica rapa
ref|XP_009125853.1|  PREDICTED: calcium-dependent protein kinase ...  88.2    9e-18   Brassica rapa
emb|CDX97174.1|  BnaC09g44510D                                        88.2    9e-18   
ref|XP_011014420.1|  PREDICTED: calcium-dependent protein kinase ...  88.2    9e-18   Populus euphratica
ref|XP_002313265.1|  calcium-dependent protein kinase                 88.2    9e-18   Populus trichocarpa [western balsam poplar]
ref|XP_011009111.1|  PREDICTED: calcium-dependent protein kinase ...  87.8    1e-17   Populus euphratica
ref|XP_002276630.2|  PREDICTED: calcium-dependent protein kinase ...  87.8    1e-17   Vitis vinifera
gb|AFW82381.1|  putative calcium-dependent protein kinase family ...  87.8    1e-17   
gb|EMT23982.1|  Calcium-dependent protein kinase 17                   87.8    1e-17   
gb|AAT69647.1|  hypothetical protein                                  87.4    2e-17   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002871516.1|  calcium-dependent protein kinase 17              87.4    2e-17   
gb|EEE64198.1|  hypothetical protein OsJ_19030                        87.4    2e-17   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001055912.1|  Os05g0491900                                     87.4    2e-17   
ref|XP_002873943.1|  calcium-dependent protein kinase 34              87.4    2e-17   Arabidopsis lyrata subsp. lyrata
ref|XP_006655439.1|  PREDICTED: calcium-dependent protein kinase ...  87.0    2e-17   
ref|XP_006399734.1|  hypothetical protein EUTSA_v10013236mg           87.0    2e-17   Eutrema salsugineum [saltwater cress]
gb|AGG35954.1|  calcium-dependent protein kinase 34                   87.0    2e-17   Brassica napus [oilseed rape]
ref|XP_009131258.1|  PREDICTED: calcium-dependent protein kinase ...  87.0    2e-17   Brassica rapa
emb|CDX78468.1|  BnaA03g03800D                                        87.0    2e-17   
gb|AHG06449.1|  calcium-dependent protein kinase 17                   87.0    2e-17   Brassica napus [oilseed rape]
emb|CDY63783.1|  BnaCnng42690D                                        87.0    2e-17   Brassica napus [oilseed rape]
ref|XP_006289743.1|  hypothetical protein CARUB_v10003311mg           87.0    2e-17   Capsella rubella
gb|KFK25494.1|  hypothetical protein AALP_AA8G122000                  87.0    3e-17   Arabis alpina [alpine rockcress]
emb|CDY44912.1|  BnaA02g04170D                                        86.7    3e-17   Brassica napus [oilseed rape]
ref|XP_009126355.1|  PREDICTED: calcium-dependent protein kinase 34   86.7    3e-17   Brassica rapa
ref|XP_010420737.1|  PREDICTED: calcium-dependent protein kinase ...  86.7    3e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010454209.1|  PREDICTED: calcium-dependent protein kinase 34   86.7    3e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010492994.1|  PREDICTED: calcium-dependent protein kinase ...  86.7    3e-17   Camelina sativa [gold-of-pleasure]
gb|KJB35709.1|  hypothetical protein B456_006G124800                  86.7    3e-17   Gossypium raimondii
gb|AAL59948.1|  putative calcium-dependent protein kinase             86.7    3e-17   Arabidopsis thaliana [mouse-ear cress]
emb|CAN62888.1|  hypothetical protein VITISV_025544                   86.7    3e-17   Vitis vinifera
ref|NP_196779.1|  calcium-dependent protein kinase 17                 86.3    4e-17   Arabidopsis thaliana [mouse-ear cress]
ref|NP_197437.1|  calcium-dependent protein kinase 34                 86.3    4e-17   Arabidopsis thaliana [mouse-ear cress]
gb|KFK26202.1|  hypothetical protein AALP_AA8G215800                  85.9    5e-17   Arabis alpina [alpine rockcress]
gb|EEC79448.1|  hypothetical protein OsI_20437                        85.9    6e-17   Oryza sativa Indica Group [Indian rice]
ref|XP_006400491.1|  hypothetical protein EUTSA_v10013240mg           85.9    6e-17   Eutrema salsugineum [saltwater cress]
gb|KJB59359.1|  hypothetical protein B456_009G251300                  81.3    7e-17   Gossypium raimondii
gb|ABY59018.1|  calcium-dependent protein kinase                      85.5    8e-17   Triticum aestivum [Canadian hard winter wheat]
dbj|BAK07881.1|  predicted protein                                    85.1    1e-16   
ref|XP_003568203.1|  PREDICTED: calcium-dependent protein kinase ...  84.7    1e-16   
gb|EMS56466.1|  Calcium-dependent protein kinase 34                   84.0    3e-16   
gb|AAA61682.1|  calcium-dependent protein kinase                      83.6    3e-16   
ref|XP_001768980.1|  predicted protein                                83.6    3e-16   
gb|EMT22025.1|  Calcium-dependent protein kinase 3                    83.2    4e-16   
ref|XP_001767768.1|  cpk1 calcium-dependent protein kinase            83.6    4e-16   
gb|ABV22562.1|  calcium-dependent protein kinase                      83.6    5e-16   
gb|KDO62721.1|  hypothetical protein CISIN_1g0096582mg                78.6    3e-15   
gb|KDO62718.1|  hypothetical protein CISIN_1g0096582mg                78.2    4e-15   
ref|XP_002971737.1|  calcium-dependent protein kinase 17              80.1    6e-15   
ref|XP_008804309.1|  PREDICTED: calcium-dependent protein kinase ...  80.1    7e-15   
ref|XP_008806408.1|  PREDICTED: calcium-dependent protein kinase 2    80.1    7e-15   
ref|XP_002991556.1|  calcium dependent protein kinase 34              79.7    7e-15   
ref|XP_002499897.1|  predicted protein                                79.3    9e-15   
gb|EMT05629.1|  Calcium-dependent protein kinase 34                   79.3    1e-14   
ref|XP_002979552.1|  calcium dependent protein kinase 17              79.3    1e-14   
ref|XP_002977722.1|  calcium dependent protein kinase 17              79.3    1e-14   
ref|XP_009388872.1|  PREDICTED: calcium-dependent protein kinase ...  79.0    2e-14   
ref|XP_010266895.1|  PREDICTED: calcium-dependent protein kinase ...  79.0    2e-14   
ref|XP_003055256.1|  predicted protein                                78.6    2e-14   
ref|XP_010266896.1|  PREDICTED: calcium-dependent protein kinase ...  78.6    2e-14   
ref|XP_006452370.1|  hypothetical protein CICLE_v10007983mg           78.2    3e-14   
ref|XP_009414250.1|  PREDICTED: calcium-dependent protein kinase ...  77.4    3e-14   
ref|XP_002456506.1|  hypothetical protein SORBIDRAFT_03g037570        77.8    3e-14   
ref|XP_010276092.1|  PREDICTED: calcium-dependent protein kinase ...  78.2    3e-14   
ref|XP_006657761.1|  PREDICTED: calcium-dependent protein kinase ...  78.2    3e-14   
ref|XP_006827112.1|  hypothetical protein AMTR_s00010p00245350        78.2    3e-14   
ref|XP_006475136.1|  PREDICTED: calcium-dependent protein kinase ...  78.6    3e-14   
ref|XP_006452371.1|  hypothetical protein CICLE_v10007983mg           78.2    3e-14   
gb|AAD17800.1|  Ca2+-dependent protein kinase                         77.8    4e-14   
gb|KCW68005.1|  hypothetical protein EUGRSUZ_F01694                   77.4    4e-14   
gb|KCW68004.1|  hypothetical protein EUGRSUZ_F01694                   77.0    4e-14   
ref|XP_006657762.1|  PREDICTED: calcium-dependent protein kinase ...  77.4    5e-14   
ref|XP_010929942.1|  PREDICTED: calcium-dependent protein kinase ...  77.8    5e-14   
ref|XP_006828852.1|  hypothetical protein AMTR_s00001p00158780        77.4    6e-14   
ref|XP_001768977.1|  predicted protein                                77.4    6e-14   
gb|KCW67039.1|  hypothetical protein EUGRSUZ_F00807                   77.0    6e-14   
gb|ABV22560.1|  calcium-dependent protein kinase                      77.4    6e-14   
ref|XP_004152931.1|  PREDICTED: calcium-dependent protein kinase-...  77.0    6e-14   
ref|XP_011090473.1|  PREDICTED: calcium-dependent protein kinase ...  77.0    7e-14   
ref|XP_007510931.1|  predicted protein                                77.0    7e-14   
gb|EMT33574.1|  Calcium-dependent protein kinase 34                   76.6    8e-14   
ref|XP_010061106.1|  PREDICTED: calcium-dependent protein kinase ...  77.0    8e-14   
emb|CDM84631.1|  unnamed protein product                              76.6    8e-14   
ref|XP_010060380.1|  PREDICTED: calcium-dependent protein kinase ...  77.0    9e-14   
ref|XP_002891589.1|  calcium-dependent protein kinase 33              76.6    9e-14   
ref|XP_009604147.1|  PREDICTED: calcium-dependent protein kinase ...  76.6    1e-13   
emb|CDX85697.1|  BnaA02g01160D                                        76.6    1e-13   
ref|XP_010092160.1|  Calcium-dependent protein kinase 9               76.6    1e-13   
emb|CDX91168.1|  BnaC02g04290D                                        76.3    1e-13   
ref|XP_009798561.1|  PREDICTED: calcium-dependent protein kinase ...  76.3    1e-13   
gb|AFR11230.1|  calcium dependent protein kinase 1                    76.3    2e-13   
ref|XP_007213894.1|  hypothetical protein PRUPE_ppa003830mg           76.3    2e-13   
ref|XP_008349938.1|  PREDICTED: LOW QUALITY PROTEIN: calcium-depe...  75.9    2e-13   
ref|XP_001782248.1|  predicted protein                                75.9    2e-13   
ref|NP_001105542.1|  calcium-dependent protein kinase 2               75.9    2e-13   
ref|NP_175485.1|  calcium-dependent protein kinase 33                 75.9    2e-13   
ref|XP_008226901.1|  PREDICTED: calcium-dependent protein kinase 2    75.9    2e-13   
gb|AGT17166.1|  calcium-dependent protein kinase                      75.5    2e-13   
ref|XP_008385882.1|  PREDICTED: LOW QUALITY PROTEIN: calcium-depe...  75.1    3e-13   
ref|XP_010278695.1|  PREDICTED: calcium-dependent protein kinase ...  75.5    3e-13   
gb|KCW75310.1|  hypothetical protein EUGRSUZ_E04057                   75.5    3e-13   
ref|XP_010057925.1|  PREDICTED: calcium-dependent protein kinase ...  75.5    3e-13   
ref|XP_010266343.1|  PREDICTED: uncharacterized protein LOC104603873  75.9    3e-13   
ref|XP_002983821.1|  calcium dependent protein kinase 3               75.1    3e-13   
gb|KCW75309.1|  hypothetical protein EUGRSUZ_E04057                   75.1    3e-13   
ref|XP_004134759.1|  PREDICTED: calcium-dependent protein kinase ...  75.1    3e-13   
ref|XP_002989102.1|  calcium dependent protein kinase                 75.1    3e-13   
ref|XP_010093289.1|  Calcium-dependent protein kinase 15              75.1    4e-13   
ref|XP_004139037.1|  PREDICTED: calcium-dependent protein kinase ...  75.1    4e-13   
ref|XP_010923910.1|  PREDICTED: calcium-dependent protein kinase ...  75.1    4e-13   
ref|XP_005647441.1|  Pkinase-domain-containing protein                74.7    4e-13   
gb|ADM14342.1|  calcium-dependent protein kinase 19                   75.1    4e-13   
gb|KCW66999.1|  hypothetical protein EUGRSUZ_F007611                  73.6    4e-13   
ref|XP_008439982.1|  PREDICTED: calcium-dependent protein kinase 2    74.7    5e-13   
ref|XP_010060346.1|  PREDICTED: calcium-dependent protein kinase ...  74.7    5e-13   
ref|XP_010060348.1|  PREDICTED: calcium-dependent protein kinase ...  74.7    5e-13   
ref|XP_008463413.1|  PREDICTED: calcium-dependent protein kinase-...  74.3    6e-13   
ref|XP_002284750.2|  PREDICTED: calcium-dependent protein kinase 29   74.3    6e-13   
ref|NP_001280761.1|  calcium-dependent protein kinase 2-like          74.3    6e-13   
ref|XP_011459094.1|  PREDICTED: calcium-dependent protein kinase ...  74.3    6e-13   
ref|XP_002510594.1|  calcium-dependent protein kinase, putative       74.3    6e-13   
ref|XP_004294385.1|  PREDICTED: calcium-dependent protein kinase ...  74.3    7e-13   
ref|XP_004291330.1|  PREDICTED: calcium-dependent protein kinase ...  74.3    7e-13   
ref|XP_009360996.1|  PREDICTED: calcium-dependent protein kinase ...  74.3    7e-13   
ref|XP_006452344.1|  hypothetical protein CICLE_v10007980mg           74.3    7e-13   
ref|XP_010040549.1|  PREDICTED: calcium-dependent protein kinase ...  74.3    7e-13   
ref|XP_008800033.1|  PREDICTED: calcium-dependent protein kinase 29   74.3    7e-13   
ref|XP_011096067.1|  PREDICTED: calcium-dependent protein kinase-...  74.3    7e-13   
ref|XP_008365060.1|  PREDICTED: calcium-dependent protein kinase 2    74.3    7e-13   
ref|XP_002268814.1|  PREDICTED: calcium-dependent protein kinase 2    74.3    8e-13   
ref|XP_004499307.1|  PREDICTED: LOW QUALITY PROTEIN: calcium-depe...  74.7    8e-13   
ref|XP_010461925.1|  PREDICTED: calcium-dependent protein kinase 33   73.9    8e-13   
gb|ABC59619.1|  calcium-dependent protein kinase                      73.9    8e-13   
gb|ABB54456.1|  calcium-dependent protein kinase                      73.9    8e-13   
dbj|BAJ99143.1|  predicted protein                                    73.9    8e-13   
gb|ABD98803.1|  calcium-dependent protein kinase                      73.9    8e-13   
ref|NP_001059775.1|  Os07g0515100                                     73.9    9e-13   
ref|XP_003519577.1|  PREDICTED: calcium-dependent protein kinase ...  73.9    9e-13   
ref|XP_008224828.1|  PREDICTED: LOW QUALITY PROTEIN: calcium-depe...  73.9    1e-12   
emb|CBI23246.3|  unnamed protein product                              73.9    1e-12   
gb|EEE64852.1|  hypothetical protein OsJ_19709                        73.9    1e-12   
ref|XP_008450417.1|  PREDICTED: calcium-dependent protein kinase ...  73.9    1e-12   
gb|KDO62703.1|  hypothetical protein CISIN_1g009382mg                 73.9    1e-12   
ref|NP_001234582.1|  calcium-dependent protein kinase CDPK1           73.6    1e-12   
emb|CDP04396.1|  unnamed protein product                              73.9    1e-12   
ref|XP_003570118.1|  PREDICTED: calcium-dependent protein kinase ...  73.9    1e-12   
ref|XP_011037643.1|  PREDICTED: calcium-dependent protein kinase-...  73.6    1e-12   
ref|XP_007222396.1|  hypothetical protein PRUPE_ppa004027mg           73.6    1e-12   
gb|KDO78219.1|  hypothetical protein CISIN_1g009091mg                 73.2    1e-12   
ref|XP_010923909.1|  PREDICTED: calcium-dependent protein kinase ...  73.6    1e-12   
ref|XP_006467440.1|  PREDICTED: calcium-dependent protein kinase ...  73.6    1e-12   
ref|XP_007020822.1|  Calmodulin-domain protein kinase 9 isoform 3     72.8    1e-12   
ref|XP_006855881.1|  hypothetical protein AMTR_s00037p00138680        72.8    1e-12   
ref|XP_008221211.1|  PREDICTED: calcium-dependent protein kinase 29   73.2    1e-12   
ref|XP_011086186.1|  PREDICTED: calcium-dependent protein kinase-...  73.2    2e-12   
gb|AIU98504.1|  calcium-dependent protein kinase                      73.2    2e-12   
ref|XP_002518484.1|  calcium-dependent protein kinase, putative       73.2    2e-12   
ref|XP_006389625.1|  hypothetical protein POPTR_0021s00750g           73.2    2e-12   
ref|NP_001275371.1|  calcium-dependent protein kinase 2               73.2    2e-12   
ref|XP_003563028.1|  PREDICTED: calcium-dependent protein kinase ...  73.2    2e-12   
ref|XP_006452345.1|  hypothetical protein CICLE_v10007978mg           73.2    2e-12   
ref|XP_007142270.1|  hypothetical protein PHAVU_008G266600g           73.2    2e-12   
ref|NP_001275456.1|  calcium-dependent protein kinase 3               73.2    2e-12   
gb|ABC59620.1|  calcium-dependent protein kinase                      72.8    2e-12   
gb|KDO78218.1|  hypothetical protein CISIN_1g009091mg                 72.8    2e-12   
ref|XP_009406510.1|  PREDICTED: calcium-dependent protein kinase ...  72.8    2e-12   
ref|XP_006346214.1|  PREDICTED: calcium-dependent protein kinase ...  72.8    2e-12   
ref|XP_006386161.1|  hypothetical protein POPTR_0002s01850g           72.8    2e-12   
gb|KDO78217.1|  hypothetical protein CISIN_1g009091mg                 72.8    2e-12   
ref|XP_009360846.1|  PREDICTED: calcium-dependent protein kinase ...  72.8    2e-12   
gb|AIU98507.1|  calcium-dependent protein kinase                      72.8    2e-12   
ref|XP_006449723.1|  hypothetical protein CICLE_v10014823mg           72.8    2e-12   
ref|XP_004154632.1|  PREDICTED: LOW QUALITY PROTEIN: calcium-depe...  72.8    2e-12   
ref|XP_003617547.1|  Calcium dependent protein kinase                 73.6    2e-12   
ref|XP_010061107.1|  PREDICTED: calcium-dependent protein kinase ...  72.8    2e-12   
dbj|BAA13440.1|  calcium dependent protein kinase                     72.8    2e-12   
gb|AHZ58490.1|  calmodulin-like domain protein kinase                 72.8    2e-12   
gb|AET00506.2|  calcium-dependent kinase                              72.8    3e-12   
ref|XP_009592788.1|  PREDICTED: calcium-dependent protein kinase 2    72.8    3e-12   
gb|AGJ83806.1|  calcium-dependent protein kinase 1d                   72.8    3e-12   
gb|KJB69279.1|  hypothetical protein B456_011G014200                  72.8    3e-12   
ref|XP_007020820.1|  Calmodulin-domain protein kinase 9 isoform 1     72.8    3e-12   
ref|XP_009783685.1|  PREDICTED: calcium-dependent protein kinase ...  72.8    3e-12   
ref|XP_008651864.1|  PREDICTED: calcium-dependent protein kinase ...  72.8    3e-12   
gb|AAB70706.1|  calmodulin-like domain protein kinase                 72.8    3e-12   
gb|AEY99979.1|  calcium-dependent protein kinase                      72.4    3e-12   
gb|AEW09346.1|  hypothetical protein UMN_5602_01                      69.3    3e-12   
ref|XP_004231610.1|  PREDICTED: calcium-dependent protein kinase ...  72.4    3e-12   
gb|KHG10851.1|  Calcium-dependent protein kinase 21                   72.8    3e-12   
gb|ABD98804.1|  calcium-dependent protein kinase                      72.4    3e-12   
gb|ABV22570.1|  calcium-dependent protein kinase                      72.4    3e-12   
gb|EYU33891.1|  hypothetical protein MIMGU_mgv1a004201mg              72.4    3e-12   
ref|XP_004957848.1|  PREDICTED: calcium-dependent protein kinase ...  72.4    3e-12   
gb|AEY99978.1|  calcium-dependent protein kinase                      72.4    3e-12   
ref|XP_009357448.1|  PREDICTED: calcium-dependent protein kinase ...  72.4    3e-12   
emb|CAN67210.1|  hypothetical protein VITISV_026712                   72.4    3e-12   
gb|AFG67165.1|  hypothetical protein UMN_5602_01                      69.3    3e-12   
gb|KDP39132.1|  hypothetical protein JCGZ_00889                       72.4    3e-12   
gb|KHG19296.1|  Calcium-dependent protein kinase 4                    72.4    3e-12   
gb|KCW68006.1|  hypothetical protein EUGRSUZ_F01695                   72.4    3e-12   
emb|CDY07254.1|  BnaC04g19170D                                        72.4    3e-12   
ref|XP_001776407.1|  cpk9 calcium-dependent protein kinase            72.4    3e-12   
gb|KHG19297.1|  Calcium-dependent protein kinase 4                    72.4    3e-12   
ref|XP_004957849.1|  PREDICTED: calcium-dependent protein kinase ...  72.4    3e-12   
gb|KDP20751.1|  hypothetical protein JCGZ_21222                       72.4    3e-12   
gb|KFK27666.1|  calcium-dependent protein kinase                      72.0    3e-12   
ref|NP_001105306.1|  calcium-dependent protein kinase                 72.4    3e-12   
ref|XP_007020821.1|  Calmodulin-domain protein kinase 9 isoform 2     71.6    4e-12   
ref|XP_002970639.1|  calcium dependent protein kinase 17              72.0    4e-12   
ref|XP_002968464.1|  calcium dependent protein kinase 17              72.4    4e-12   
ref|XP_011034967.1|  PREDICTED: calcium-dependent protein kinase 29   72.0    4e-12   
ref|XP_004491400.1|  PREDICTED: calcium-dependent protein kinase ...  72.0    4e-12   
ref|XP_002968465.1|  calcium dependent protein kinase 17              72.0    4e-12   
ref|XP_011095398.1|  PREDICTED: calcium-dependent protein kinase ...  72.0    4e-12   
ref|XP_011047987.1|  PREDICTED: calcium-dependent protein kinase-...  72.0    4e-12   
ref|XP_005849715.1|  hypothetical protein CHLNCDRAFT_30247            72.0    4e-12   
ref|XP_011047988.1|  PREDICTED: calcium-dependent protein kinase-...  72.0    4e-12   
ref|XP_009798869.1|  PREDICTED: calcium-dependent protein kinase 29   72.0    4e-12   
gb|AGJ83805.1|  calcium-dependent protein kinase 1a                   72.0    5e-12   
gb|ADZ52811.1|  calcium-dependent protein kinase 3                    72.0    5e-12   
ref|XP_004238385.1|  PREDICTED: calcium-dependent protein kinase 29   72.0    5e-12   
ref|XP_006473713.1|  PREDICTED: calcium-dependent protein kinase ...  71.6    5e-12   
ref|XP_006473712.1|  PREDICTED: calcium-dependent protein kinase ...  71.6    5e-12   
ref|XP_006435253.1|  hypothetical protein CICLE_v10000897mg           71.6    5e-12   
gb|KDO56659.1|  hypothetical protein CISIN_1g009731mg                 70.5    6e-12   
ref|XP_010686845.1|  PREDICTED: calcium-dependent protein kinase ...  71.6    6e-12   
gb|KDO84959.1|  hypothetical protein CISIN_1g010263mg                 70.9    6e-12   
gb|KDO56657.1|  hypothetical protein CISIN_1g009731mg                 70.9    6e-12   
gb|AAF14337.1|U73610_1  ATCDPK1a                                      69.3    6e-12   
gb|KJB79736.1|  hypothetical protein B456_013G064500                  71.6    6e-12   
ref|XP_010501945.1|  PREDICTED: calcium-dependent protein kinase ...  71.6    6e-12   
ref|XP_009620047.1|  PREDICTED: calcium-dependent protein kinase 29   71.6    7e-12   
ref|XP_009627158.1|  PREDICTED: calcium-dependent protein kinase ...  71.6    7e-12   
emb|CDP05759.1|  unnamed protein product                              71.2    7e-12   
ref|XP_006653668.1|  PREDICTED: calcium-dependent protein kinase ...  71.2    7e-12   
ref|XP_002278179.1|  PREDICTED: calcium-dependent protein kinase 2    71.2    7e-12   
gb|AGJ83807.1|  calcium-dependent protein kinase 1e                   71.2    7e-12   
ref|XP_007026067.1|  Calcium-dependent protein kinase 21 isoform 2    71.2    7e-12   
gb|KHG26977.1|  Calcium-dependent protein kinase 9                    71.2    7e-12   
gb|ACB71246.2|  calcium-dependent protein kinase 1                    71.2    8e-12   
ref|XP_007026068.1|  Calcium-dependent protein kinase 21 isoform 3    71.2    8e-12   
gb|KDO56658.1|  hypothetical protein CISIN_1g009731mg                 70.9    8e-12   
emb|CAD70165.1|  calcium-dependent protein kinase                     71.2    8e-12   
gb|KFK40633.1|  hypothetical protein AALP_AA2G022000                  71.2    8e-12   
ref|XP_010479536.1|  PREDICTED: calcium-dependent protein kinase ...  71.2    8e-12   
ref|XP_006429404.1|  hypothetical protein CICLE_v10011471mg           71.2    8e-12   
ref|XP_007026066.1|  Calcium-dependent protein kinase 21 isoform 1    71.2    9e-12   
gb|KJB62816.1|  hypothetical protein B456_009G438300                  71.2    9e-12   
gb|AAP03014.1|  seed calcium dependent protein kinase c               71.2    9e-12   
gb|EPS59225.1|  calcium-dependent protein kinase 1                    70.9    9e-12   
ref|XP_006303970.1|  hypothetical protein CARUB_v10008860mg           71.2    9e-12   
ref|XP_010533815.1|  PREDICTED: calcium-dependent protein kinase 19   71.2    9e-12   
gb|AAQ17506.1|  calcium dependent protein kinase 3                    70.9    9e-12   
gb|ACJ61504.1|  calcium-dependent protein kinase                      71.2    9e-12   
ref|XP_002305576.2|  hypothetical protein POPTR_0004s01530g           70.9    1e-11   
gb|KFK30983.1|  hypothetical protein AALP_AA6G053500                  70.9    1e-11   
emb|CAA57157.1|  calcium-dependent protein kinase                     70.9    1e-11   
gb|KJB68586.1|  hypothetical protein B456_010G252400                  70.5    1e-11   
emb|CDY24863.1|  BnaA03g59670D                                        70.9    1e-11   



>gb|ABC47163.2| CDPK1 [Ipomoea nil]
 gb|AFO63177.1| calcium dependent protein kinase 1 [Ipomoea nil]
Length=514

 Score =   204 bits (518),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 109/109 (100%), Positives = 109/109 (100%), Gaps = 0/109 (0%)
 Frame = +3

Query  18   MGSCNSIPSSPFAATSAGGESDPPPPKNDITVLppsqpppprpFLSGVGRVLGRPMEDVH  197
            MGSCNSIPSSPFAATSAGGESDPPPPKNDITVLPPSQPPPPRPFLSGVGRVLGRPMEDVH
Sbjct  1    MGSCNSIPSSPFAATSAGGESDPPPPKNDITVLPPSQPPPPRPFLSGVGRVLGRPMEDVH  60

Query  198  STYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVR  344
            STYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVR
Sbjct  61   STYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVR  109



>ref|XP_009786035.1| PREDICTED: calcium-dependent protein kinase 3 [Nicotiana sylvestris]
Length=514

 Score =   130 bits (326),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 83/109 (76%), Gaps = 0/109 (0%)
 Frame = +3

Query  18   MGSCNSIPSSPFAATSAGGESDPPPPKNDITVLppsqpppprpFLSGVGRVLGRPMEDVH  197
            MG+CNS  S      S+GG + PPP +     + PS  PPP   LSG+GRVLG+PMEDV 
Sbjct  1    MGNCNSSSSDQTTTISSGGATGPPPSETTGIRIIPSSQPPPPRPLSGIGRVLGKPMEDVR  60

Query  198  STYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVR  344
            STYIFGGELGRGQFGVT+LVTH++T ++ ACKSIATRKL++ DDVDDVR
Sbjct  61   STYIFGGELGRGQFGVTFLVTHKQTHQQFACKSIATRKLIAADDVDDVR  109



>ref|XP_009620189.1| PREDICTED: calcium-dependent protein kinase 3 [Nicotiana tomentosiformis]
Length=514

 Score =   125 bits (315),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 71/109 (65%), Positives = 84/109 (77%), Gaps = 0/109 (0%)
 Frame = +3

Query  18   MGSCNSIPSSPFAATSAGGESDPPPPKNDITVLppsqpppprpFLSGVGRVLGRPMEDVH  197
            MG+CNS  S     TS GG + PPP +     + PS  PPP   LSG+GRVLG+PME+V 
Sbjct  1    MGNCNSSSSDQTTTTSLGGATGPPPSETTGIRIIPSSQPPPPRPLSGIGRVLGKPMEEVR  60

Query  198  STYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVR  344
            STYIFGGELGRGQFGVTYLVTH++TR++ ACKSIATRKL++ DDVDDVR
Sbjct  61   STYIFGGELGRGQFGVTYLVTHKQTRQQFACKSIATRKLIAADDVDDVR  109



>gb|ACH85192.1| calcium-dependent protein kinase CDPK5 [Nicotiana tabacum]
Length=514

 Score =   125 bits (315),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 70/109 (64%), Positives = 83/109 (76%), Gaps = 0/109 (0%)
 Frame = +3

Query  18   MGSCNSIPSSPFAATSAGGESDPPPPKNDITVLppsqpppprpFLSGVGRVLGRPMEDVH  197
            MG+CNS  S     T  GG + PPP +     + PS  PPP   LSG+GRVLG+PME+V 
Sbjct  1    MGNCNSSSSDQTTTTCLGGATGPPPSETTGIRIIPSSQPPPPRPLSGIGRVLGKPMEEVR  60

Query  198  STYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVR  344
            STYIFGGELGRGQFGVTYLVTH++TR++ ACKSIATRKL++ DDVDDVR
Sbjct  61   STYIFGGELGRGQFGVTYLVTHKQTRQQFACKSIATRKLIAADDVDDVR  109



>ref|XP_006352261.1| PREDICTED: calcium-dependent protein kinase 3-like [Solanum tuberosum]
Length=517

 Score =   118 bits (296),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 54/65 (83%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +3

Query  150  LSGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDD  329
             SG+GRVLGRPMEDV S YIFGGELGRGQFGVTYLVT++KTR++ ACKSIATRKL++KDD
Sbjct  48   FSGIGRVLGRPMEDVRSIYIFGGELGRGQFGVTYLVTNKKTRQQFACKSIATRKLINKDD  107

Query  330  VDDVR  344
            VDDVR
Sbjct  108  VDDVR  112



>ref|XP_004244622.1| PREDICTED: calcium-dependent protein kinase 3 [Solanum lycopersicum]
Length=516

 Score =   116 bits (291),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 53/63 (84%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = +3

Query  156  GVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVD  335
            G+GRVLGRPMEDV S YIFGGELGRGQFGVTYLVT++KTR++ ACKSIATRKL++KDDVD
Sbjct  49   GIGRVLGRPMEDVRSIYIFGGELGRGQFGVTYLVTNKKTRQQFACKSIATRKLINKDDVD  108

Query  336  DVR  344
            DVR
Sbjct  109  DVR  111



>ref|XP_010261434.1| PREDICTED: calcium-dependent protein kinase 3-like [Nelumbo nucifera]
Length=531

 Score =   116 bits (291),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 66/126 (52%), Positives = 80/126 (63%), Gaps = 17/126 (13%)
 Frame = +3

Query  18   MGSCNSIPSS--PFAATSAGGESDPPPPKNDITV-----------LppsqpppprpF---  149
            MG+CN +PS+        A     PPP  N I V           +    P  P  F   
Sbjct  1    MGNCNGLPSNGDQLQPGGAANLHAPPPTNNVINVRPDDKPTPPPSILHQGPQQPPSFVHR  60

Query  150  -LSGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKD  326
             LS  GRVLGRPMEDV STYIFG ELGRGQFGVTYLVTH++T+++ ACKSIATRKL+++D
Sbjct  61   PLSSTGRVLGRPMEDVRSTYIFGRELGRGQFGVTYLVTHKETKQQYACKSIATRKLVNRD  120

Query  327  DVDDVR  344
            D++DVR
Sbjct  121  DIEDVR  126



>gb|KEH21166.1| calmodulin-domain kinase CDPK protein [Medicago truncatula]
Length=516

 Score =   114 bits (286),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 62/111 (56%), Positives = 80/111 (72%), Gaps = 4/111 (4%)
 Frame = +3

Query  21   GSCNSIPSSPFAATSAGGESDPPPPKNDITVLpps---qpppprpFLSGVGRVLGRPMED  191
            G+C++   +    T+    SDPPP KN  T+LP +    PP P    + +GR+L RPMED
Sbjct  3    GNCSTGAGAGINTTTTTPHSDPPP-KNAPTILPQNFTPSPPQPPLPTTTLGRILNRPMED  61

Query  192  VHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVR  344
            V S +IFG ELGRGQFGVTYLVTH+ T+E+ ACKSIATRKL+++DD+DDVR
Sbjct  62   VRSIFIFGRELGRGQFGVTYLVTHKVTKEQFACKSIATRKLVNRDDIDDVR  112



>emb|CAN61364.1| hypothetical protein VITISV_032639 [Vitis vinifera]
Length=482

 Score =   114 bits (284),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 50/65 (77%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = +3

Query  150  LSGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDD  329
            L+G GRVLGRPMEDV  TYIFG ELGRGQFGVTYLVTH++T+E+ ACKSIATRKL+++DD
Sbjct  14   LAGNGRVLGRPMEDVRQTYIFGRELGRGQFGVTYLVTHKETKEQFACKSIATRKLVNRDD  73

Query  330  VDDVR  344
            ++DVR
Sbjct  74   IEDVR  78



>ref|XP_006849377.1| hypothetical protein AMTR_s00158p00082100 [Amborella trichopoda]
 gb|ERN10958.1| hypothetical protein AMTR_s00158p00082100 [Amborella trichopoda]
Length=538

 Score =   114 bits (285),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 49/65 (75%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = +3

Query  150  LSGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDD  329
            ++G+GR+LGRPMED  STYIFG ELGRGQFGVTY+ THR+T+E LACKSIATRKL++KDD
Sbjct  60   IAGIGRILGRPMEDGRSTYIFGKELGRGQFGVTYMCTHRETKEVLACKSIATRKLITKDD  119

Query  330  VDDVR  344
            ++DVR
Sbjct  120  IEDVR  124



>ref|XP_010251583.1| PREDICTED: calcium-dependent protein kinase 3-like [Nelumbo nucifera]
Length=522

 Score =   114 bits (284),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 80/125 (64%), Gaps = 24/125 (19%)
 Frame = +3

Query  18   MGSCNSIPSSPFAATSAGGESDPPPPKNDITVLppsqpp----------------pprpF  149
            MG+CN +PS+         +  PPPP N I+V P  +P                      
Sbjct  1    MGNCNGLPSN--------DDRHPPPPINVISVRPDDKPTTPTPPNQHQGPPQPPSAVHRP  52

Query  150  LSGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDD  329
            LSG GRVLGRPMEDV +TY+FG E+GRGQFGVT L TH++T+E+ ACKSIATRKL+++DD
Sbjct  53   LSGTGRVLGRPMEDVRATYVFGREIGRGQFGVTCLATHKETKEQFACKSIATRKLVNRDD  112

Query  330  VDDVR  344
            +DDVR
Sbjct  113  IDDVR  117



>gb|KDO76377.1| hypothetical protein CISIN_1g010013mg [Citrus sinensis]
Length=480

 Score =   113 bits (282),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 75/115 (65%), Gaps = 6/115 (5%)
 Frame = +3

Query  18   MGSCNSIPSSPFAATSAGGESDPPP------PKNDITVLppsqpppprpFLSGVGRVLGR  179
            MG+CN +PSS     S   + D  P       K D    P           S VGRVLG+
Sbjct  1    MGNCNGLPSSQTQLHSTTADPDTGPGHHPNGLKIDPPGPPRPSSSATSATSSSVGRVLGK  60

Query  180  PMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVR  344
            PMEDV +TYIFG ELGRGQFGVTYLVTH+ T+++ ACKSI++RKL+++DDV+DVR
Sbjct  61   PMEDVRNTYIFGRELGRGQFGVTYLVTHKDTKQQFACKSISSRKLINRDDVEDVR  115



>gb|KDP25359.1| hypothetical protein JCGZ_20515 [Jatropha curcas]
Length=525

 Score =   113 bits (283),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 86/123 (70%), Gaps = 17/123 (14%)
 Frame = +3

Query  18   MGSCNSIPSSPFAATSAGGESDPPPPKNDITVLppsqpppprpFLS--------------  155
            MG+C+S+PSS   ++     SD PPP N IT+ P +  PPPRP                 
Sbjct  1    MGNCSSLPSSFTTSSGG---SDNPPPSNGITIHPATASPPPRPPPPHSFQPSNRPSSTTP  57

Query  156  GVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVD  335
             VGRVLGRP+EDV +TYIFG ELGRGQFG+TYLVTH++T+E+ ACKSI TRKL+++DD++
Sbjct  58   AVGRVLGRPIEDVRNTYIFGRELGRGQFGITYLVTHKETKEQFACKSITTRKLINRDDIE  117

Query  336  DVR  344
            DVR
Sbjct  118  DVR  120



>gb|KDO76378.1| hypothetical protein CISIN_1g010013mg [Citrus sinensis]
Length=420

 Score =   112 bits (280),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 75/115 (65%), Gaps = 6/115 (5%)
 Frame = +3

Query  18   MGSCNSIPSSPFAATSAGGESDPPP------PKNDITVLppsqpppprpFLSGVGRVLGR  179
            MG+CN +PSS     S   + D  P       K D    P           S VGRVLG+
Sbjct  1    MGNCNGLPSSQTQLHSTTADPDTGPGHHPNGLKIDPPGPPRPSSSATSATSSSVGRVLGK  60

Query  180  PMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVR  344
            PMEDV +TYIFG ELGRGQFGVTYLVTH+ T+++ ACKSI++RKL+++DDV+DVR
Sbjct  61   PMEDVRNTYIFGRELGRGQFGVTYLVTHKDTKQQFACKSISSRKLINRDDVEDVR  115



>gb|KDO76380.1| hypothetical protein CISIN_1g010013mg [Citrus sinensis]
Length=350

 Score =   112 bits (279),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 75/115 (65%), Gaps = 6/115 (5%)
 Frame = +3

Query  18   MGSCNSIPSSPFAATSAGGESDPPPP------KNDITVLppsqpppprpFLSGVGRVLGR  179
            MG+CN +PSS     S   + D  P       K D    P           S VGRVLG+
Sbjct  1    MGNCNGLPSSQTQLHSTTADPDTGPGHHPNGLKIDPPGPPRPSSSATSATSSSVGRVLGK  60

Query  180  PMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVR  344
            PMEDV +TYIFG ELGRGQFGVTYLVTH+ T+++ ACKSI++RKL+++DDV+DVR
Sbjct  61   PMEDVRNTYIFGRELGRGQFGVTYLVTHKDTKQQFACKSISSRKLINRDDVEDVR  115



>gb|KDO76376.1| hypothetical protein CISIN_1g010013mg [Citrus sinensis]
Length=520

 Score =   113 bits (282),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 75/115 (65%), Gaps = 6/115 (5%)
 Frame = +3

Query  18   MGSCNSIPSSPFAATSAGGESDPPPP------KNDITVLppsqpppprpFLSGVGRVLGR  179
            MG+CN +PSS     S   + D  P       K D    P           S VGRVLG+
Sbjct  1    MGNCNGLPSSQTQLHSTTADPDTGPGHHPNGLKIDPPGPPRPSSSATSATSSSVGRVLGK  60

Query  180  PMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVR  344
            PMEDV +TYIFG ELGRGQFGVTYLVTH+ T+++ ACKSI++RKL+++DDV+DVR
Sbjct  61   PMEDVRNTYIFGRELGRGQFGVTYLVTHKDTKQQFACKSISSRKLINRDDVEDVR  115



>ref|XP_006476469.1| PREDICTED: calcium-dependent protein kinase 3-like [Citrus sinensis]
Length=520

 Score =   113 bits (282),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 75/115 (65%), Gaps = 6/115 (5%)
 Frame = +3

Query  18   MGSCNSIPSSPFAATSAGGESDPPPP------KNDITVLppsqpppprpFLSGVGRVLGR  179
            MG+CN +PSS     S   + D  P       K D    P           + VGRVLG+
Sbjct  1    MGNCNGLPSSQTQLHSTTADPDTGPGHHPNGLKIDPPGPPGPSSSATSATSASVGRVLGK  60

Query  180  PMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVR  344
            PMEDV +TYIFG ELGRGQFGVTYLVTH+ T+++ ACKSI++RKL+++DDV+DVR
Sbjct  61   PMEDVRNTYIFGRELGRGQFGVTYLVTHKDTKQQFACKSISSRKLINRDDVEDVR  115



>gb|KDO76379.1| hypothetical protein CISIN_1g010013mg [Citrus sinensis]
Length=397

 Score =   112 bits (279),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 75/115 (65%), Gaps = 6/115 (5%)
 Frame = +3

Query  18   MGSCNSIPSSPFAATSAGGESDPPP------PKNDITVLppsqpppprpFLSGVGRVLGR  179
            MG+CN +PSS     S   + D  P       K D    P           S VGRVLG+
Sbjct  1    MGNCNGLPSSQTQLHSTTADPDTGPGHHPNGLKIDPPGPPRPSSSATSATSSSVGRVLGK  60

Query  180  PMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVR  344
            PMEDV +TYIFG ELGRGQFGVTYLVTH+ T+++ ACKSI++RKL+++DDV+DVR
Sbjct  61   PMEDVRNTYIFGRELGRGQFGVTYLVTHKDTKQQFACKSISSRKLINRDDVEDVR  115



>ref|XP_006439442.1| hypothetical protein CICLE_v10019724mg [Citrus clementina]
 gb|ESR52682.1| hypothetical protein CICLE_v10019724mg [Citrus clementina]
Length=420

 Score =   111 bits (278),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 75/115 (65%), Gaps = 6/115 (5%)
 Frame = +3

Query  18   MGSCNSIPSSPFAATSAGGESDPPP------PKNDITVLppsqpppprpFLSGVGRVLGR  179
            MG+CN +PSS     S   + D  P       K D    P           S VGRVLG+
Sbjct  1    MGNCNGLPSSQTQLHSTTADPDTGPGHHPNGLKIDPPGPPRPSSSATSATSSSVGRVLGK  60

Query  180  PMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVR  344
            PMEDV +TYIFG ELGRGQFG+TYLVTH+ T+++ ACKSI++RKL+++DDV+DVR
Sbjct  61   PMEDVRNTYIFGRELGRGQFGITYLVTHKYTKQQFACKSISSRKLINRDDVEDVR  115



>ref|XP_006439440.1| hypothetical protein CICLE_v10019724mg [Citrus clementina]
 gb|ESR52680.1| hypothetical protein CICLE_v10019724mg [Citrus clementina]
Length=350

 Score =   111 bits (277),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 75/115 (65%), Gaps = 6/115 (5%)
 Frame = +3

Query  18   MGSCNSIPSSPFAATSAGGESDPPP------PKNDITVLppsqpppprpFLSGVGRVLGR  179
            MG+CN +PSS     S   + D  P       K D    P           S VGRVLG+
Sbjct  1    MGNCNGLPSSQTQLHSTTADPDTGPGHHPNGLKIDPPGPPRPSSSATSATSSSVGRVLGK  60

Query  180  PMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVR  344
            PMEDV +TYIFG ELGRGQFG+TYLVTH+ T+++ ACKSI++RKL+++DDV+DVR
Sbjct  61   PMEDVRNTYIFGRELGRGQFGITYLVTHKYTKQQFACKSISSRKLINRDDVEDVR  115



>ref|XP_007160124.1| hypothetical protein PHAVU_002G294500g [Phaseolus vulgaris]
 gb|ESW32118.1| hypothetical protein PHAVU_002G294500g [Phaseolus vulgaris]
Length=519

 Score =   112 bits (280),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 81/116 (70%), Gaps = 11/116 (9%)
 Frame = +3

Query  18   MGSCNSIPS---SPFAATSAGGESDPPPPKNDITVLppsqppp----prpFLSGVGRVLG  176
            MG+C+S      +P  +T     SD  P +N ITVLPP+  P          S +GRVLG
Sbjct  1    MGNCSSSHGGGGTPATSTY----SDELPQRNGITVLPPNTNPSPPLPKPQASSSLGRVLG  56

Query  177  RPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVR  344
            RPMEDV S YIFG ELGRGQFGVTYLVTH+ T+E+ ACKSIATRKL+++DD+DDVR
Sbjct  57   RPMEDVRSIYIFGRELGRGQFGVTYLVTHKVTKEQFACKSIATRKLVNRDDIDDVR  112



>ref|XP_006439441.1| hypothetical protein CICLE_v10019724mg [Citrus clementina]
 gb|ESR52681.1| hypothetical protein CICLE_v10019724mg [Citrus clementina]
Length=397

 Score =   111 bits (277),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 75/115 (65%), Gaps = 6/115 (5%)
 Frame = +3

Query  18   MGSCNSIPSSPFAATSAGGESDPPP------PKNDITVLppsqpppprpFLSGVGRVLGR  179
            MG+CN +PSS     S   + D  P       K D    P           S VGRVLG+
Sbjct  1    MGNCNGLPSSQTQLHSTTADPDTGPGHHPNGLKIDPPGPPRPSSSATSATSSSVGRVLGK  60

Query  180  PMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVR  344
            PMEDV +TYIFG ELGRGQFG+TYLVTH+ T+++ ACKSI++RKL+++DDV+DVR
Sbjct  61   PMEDVRNTYIFGRELGRGQFGITYLVTHKYTKQQFACKSISSRKLINRDDVEDVR  115



>ref|XP_006439443.1| hypothetical protein CICLE_v10019724mg [Citrus clementina]
 gb|ESR52683.1| hypothetical protein CICLE_v10019724mg [Citrus clementina]
Length=520

 Score =   112 bits (280),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 75/115 (65%), Gaps = 6/115 (5%)
 Frame = +3

Query  18   MGSCNSIPSSPFAATSAGGESDPPPP------KNDITVLppsqpppprpFLSGVGRVLGR  179
            MG+CN +PSS     S   + D  P       K D    P           S VGRVLG+
Sbjct  1    MGNCNGLPSSQTQLHSTTADPDTGPGHHPNGLKIDPPGPPRPSSSATSATSSSVGRVLGK  60

Query  180  PMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVR  344
            PMEDV +TYIFG ELGRGQFG+TYLVTH+ T+++ ACKSI++RKL+++DDV+DVR
Sbjct  61   PMEDVRNTYIFGRELGRGQFGITYLVTHKYTKQQFACKSISSRKLINRDDVEDVR  115



>ref|XP_003525360.1| PREDICTED: calcium-dependent protein kinase 3-like isoform 1 
[Glycine max]
Length=518

 Score =   112 bits (280),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 78/117 (67%), Gaps = 14/117 (12%)
 Frame = +3

Query  18   MGSCNSIPSSPFAATSAGGESDPPPPKNDITVL--------ppsqpppprpFLSGVGRVL  173
            MG+C+S   +P         SD  P  N ITVL           +PPP     S +GRVL
Sbjct  1    MGNCSSGAGAPTTY------SDDHPHHNGITVLPPNSNPSPQLPKPPPTSSSSSSLGRVL  54

Query  174  GRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVR  344
            GRPMEDV S YIFG ELGRGQFGVTYLVTH+ T+E+ ACKSIATRKL+++DD+DD+R
Sbjct  55   GRPMEDVRSIYIFGRELGRGQFGVTYLVTHKATKEQFACKSIATRKLVNRDDIDDIR  111



>gb|AGS15000.1| calcium-dependent protein kinase 3 [Vitis amurensis]
Length=528

 Score =   112 bits (280),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = +3

Query  150  LSGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDD  329
            L+G GRVLGRPMEDV  TYIFG ELGRGQFGVTYLVTH++T+E+ ACKSIATRKL+++DD
Sbjct  60   LAGNGRVLGRPMEDVRQTYIFGRELGRGQFGVTYLVTHKETKEQFACKSIATRKLVNRDD  119

Query  330  VDDVR  344
            ++DVR
Sbjct  120  IEDVR  124



>ref|XP_002272270.1| PREDICTED: calcium-dependent protein kinase 3 [Vitis vinifera]
 ref|XP_010658560.1| PREDICTED: calcium-dependent protein kinase 3 [Vitis vinifera]
Length=528

 Score =   112 bits (279),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = +3

Query  150  LSGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDD  329
            L+G GRVLGRPMEDV  TYIFG ELGRGQFGVTYLVTH++T+E+ ACKSIATRKL+++DD
Sbjct  60   LAGNGRVLGRPMEDVRQTYIFGRELGRGQFGVTYLVTHKETKEQFACKSIATRKLVNRDD  119

Query  330  VDDVR  344
            ++DVR
Sbjct  120  IEDVR  124



>ref|XP_002298000.1| calcium-dependent protein kinase 1 [Populus trichocarpa]
 gb|EEE82805.1| calcium-dependent protein kinase 1 [Populus trichocarpa]
Length=515

 Score =   111 bits (278),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 63/113 (56%), Positives = 82/113 (73%), Gaps = 8/113 (7%)
 Frame = +3

Query  18   MGSCNSIPSSPFAATSAGGESDPPPPKNDITVLppsqppp-prpFL----SGVGRVLGRP  182
            MG+CNS+ SS   +++     +PPP    I VLPP+  PP    FL    + VGRVLGRP
Sbjct  1    MGNCNSLASS---SSTTTNHRNPPPSNGGIKVLPPNASPPPRSQFLHHSSAAVGRVLGRP  57

Query  183  MEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDV  341
            MEDV +TY FG E+GRGQFGVTYLVTH++T++  ACKSIA RKL+++DD++DV
Sbjct  58   MEDVRNTYTFGREVGRGQFGVTYLVTHKETKQHFACKSIAKRKLINRDDIEDV  110



>gb|KJB52213.1| hypothetical protein B456_008G251000 [Gossypium raimondii]
Length=534

 Score =   110 bits (276),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 79/129 (61%), Gaps = 20/129 (16%)
 Frame = +3

Query  18   MGSCNSIPS--SPFA-ATSAGG------------ESDPPPPK-----NDITVLppsqppp  137
            MG+CNS PS  S F   T+ GG             S P PPK     N  +         
Sbjct  1    MGNCNSQPSADSQFRPETNTGGGPNHGINVLPADASAPRPPKPSTHHNLSSSSAAPNHHT  60

Query  138  prpFLSGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLL  317
                   +GRVLGRPMEDV STY+FG ELGRGQFGVTYLVTH++T ++ ACKSIATRKL+
Sbjct  61   APSATPPIGRVLGRPMEDVRSTYVFGRELGRGQFGVTYLVTHKETNQQFACKSIATRKLI  120

Query  318  SKDDVDDVR  344
            ++DD++DVR
Sbjct  121  NRDDIEDVR  129



>ref|XP_007040388.1| Calcium-dependent protein kinase 6 isoform 2 [Theobroma cacao]
 gb|EOY24889.1| Calcium-dependent protein kinase 6 isoform 2 [Theobroma cacao]
Length=476

 Score =   110 bits (274),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 59/126 (47%), Positives = 78/126 (62%), Gaps = 17/126 (13%)
 Frame = +3

Query  18   MGSCNSIPSSPFA----ATSAGGESD---------PPPPKNDITVLppsqpppprpFLSG  158
            MG+CN  PS+       + S GG  +         PP P+   T    S         + 
Sbjct  1    MGNCNGHPSADNQFRPDSDSGGGPHNGINIKAGPSPPRPQQHSTTHHSSSAASNHRLATP  60

Query  159  ----VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKD  326
                +GRVLGRPMEDV S Y+FG ELGRGQFG+TYLVTH++T+++ ACKSIATRKL+++D
Sbjct  61   TTPPIGRVLGRPMEDVRSNYVFGRELGRGQFGITYLVTHKETKQQFACKSIATRKLINRD  120

Query  327  DVDDVR  344
            D++DVR
Sbjct  121  DIEDVR  126



>ref|XP_003517491.2| PREDICTED: calcium-dependent protein kinase 3-like [Glycine max]
Length=528

 Score =   110 bits (274),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 76/113 (67%), Gaps = 12/113 (11%)
 Frame = +3

Query  12   LQMGSCNSIPSSPFAATSAGGESDPPPPKND--ITVLppsqpppprpFLSGVGRVLGRPM  185
            + MG+CNS  SS    T    +  P P  N   ITVLPP+           VGRVLGRPM
Sbjct  22   VSMGNCNSEASS---QTQPHSDHHPQPRSNSNGITVLPPNSK-------PSVGRVLGRPM  71

Query  186  EDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVR  344
            EDV STY FG ELGRGQFGVTYLVTH+ T+++ ACKSIAT KL+ +DD++DVR
Sbjct  72   EDVRSTYTFGRELGRGQFGVTYLVTHKHTKQQFACKSIATPKLVHRDDLEDVR  124



>ref|XP_007040387.1| Calcium-dependent protein kinase 6 isoform 1 [Theobroma cacao]
 gb|EOY24888.1| Calcium-dependent protein kinase 6 isoform 1 [Theobroma cacao]
Length=531

 Score =   110 bits (274),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 59/126 (47%), Positives = 78/126 (62%), Gaps = 17/126 (13%)
 Frame = +3

Query  18   MGSCNSIPSSPFA----ATSAGGESD---------PPPPKNDITVLppsqpppprpFLSG  158
            MG+CN  PS+       + S GG  +         PP P+   T    S         + 
Sbjct  1    MGNCNGHPSADNQFRPDSDSGGGPHNGINIKAGPSPPRPQQHSTTHHSSSAASNHRLATP  60

Query  159  ----VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKD  326
                +GRVLGRPMEDV S Y+FG ELGRGQFG+TYLVTH++T+++ ACKSIATRKL+++D
Sbjct  61   TTPPIGRVLGRPMEDVRSNYVFGRELGRGQFGITYLVTHKETKQQFACKSIATRKLINRD  120

Query  327  DVDDVR  344
            D++DVR
Sbjct  121  DIEDVR  126



>ref|NP_001169721.1| uncharacterized LOC100383602 [Zea mays]
 gb|ACN34646.1| unknown [Zea mays]
 tpg|DAA58515.1| TPA: putative calcium-dependent protein kinase family protein 
[Zea mays]
Length=524

 Score =   110 bits (274),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 49/63 (78%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +3

Query  156  GVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVD  335
             VGRVLGRPMEDV +TY FG ELGRGQFGVTYLVTHR+T +R ACKSIATRKL+ +DD++
Sbjct  56   AVGRVLGRPMEDVKATYTFGRELGRGQFGVTYLVTHRETGQRFACKSIATRKLVHRDDIE  115

Query  336  DVR  344
            DVR
Sbjct  116  DVR  118



>gb|KHG11508.1| Calcium-dependent protein kinase 3 [Gossypium arboreum]
Length=534

 Score =   110 bits (274),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 80/129 (62%), Gaps = 20/129 (16%)
 Frame = +3

Query  18   MGSCNSIPS--SPF-AATSAGG------------ESDPPPPK-----NDITVLppsqppp  137
            MG+CNS PS  S F   T+ GG             S P PPK     N  +  P      
Sbjct  1    MGNCNSQPSADSQFRPETNTGGGPNHGINVLPADASAPRPPKPSTHHNLSSSSPAPNHHT  60

Query  138  prpFLSGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLL  317
                   +GRVLGRPMEDV STY+FG ELGRGQFGVTYLVTH++T ++ ACKSIATRKL+
Sbjct  61   APSTTPPIGRVLGRPMEDVRSTYVFGRELGRGQFGVTYLVTHKETNQQFACKSIATRKLI  120

Query  318  SKDDVDDVR  344
            ++DD++DVR
Sbjct  121  NRDDIEDVR  129



>gb|AIU98505.1| calcium-dependent protein kinase [Musa acuminata AAA Group]
Length=517

 Score =   109 bits (273),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 49/65 (75%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = +3

Query  150  LSGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDD  329
            LS VGRVLGRPME+V +TY FG ELGRGQFG+TYLVTHR+TRE+ ACKSIATRKL+ ++D
Sbjct  45   LSNVGRVLGRPMENVRATYSFGRELGRGQFGITYLVTHRETREQFACKSIATRKLVHEED  104

Query  330  VDDVR  344
            ++DVR
Sbjct  105  LEDVR  109



>ref|XP_010676387.1| PREDICTED: calcium-dependent protein kinase 3 [Beta vulgaris 
subsp. vulgaris]
Length=526

 Score =   109 bits (273),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 47/64 (73%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +3

Query  153  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  332
            S +GRVLGRPMEDV  +YIFG ELGRGQFG+TYLVTH++T+   ACKSIATRKL+++DD+
Sbjct  58   SNIGRVLGRPMEDVRESYIFGRELGRGQFGITYLVTHKQTKLNFACKSIATRKLINQDDI  117

Query  333  DDVR  344
            DDVR
Sbjct  118  DDVR  121



>ref|XP_010106587.1| Calcium-dependent protein kinase 3 [Morus notabilis]
 gb|EXC10841.1| Calcium-dependent protein kinase 3 [Morus notabilis]
Length=639

 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            VGRVLGRPMEDV STYIFG ELGRGQFGVTYLVTH++T+++ ACKSIATRKL+++DDV+D
Sbjct  60   VGRVLGRPMEDVRSTYIFGRELGRGQFGVTYLVTHKETKQQFACKSIATRKLVNRDDVED  119

Query  339  VR  344
            VR
Sbjct  120  VR  121



>ref|XP_009386326.1| PREDICTED: calcium-dependent protein kinase 3-like [Musa acuminata 
subsp. malaccensis]
Length=517

 Score =   109 bits (273),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 49/65 (75%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = +3

Query  150  LSGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDD  329
            LS VGRVLGRPME+V +TY FG ELGRGQFG+TYLVTHR+TRE+ ACKSIATRKL+ ++D
Sbjct  45   LSNVGRVLGRPMENVRATYSFGRELGRGQFGITYLVTHRETREQFACKSIATRKLVHEED  104

Query  330  VDDVR  344
            ++DVR
Sbjct  105  LEDVR  109



>ref|XP_004511540.1| PREDICTED: calcium-dependent protein kinase 3-like [Cicer arietinum]
Length=509

 Score =   109 bits (273),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 63/112 (56%), Positives = 78/112 (70%), Gaps = 10/112 (9%)
 Frame = +3

Query  18   MGSCNSIPSSPFAATSAGGESDP---PPPKNDITVLppsqpppprpFLSGVGRVLGRPME  188
            MG+C S P S   + S    S+P   PPP      L P+QP P     S +GRVLGRPME
Sbjct  1    MGNCKSEPIS--NSESQPPHSNPISTPPPD-----LNPNQPTPTATPTSTMGRVLGRPME  53

Query  189  DVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVR  344
            D+ STY FG ELGRGQFGVTYLVTH+ T+E+ ACKSIATRK++++ D+DD+R
Sbjct  54   DIRSTYTFGRELGRGQFGVTYLVTHKITKEQFACKSIATRKIINRGDLDDIR  105



>ref|XP_004503656.1| PREDICTED: calcium-dependent protein kinase 3-like [Cicer arietinum]
Length=511

 Score =   108 bits (271),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 47/61 (77%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = +3

Query  162  GRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDV  341
            GR+L RPMEDV ST+IFG ELGRGQFGVTYLVTH+ T+E+ ACKSIATRKL+++DD+DDV
Sbjct  47   GRILNRPMEDVRSTFIFGRELGRGQFGVTYLVTHKVTKEQFACKSIATRKLINRDDIDDV  106

Query  342  R  344
            R
Sbjct  107  R  107



>ref|XP_002304529.2| hypothetical protein POPTR_0003s13380g [Populus trichocarpa]
 gb|EEE79508.2| hypothetical protein POPTR_0003s13380g [Populus trichocarpa]
Length=523

 Score =   108 bits (269),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 77/119 (65%), Gaps = 10/119 (8%)
 Frame = +3

Query  18   MGSCNSIPSSPFAATSAGG-ESDPPPPKNDITVL---------ppsqpppprpFLSGVGR  167
            MG+CNS+PSS    T++   +    PP   I VL                     + VGR
Sbjct  1    MGNCNSLPSSSSTTTTSTTTDHHNTPPNGVIKVLPPTATPPPRSQHHHHSSASGSTAVGR  60

Query  168  VLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVR  344
            VLGRP EDV +TYIFG ELGRGQFGVTYLVTH++T++  ACKSIA+RKL+++DD++DVR
Sbjct  61   VLGRPREDVRNTYIFGRELGRGQFGVTYLVTHKETKQHFACKSIASRKLINRDDIEDVR  119



>ref|XP_006655639.1| PREDICTED: calcium-dependent protein kinase 3-like, partial [Oryza 
brachyantha]
Length=470

 Score =   107 bits (268),  Expect = 5e-25, Method: Composition-based stats.
 Identities = 50/63 (79%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +3

Query  156  GVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVD  335
            GVGRVLGRPMEDV +TY FG ELGRGQFGVTYL TH+ T  R ACKSIA RKL  KDDVD
Sbjct  2    GVGRVLGRPMEDVRATYTFGRELGRGQFGVTYLATHKPTGRRYACKSIAARKLARKDDVD  61

Query  336  DVR  344
            DVR
Sbjct  62   DVR  64



>ref|XP_004969206.1| PREDICTED: calcium-dependent protein kinase 3-like [Setaria italica]
Length=522

 Score =   108 bits (269),  Expect = 5e-25, Method: Composition-based stats.
 Identities = 48/61 (79%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +3

Query  162  GRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDV  341
            GRVLGRPMEDV +TY FG ELGRGQFGVTYLVTHR+T +R ACKSIATRKL+ +DD++DV
Sbjct  56   GRVLGRPMEDVRATYTFGRELGRGQFGVTYLVTHRETGQRFACKSIATRKLVHRDDIEDV  115

Query  342  R  344
            R
Sbjct  116  R  116



>ref|XP_002509886.1| calcium-dependent protein kinase, putative [Ricinus communis]
 gb|EEF51273.1| calcium-dependent protein kinase, putative [Ricinus communis]
Length=528

 Score =   107 bits (268),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +3

Query  153  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  332
            + VGRVLGRPMEDV S Y FG ELGRGQFGVTYLVTH++T+++ ACKSIATRKL+++DD+
Sbjct  60   AAVGRVLGRPMEDVRSIYAFGRELGRGQFGVTYLVTHKETKQQFACKSIATRKLINRDDI  119

Query  333  DDVR  344
            +DVR
Sbjct  120  EDVR  123



>ref|XP_010055801.1| PREDICTED: calcium-dependent protein kinase 3 [Eucalyptus grandis]
 gb|KCW72352.1| hypothetical protein EUGRSUZ_E00806 [Eucalyptus grandis]
Length=539

 Score =   108 bits (269),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            VGRVLGRPMEDV +TY+FG ELGRGQFGVTYLVTH++T+++ ACKSIA RKL++KDD++D
Sbjct  68   VGRVLGRPMEDVRATYVFGRELGRGQFGVTYLVTHKETKQQFACKSIAARKLVNKDDIED  127

Query  339  VR  344
            VR
Sbjct  128  VR  129



>ref|XP_003538256.1| PREDICTED: calcium-dependent protein kinase 3-like isoform 1 
[Glycine max]
Length=505

 Score =   107 bits (267),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 74/109 (68%), Gaps = 8/109 (7%)
 Frame = +3

Query  18   MGSCNSIPSSPFAATSAGGESDPPPPKNDITVLppsqpppprpFLSGVGRVLGRPMEDVH  197
            MG+CNS PSS      +      P P N ITVLPP+           VGRVLGRPMED  
Sbjct  1    MGNCNSEPSSQ-TQPHSDHHHHHPQPSNGITVLPPNSK-------PSVGRVLGRPMEDAR  52

Query  198  STYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVR  344
            STY FG ELGRGQFGVTY VTH+ T+++ ACKSIATRKL+ +DD++DVR
Sbjct  53   STYTFGRELGRGQFGVTYQVTHKHTKQQFACKSIATRKLVHRDDLEDVR  101



>ref|NP_001152509.1| calcium-dependent protein kinase, isoform 2 [Zea mays]
 gb|ACG47976.1| calcium-dependent protein kinase, isoform 2 [Zea mays]
 gb|AFW83318.1| putative calcium-dependent protein kinase family protein isoform 
1 [Zea mays]
 gb|AFW83319.1| putative calcium-dependent protein kinase family protein isoform 
2 [Zea mays]
Length=530

 Score =   107 bits (268),  Expect = 8e-25, Method: Composition-based stats.
 Identities = 48/65 (74%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +3

Query  150  LSGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDD  329
            +  VGRVLGRPMEDV +TY FG ELGRGQFGVTYLVTH +T +R ACKSIATRKL+ +DD
Sbjct  60   VGAVGRVLGRPMEDVRATYTFGRELGRGQFGVTYLVTHSETGQRFACKSIATRKLVHRDD  119

Query  330  VDDVR  344
            ++DVR
Sbjct  120  IEDVR  124



>ref|XP_011073451.1| PREDICTED: calcium-dependent protein kinase 3-like [Sesamum indicum]
Length=517

 Score =   107 bits (266),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +3

Query  153  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  332
            +G GRVLGRPM DVHS YIFG ELGRGQFGVT+LVTHR TR+  ACKSIATRKL++ DDV
Sbjct  49   TGTGRVLGRPMSDVHSAYIFGRELGRGQFGVTHLVTHRATRQTFACKSIATRKLVTPDDV  108

Query  333  DDVR  344
             DVR
Sbjct  109  ADVR  112



>gb|KJB19075.1| hypothetical protein B456_003G084000 [Gossypium raimondii]
Length=508

 Score =   106 bits (265),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +3

Query  156  GVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVD  335
             VGRVLGRPMEDV STY+F GELGRGQFG+TYLVTH+KT+++ ACKSI  RKL++++D++
Sbjct  53   AVGRVLGRPMEDVRSTYVFSGELGRGQFGITYLVTHKKTKQQFACKSITKRKLINREDIE  112

Query  336  DVR  344
            DVR
Sbjct  113  DVR  115



>gb|AFW83320.1| putative calcium-dependent protein kinase family protein [Zea 
mays]
Length=373

 Score =   105 bits (261),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +3

Query  150  LSGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDD  329
            +  VGRVLGRPMEDV +TY FG ELGRGQFGVTYLVTH +T +R ACKSIATRKL+ +DD
Sbjct  60   VGAVGRVLGRPMEDVRATYTFGRELGRGQFGVTYLVTHSETGQRFACKSIATRKLVHRDD  119

Query  330  VDDVR  344
            ++DVR
Sbjct  120  IEDVR  124



>ref|XP_009416404.1| PREDICTED: calcium-dependent protein kinase 3-like [Musa acuminata 
subsp. malaccensis]
Length=519

 Score =   106 bits (264),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +3

Query  153  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  332
            S VGRVLGRPMEDV +TY FG ELGRGQFGVTYLVTHR T ++ ACKSIATRKL+ +DD+
Sbjct  49   SDVGRVLGRPMEDVRATYTFGRELGRGQFGVTYLVTHRGTTKQFACKSIATRKLVRQDDL  108

Query  333  DDVR  344
            DDVR
Sbjct  109  DDVR  112



>gb|AIU98501.1| calcium-dependent protein kinase [Musa acuminata AAA Group]
Length=521

 Score =   106 bits (264),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +3

Query  153  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  332
            S VGRVLGRPMEDV +TY FG ELGRGQFGVTYLVTHR T ++ ACKSIATRKL+ +DD+
Sbjct  51   SDVGRVLGRPMEDVRATYTFGRELGRGQFGVTYLVTHRGTTKQFACKSIATRKLVRQDDL  110

Query  333  DDVR  344
            DDVR
Sbjct  111  DDVR  114



>gb|KHN16772.1| Calcium-dependent protein kinase 3 [Glycine soja]
Length=160

 Score =   101 bits (251),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +3

Query  171  LGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVR  344
            LGRPMED+ S YIFG ELGRGQFGVTYLVTH+ T+E+ ACKSIATRKL+++DD+DD+R
Sbjct  43   LGRPMEDMRSIYIFGRELGRGQFGVTYLVTHKATKEQFACKSIATRKLVNRDDIDDIR  100



>ref|XP_011022588.1| PREDICTED: calcium-dependent protein kinase 3-like [Populus euphratica]
 ref|XP_011022589.1| PREDICTED: calcium-dependent protein kinase 3-like [Populus euphratica]
 ref|XP_011022590.1| PREDICTED: calcium-dependent protein kinase 3-like [Populus euphratica]
Length=517

 Score =   105 bits (263),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +3

Query  153  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  332
            + VGRVLGRP EDV +TYIFG ELGRGQFGVTYLVTH++T++  ACKSIA+RKL+++DD+
Sbjct  50   TAVGRVLGRPREDVRNTYIFGRELGRGQFGVTYLVTHKETKQHFACKSIASRKLINRDDI  109

Query  333  DDVR  344
            +DVR
Sbjct  110  EDVR  113



>gb|KHG03431.1| Calcium-dependent protein kinase 3 [Gossypium arboreum]
Length=604

 Score =   106 bits (264),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +3

Query  156  GVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVD  335
             VGRVLGRPMEDV STY+F GELGRGQFG+TYLVTH+KT+++ ACKSI  RKL++++D++
Sbjct  52   AVGRVLGRPMEDVRSTYVFSGELGRGQFGITYLVTHKKTKQQFACKSIPKRKLINREDIE  111

Query  336  DVR  344
            DVR
Sbjct  112  DVR  114



>ref|XP_003569386.1| PREDICTED: calcium-dependent protein kinase 3-like [Brachypodium 
distachyon]
Length=526

 Score =   105 bits (262),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 46/63 (73%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = +3

Query  156  GVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVD  335
             +GRVLGRPMEDV +TY FG ELGRGQFGVTYLVTH+ T +R ACKSIATRKL+ +DD++
Sbjct  58   AMGRVLGRPMEDVRATYTFGRELGRGQFGVTYLVTHKATGQRFACKSIATRKLVHRDDIE  117

Query  336  DVR  344
            DV+
Sbjct  118  DVQ  120



>gb|EEC71113.1| hypothetical protein OsI_02910 [Oryza sativa Indica Group]
Length=520

 Score =   105 bits (262),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 47/62 (76%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            +GRVLGRPMEDV +TY FG ELGRGQFGVTYLVTH+ T +R ACKSIATRKL  +DD++D
Sbjct  53   MGRVLGRPMEDVRATYTFGRELGRGQFGVTYLVTHKATGKRFACKSIATRKLAHRDDIED  112

Query  339  VR  344
            VR
Sbjct  113  VR  114



>gb|EAZ12734.1| hypothetical protein OsJ_02652 [Oryza sativa Japonica Group]
 dbj|BAH01699.1| unnamed protein product [Oryza sativa Japonica Group]
Length=518

 Score =   105 bits (262),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 47/62 (76%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            +GRVLGRPMEDV +TY FG ELGRGQFGVTYLVTH+ T +R ACKSIATRKL  +DD++D
Sbjct  51   MGRVLGRPMEDVRATYTFGRELGRGQFGVTYLVTHKATGKRFACKSIATRKLAHRDDIED  110

Query  339  VR  344
            VR
Sbjct  111  VR  112



>dbj|BAJ95679.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=520

 Score =   105 bits (261),  Expect = 6e-24, Method: Composition-based stats.
 Identities = 46/63 (73%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = +3

Query  156  GVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVD  335
             +GRVLGRPMEDV +TY FG ELGRGQFGVTYLVTH+ T +R ACKSIATRKL+ +DD++
Sbjct  52   AMGRVLGRPMEDVRATYTFGRELGRGQFGVTYLVTHKATGQRFACKSIATRKLVHRDDIE  111

Query  336  DVR  344
            DV+
Sbjct  112  DVQ  114



>gb|ABY59010.1| calcium-dependent protein kinase [Triticum aestivum]
Length=518

 Score =   105 bits (261),  Expect = 6e-24, Method: Composition-based stats.
 Identities = 46/63 (73%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = +3

Query  156  GVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVD  335
             +GRVLGRPMEDV +TY FG ELGRGQFGVTYLVTH+ T +R ACKSIATRKL+ +DD++
Sbjct  50   AMGRVLGRPMEDVRATYTFGRELGRGQFGVTYLVTHKATGQRFACKSIATRKLVHRDDIE  109

Query  336  DVR  344
            DV+
Sbjct  110  DVQ  112



>emb|CAF18446.1| putative calcium-dependent protein kinase [Triticum aestivum]
 emb|CDM83446.1| unnamed protein product [Triticum aestivum]
Length=518

 Score =   105 bits (261),  Expect = 6e-24, Method: Composition-based stats.
 Identities = 46/63 (73%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = +3

Query  156  GVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVD  335
             +GRVLGRPMEDV +TY FG ELGRGQFGVTYLVTH+ T +R ACKSIATRKL+ +DD++
Sbjct  50   AMGRVLGRPMEDVRATYTFGRELGRGQFGVTYLVTHKATGQRFACKSIATRKLVHRDDIE  109

Query  336  DVR  344
            DV+
Sbjct  110  DVQ  112



>gb|ACA63885.1| calcium-dependent protein kinase [Hordeum vulgare]
Length=520

 Score =   105 bits (261),  Expect = 7e-24, Method: Composition-based stats.
 Identities = 46/63 (73%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = +3

Query  156  GVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVD  335
             +GRVLGRPMEDV +TY FG ELGRGQFGVTYLVTH+ T +R ACKSIATRKL+ +DD++
Sbjct  52   AMGRVLGRPMEDVRATYTFGRELGRGQFGVTYLVTHKATGQRFACKSIATRKLVHRDDIE  111

Query  336  DVR  344
            DV+
Sbjct  112  DVQ  114



>ref|XP_011026960.1| PREDICTED: calcium-dependent protein kinase 3 [Populus euphratica]
Length=515

 Score =   105 bits (261),  Expect = 7e-24, Method: Composition-based stats.
 Identities = 62/113 (55%), Positives = 81/113 (72%), Gaps = 8/113 (7%)
 Frame = +3

Query  18   MGSCNSIPSSPFAATSAGGESDPPPPKNDITVLppsqppp-prpFL----SGVGRVLGRP  182
            MG+CNS+ SS   +++     + PP    I VLPP+  PP    FL    + VGRVLGRP
Sbjct  1    MGNCNSLSSS---SSTTTNHRNSPPSNGGIKVLPPNASPPPRSQFLHHSSAAVGRVLGRP  57

Query  183  MEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDV  341
            MEDV +TY FG E+GRGQFGVTYLVTH++T++  ACKSIA RKL+++DD++DV
Sbjct  58   MEDVRNTYTFGREVGRGQFGVTYLVTHKETKQHFACKSIAKRKLINRDDIEDV  110



>ref|XP_007209903.1| hypothetical protein PRUPE_ppa004162mg [Prunus persica]
 gb|EMJ11102.1| hypothetical protein PRUPE_ppa004162mg [Prunus persica]
Length=526

 Score =   104 bits (260),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            +GRVLGRPMEDV +TY FG ELGRGQFGVTYLVTH+  +++ ACKSIATRKL++ DDV+D
Sbjct  60   IGRVLGRPMEDVRATYTFGRELGRGQFGVTYLVTHKHNKQQFACKSIATRKLINHDDVED  119

Query  339  VR  344
            VR
Sbjct  120  VR  121



>ref|XP_010529626.1| PREDICTED: calcium-dependent protein kinase 3-like [Tarenaya 
hassleriana]
Length=513

 Score =   104 bits (259),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 44/62 (71%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            +GR+LGRPME+V STY FG ELGRGQFGVTYLVTH++TR++ ACKSI TR+L+ +DD++D
Sbjct  47   IGRILGRPMENVRSTYEFGHELGRGQFGVTYLVTHKETRKQFACKSIPTRRLVHRDDIED  106

Query  339  VR  344
            VR
Sbjct  107  VR  108



>ref|XP_004961071.1| PREDICTED: calcium-dependent protein kinase 3-like [Setaria italica]
Length=546

 Score =   103 bits (258),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 48/63 (76%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = +3

Query  156  GVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVD  335
            GVGRVLGRPMEDV + Y FG ELGRGQFGVTYL TH+ T  R ACKSIA RKL  +DDVD
Sbjct  78   GVGRVLGRPMEDVRAAYTFGRELGRGQFGVTYLATHKPTGRRYACKSIAARKLAHRDDVD  137

Query  336  DVR  344
            DVR
Sbjct  138  DVR  140



>ref|NP_001056455.1| Os05g0585500 [Oryza sativa Japonica Group]
 gb|AAT47064.1| putative calcium-dependent protein kinase [Oryza sativa Japonica 
Group]
 dbj|BAF18369.1| Os05g0585500 [Oryza sativa Japonica Group]
Length=542

 Score =   103 bits (257),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 48/63 (76%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = +3

Query  156  GVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVD  335
            GVGRVLGRPMEDV +TY FG ELGRGQFGVTYL TH+ T  R ACKSIA RKL   DD+D
Sbjct  74   GVGRVLGRPMEDVRATYTFGRELGRGQFGVTYLATHKPTGRRYACKSIAARKLARPDDLD  133

Query  336  DVR  344
            DVR
Sbjct  134  DVR  136



>gb|KJB39672.1| hypothetical protein B456_007G025000 [Gossypium raimondii]
Length=431

 Score =   102 bits (254),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            +GRV GRPMEDV STY+ G ELGRGQFGVTYLVTH++T++  ACKSI+ RKLL++DD++D
Sbjct  64   IGRVFGRPMEDVRSTYVVGRELGRGQFGVTYLVTHKETKQHFACKSISRRKLLTRDDIED  123

Query  339  VR  344
            VR
Sbjct  124  VR  125



>ref|XP_006283520.1| hypothetical protein CARUB_v10004572mg [Capsella rubella]
 gb|ACC91261.1| putative calcium-dependent protein kinase [Capsella rubella]
 gb|EOA16418.1| hypothetical protein CARUB_v10004572mg [Capsella rubella]
Length=529

 Score =   103 bits (257),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 44/61 (72%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +3

Query  162  GRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDV  341
            GR+LGRPME+V  TY FG ELGRGQFGVTYLVTH++T+++ ACKSI TR+L+ KDD+DDV
Sbjct  63   GRILGRPMENVKGTYEFGRELGRGQFGVTYLVTHKETKQQFACKSIPTRRLVHKDDIDDV  122

Query  342  R  344
            R
Sbjct  123  R  123



>gb|KHG14847.1| Calcium-dependent protein kinase 3 [Gossypium arboreum]
Length=530

 Score =   103 bits (257),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            +GRV GRPMEDV STYI G ELGRGQFGVTYLVTH++T++  ACKSI+ RKLL++DD++D
Sbjct  64   IGRVFGRPMEDVRSTYIVGRELGRGQFGVTYLVTHKETKQHFACKSISRRKLLNRDDIED  123

Query  339  VR  344
            VR
Sbjct  124  VR  125



>gb|KJB39669.1| hypothetical protein B456_007G025000 [Gossypium raimondii]
Length=438

 Score =   102 bits (254),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            +GRV GRPMEDV STY+ G ELGRGQFGVTYLVTH++T++  ACKSI+ RKLL++DD++D
Sbjct  64   IGRVFGRPMEDVRSTYVVGRELGRGQFGVTYLVTHKETKQHFACKSISRRKLLTRDDIED  123

Query  339  VR  344
            VR
Sbjct  124  VR  125



>ref|XP_008656081.1| PREDICTED: calcium-dependent protein kinase 3-like [Zea mays]
 gb|AFW81270.1| putative calcium-dependent protein kinase family protein isoform 
1 [Zea mays]
 gb|AFW81271.1| putative calcium-dependent protein kinase family protein isoform 
2 [Zea mays]
Length=539

 Score =   103 bits (257),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 48/62 (77%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            VGRVLGRPMEDV ++Y FG ELGRGQFGVTYL TH+ T  R ACKSIATRKL   DDVDD
Sbjct  72   VGRVLGRPMEDVRASYTFGRELGRGQFGVTYLATHKPTGRRYACKSIATRKLAHSDDVDD  131

Query  339  VR  344
            VR
Sbjct  132  VR  133



>ref|XP_008792394.1| PREDICTED: calcium-dependent protein kinase 3-like [Phoenix dactylifera]
Length=531

 Score =   103 bits (256),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            VGRVLGRPMEDV + Y FG ELGRGQFGVTYLVT ++T ERLACKSIATRKL+ +DD++D
Sbjct  65   VGRVLGRPMEDVRAFYTFGRELGRGQFGVTYLVTRKETGERLACKSIATRKLIHRDDIED  124

Query  339  VR  344
            VR
Sbjct  125  VR  126



>gb|EYU40050.1| hypothetical protein MIMGU_mgv1a011511mg [Erythranthe guttata]
Length=279

 Score =   100 bits (250),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +3

Query  153  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  332
            +G GR+LGRPM DVHS Y FG ELGRGQFGVT+LVT R TRE  ACKSIATRKL++ DDV
Sbjct  57   TGNGRILGRPMADVHSVYTFGRELGRGQFGVTHLVTRRATREAFACKSIATRKLVTADDV  116

Query  333  DDVR  344
             DVR
Sbjct  117  ADVR  120



>gb|KJB39670.1| hypothetical protein B456_007G025000 [Gossypium raimondii]
 gb|KJB39671.1| hypothetical protein B456_007G025000 [Gossypium raimondii]
Length=504

 Score =   102 bits (254),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            +GRV GRPMEDV STY+ G ELGRGQFGVTYLVTH++T++  ACKSI+ RKLL++DD++D
Sbjct  64   IGRVFGRPMEDVRSTYVVGRELGRGQFGVTYLVTHKETKQHFACKSISRRKLLTRDDIED  123

Query  339  VR  344
            VR
Sbjct  124  VR  125



>ref|XP_004298849.1| PREDICTED: calcium-dependent protein kinase 3 [Fragaria vesca 
subsp. vesca]
Length=519

 Score =   102 bits (254),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +3

Query  153  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  332
            S VGRVLG+PMEDV +TY FG ELGRGQFGVTYLVTH++++ + ACKSIATRKL++ DDV
Sbjct  51   SPVGRVLGKPMEDVRATYTFGRELGRGQFGVTYLVTHKESKLQFACKSIATRKLVNHDDV  110

Query  333  DDVR  344
            +DVR
Sbjct  111  EDVR  114



>ref|XP_002455974.1| hypothetical protein SORBIDRAFT_03g028340 [Sorghum bicolor]
 gb|EES01094.1| hypothetical protein SORBIDRAFT_03g028340 [Sorghum bicolor]
Length=525

 Score =   102 bits (254),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 45/58 (78%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +3

Query  171  LGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVR  344
            LGRPMEDV +TY FG ELGRGQFGVTYLVTHR+T +R ACKSIATRKL+ +DD++DVR
Sbjct  62   LGRPMEDVRATYTFGRELGRGQFGVTYLVTHRETGQRFACKSIATRKLVHRDDIEDVR  119



>gb|KJB39673.1| hypothetical protein B456_007G025000 [Gossypium raimondii]
Length=530

 Score =   102 bits (254),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            +GRV GRPMEDV STY+ G ELGRGQFGVTYLVTH++T++  ACKSI+ RKLL++DD++D
Sbjct  64   IGRVFGRPMEDVRSTYVVGRELGRGQFGVTYLVTHKETKQHFACKSISRRKLLTRDDIED  123

Query  339  VR  344
            VR
Sbjct  124  VR  125



>ref|XP_009334485.1| PREDICTED: calcium-dependent protein kinase 3 [Pyrus x bretschneideri]
Length=525

 Score =   102 bits (253),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            +GRVLGRPMEDV STY FG ELGRGQFGVTYLVT ++T++  ACKSIATRKL ++DDV+D
Sbjct  59   IGRVLGRPMEDVRSTYTFGRELGRGQFGVTYLVTDKQTKQLFACKSIATRKLSNQDDVED  118

Query  339  VR  344
            VR
Sbjct  119  VR  120



>ref|XP_008451994.1| PREDICTED: calcium-dependent protein kinase 3 [Cucumis melo]
Length=527

 Score =   102 bits (253),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 73/122 (60%), Gaps = 13/122 (11%)
 Frame = +3

Query  18   MGSCNSIPSSPFAATSAGGESDPP--PPKNDITVLppsqpppprpFLS-----------G  158
            MG+C+ +P+   +     G SD    PP N +  + P    P  P               
Sbjct  1    MGNCSGLPTGQTSTAYPLGHSDADYRPPSNGVVKVLPPDSDPSLPPPLPKEISTSSAPPA  60

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            VGRVLGRP  DV S Y F GELGRGQFGVTYLVTH++T++  ACKSIATRKL+ +DDV+D
Sbjct  61   VGRVLGRPFSDVRSFYSFRGELGRGQFGVTYLVTHKETKQDFACKSIATRKLIDQDDVED  120

Query  339  VR  344
            VR
Sbjct  121  VR  122



>ref|XP_010433881.1| PREDICTED: calcium-dependent protein kinase 3-like [Camelina 
sativa]
Length=528

 Score =   102 bits (253),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 43/61 (70%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +3

Query  162  GRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDV  341
            GR+LGRPME+V  +Y FG ELGRGQFGVTYLVTH++T+++ ACKSI TR+L+ KDD+DDV
Sbjct  62   GRILGRPMENVRGSYEFGPELGRGQFGVTYLVTHKETKQQFACKSIPTRRLVHKDDIDDV  121

Query  342  R  344
            R
Sbjct  122  R  122



>ref|XP_010439150.1| PREDICTED: calcium-dependent protein kinase 3-like [Camelina 
sativa]
Length=528

 Score =   102 bits (253),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 43/61 (70%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +3

Query  162  GRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDV  341
            GR+LGRPME+V  +Y FG ELGRGQFGVTYLVTH++T+++ ACKSI TR+L+ KDD+DDV
Sbjct  62   GRILGRPMENVRGSYEFGPELGRGQFGVTYLVTHKETKQQFACKSIPTRRLVHKDDIDDV  121

Query  342  R  344
            R
Sbjct  122  R  122



>ref|XP_010509303.1| PREDICTED: calcium-dependent protein kinase 3 [Camelina sativa]
Length=529

 Score =   101 bits (252),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 43/61 (70%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +3

Query  162  GRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDV  341
            GR+LGRPME+V  +Y FG ELGRGQFGVTYLVTH++T+++ ACKSI TR+L+ KDD+DDV
Sbjct  64   GRILGRPMENVRGSYEFGPELGRGQFGVTYLVTHKETKQQFACKSIPTRRLVHKDDIDDV  123

Query  342  R  344
            R
Sbjct  124  R  124



>dbj|BAD61167.1| putative calcium-dependent protein kinase [Oryza sativa Japonica 
Group]
Length=713

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            +GRVLGRPMEDV +TY FG ELGRGQFGVTYLVTH+ T +R ACKSIATRKL  +DD++D
Sbjct  246  MGRVLGRPMEDVRATYTFGRELGRGQFGVTYLVTHKATGKRFACKSIATRKLAHRDDIED  305

Query  339  VR  344
            VR
Sbjct  306  VR  307



>gb|AAL38596.1|AF446863_1 AT4g23650/F9D16_120 [Arabidopsis thaliana]
 gb|AAK96512.1| AT4g23650/F9D16_120 [Arabidopsis thaliana]
Length=529

 Score =   101 bits (252),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 43/61 (70%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +3

Query  162  GRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDV  341
            GR+LGRPME+V  TY FG ELGRGQFGVTYLVTH++T++++ACKSI TR+L+ KDD++DV
Sbjct  64   GRILGRPMEEVRRTYEFGRELGRGQFGVTYLVTHKETKQQVACKSIPTRRLVHKDDIEDV  123

Query  342  R  344
            R
Sbjct  124  R  124



>ref|NP_194096.1| calcium-dependent protein kinase 6 [Arabidopsis thaliana]
 sp|Q42479.1|CDPK3_ARATH RecName: Full=Calcium-dependent protein kinase 3; AltName: Full=Calcium-dependent 
protein kinase isoform CDPK6; Short=AtCDPK6 
[Arabidopsis thaliana]
 gb|AAK60302.1|AF385710_1 AT4g23650/F9D16_120 [Arabidopsis thaliana]
 gb|AAA67654.1| calcium-dependent protein kinase [Arabidopsis thaliana]
 gb|AAA67656.1| calcium-dependent protein kinase [Arabidopsis thaliana]
 emb|CAA23031.1| calcium-dependent protein kinase (CDPK6) [Arabidopsis thaliana]
 emb|CAB79320.1| calcium-dependent protein kinase (CDPK6) [Arabidopsis thaliana]
 gb|AAL87385.1| AT4g23650/F9D16_120 [Arabidopsis thaliana]
 gb|AAM65176.1| calcium-dependent protein kinase CDPK6 [Arabidopsis thaliana]
 gb|AAN31878.1| putative calcium-dependent protein kinase (CDPK6) [Arabidopsis 
thaliana]
 gb|AEE84789.1| calcium-dependent protein kinase 6 [Arabidopsis thaliana]
Length=529

 Score =   101 bits (252),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 43/61 (70%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +3

Query  162  GRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDV  341
            GR+LGRPME+V  TY FG ELGRGQFGVTYLVTH++T++++ACKSI TR+L+ KDD++DV
Sbjct  64   GRILGRPMEEVRRTYEFGRELGRGQFGVTYLVTHKETKQQVACKSIPTRRLVHKDDIEDV  123

Query  342  R  344
            R
Sbjct  124  R  124



>gb|AFW81269.1| putative calcium-dependent protein kinase family protein [Zea 
mays]
Length=478

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            VGRVLGRPMEDV ++Y FG ELGRGQFGVTYL TH+ T  R ACKSIATRKL   DDVDD
Sbjct  72   VGRVLGRPMEDVRASYTFGRELGRGQFGVTYLATHKPTGRRYACKSIATRKLAHSDDVDD  131

Query  339  VR  344
            VR
Sbjct  132  VR  133



>ref|XP_010541306.1| PREDICTED: calcium-dependent protein kinase 3 [Tarenaya hassleriana]
Length=521

 Score =   100 bits (249),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            +GR+LGRPME+V +TY FG ELGRGQFGVTYLVTH++TR++ ACKSI TR+L+ +DD++D
Sbjct  53   IGRILGRPMENVRTTYEFGRELGRGQFGVTYLVTHKETRKQFACKSIPTRRLVHRDDIED  112

Query  339  VR  344
            VR
Sbjct  113  VR  114



>gb|KFK28919.1| hypothetical protein AALP_AA7G065000 [Arabis alpina]
Length=529

 Score =   100 bits (249),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 42/62 (68%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            +GR+LGRPME+V +TY FG ELGRGQFGVTYLVTH++T++  ACKSI TR+L+ +DD++D
Sbjct  61   IGRILGRPMENVRATYEFGRELGRGQFGVTYLVTHKETKQIFACKSIPTRRLVHRDDIED  120

Query  339  VR  344
            VR
Sbjct  121  VR  122



>ref|XP_010673770.1| PREDICTED: calcium-dependent protein kinase 17-like [Beta vulgaris 
subsp. vulgaris]
Length=534

 Score =   100 bits (249),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 53/108 (49%), Positives = 69/108 (64%), Gaps = 8/108 (7%)
 Frame = +3

Query  21   GSCNSIPSSPFAATSAGGESDPPPPKNDITVLppsqpppprpFLSGVGRVLGRPMEDVHS  200
            G+ N+IP+       A   + P PP +  T    +            G VLGRPMEDV +
Sbjct  26   GNNNAIPNPSTQKPEA--STKPTPPSSSGTTHNKNTKTAQN------GPVLGRPMEDVKT  77

Query  201  TYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVR  344
            TY FG ELGRGQFGVT+LVTHR+T E+ ACK+IA RKL++K+D++DVR
Sbjct  78   TYSFGKELGRGQFGVTHLVTHRQTGEQFACKTIAKRKLVNKEDIEDVR  125



>ref|XP_010924783.1| PREDICTED: calcium-dependent protein kinase 3-like isoform X2 
[Elaeis guineensis]
Length=527

 Score =   100 bits (249),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            VGRVLGRPMEDV + Y FG ELGRGQFGVTYLVT ++T ER ACKSIATRKL  +DD++D
Sbjct  61   VGRVLGRPMEDVRAFYTFGRELGRGQFGVTYLVTSKQTGERFACKSIATRKLTHRDDIED  120

Query  339  VR  344
            VR
Sbjct  121  VR  122



>ref|XP_010924782.1| PREDICTED: calcium-dependent protein kinase 3-like isoform X1 
[Elaeis guineensis]
Length=531

 Score =   100 bits (249),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            VGRVLGRPMEDV + Y FG ELGRGQFGVTYLVT ++T ER ACKSIATRKL  +DD++D
Sbjct  61   VGRVLGRPMEDVRAFYTFGRELGRGQFGVTYLVTSKQTGERFACKSIATRKLTHRDDIED  120

Query  339  VR  344
            VR
Sbjct  121  VR  122



>ref|XP_002867697.1| calcium-dependent protein kinase 6 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43956.1| calcium-dependent protein kinase 6 [Arabidopsis lyrata subsp. 
lyrata]
Length=519

 Score =   100 bits (248),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 43/61 (70%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +3

Query  162  GRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDV  341
            GR+LGRPME+V  TY FG ELGRGQFGVTYLVTH++T++  ACKSI TR+L+ KDD++DV
Sbjct  54   GRILGRPMENVRGTYEFGRELGRGQFGVTYLVTHKETKQLFACKSIPTRRLVHKDDIEDV  113

Query  342  R  344
            R
Sbjct  114  R  114



>ref|XP_007158545.1| hypothetical protein PHAVU_002G161200g [Phaseolus vulgaris]
 gb|ESW30539.1| hypothetical protein PHAVU_002G161200g [Phaseolus vulgaris]
Length=502

 Score = 99.8 bits (247),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 61/111 (55%), Positives = 71/111 (64%), Gaps = 13/111 (12%)
 Frame = +3

Query  18   MGSCNSIPSSPFAATSAGGE--SDPPPPKNDITVLppsqpppprpFLSGVGRVLGRPMED  191
            MG+ NS     ++ T    E     P P N ++VLPP+  P        VGRVL RPMED
Sbjct  1    MGNSNS---QAYSQTQPHSEHHQHQPQPSNGVSVLPPNSKPT-------VGRVLDRPMED  50

Query  192  VHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVR  344
            V S YIFG ELGRGQFGVTY VTH+ T E LACKSIA RK L +DD++DVR
Sbjct  51   VRSDYIFGRELGRGQFGVTYSVTHKHTNENLACKSIAKRK-LHRDDLEDVR  100



>dbj|BAJ94561.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=527

 Score = 99.4 bits (246),  Expect = 8e-22, Method: Composition-based stats.
 Identities = 46/62 (74%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            VGRVLGRPMEDV +TY FG ELGRGQFGVTYL TH+ T  R ACKSIA RKL   DDV+D
Sbjct  60   VGRVLGRPMEDVRATYTFGRELGRGQFGVTYLATHKSTGARYACKSIAARKLARADDVED  119

Query  339  VR  344
             R
Sbjct  120  AR  121



>emb|CDY62741.1| BnaC07g50270D [Brassica napus]
Length=615

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 42/61 (69%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +3

Query  162  GRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDV  341
            GR+LGRPME+V  TY FG ELGRGQFGVTYLVTH++T++  ACKSI TR+L+ +DD++DV
Sbjct  148  GRILGRPMENVRGTYDFGKELGRGQFGVTYLVTHKETKKLFACKSIPTRRLVHRDDIEDV  207

Query  342  R  344
            R
Sbjct  208  R  208



>ref|XP_009414363.1| PREDICTED: calcium-dependent protein kinase 17 [Musa acuminata 
subsp. malaccensis]
Length=523

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 43/62 (69%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            +G VLGRPM+DVH+TY  G ELGRGQFGVT+L TH+ T E+ ACK+IA RKL SK+DV+D
Sbjct  54   IGLVLGRPMQDVHATYTIGKELGRGQFGVTHLCTHKTTAEQFACKTIAKRKLTSKEDVED  113

Query  339  VR  344
            VR
Sbjct  114  VR  115



>ref|XP_009137374.1| PREDICTED: calcium-dependent protein kinase 3-like [Brassica 
rapa]
 ref|XP_009137377.1| PREDICTED: calcium-dependent protein kinase 3-like [Brassica 
rapa]
Length=532

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 42/61 (69%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +3

Query  162  GRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDV  341
            GR+LGRPME+V  TY FG ELGRGQFGVTYLVTH++T++  ACKSI TR+L+ +DD++DV
Sbjct  65   GRILGRPMENVRGTYDFGKELGRGQFGVTYLVTHKETKKLFACKSIPTRRLVHRDDIEDV  124

Query  342  R  344
            R
Sbjct  125  R  125



>gb|AHN16201.1| CPK3-2.1 [Brassica napus]
Length=527

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 42/61 (69%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +3

Query  162  GRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDV  341
            GR+LG+PMEDV +TY FG ELGRGQFGVTYLVTH++T++  ACKSI TR+L+  DD++DV
Sbjct  60   GRILGKPMEDVKATYDFGRELGRGQFGVTYLVTHKETKKVFACKSIPTRRLVQSDDIEDV  119

Query  342  R  344
            R
Sbjct  120  R  120



>emb|CDY54853.1| BnaC01g15460D [Brassica napus]
Length=525

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 42/61 (69%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +3

Query  162  GRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDV  341
            GR+LG+PMEDV +TY FG ELGRGQFGVTYLVTH++T++  ACKSI TR+L+  DD++DV
Sbjct  58   GRILGKPMEDVKATYDFGRELGRGQFGVTYLVTHKETKKVFACKSIPTRRLVQSDDIEDV  117

Query  342  R  344
            R
Sbjct  118  R  118



>ref|XP_006413532.1| hypothetical protein EUTSA_v10024899mg [Eutrema salsugineum]
 gb|ESQ54985.1| hypothetical protein EUTSA_v10024899mg [Eutrema salsugineum]
Length=527

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 42/61 (69%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +3

Query  162  GRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDV  341
            GR+LGRPME+V  TY FG ELGRGQFGVTYLVTH++T++  ACKSI TR+L+ +DD++DV
Sbjct  60   GRILGRPMENVRGTYEFGRELGRGQFGVTYLVTHKETKKLFACKSIPTRRLVHRDDIEDV  119

Query  342  R  344
            R
Sbjct  120  R  120



>ref|XP_002441592.1| hypothetical protein SORBIDRAFT_09g029950 [Sorghum bicolor]
 gb|EES20022.1| hypothetical protein SORBIDRAFT_09g029950 [Sorghum bicolor]
Length=541

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +3

Query  153  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  332
            + +GRVLGRPMEDV ++Y FG ELGRGQFGVTYL TH+ T  R ACKSIATRKL   DDV
Sbjct  72   TNIGRVLGRPMEDVRASYTFGRELGRGQFGVTYLATHKPTGRRYACKSIATRKLAHLDDV  131

Query  333  DDVR  344
            +DVR
Sbjct  132  EDVR  135



>ref|XP_004980140.1| PREDICTED: calcium-dependent protein kinase 17-like [Setaria 
italica]
Length=538

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            VG VLGRPMEDV +TY  G ELGRGQFGVT+L THR T E+LACK+IA RKL SK+DVDD
Sbjct  66   VGPVLGRPMEDVRTTYSMGKELGRGQFGVTHLCTHRATGEKLACKTIAKRKLASKEDVDD  125

Query  339  VR  344
            VR
Sbjct  126  VR  127



>ref|XP_004978350.1| PREDICTED: calcium-dependent protein kinase 17-like [Setaria 
italica]
Length=541

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            VG VLGRPMEDV +TY  G ELGRGQFGVT+L THR T E+LACK+IA RKL SK+DVDD
Sbjct  69   VGPVLGRPMEDVRTTYSMGKELGRGQFGVTHLCTHRATGEKLACKTIAKRKLASKEDVDD  128

Query  339  VR  344
            VR
Sbjct  129  VR  130



>gb|EPS70504.1| calcium dependent protein kinase 25 [Genlisea aurea]
Length=527

 Score = 97.4 bits (241),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 42/62 (68%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            +G VLGRPMEDV +TY  G ELGRGQFGVTYL TH++T E+ ACK+IA RKL +K+D++D
Sbjct  54   IGPVLGRPMEDVRATYTIGKELGRGQFGVTYLCTHKQTGEKFACKTIAKRKLANKEDIED  113

Query  339  VR  344
            VR
Sbjct  114  VR  115



>ref|NP_001267714.1| calcium-dependent protein kinase 3-like [Cucumis sativus]
 emb|CAC44471.1| calcium dependent calmodulin independent protein kinase [Cucumis 
sativus]
 gb|AAK26164.2| calcium-dependent calmodulin-independent protein kinase 5 [Cucumis 
sativus]
Length=514

 Score = 97.1 bits (240),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +3

Query  156  GVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVD  335
             +GRVL RP  DV S Y F GELGRGQFGVTYLVTH++T++  ACKSIATRKL+ +DDV+
Sbjct  47   ALGRVLARPFSDVRSFYSFRGELGRGQFGVTYLVTHKETKQDFACKSIATRKLIDQDDVE  106

Query  336  DVR  344
            DVR
Sbjct  107  DVR  109



>gb|KGN53365.1| hypothetical protein Csa_4G050200 [Cucumis sativus]
Length=527

 Score = 97.1 bits (240),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +3

Query  156  GVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVD  335
             +GRVL RP  DV S Y F GELGRGQFGVTYLVTH++T++  ACKSIATRKL+ +DDV+
Sbjct  60   ALGRVLARPFSDVRSFYSFRGELGRGQFGVTYLVTHKETKQDFACKSIATRKLIDQDDVE  119

Query  336  DVR  344
            DVR
Sbjct  120  DVR  122



>ref|XP_008671573.1| PREDICTED: calcium-dependent protein kinase 17-like [Zea mays]
 tpg|DAA39257.1| TPA: putative calcium-dependent protein kinase family protein 
[Zea mays]
Length=552

 Score = 96.7 bits (239),  Expect = 9e-21, Method: Composition-based stats.
 Identities = 44/64 (69%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +3

Query  153  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  332
            + VG VLGRPMEDV +TY  G ELGRGQFGVT+L THR + E+LACK+IA RKL +++DV
Sbjct  78   AAVGTVLGRPMEDVRATYSMGKELGRGQFGVTHLCTHRTSGEKLACKTIAKRKLAAREDV  137

Query  333  DDVR  344
            DDVR
Sbjct  138  DDVR  141



>ref|XP_009627412.1| PREDICTED: calcium-dependent protein kinase 17-like [Nicotiana 
tomentosiformis]
Length=541

 Score = 96.3 bits (238),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 41/62 (66%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            +G VLGRPMEDV +TY  G ELGRGQFGVT+L TH++T E+ ACK+IA RKL++K+D++D
Sbjct  68   IGPVLGRPMEDVRTTYTIGKELGRGQFGVTHLCTHKQTGEQFACKTIAKRKLVNKEDIED  127

Query  339  VR  344
            VR
Sbjct  128  VR  129



>ref|XP_009773532.1| PREDICTED: calcium-dependent protein kinase 17-like [Nicotiana 
sylvestris]
Length=542

 Score = 96.3 bits (238),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 41/62 (66%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            +G VLGRPMEDV +TY  G ELGRGQFGVT+L TH++T E+ ACK+IA RKL++K+D++D
Sbjct  69   IGPVLGRPMEDVRTTYTIGKELGRGQFGVTHLCTHKQTGEQFACKTIAKRKLVNKEDIED  128

Query  339  VR  344
            VR
Sbjct  129  VR  130



>ref|XP_004228884.1| PREDICTED: calcium-dependent protein kinase 34-like [Solanum 
lycopersicum]
Length=541

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 42/62 (68%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            +G VLGRPMEDV STY  G ELGRGQFGVT+L T ++T E+ ACK+IA RKL+SK+D++D
Sbjct  68   IGLVLGRPMEDVRSTYTIGKELGRGQFGVTHLCTQKQTNEQYACKTIAKRKLVSKEDIED  127

Query  339  VR  344
            VR
Sbjct  128  VR  129



>ref|XP_009419685.1| PREDICTED: calcium-dependent protein kinase 34-like [Musa acuminata 
subsp. malaccensis]
Length=524

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 55/116 (47%), Positives = 70/116 (60%), Gaps = 7/116 (6%)
 Frame = +3

Query  18   MGSC-NSIPSSPFAATSAG-GESDPPPPKNDITVLppsqpppprpFL-----SGVGRVLG  176
            MG+C    P++P  A   G   +DP P            P P   F      + +G VLG
Sbjct  1    MGNCFTKNPTNPAPAEGEGEAGADPVPSSAPDDAPVQKAPIPTAAFTPPPKPTAIGPVLG  60

Query  177  RPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVR  344
            RPMEDV +TY  G ELGRGQFGVT+L TH+ T E+LACK+IA RKL +K+D++DVR
Sbjct  61   RPMEDVRTTYSLGKELGRGQFGVTHLCTHKATGEKLACKTIAKRKLTNKEDIEDVR  116



>ref|XP_008788593.1| PREDICTED: calcium-dependent protein kinase 17-like [Phoenix 
dactylifera]
Length=515

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 43/61 (70%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +3

Query  162  GRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDV  341
            G VLGRPMEDV +TY  G ELGRGQFGVT+L THR T E+ ACK+IA RKL+SK+D++DV
Sbjct  47   GPVLGRPMEDVKATYTMGKELGRGQFGVTHLCTHRLTGEQFACKTIAKRKLVSKEDIEDV  106

Query  342  R  344
            R
Sbjct  107  R  107



>ref|XP_004293141.1| PREDICTED: calcium-dependent protein kinase 34 [Fragaria vesca 
subsp. vesca]
Length=531

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 42/62 (68%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            +G VLGRPMEDV STY  G ELGRGQFGVT+L TH++T E  ACK+IA RKL++K+D++D
Sbjct  61   IGPVLGRPMEDVRSTYSIGKELGRGQFGVTHLCTHKQTGEHFACKTIAKRKLVNKEDIED  120

Query  339  VR  344
            VR
Sbjct  121  VR  122



>ref|XP_009402456.1| PREDICTED: calcium-dependent protein kinase 17-like [Musa acuminata 
subsp. malaccensis]
Length=509

 Score = 95.5 bits (236),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 54/117 (46%), Positives = 74/117 (63%), Gaps = 8/117 (7%)
 Frame = +3

Query  18   MGSC----NSIPSSPFAATSAGGESDPPPPKNDITV----LppsqpppprpFLSGVGRVL  173
            MG+C     + P++P  A +     DP P  +D  V    +P +   PP    + +G VL
Sbjct  1    MGNCFTKKPADPATPTDADTPAHAPDPSPAPDDAPVQTAPVPTAAFSPPPKPAAPIGPVL  60

Query  174  GRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVR  344
            GRPMEDV +TY  G ELGRGQFGVT+L TH+ T ++ ACK+IA RKL +K+D++DVR
Sbjct  61   GRPMEDVRTTYSLGKELGRGQFGVTHLCTHKATGDKYACKTIAKRKLANKEDIEDVR  117



>ref|XP_011080890.1| PREDICTED: calcium-dependent protein kinase 3 [Sesamum indicum]
Length=481

 Score = 95.1 bits (235),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +3

Query  147  FLSGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKD  326
            F  G GRVLGRPM DVHS Y FG ELGRGQFGVT+LVTHR T +  ACKSIATRKL+  D
Sbjct  18   FTGGTGRVLGRPMSDVHSAYTFGRELGRGQFGVTHLVTHRVTCQTFACKSIATRKLVILD  77

Query  327  DV  332
            DV
Sbjct  78   DV  79



>ref|XP_011080420.1| PREDICTED: calcium-dependent protein kinase 34-like [Sesamum 
indicum]
Length=532

 Score = 95.5 bits (236),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 43/62 (69%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            VG VLGRPMEDV STY  G ELGRGQFGVT+L TH++T E+ ACK+IA RKL +K+D++D
Sbjct  59   VGPVLGRPMEDVRSTYTMGKELGRGQFGVTHLCTHKQTGEQFACKTIAKRKLANKEDIED  118

Query  339  VR  344
            VR
Sbjct  119  VR  120



>ref|XP_002526062.1| calcium-dependent protein kinase, putative [Ricinus communis]
 gb|EEF36339.1| calcium-dependent protein kinase, putative [Ricinus communis]
Length=536

 Score = 95.5 bits (236),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 56/127 (44%), Positives = 71/127 (56%), Gaps = 18/127 (14%)
 Frame = +3

Query  18   MGSCNSIPSSPFAATSAGGE------------------SDPPPPKNDITVLppsqppppr  143
            MG+C S   S  AA +  GE                  S  PPPK+     P     P  
Sbjct  1    MGNCCSRGDSGDAAENEKGEAVANNTNGSVANNANQENSTTPPPKSTAPTSPSPAASPKP  60

Query  144  pFLSGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSK  323
               + +G VLGRPME+V S Y  G ELGRGQFGVT+L TH+ T E+ ACK+IA RKL++K
Sbjct  61   AKAAPIGPVLGRPMEEVKSVYTIGKELGRGQFGVTHLCTHKATGEQFACKTIAKRKLVNK  120

Query  324  DDVDDVR  344
            +DV+DV+
Sbjct  121  EDVEDVK  127



>ref|XP_008449648.1| PREDICTED: calcium-dependent protein kinase 34-like [Cucumis 
melo]
Length=535

 Score = 95.1 bits (235),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = +3

Query  153  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  332
            S +G VLGRPMEDV STY  G ELGRGQFGVT+L TH+ + E+LACK+IA RKL++K+D+
Sbjct  64   SQIGTVLGRPMEDVRSTYSIGKELGRGQFGVTHLCTHKASGEQLACKTIAKRKLVNKEDI  123

Query  333  DDVR  344
            +DVR
Sbjct  124  EDVR  127



>ref|XP_006349794.1| PREDICTED: calcium-dependent protein kinase 17-like isoform X1 
[Solanum tuberosum]
 ref|XP_006349795.1| PREDICTED: calcium-dependent protein kinase 17-like isoform X2 
[Solanum tuberosum]
 ref|XP_006349796.1| PREDICTED: calcium-dependent protein kinase 17-like isoform X3 
[Solanum tuberosum]
 ref|XP_010314698.1| PREDICTED: calcium-dependent protein kinase 17-like isoform X2 
[Solanum lycopersicum]
 ref|XP_010314699.1| PREDICTED: calcium-dependent protein kinase 17-like isoform X2 
[Solanum lycopersicum]
Length=500

 Score = 94.7 bits (234),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 40/62 (65%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            +G VLGRPMED+ +TY  G ELGRGQFGVT+L TH++T E+ ACK+IA RKL++K+D++D
Sbjct  28   IGPVLGRPMEDIKATYTLGKELGRGQFGVTHLCTHKQTGEQFACKTIAKRKLVNKEDIED  87

Query  339  VR  344
            VR
Sbjct  88   VR  89



>gb|KJB59358.1| hypothetical protein B456_009G251300 [Gossypium raimondii]
 gb|KJB59360.1| hypothetical protein B456_009G251300 [Gossypium raimondii]
Length=148

 Score = 90.5 bits (223),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +3

Query  153  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  332
            S   RV  RPMEDV STY+F  ELG GQFG+TYLVTH++T+++ ACKSI++RKL++ +D+
Sbjct  4    SLFNRVFSRPMEDVRSTYVFDRELGYGQFGITYLVTHKETKQQFACKSISSRKLINHNDI  63

Query  333  DDV  341
            +DV
Sbjct  64   EDV  66



>ref|XP_009412989.1| PREDICTED: calcium-dependent protein kinase 17-like [Musa acuminata 
subsp. malaccensis]
Length=523

 Score = 95.1 bits (235),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 42/64 (66%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +3

Query  153  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  332
            + +G VLGRPMEDV +TY  G ELGRGQFGVT+L TH+ T E+LACK+IA RKL +K+D+
Sbjct  52   AAIGPVLGRPMEDVGATYSLGKELGRGQFGVTHLCTHKATDEKLACKTIAKRKLANKEDI  111

Query  333  DDVR  344
            +DVR
Sbjct  112  EDVR  115



>gb|KJB21813.1| hypothetical protein B456_004G015100 [Gossypium raimondii]
Length=538

 Score = 95.1 bits (235),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 49/102 (48%), Positives = 60/102 (59%), Gaps = 18/102 (18%)
 Frame = +3

Query  39   PSSPFAATSAGGESDPPPPKNDITVLppsqpppprpFLSGVGRVLGRPMEDVHSTYIFGG  218
            P+ P A+ S      P P  N I                  G VL RPMEDV +TY  G 
Sbjct  42   PTQPPASPSEEASPKPTPKPNPI------------------GTVLCRPMEDVRNTYTIGK  83

Query  219  ELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVR  344
            ELGRGQFGVTYL TH+ T E+ ACK+IA RKL++K+D++DVR
Sbjct  84   ELGRGQFGVTYLCTHKVTGEQFACKTIAKRKLVNKEDIEDVR  125



>gb|EPS59027.1| hypothetical protein M569_15783, partial [Genlisea aurea]
Length=433

 Score = 94.0 bits (232),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            +G VLGRPMEDV S Y  G ELGRGQFGVT+L TH++T ++LACK+IA RKL SK+DVDD
Sbjct  70   IGPVLGRPMEDVRSIYTMGKELGRGQFGVTHLCTHKQTGQQLACKTIAKRKLGSKEDVDD  129

Query  339  VR  344
            VR
Sbjct  130  VR  131



>ref|XP_002448943.1| hypothetical protein SORBIDRAFT_05g002110 [Sorghum bicolor]
 gb|EES07931.1| hypothetical protein SORBIDRAFT_05g002110 [Sorghum bicolor]
Length=538

 Score = 95.1 bits (235),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 44/64 (69%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +3

Query  153  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  332
            + VG VLGRPMEDV  T+  G ELGRGQFGVT+L THR + E+LACK+IA RKL +K+DV
Sbjct  65   AAVGPVLGRPMEDVRDTHSMGKELGRGQFGVTHLCTHRASGEKLACKTIAKRKLATKEDV  124

Query  333  DDVR  344
            DDVR
Sbjct  125  DDVR  128



>ref|XP_009789543.1| PREDICTED: calcium-dependent protein kinase 34-like [Nicotiana 
sylvestris]
Length=532

 Score = 94.7 bits (234),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 40/62 (65%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            +G VLGRPMED+ +TY  G ELGRGQFGVT+L TH++T E+ ACK+IA RKL++K+D++D
Sbjct  60   IGPVLGRPMEDIKATYTLGKELGRGQFGVTHLCTHKQTGEQFACKTIAKRKLVNKEDIED  119

Query  339  VR  344
            VR
Sbjct  120  VR  121



>ref|XP_006664312.1| PREDICTED: calcium-dependent protein kinase 34-like, partial 
[Oryza brachyantha]
Length=483

 Score = 94.4 bits (233),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 43/62 (69%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            +G VLGR ME+V +TY  G ELGRGQFGVT+L TH+ T E+LACK+IA RKL SK+DVDD
Sbjct  11   IGDVLGRAMEEVRATYSIGKELGRGQFGVTHLCTHKATGEKLACKTIAKRKLTSKEDVDD  70

Query  339  VR  344
            VR
Sbjct  71   VR  72



>ref|XP_009603797.1| PREDICTED: calcium-dependent protein kinase 17-like [Nicotiana 
tomentosiformis]
Length=536

 Score = 94.7 bits (234),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 40/62 (65%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            +G VLGRPMED+ +TY  G ELGRGQFGVT+L TH++T E+ ACK+IA RKL++K+D++D
Sbjct  64   IGPVLGRPMEDIKATYTLGKELGRGQFGVTHLCTHKQTGEQFACKTIAKRKLVNKEDIED  123

Query  339  VR  344
            VR
Sbjct  124  VR  125



>ref|XP_004252886.1| PREDICTED: calcium-dependent protein kinase 17-like isoform X1 
[Solanum lycopersicum]
Length=535

 Score = 94.7 bits (234),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 40/62 (65%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            +G VLGRPMED+ +TY  G ELGRGQFGVT+L TH++T E+ ACK+IA RKL++K+D++D
Sbjct  63   IGPVLGRPMEDIKATYTLGKELGRGQFGVTHLCTHKQTGEQFACKTIAKRKLVNKEDIED  122

Query  339  VR  344
            VR
Sbjct  123  VR  124



>ref|XP_010099802.1| Calcium-dependent protein kinase 17 [Morus notabilis]
 gb|EXB80470.1| Calcium-dependent protein kinase 17 [Morus notabilis]
Length=538

 Score = 94.7 bits (234),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 51/102 (50%), Positives = 62/102 (61%), Gaps = 23/102 (23%)
 Frame = +3

Query  39   PSSPFAATSAGGESDPPPPKNDITVLppsqpppprpFLSGVGRVLGRPMEDVHSTYIFGG  218
            PSS  AAT A  +   P P                     +G VLGRPMEDV STY  G 
Sbjct  51   PSS--AATGASSKPSKPAP---------------------IGTVLGRPMEDVRSTYNIGK  87

Query  219  ELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVR  344
            ELGRGQFGVT+L TH+ T E+ ACK+IA RKL++K+D++DVR
Sbjct  88   ELGRGQFGVTHLCTHKVTGEQFACKTIAKRKLVNKEDIEDVR  129



>ref|XP_008365176.1| PREDICTED: calcium-dependent protein kinase 17-like [Malus domestica]
Length=533

 Score = 94.7 bits (234),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 41/62 (66%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            +G VLGRPMEDVH+TY  G ELGRGQFGVT+L TH+   E+ ACK+IA RKL++K+D++D
Sbjct  63   IGPVLGRPMEDVHTTYSIGKELGRGQFGVTHLCTHKAXGEQFACKTIAKRKLVNKEDIED  122

Query  339  VR  344
            VR
Sbjct  123  VR  124



>ref|XP_004140192.1| PREDICTED: calcium-dependent protein kinase 17-like [Cucumis 
sativus]
 ref|XP_004156049.1| PREDICTED: calcium-dependent protein kinase 17-like [Cucumis 
sativus]
 gb|KGN48093.1| hypothetical protein Csa_6G430690 [Cucumis sativus]
Length=535

 Score = 94.7 bits (234),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +3

Query  153  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  332
            S +G VLGRPMEDV STY  G ELGRGQFGVT+L TH+ + E LACK+IA RKL++K+D+
Sbjct  64   SQIGTVLGRPMEDVRSTYSIGKELGRGQFGVTHLCTHKASGEHLACKTIAKRKLVNKEDI  123

Query  333  DDVR  344
            +DVR
Sbjct  124  EDVR  127



>ref|XP_010106395.1| Calcium-dependent protein kinase 17 [Morus notabilis]
 gb|EXC10389.1| Calcium-dependent protein kinase 17 [Morus notabilis]
Length=538

 Score = 94.4 bits (233),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 51/102 (50%), Positives = 62/102 (61%), Gaps = 23/102 (23%)
 Frame = +3

Query  39   PSSPFAATSAGGESDPPPPKNDITVLppsqpppprpFLSGVGRVLGRPMEDVHSTYIFGG  218
            PSS  AAT A  +   P P                     +G VLGRPMEDV STY  G 
Sbjct  51   PSS--AATGASSKPSNPAP---------------------IGTVLGRPMEDVRSTYNIGK  87

Query  219  ELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVR  344
            ELGRGQFGVT+L TH+ T E+ ACK+IA RKL++K+D++DVR
Sbjct  88   ELGRGQFGVTHLCTHKVTGEQFACKTIAKRKLVNKEDIEDVR  129



>gb|EYU46187.1| hypothetical protein MIMGU_mgv1a004352mg [Erythranthe guttata]
Length=531

 Score = 94.4 bits (233),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 42/62 (68%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            VG VLGRPMEDV STY  G ELGRGQFGVT+L TH+++ E+ ACK+IA RKL +K+D++D
Sbjct  58   VGPVLGRPMEDVRSTYTMGKELGRGQFGVTHLCTHKQSGEQFACKTIAKRKLANKEDIED  117

Query  339  VR  344
            VR
Sbjct  118  VR  119



>ref|XP_009137281.1| PREDICTED: calcium-dependent protein kinase 3-like [Brassica 
rapa]
Length=525

 Score = 94.4 bits (233),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 40/61 (66%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +3

Query  162  GRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDV  341
            GR+LG+PMEDV  TY  G ELGRGQFGVT+LVTH++T++  ACKSI TR+L+  DD++DV
Sbjct  58   GRILGKPMEDVKGTYDLGRELGRGQFGVTHLVTHKETKKVFACKSIPTRRLVQSDDIEDV  117

Query  342  R  344
            R
Sbjct  118  R  118



>ref|XP_003567831.1| PREDICTED: calcium-dependent protein kinase 3-like [Brachypodium 
distachyon]
Length=548

 Score = 94.4 bits (233),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 43/61 (70%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = +3

Query  162  GRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDV  341
            GRVLGRP+ DV +TY FG ELGRGQFGVTYL TH+ T  R ACKSI+ RKL   DD DDV
Sbjct  82   GRVLGRPLSDVRATYTFGRELGRGQFGVTYLATHKSTGARYACKSISARKLSRGDDADDV  141

Query  342  R  344
            R
Sbjct  142  R  142



>emb|CDY44125.1| BnaA01g13330D [Brassica napus]
Length=525

 Score = 94.0 bits (232),  Expect = 7e-20, Method: Composition-based stats.
 Identities = 40/61 (66%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +3

Query  162  GRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDV  341
            GR+LG+PMEDV  TY  G ELGRGQFGVT+LVTH++T++  ACKSI TR+L+  DD++DV
Sbjct  58   GRILGKPMEDVKGTYDLGRELGRGQFGVTHLVTHKETKKVFACKSIPTRRLVQSDDIEDV  117

Query  342  R  344
            R
Sbjct  118  R  118



>gb|AGG35973.1| calcium-dependent protein kinase 3, partial [Brassica napus]
Length=525

 Score = 94.0 bits (232),  Expect = 7e-20, Method: Composition-based stats.
 Identities = 40/61 (66%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +3

Query  162  GRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDV  341
            GR+LG+PMEDV  TY  G ELGRGQFGVT+LVTH++T++  ACKSI TR+L+  DD++DV
Sbjct  58   GRILGKPMEDVKGTYDLGRELGRGQFGVTHLVTHKETKKVFACKSIPTRRLVQSDDIEDV  117

Query  342  R  344
            R
Sbjct  118  R  118



>tpg|DAA58514.1| TPA: putative calcium-dependent protein kinase family protein 
[Zea mays]
Length=460

 Score = 93.6 bits (231),  Expect = 7e-20, Method: Composition-based stats.
 Identities = 41/54 (76%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +3

Query  183  MEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVR  344
            MEDV +TY FG ELGRGQFGVTYLVTHR+T +R ACKSIATRKL+ +DD++DVR
Sbjct  1    MEDVKATYTFGRELGRGQFGVTYLVTHRETGQRFACKSIATRKLVHRDDIEDVR  54



>gb|EAY79844.1| hypothetical protein OsI_35004 [Oryza sativa Indica Group]
Length=272

 Score = 91.7 bits (226),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            +G VL RPME+V +TY  G ELGRGQFGVT+L TH+ T E+LACK+IA RKL +K+DVDD
Sbjct  68   IGEVLERPMEEVRTTYSIGKELGRGQFGVTHLCTHKATGEKLACKTIAKRKLANKEDVDD  127

Query  339  VR  344
            VR
Sbjct  128  VR  129



>ref|NP_001266856.1| calcium-dependent protein kinase [Zea mays]
 gb|AFP36377.1| calcium-dependent protein kinase [Zea mays]
Length=549

 Score = 94.4 bits (233),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            VG VLGRPMEDV +TY  G ELGRGQFGVT+L THR + E+LACK+IA RKL  K+DV+D
Sbjct  77   VGTVLGRPMEDVRATYTMGKELGRGQFGVTHLCTHRASGEKLACKTIAKRKLAGKEDVED  136

Query  339  VR  344
            VR
Sbjct  137  VR  138



>emb|CBX25242.1| hypothetical_protein [Oryza brachyantha]
Length=545

 Score = 94.0 bits (232),  Expect = 8e-20, Method: Composition-based stats.
 Identities = 44/64 (69%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +3

Query  153  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  332
            S +G VLGR ME+V +TY  G ELGRGQFGVT+L TH+ T E+LACK+IA RKL SK+DV
Sbjct  52   SPIGDVLGRAMEEVRATYSIGKELGRGQFGVTHLCTHKATGEKLACKTIAKRKLTSKEDV  111

Query  333  DDVR  344
            DDVR
Sbjct  112  DDVR  115



>ref|XP_010922091.1| PREDICTED: calcium-dependent protein kinase 17-like [Elaeis guineensis]
Length=515

 Score = 94.0 bits (232),  Expect = 8e-20, Method: Composition-based stats.
 Identities = 41/62 (66%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            +G VLGRPMEDV +TY  G ELGRGQFGVT+L THR + E+ ACK+IA RKL++K+D++D
Sbjct  46   IGPVLGRPMEDVKATYTMGKELGRGQFGVTHLCTHRISGEQFACKTIAKRKLVNKEDIED  105

Query  339  VR  344
            VR
Sbjct  106  VR  107



>gb|AFW64738.1| putative calcium-dependent protein kinase family protein [Zea 
mays]
Length=581

 Score = 94.4 bits (233),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            VG VLGRPMEDV +TY  G ELGRGQFGVT+L THR + E+LACK+IA RKL  K+DV+D
Sbjct  77   VGTVLGRPMEDVRATYTMGKELGRGQFGVTHLCTHRASGEKLACKTIAKRKLAGKEDVED  136

Query  339  VR  344
            VR
Sbjct  137  VR  138



>ref|XP_006361005.1| PREDICTED: calcium-dependent protein kinase 17-like [Solanum 
tuberosum]
Length=544

 Score = 94.0 bits (232),  Expect = 8e-20, Method: Composition-based stats.
 Identities = 40/62 (65%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            +G VLGRPMEDV +TY  G ELGRGQFGVT+L T ++T E+ ACK+IA RKL++K+D++D
Sbjct  71   IGLVLGRPMEDVRTTYTIGKELGRGQFGVTHLCTQKQTSEQFACKTIAKRKLVNKEDIED  130

Query  339  VR  344
            VR
Sbjct  131  VR  132



>gb|EEC67625.1| hypothetical protein OsI_35012 [Oryza sativa Indica Group]
Length=380

 Score = 92.4 bits (228),  Expect = 9e-20, Method: Composition-based stats.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            +G VL RPME+V +TY  G ELGRGQFGVT+L TH+ T E+LACK+IA RKL +K+DVDD
Sbjct  63   IGEVLERPMEEVRTTYSIGKELGRGQFGVTHLCTHKATGEKLACKTIAKRKLANKEDVDD  122

Query  339  VR  344
            VR
Sbjct  123  VR  124



>ref|XP_009385897.1| PREDICTED: calcium-dependent protein kinase 3-like [Musa acuminata 
subsp. malaccensis]
Length=506

 Score = 93.6 bits (231),  Expect = 9e-20, Method: Composition-based stats.
 Identities = 42/58 (72%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +3

Query  171  LGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVR  344
            L RPMEDVH+TY FG ELGRGQFGVT+L+T+R + E LACKSIATRKL ++DD++DVR
Sbjct  43   LRRPMEDVHATYSFGRELGRGQFGVTHLITNRASGEVLACKSIATRKLTNRDDLEDVR  100



>ref|XP_003576346.1| PREDICTED: calcium-dependent protein kinase 17-like [Brachypodium 
distachyon]
Length=532

 Score = 93.6 bits (231),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 65/101 (64%), Gaps = 16/101 (16%)
 Frame = +3

Query  42   SSPFAATSAGGESDPPPPKNDITVLppsqpppprpFLSGVGRVLGRPMEDVHSTYIFGGE  221
            +S  +A++ GG S   PP +                 + VG VLGRPMEDV +TY  G E
Sbjct  37   ASSSSASNRGGASKAAPPSSS----------------APVGEVLGRPMEDVRATYSIGKE  80

Query  222  LGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVR  344
            LGRGQFGVT+L THR + E+LACK+IA RKL +++D++DVR
Sbjct  81   LGRGQFGVTHLCTHRTSGEKLACKTIAKRKLSTREDLEDVR  121



>ref|XP_006845045.1| hypothetical protein AMTR_s00269p00011940 [Amborella trichopoda]
 gb|ERN06720.1| hypothetical protein AMTR_s00269p00011940 [Amborella trichopoda]
Length=517

 Score = 93.6 bits (231),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 40/62 (65%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            +G VLGRPMEDV +TYI G ELGRGQFG+T+L TH+ T +  ACK+IA RKL++K+D++D
Sbjct  49   IGPVLGRPMEDVRATYIMGKELGRGQFGITHLCTHKATGQPFACKTIAKRKLVNKEDIED  108

Query  339  VR  344
            VR
Sbjct  109  VR  110



>ref|XP_006662719.1| PREDICTED: calcium-dependent protein kinase 17-like [Oryza brachyantha]
Length=526

 Score = 93.2 bits (230),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 43/62 (69%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            +G VLGR ME+V +TY  G ELGRGQFGVT+L TH+ T E+LACK+IA RKL SK+DVDD
Sbjct  54   IGDVLGRAMEEVRATYSIGKELGRGQFGVTHLCTHKATGEKLACKTIAKRKLTSKEDVDD  113

Query  339  VR  344
            VR
Sbjct  114  VR  115



>emb|CBX25340.1| hypothetical_protein [Oryza brachyantha]
Length=524

 Score = 93.2 bits (230),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 43/62 (69%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            +G VLGR ME+V +TY  G ELGRGQFGVT+L TH+ T E+LACK+IA RKL SK+DVDD
Sbjct  54   IGDVLGRAMEEVRATYSIGKELGRGQFGVTHLCTHKATGEKLACKTIAKRKLTSKEDVDD  113

Query  339  VR  344
            VR
Sbjct  114  VR  115



>ref|XP_004513232.1| PREDICTED: calcium-dependent protein kinase 17-like [Cicer arietinum]
Length=540

 Score = 93.2 bits (230),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 40/64 (63%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +3

Query  153  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  332
            + +G VL RPMEDV +TY  G ELGRGQFGVT+L TH+ T+E+ ACK+IA RKL++K+D+
Sbjct  67   AAMGPVLQRPMEDVRATYTIGKELGRGQFGVTHLCTHKVTKEQFACKTIAKRKLVNKEDI  126

Query  333  DDVR  344
            +DVR
Sbjct  127  EDVR  130



>ref|XP_009368734.1| PREDICTED: calcium-dependent protein kinase 17-like [Pyrus x 
bretschneideri]
Length=534

 Score = 93.2 bits (230),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 41/62 (66%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            +G VLGRPMEDV +TY  G ELGRGQFGVT+L TH+ T E+ ACK+IA RKL++K+D++D
Sbjct  65   IGPVLGRPMEDVRTTYSIGKELGRGQFGVTHLCTHKATGEQFACKTIAKRKLVNKEDIED  124

Query  339  VR  344
            VR
Sbjct  125  VR  126



>gb|EAZ17352.1| hypothetical protein OsJ_32875 [Oryza sativa Japonica Group]
Length=487

 Score = 92.8 bits (229),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            +G VL RPME+V +TY  G ELGRGQFGVT+L TH+ T E+LACK+IA RKL +K+DVDD
Sbjct  68   IGEVLERPMEEVRTTYSIGKELGRGQFGVTHLCTHKATGEKLACKTIAKRKLANKEDVDD  127

Query  339  VR  344
            VR
Sbjct  128  VR  129



>ref|XP_010904692.1| PREDICTED: calcium-dependent protein kinase 34-like [Elaeis guineensis]
Length=516

 Score = 92.8 bits (229),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 41/62 (66%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            +G VLGRPMEDV S Y  G ELGRGQFGVT+L TH+ T E+ ACK+IA RKL++K+D++D
Sbjct  47   IGPVLGRPMEDVKSAYTMGKELGRGQFGVTHLCTHKLTGEQFACKTIAKRKLVNKEDIED  106

Query  339  VR  344
            VR
Sbjct  107  VR  108



>ref|XP_003622837.1| Calcium dependent protein kinase [Medicago truncatula]
 gb|KEH17263.1| calmodulin-domain kinase CDPK protein [Medicago truncatula]
Length=534

 Score = 92.8 bits (229),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 41/64 (64%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +3

Query  153  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  332
            + VG VL RPMEDV +TY  G ELGRGQFGVT+L TH+ T+E+ ACK+IA RKL++K+D+
Sbjct  61   AAVGPVLQRPMEDVRATYSIGKELGRGQFGVTHLCTHKVTKEQFACKTIAKRKLVNKEDI  120

Query  333  DDVR  344
            +DVR
Sbjct  121  EDVR  124



>dbj|BAA81749.1| calcium-dependent protein kinase [Marchantia polymorpha]
 dbj|BAA81751.1| calcium-dependent protein kinase [Marchantia polymorpha]
Length=548

 Score = 92.8 bits (229),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 44/61 (72%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +3

Query  162  GRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDV  341
            G VLGRP+EDV S Y  G ELGRGQFGVT+L TH+ T E LACKSIA RKL +KDDV+DV
Sbjct  67   GNVLGRPLEDVRSIYTLGRELGRGQFGVTHLCTHKVTGELLACKSIAKRKLTNKDDVEDV  126

Query  342  R  344
            R
Sbjct  127  R  127



>dbj|BAA81748.1| calcium-dependent protein kinase [Marchantia polymorpha]
 dbj|BAA81750.1| calcium-dependent protein kinase [Marchantia polymorpha]
Length=548

 Score = 92.8 bits (229),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 44/61 (72%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +3

Query  162  GRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDV  341
            G VLGRP+EDV S Y  G ELGRGQFGVT+L TH+ T E LACKSIA RKL +KDDV+DV
Sbjct  67   GNVLGRPLEDVRSIYTLGRELGRGQFGVTHLCTHKVTGELLACKSIAKRKLTNKDDVEDV  126

Query  342  R  344
            R
Sbjct  127  R  127



>gb|ABA95733.1| Calcium-dependent protein kinase, isoform 2, putative [Oryza 
sativa Japonica Group]
 gb|EAZ17361.1| hypothetical protein OsJ_32884 [Oryza sativa Japonica Group]
Length=541

 Score = 92.8 bits (229),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            +G VL RPME+V +TY  G ELGRGQFGVT+L TH+ T E+LACK+IA RKL +K+DVDD
Sbjct  68   IGEVLERPMEEVRTTYSIGKELGRGQFGVTHLCTHKATGEKLACKTIAKRKLANKEDVDD  127

Query  339  VR  344
            VR
Sbjct  128  VR  129



>ref|XP_010247475.1| PREDICTED: calcium-dependent protein kinase 34 [Nelumbo nucifera]
Length=521

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 40/64 (63%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +3

Query  153  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  332
            S +G VLGRPMED+ + Y  G ELGRGQFGVT+L TH+ T E+ ACK+IA RKL++K+D+
Sbjct  50   SQIGTVLGRPMEDIKTVYTIGKELGRGQFGVTHLCTHKVTGEQFACKTIAKRKLVNKEDI  109

Query  333  DDVR  344
            +DVR
Sbjct  110  EDVR  113



>ref|XP_008786936.1| PREDICTED: calcium-dependent protein kinase 34-like [Phoenix 
dactylifera]
Length=514

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 55/109 (50%), Positives = 68/109 (62%), Gaps = 3/109 (3%)
 Frame = +3

Query  18   MGSCNSIPSSPFAATSAGGESDPPPPKNDITVLppsqpppprpFLSGVGRVLGRPMEDVH  197
            MG+C S   SP     A G +    P       PP +P PP      +G VLGRPMEDV 
Sbjct  1    MGNCFSNDKSP---RPAAGNAAADRPNLSPHAAPPPKPSPPPSKPVPIGPVLGRPMEDVK  57

Query  198  STYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVR  344
            +TY  G ELGRGQFGVT+L TH+ T E+ ACK+IA RKL +K+D++DVR
Sbjct  58   ATYSMGKELGRGQFGVTHLCTHKLTGEQFACKTIAKRKLANKEDIEDVR  106



>dbj|BAK06838.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=542

 Score = 92.8 bits (229),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 43/62 (69%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            VG VLGRP+EDV +TY  G ELGRGQFGVTYL TH +T E+LACK+IA RKL   +DV+D
Sbjct  69   VGEVLGRPIEDVRATYTIGEELGRGQFGVTYLCTHTETGEKLACKTIAKRKLSGAEDVED  128

Query  339  VR  344
            VR
Sbjct  129  VR  130



>ref|XP_002442700.1| hypothetical protein SORBIDRAFT_08g001380 [Sorghum bicolor]
 gb|EES16538.1| hypothetical protein SORBIDRAFT_08g001380 [Sorghum bicolor]
Length=574

 Score = 92.8 bits (229),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 47/104 (45%), Positives = 62/104 (60%), Gaps = 19/104 (18%)
 Frame = +3

Query  33   SIPSSPFAATSAGGESDPPPPKNDITVLppsqpppprpFLSGVGRVLGRPMEDVHSTYIF  212
            ++ +SP    ++ G S   PP                     +G VLGRPMEDV + Y  
Sbjct  79   AVAASPSGGRASTGTSSSKPP-------------------GPLGAVLGRPMEDVRAAYSM  119

Query  213  GGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVR  344
            G ELGRGQFGVT+L TH+ + E+LACK+IA RKL +K+DV+DVR
Sbjct  120  GKELGRGQFGVTHLCTHKASGEKLACKTIAKRKLATKEDVEDVR  163



>ref|NP_001065691.1| Os11g0136600 [Oryza sativa Japonica Group]
 gb|AAQ14593.1|AF319480_1 calcium-dependent calmodulin-independent protein kinase [Oryza 
sativa]
 gb|AAQ14594.1|AF319481_1 calcium-dependent calmodulin-independent protein kinase [Oryza 
sativa]
 gb|ABA91345.1| Calcium-dependent protein kinase, isoform 2, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF27536.1| Os11g0136600 [Oryza sativa Japonica Group]
Length=541

 Score = 92.4 bits (228),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            +G VL RPME+V +TY  G ELGRGQFGVT+L TH+ T E+LACK+IA RKL +K+DVDD
Sbjct  68   IGEVLERPMEEVRTTYSIGKELGRGQFGVTHLCTHKATGEKLACKTIAKRKLANKEDVDD  127

Query  339  VR  344
            VR
Sbjct  128  VR  129



>ref|NP_001176777.1| Os12g0133500 [Oryza sativa Japonica Group]
 dbj|BAH95505.1| Os12g0133500 [Oryza sativa Japonica Group]
Length=572

 Score = 92.4 bits (228),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            +G VL RPME+V +TY  G ELGRGQFGVT+L TH+ T E+LACK+IA RKL +K+DVDD
Sbjct  68   IGEVLERPMEEVRTTYSIGKELGRGQFGVTHLCTHKATGEKLACKTIAKRKLANKEDVDD  127

Query  339  VR  344
            VR
Sbjct  128  VR  129



>ref|XP_008802050.1| PREDICTED: calcium-dependent protein kinase 3-like [Phoenix dactylifera]
Length=525

 Score = 92.4 bits (228),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = +3

Query  147  FLSGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKD  326
             +  VGRV  RPM+ V + Y FG E+GRGQFGVTYLVTH++T +  ACKSIATR+LL +D
Sbjct  51   IIPNVGRVFKRPMDHVRAFYTFGSEIGRGQFGVTYLVTHKETGKLFACKSIATRRLLHRD  110

Query  327  DVDDVR  344
            D++DVR
Sbjct  111  DIEDVR  116



>gb|KEH27423.1| calmodulin-domain kinase CDPK protein [Medicago truncatula]
Length=433

 Score = 91.3 bits (225),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +3

Query  153  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRK  311
            S +GRVLG+PMEDV STY FG ELGRGQFGVTYLVTH+ T+E+ ACKSIATRK
Sbjct  50   SPLGRVLGKPMEDVRSTYTFGRELGRGQFGVTYLVTHKLTKEQFACKSIATRK  102



>ref|XP_009630031.1| PREDICTED: calcium-dependent protein kinase 17-like [Nicotiana 
tomentosiformis]
Length=536

 Score = 92.0 bits (227),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 40/64 (63%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +3

Query  153  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  332
            S +G VLGRPMEDV  TY  G ELGRGQFGVT+L TH+++ E+ ACK+IA RKL++K+D+
Sbjct  62   SPIGPVLGRPMEDVRKTYSIGKELGRGQFGVTHLCTHKQSGEQFACKTIAKRKLVNKEDI  121

Query  333  DDVR  344
            +DV+
Sbjct  122  EDVK  125



>gb|AAZ76712.1| calcium-dependent protein kinase 1 [Petunia integrifolia subsp. 
inflata]
Length=532

 Score = 92.0 bits (227),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 40/64 (63%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +3

Query  153  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  332
            S +G VLGRPMEDV  TY  G ELGRGQFGVT+L TH+++ E+ ACK+IA RKL++K+D+
Sbjct  57   SPIGPVLGRPMEDVRKTYSIGKELGRGQFGVTHLCTHKQSGEQFACKTIAKRKLVNKEDI  116

Query  333  DDVR  344
            +DV+
Sbjct  117  EDVK  120



>ref|XP_009796949.1| PREDICTED: calcium-dependent protein kinase 34-like [Nicotiana 
sylvestris]
Length=537

 Score = 92.0 bits (227),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 39/62 (63%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            +G VLGRPMEDV  TY  G ELGRGQFGVT+L TH+++ E+ ACK+IA RKL++K+D++D
Sbjct  65   IGPVLGRPMEDVRKTYSIGKELGRGQFGVTHLCTHKQSGEQFACKTIAKRKLVNKEDIED  124

Query  339  VR  344
            V+
Sbjct  125  VK  126



>ref|XP_003611046.1| Calcium dependent protein kinase [Medicago truncatula]
 gb|AES94004.1| calmodulin-domain kinase CDPK protein [Medicago truncatula]
Length=517

 Score = 92.0 bits (227),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 42/53 (79%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +3

Query  153  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRK  311
            S +GRVLG+PMEDV STY FG ELGRGQFGVTYLVTH+ T+E+ ACKSIATRK
Sbjct  50   SPLGRVLGKPMEDVRSTYTFGRELGRGQFGVTYLVTHKLTKEQFACKSIATRK  102



>gb|ADE76782.1| unknown [Picea sitchensis]
Length=256

 Score = 89.4 bits (220),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +3

Query  162  GRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDV  341
            GR+LGRP+EDV S Y  G ELGRGQFGVTY+ THR+T ++ ACKSIA RKL   DD++ V
Sbjct  62   GRILGRPLEDVRSQYSIGKELGRGQFGVTYICTHRQTLQKYACKSIAIRKLKRNDDIEKV  121

Query  342  R  344
            R
Sbjct  122  R  122



>gb|KJB83565.1| hypothetical protein B456_013G253100 [Gossypium raimondii]
Length=527

 Score = 91.7 bits (226),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            +G VLGRPMEDV +TY  G ELGRGQFG+T+L TH+ T E+ ACK+IA RKL SK+DV+D
Sbjct  58   MGPVLGRPMEDVKATYTIGKELGRGQFGITHLCTHKTTGEQFACKTIAKRKLSSKEDVED  117

Query  339  VR  344
            VR
Sbjct  118  VR  119



>gb|KDO36585.1| hypothetical protein CISIN_1g042977mg, partial [Citrus sinensis]
Length=471

 Score = 91.3 bits (225),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 39/59 (66%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +3

Query  168  VLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVR  344
            VLGRPMEDV +TY FG ELGRGQFG+T+L TH+ T ++ ACK+IA RKL++K+D++DVR
Sbjct  69   VLGRPMEDVKATYSFGKELGRGQFGITHLCTHKGTGQQFACKTIAKRKLVNKEDIEDVR  127



>ref|XP_008227265.1| PREDICTED: calcium-dependent protein kinase 34-like [Prunus mume]
Length=534

 Score = 91.7 bits (226),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 41/62 (66%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            +G VLGRPMEDV S Y  G ELGRGQFGVT+L TH+ T E  ACK+IA RKL++K+D++D
Sbjct  64   IGPVLGRPMEDVRSMYSIGKELGRGQFGVTHLCTHKATGEHFACKTIAKRKLVNKEDIED  123

Query  339  VR  344
            VR
Sbjct  124  VR  125



>ref|XP_010536137.1| PREDICTED: calcium-dependent protein kinase 17 [Tarenaya hassleriana]
Length=521

 Score = 91.7 bits (226),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 44/102 (43%), Positives = 63/102 (62%), Gaps = 13/102 (13%)
 Frame = +3

Query  39   PSSPFAATSAGGESDPPPPKNDITVLppsqpppprpFLSGVGRVLGRPMEDVHSTYIFGG  218
            P++P   ++A  +  PP P   I                 +G VLGRPMED+ +++  G 
Sbjct  24   PTNPAETSAAASKHAPPSPPPAIK-------------QGPIGPVLGRPMEDIKASFSLGK  70

Query  219  ELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVR  344
            ELGRGQFGVT+L TH+ T  + ACK+IA RKL++K+D++DVR
Sbjct  71   ELGRGQFGVTHLCTHKATGHQFACKTIAKRKLVNKEDIEDVR  112



>ref|XP_007213195.1| hypothetical protein PRUPE_ppa026653mg [Prunus persica]
 gb|EMJ14394.1| hypothetical protein PRUPE_ppa026653mg [Prunus persica]
Length=534

 Score = 91.7 bits (226),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 41/62 (66%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            +G VLGRPMEDV S Y  G ELGRGQFGVT+L TH+ T E  ACK+IA RKL++K+D++D
Sbjct  64   IGPVLGRPMEDVRSMYSIGKELGRGQFGVTHLCTHKATGEHFACKTIAKRKLVNKEDIED  123

Query  339  VR  344
            VR
Sbjct  124  VR  125



>emb|CAG27840.1| calcium-dependent protein kinase 17 [Nicotiana plumbaginifolia]
Length=534

 Score = 91.7 bits (226),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 39/64 (61%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +3

Query  153  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  332
            S +G VLGRPMEDV  TY  G ELGRGQFG+T+L TH+++ E+ ACK+IA RKL++K+D+
Sbjct  60   SPIGPVLGRPMEDVRKTYSIGKELGRGQFGITHLCTHKQSGEQFACKTIAKRKLVNKEDI  119

Query  333  DDVR  344
            +DV+
Sbjct  120  EDVK  123



>gb|KDP43197.1| hypothetical protein JCGZ_22749 [Jatropha curcas]
Length=531

 Score = 91.7 bits (226),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 41/62 (66%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            +G VLGRPMEDV S Y  G ELGRGQFGVT+L TH+ T E+ ACK+IA RKL++K+DV+D
Sbjct  68   IGPVLGRPMEDVKSVYTIGKELGRGQFGVTHLCTHKITGEQFACKTIAKRKLVNKEDVED  127

Query  339  VR  344
            V+
Sbjct  128  VK  129



>ref|XP_003617233.1| Calcium dependent protein kinase [Medicago truncatula]
 gb|AET00192.1| calmodulin-domain kinase CDPK protein [Medicago truncatula]
Length=523

 Score = 91.7 bits (226),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 41/64 (64%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +3

Query  153  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  332
            S +G VLGRPMEDV +TY  G ELGRGQFGVT+L TH+ T ++ ACK+IA RKL +K+D+
Sbjct  51   SAIGPVLGRPMEDVKATYSMGKELGRGQFGVTHLCTHKTTGKQYACKTIAKRKLANKEDI  110

Query  333  DDVR  344
            +DVR
Sbjct  111  EDVR  114



>ref|XP_006356386.1| PREDICTED: calcium-dependent protein kinase 17-like [Solanum 
tuberosum]
Length=524

 Score = 91.7 bits (226),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 40/64 (63%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +3

Query  153  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  332
            S +G VLGRPMEDV  TY  G ELGRGQFGVT+L TH++  E+ ACK+IA RKL++K+D+
Sbjct  50   SPIGLVLGRPMEDVRKTYSIGKELGRGQFGVTHLCTHKQNGEQFACKTIAKRKLVNKEDI  109

Query  333  DDVR  344
            +DV+
Sbjct  110  EDVK  113



>ref|XP_006470577.1| PREDICTED: calcium-dependent protein kinase 17-like [Citrus sinensis]
Length=534

 Score = 91.7 bits (226),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 39/59 (66%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +3

Query  168  VLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVR  344
            VLGRPMEDV +TY FG ELGRGQFG+T+L TH+ T ++ ACK+IA RKL++K+D++DVR
Sbjct  69   VLGRPMEDVKATYSFGKELGRGQFGITHLCTHKGTGQQFACKTIAKRKLVNKEDIEDVR  127



>ref|XP_006446309.1| hypothetical protein CICLE_v10014854mg [Citrus clementina]
 gb|ESR59549.1| hypothetical protein CICLE_v10014854mg [Citrus clementina]
Length=534

 Score = 91.3 bits (225),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 39/59 (66%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +3

Query  168  VLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVR  344
            VLGRPMEDV +TY FG ELGRGQFG+T+L TH+ T ++ ACK+IA RKL++K+D++DVR
Sbjct  69   VLGRPMEDVKATYSFGKELGRGQFGITHLCTHKGTGQQFACKTIAKRKLVNKEDIEDVR  127



>ref|XP_003545165.1| PREDICTED: calcium-dependent protein kinase 17-like [Glycine 
max]
Length=529

 Score = 91.3 bits (225),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 40/63 (63%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +3

Query  156  GVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVD  335
             +G VLGRPMEDV STY  G ELGRGQFGVT+L TH+ T ++ ACK+IA RKL++K+D++
Sbjct  58   AIGPVLGRPMEDVKSTYSMGKELGRGQFGVTHLCTHKSTGKQYACKTIAKRKLVNKEDIE  117

Query  336  DVR  344
            DV+
Sbjct  118  DVK  120



>emb|CDP20327.1| unnamed protein product [Coffea canephora]
Length=530

 Score = 91.3 bits (225),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 41/62 (66%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            VG VLGRPMEDV S Y  G ELGRGQFGVT+L T+++T E+ ACK+IA RKL++K+D++D
Sbjct  58   VGPVLGRPMEDVRSLYTIGKELGRGQFGVTHLCTNKQTGEQFACKTIAKRKLVNKEDIED  117

Query  339  VR  344
            VR
Sbjct  118  VR  119



>ref|XP_004250895.1| PREDICTED: calcium-dependent protein kinase 17-like [Solanum 
lycopersicum]
Length=529

 Score = 91.3 bits (225),  Expect = 7e-19, Method: Composition-based stats.
 Identities = 39/62 (63%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            +G VLGRPMEDV  TY  G ELGRGQFGVT+L TH++  E+ ACK+IA RKL++K+D++D
Sbjct  57   IGPVLGRPMEDVKKTYSIGKELGRGQFGVTHLCTHKQNGEQFACKTIAKRKLVNKEDIED  116

Query  339  VR  344
            V+
Sbjct  117  VK  118



>ref|XP_007141507.1| hypothetical protein PHAVU_008G201900g [Phaseolus vulgaris]
 gb|ESW13501.1| hypothetical protein PHAVU_008G201900g [Phaseolus vulgaris]
Length=521

 Score = 90.9 bits (224),  Expect = 8e-19, Method: Composition-based stats.
 Identities = 39/64 (61%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +3

Query  153  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  332
            + +G VLG+PMEDV STY  G ELGRGQFGVT+L TH+ T ++ ACK+IA RKL++K+D+
Sbjct  49   AAIGPVLGKPMEDVRSTYSMGKELGRGQFGVTHLCTHKSTGKQYACKTIAKRKLVNKEDI  108

Query  333  DDVR  344
            +DV+
Sbjct  109  EDVK  112



>gb|AFW84809.1| putative calcium-dependent protein kinase family protein [Zea 
mays]
Length=464

 Score = 90.5 bits (223),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            +G VLGRPMEDV S Y  G ELGRGQFGVT L TH+ T ER ACK+IA RKL +K+DV+D
Sbjct  51   IGPVLGRPMEDVRSIYTVGKELGRGQFGVTSLCTHKATGERFACKTIAKRKLSTKEDVED  110

Query  339  VR  344
            VR
Sbjct  111  VR  112



>gb|AFW82380.1| putative calcium-dependent protein kinase family protein [Zea 
mays]
Length=220

 Score = 87.8 bits (216),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            +G VLGRPMEDV +TY  G ELGRGQFGVT L TH+ T  R ACK+I+ RKL +K+DV+D
Sbjct  50   IGPVLGRPMEDVRATYAVGKELGRGQFGVTSLCTHKATGHRFACKTISKRKLSTKEDVED  109

Query  339  VR  344
            VR
Sbjct  110  VR  111



>gb|KJB09335.1| hypothetical protein B456_001G135000 [Gossypium raimondii]
Length=513

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 49/115 (43%), Positives = 65/115 (57%), Gaps = 16/115 (14%)
 Frame = +3

Query  18   MGSCNSIPSSPFAATSAGGESDPP------PPKNDITVLppsqpppprpFLSGVGRVLGR  179
            MG+C S   SP A  +   + D P      PP    +                +G VLGR
Sbjct  1    MGNCCS-RGSPAAEDANDDKGDAPKQAEGSPPSGGAS---------SNSMSDSIGNVLGR  50

Query  180  PMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVR  344
            PMED+ +TY  G ELGRGQFGVT+L TH+ T E+ ACK+I  RKL +K+D++DV+
Sbjct  51   PMEDIKATYTIGKELGRGQFGVTHLCTHKTTGEQFACKTITKRKLSTKEDIEDVK  105



>tpg|DAA57188.1| TPA: putative calcium-dependent protein kinase family protein 
[Zea mays]
Length=510

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            +G VLGRPMEDV S Y  G ELGRGQFGVT L TH+ T ER ACK+IA RKL +K+DV+D
Sbjct  51   IGPVLGRPMEDVRSIYTVGKELGRGQFGVTSLCTHKATGERFACKTIAKRKLSTKEDVED  110

Query  339  VR  344
            VR
Sbjct  111  VR  112



>ref|XP_001771902.1| predicted protein [Physcomitrella patens]
 gb|EDQ63331.1| predicted protein [Physcomitrella patens]
Length=482

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 41/65 (63%), Positives = 54/65 (83%), Gaps = 1/65 (2%)
 Frame = +3

Query  150  LSGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDD  329
            +S VG VLG+P+ D+  TY  G ELGRGQFGVTYL TH++T E+LACKSIA RKL++K+D
Sbjct  9    VSNVG-VLGKPLVDIRQTYSLGKELGRGQFGVTYLCTHKETGEKLACKSIAKRKLIAKED  67

Query  330  VDDVR  344
            ++DV+
Sbjct  68   IEDVK  72



>ref|XP_008674922.1| PREDICTED: calcium-dependent protein kinase 34 [Zea mays]
Length=520

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            +G VLGRPMEDV S Y  G ELGRGQFGVT L TH+ T ER ACK+IA RKL +K+DV+D
Sbjct  51   IGPVLGRPMEDVRSIYTVGKELGRGQFGVTSLCTHKATGERFACKTIAKRKLSTKEDVED  110

Query  339  VR  344
            VR
Sbjct  111  VR  112



>ref|XP_009406794.1| PREDICTED: calcium-dependent protein kinase 3-like [Musa acuminata 
subsp. malaccensis]
Length=461

 Score = 90.1 bits (222),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 40/54 (74%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +3

Query  183  MEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVR  344
            MEDV +TY FG ELGRGQFGVTYLV HR+T ++LACK+IATRKL+ +DD+DDVR
Sbjct  1    MEDVRATYSFGRELGRGQFGVTYLVVHRETGKQLACKAIATRKLVRQDDLDDVR  54



>gb|KHN28162.1| Calcium-dependent protein kinase 17 [Glycine soja]
Length=472

 Score = 90.1 bits (222),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 39/62 (63%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            +G VLGRPMEDV +TY  G ELGRGQFGVT+L T++ T ++ ACK+IA RKL++K+D++D
Sbjct  1    MGPVLGRPMEDVRATYTIGKELGRGQFGVTHLCTNKTTGQQFACKTIAKRKLVNKEDIED  60

Query  339  VR  344
            VR
Sbjct  61   VR  62



>ref|XP_010031714.1| PREDICTED: calcium-dependent protein kinase 34-like [Eucalyptus 
grandis]
 gb|KCW51080.1| hypothetical protein EUGRSUZ_J00686 [Eucalyptus grandis]
Length=534

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +3

Query  153  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  332
            S +G VLGRPME+V S Y  G ELGRGQFGVT+L TH++T ++ ACK+IA RKL++K+D+
Sbjct  63   SPIGPVLGRPMEEVKSMYTIGKELGRGQFGVTHLCTHKQTGQQFACKTIAKRKLVNKEDI  122

Query  333  DDVR  344
            +DVR
Sbjct  123  EDVR  126



>ref|XP_008657141.1| PREDICTED: calcium-dependent protein kinase 34-like [Zea mays]
Length=520

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            +G VLGRPMEDV S Y  G ELGRGQFGVT L TH+ T ER ACK+IA RKL +K+DV+D
Sbjct  51   IGPVLGRPMEDVRSIYTVGKELGRGQFGVTSLCTHKATGERFACKTIAKRKLSTKEDVED  110

Query  339  VR  344
            VR
Sbjct  111  VR  112



>gb|EYU35947.1| hypothetical protein MIMGU_mgv1a004350mg [Erythranthe guttata]
Length=532

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            +G VLGRPMED+ +TY  G ELGRGQFGVT+L TH+++ E+ ACK+IA RKL +K+D++D
Sbjct  59   MGPVLGRPMEDIRATYTIGKELGRGQFGVTHLCTHKQSGEQFACKTIAKRKLANKEDIED  118

Query  339  VR  344
            VR
Sbjct  119  VR  120



>ref|XP_007015253.1| Calcium-dependent protein kinase 17 [Theobroma cacao]
 gb|EOY32872.1| Calcium-dependent protein kinase 17 [Theobroma cacao]
Length=535

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            +G VLGRPMED+ STY  G ELGRGQFGVT+L T++ T E+ ACK+IA RKL++K+D++D
Sbjct  66   IGPVLGRPMEDIKSTYTIGKELGRGQFGVTHLCTNKATGEQFACKTIAKRKLVNKEDIED  125

Query  339  VR  344
            VR
Sbjct  126  VR  127



>ref|XP_003528592.1| PREDICTED: calcium-dependent protein kinase 17-like [Glycine 
max]
Length=541

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 39/64 (61%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +3

Query  153  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  332
            + +G VLGRPMEDV +TY  G ELGRGQFGVT+L T++ T ++ ACK+IA RKL++K+D+
Sbjct  68   AAMGPVLGRPMEDVRATYTIGKELGRGQFGVTHLCTNKTTGQQFACKTIAKRKLVNKEDI  127

Query  333  DDVR  344
            +DVR
Sbjct  128  EDVR  131



>ref|XP_006644382.1| PREDICTED: calcium-dependent protein kinase 3-like isoform X1 
[Oryza brachyantha]
 ref|XP_006644383.1| PREDICTED: calcium-dependent protein kinase 3-like isoform X2 
[Oryza brachyantha]
Length=460

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 39/54 (72%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +3

Query  183  MEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVR  344
            MEDV +TY FG ELGRGQFGVTYLVTH+ + +R ACKSIATRKL+ +DD++DVR
Sbjct  1    MEDVRATYTFGRELGRGQFGVTYLVTHKASGKRFACKSIATRKLVHRDDIEDVR  54



>ref|XP_003578964.1| PREDICTED: calcium-dependent protein kinase 34-like [Brachypodium 
distachyon]
Length=549

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            VG VLG P+EDV +TY  G ELGRGQFGVTYL TH  T E+LACK+IA RKL  K+DV+D
Sbjct  76   VGEVLGNPIEDVRATYTIGEELGRGQFGVTYLCTHSITGEKLACKTIAKRKLSGKEDVED  135

Query  339  VR  344
            VR
Sbjct  136  VR  137



>gb|KHN23929.1| Calcium-dependent protein kinase 17 [Glycine soja]
Length=474

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 39/62 (63%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            +G VLGRPMEDV +TY  G ELGRGQFGVT+L T++ T ++ ACK+IA RKL++K+D++D
Sbjct  1    MGPVLGRPMEDVRATYTIGKELGRGQFGVTHLCTNKATGQQFACKTIAKRKLVNKEDIED  60

Query  339  VR  344
            VR
Sbjct  61   VR  62



>ref|XP_003556786.1| PREDICTED: calcium-dependent protein kinase 17-like [Glycine 
max]
Length=546

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 39/64 (61%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +3

Query  153  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  332
            + +G VLGRPMEDV +TY  G ELGRGQFGVT+L T++ T ++ ACK+IA RKL++K+D+
Sbjct  71   AAMGPVLGRPMEDVRATYTIGKELGRGQFGVTHLCTNKATGQQFACKTIAKRKLVNKEDI  130

Query  333  DDVR  344
            +DVR
Sbjct  131  EDVR  134



>ref|XP_008798404.1| PREDICTED: calcium-dependent protein kinase 17-like [Phoenix 
dactylifera]
Length=525

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 48/101 (48%), Positives = 61/101 (60%), Gaps = 4/101 (4%)
 Frame = +3

Query  42   SSPFAATSAGGESDPPPPKNDITVLppsqpppprpFLSGVGRVLGRPMEDVHSTYIFGGE  221
            ++PF A  A      P P N       +    P    + +G VLGRPMEDV  TY  G E
Sbjct  21   AAPFDAVRA----SKPSPHNASPAAAAAATSRPPAKPARIGPVLGRPMEDVRFTYSMGKE  76

Query  222  LGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVR  344
            LGRGQFGVT+  TH+ T E+ ACK+IA RKL++K+D+ DVR
Sbjct  77   LGRGQFGVTHRCTHKATGEQFACKTIAKRKLVNKEDIQDVR  117



>ref|XP_004491231.1| PREDICTED: calcium-dependent protein kinase 17-like [Cicer arietinum]
Length=520

 Score = 89.7 bits (221),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 39/64 (61%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = +3

Query  153  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  332
            + +G VL RPMEDV +TY  G ELGRGQFGVTYL TH+ T ++ ACK+IA RKL++K+D+
Sbjct  48   AAIGPVLERPMEDVKATYSIGKELGRGQFGVTYLCTHKTTGKQYACKTIAKRKLVNKEDI  107

Query  333  DDVR  344
            +D R
Sbjct  108  EDAR  111



>ref|XP_002441304.1| hypothetical protein SORBIDRAFT_09g024100 [Sorghum bicolor]
 gb|EES19734.1| hypothetical protein SORBIDRAFT_09g024100 [Sorghum bicolor]
Length=527

 Score = 89.7 bits (221),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = +3

Query  153  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  332
            + +G VLGRPMEDV STY  G ELGRGQFGVT L TH+ T ++ ACK+I+ RKL +K+D+
Sbjct  55   AAIGPVLGRPMEDVKSTYTMGKELGRGQFGVTSLCTHKATGQKFACKTISKRKLSTKEDI  114

Query  333  DDVR  344
            +DVR
Sbjct  115  EDVR  118



>gb|EYU23402.1| hypothetical protein MIMGU_mgv1a004683mg [Erythranthe guttata]
Length=515

 Score = 89.4 bits (220),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 54/111 (49%), Positives = 66/111 (59%), Gaps = 6/111 (5%)
 Frame = +3

Query  18   MGSCNSIPSSPFAATSAGGESDPPPPKNDITVLppsqpppprpFLSGV--GRVLGRPMED  191
            MG+  SI + P A T+    + PP    D     P+ P  P      +  G +LGRP+ +
Sbjct  1    MGNAPSIDAPPHAPTA----TSPPNGGADSETSLPTPPESPPHPPGSLPTGAILGRPISN  56

Query  192  VHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVR  344
            VHS Y FG ELGRGQFGVT+LVTHR+TR   ACKSIA RKL + DD   VR
Sbjct  57   VHSAYNFGRELGRGQFGVTHLVTHRETRRAFACKSIAVRKLAAPDDAAAVR  107



>gb|EPS65220.1| hypothetical protein M569_09555, partial [Genlisea aurea]
Length=457

 Score = 89.0 bits (219),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = +3

Query  156  GVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVD  335
            G GRVLG+PM DV S Y FG E+GRGQFGVTYLVTH  T E+ ACKSI+ RK++S  DV 
Sbjct  1    GKGRVLGKPMSDVRSKYGFGKEIGRGQFGVTYLVTHSVTGEKFACKSISKRKIISPADVA  60

Query  336  DVR  344
            DVR
Sbjct  61   DVR  63



>ref|XP_010519814.1| PREDICTED: calcium-dependent protein kinase 34 isoform X2 [Tarenaya 
hassleriana]
Length=526

 Score = 89.4 bits (220),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            +G VLGRPMEDV ++Y  G ELGRGQFGVT+L TH+ T  + ACK+IA RKL++K+D++D
Sbjct  56   IGPVLGRPMEDVKASYSLGKELGRGQFGVTHLCTHKATGHQFACKTIAKRKLVNKEDIED  115

Query  339  VR  344
            VR
Sbjct  116  VR  117



>ref|XP_001781985.1| predicted protein [Physcomitrella patens]
 gb|EDQ53209.1| predicted protein [Physcomitrella patens]
Length=479

 Score = 89.0 bits (219),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 41/61 (67%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +3

Query  162  GRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDV  341
            G VLG+P+ DV S Y  G ELGRGQFGVTY  T+ KT E LACKSIA RKL+SK+D++DV
Sbjct  12   GTVLGKPLSDVRSVYTLGKELGRGQFGVTYACTNIKTGEHLACKSIAKRKLISKEDIEDV  71

Query  342  R  344
            R
Sbjct  72   R  72



>ref|XP_010519813.1| PREDICTED: calcium-dependent protein kinase 34 isoform X1 [Tarenaya 
hassleriana]
Length=562

 Score = 89.4 bits (220),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            +G VLGRPMEDV ++Y  G ELGRGQFGVT+L TH+ T  + ACK+IA RKL++K+D++D
Sbjct  56   IGPVLGRPMEDVKASYSLGKELGRGQFGVTHLCTHKATGHQFACKTIAKRKLVNKEDIED  115

Query  339  VR  344
            VR
Sbjct  116  VR  117



>emb|CAD70166.1| putative calcium-dependent protein kinase [Landoltia punctata]
Length=182

 Score = 85.9 bits (211),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 62/108 (57%), Gaps = 18/108 (17%)
 Frame = +3

Query  21   GSCNSIPSSPFAATSAGGESDPPPPKNDITVLppsqpppprpFLSGVGRVLGRPMEDVHS  200
            GS N+ P  P  A +  G    PP K                  + VG VLGR MEDV  
Sbjct  35   GSANAPPQKPPGAVT--GVLRQPPAKGS----------------AAVGPVLGRRMEDVRQ  76

Query  201  TYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVR  344
            TY  G ELGRGQFGVT+L T R T ++ ACK+IA RKL++K+D++DVR
Sbjct  77   TYAIGKELGRGQFGVTHLCTDRVTGKQFACKTIAKRKLVNKEDIEDVR  124



>gb|ABV22575.1| calcium-dependent protein kinase [Physcomitrella patens]
 gb|ABV22576.1| calcium-dependent protein kinase [Physcomitrella patens]
Length=628

 Score = 89.4 bits (220),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 54/65 (83%), Gaps = 1/65 (2%)
 Frame = +3

Query  150  LSGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDD  329
            +S VG VLG+P+ D+  TY  G ELGRGQFGVTYL TH++T E+LACKSIA RKL++K+D
Sbjct  155  VSNVG-VLGKPLVDIRQTYSLGKELGRGQFGVTYLCTHKETGEKLACKSIAKRKLIAKED  213

Query  330  VDDVR  344
            ++DV+
Sbjct  214  IEDVK  218



>ref|XP_011024983.1| PREDICTED: calcium-dependent protein kinase 17 [Populus euphratica]
Length=530

 Score = 89.0 bits (219),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 40/62 (65%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            +G VLGRPMEDV S Y  G ELGRGQFG+T+L T++ T E+ ACK+IA RKL++K+DV+D
Sbjct  60   IGPVLGRPMEDVKSIYSIGKELGRGQFGITHLCTNKVTGEQFACKTIAKRKLVNKEDVED  119

Query  339  VR  344
            VR
Sbjct  120  VR  121



>ref|XP_009120894.1| PREDICTED: calcium-dependent protein kinase 34 [Brassica rapa]
 emb|CDX92536.1| BnaA10g15750D [Brassica napus]
Length=517

 Score = 89.0 bits (219),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 40/62 (65%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            +G VLGRPMEDV S+Y  G ELGRGQFGVTYL T + T  + ACK+IA RKL++K+D++D
Sbjct  45   IGPVLGRPMEDVKSSYSLGKELGRGQFGVTYLCTQKATGLQFACKTIAKRKLVNKEDIED  104

Query  339  VR  344
            VR
Sbjct  105  VR  106



>emb|CDY13993.1| BnaC09g38330D [Brassica napus]
Length=517

 Score = 89.0 bits (219),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 40/62 (65%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            +G VLGRPMEDV S+Y  G ELGRGQFGVTYL T + T  + ACK+IA RKL++K+D++D
Sbjct  45   IGPVLGRPMEDVKSSYSLGKELGRGQFGVTYLCTQKATGLQFACKTIAKRKLVNKEDIED  104

Query  339  VR  344
            VR
Sbjct  105  VR  106



>ref|XP_002299975.2| hypothetical protein POPTR_0001s28150g [Populus trichocarpa]
 gb|EEE84780.2| hypothetical protein POPTR_0001s28150g [Populus trichocarpa]
Length=505

 Score = 89.0 bits (219),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 40/62 (65%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            +G VLGRPMEDV S Y  G ELGRGQFG+T+L T++ T E+ ACK+IA RKL++K+DV+D
Sbjct  34   IGPVLGRPMEDVKSIYSIGKELGRGQFGITHLCTNKVTGEQFACKTIAKRKLVNKEDVED  93

Query  339  VR  344
            VR
Sbjct  94   VR  95



>ref|XP_009404695.1| PREDICTED: calcium-dependent protein kinase 34-like [Musa acuminata 
subsp. malaccensis]
Length=515

 Score = 89.0 bits (219),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 39/62 (63%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            +G VLGRPMED+ + Y  G ELGRGQFGVT+  TH+ T E LACK+IA RKL +K+D++D
Sbjct  46   IGPVLGRPMEDIRTMYTIGKELGRGQFGVTHRCTHKATGEELACKTIAKRKLRTKEDIED  105

Query  339  VR  344
            VR
Sbjct  106  VR  107



>dbj|BAK06618.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=521

 Score = 89.0 bits (219),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 50/64 (78%), Gaps = 0/64 (0%)
 Frame = +3

Query  153  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  332
            + +G VLGRPMEDV S Y  G ELGRGQFGVT L TH+ T ++ ACK+IA RKL +K+DV
Sbjct  48   AAIGPVLGRPMEDVRSIYTVGKELGRGQFGVTSLCTHKATGQKFACKTIAKRKLSTKEDV  107

Query  333  DDVR  344
            +DVR
Sbjct  108  EDVR  111



>gb|KHN38392.1| Calcium-dependent protein kinase 17 [Glycine soja]
Length=511

 Score = 89.0 bits (219),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 39/64 (61%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +3

Query  153  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  332
            + +G VLGR MEDV STY  G ELGRGQFGVT+L TH+ T ++ ACK+IA RKL++K+D+
Sbjct  55   AAIGPVLGRAMEDVKSTYSMGKELGRGQFGVTHLCTHKSTGKQYACKTIAKRKLVNKEDI  114

Query  333  DDVR  344
            +DV+
Sbjct  115  EDVK  118



>ref|NP_001044575.1| Os01g0808400 [Oryza sativa Japonica Group]
 dbj|BAD68074.1| putative calcium-dependent protein kinase [Oryza sativa Japonica 
Group]
 dbj|BAD68220.1| putative calcium-dependent protein kinase [Oryza sativa Japonica 
Group]
 dbj|BAF06489.1| Os01g0808400 [Oryza sativa Japonica Group]
Length=515

 Score = 88.6 bits (218),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            +G VLGRPMEDV S Y  G ELGRGQFGVT L TH+ T ++ ACK+IA RKL +K+DV+D
Sbjct  46   IGPVLGRPMEDVRSIYTIGKELGRGQFGVTSLCTHKATGQKFACKTIAKRKLSTKEDVED  105

Query  339  VR  344
            VR
Sbjct  106  VR  107



>gb|EAY76207.1| hypothetical protein OsI_04143 [Oryza sativa Indica Group]
 gb|EAZ13887.1| hypothetical protein OsJ_03814 [Oryza sativa Japonica Group]
Length=501

 Score = 88.6 bits (218),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            +G VLGRPMEDV S Y  G ELGRGQFGVT L TH+ T ++ ACK+IA RKL +K+DV+D
Sbjct  46   IGPVLGRPMEDVRSIYTIGKELGRGQFGVTSLCTHKATGQKFACKTIAKRKLSTKEDVED  105

Query  339  VR  344
            VR
Sbjct  106  VR  107



>ref|XP_006575622.1| PREDICTED: calcium-dependent protein kinase 34-like [Glycine 
max]
Length=527

 Score = 88.6 bits (218),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 39/64 (61%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +3

Query  153  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  332
            + +G VLGR MEDV STY  G ELGRGQFGVT+L TH+ T ++ ACK+IA RKL++K+D+
Sbjct  55   AAIGPVLGRAMEDVKSTYSMGKELGRGQFGVTHLCTHKSTGKQYACKTIAKRKLVNKEDI  114

Query  333  DDVR  344
            +DV+
Sbjct  115  EDVK  118



>gb|ABV22565.1| calcium-dependent protein kinase [Physcomitrella patens]
 gb|ABV22571.1| calcium-dependent protein kinase [Physcomitrella patens]
Length=545

 Score = 88.6 bits (218),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 41/61 (67%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +3

Query  162  GRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDV  341
            G VLG+P+ DV S Y  G ELGRGQFGVTY  T+ KT E LACKSIA RKL+SK+D++DV
Sbjct  78   GTVLGKPLSDVRSVYTLGKELGRGQFGVTYACTNIKTGEHLACKSIAKRKLISKEDIEDV  137

Query  342  R  344
            R
Sbjct  138  R  138



>gb|KHN12036.1| Calcium-dependent protein kinase 17 [Glycine soja]
Length=580

 Score = 89.0 bits (219),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 39/64 (61%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +3

Query  153  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  332
            + +G VLGR MEDV STY  G ELGRGQFGVT+L TH+ T ++ ACK+IA RKL++K+D+
Sbjct  46   AAIGPVLGRAMEDVKSTYSMGKELGRGQFGVTHLCTHKSTGKQYACKTIAKRKLVNKEDI  105

Query  333  DDVR  344
            +DV+
Sbjct  106  EDVK  109



>gb|AGT15898.1| calcium-dependent protein kinase [Saccharum hybrid cultivar R570]
 gb|AGT16288.1| Protein kinase-like domain [Saccharum hybrid cultivar R570]
Length=526

 Score = 88.6 bits (218),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            +G VLGRPMEDV STY  G ELGRGQFGVT L TH+ T ++ ACK+I+ RKL +K+D++D
Sbjct  56   IGPVLGRPMEDVKSTYTVGKELGRGQFGVTSLCTHKATGQKFACKTISKRKLSTKEDIED  115

Query  339  VR  344
            VR
Sbjct  116  VR  117



>gb|KJB55472.1| hypothetical protein B456_009G078000 [Gossypium raimondii]
Length=532

 Score = 88.6 bits (218),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 39/62 (63%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            +G VLGRPMED+ +TY  G ELGRGQFGVT+L T++ T E+ ACK+IA RKL +K+D++D
Sbjct  60   IGPVLGRPMEDIKTTYNIGKELGRGQFGVTHLCTNKSTGEQFACKTIAKRKLANKEDIED  119

Query  339  VR  344
            VR
Sbjct  120  VR  121



>gb|AGT16545.1| calcium-dependent protein kinase 34 [Saccharum hybrid cultivar 
R570]
Length=519

 Score = 88.6 bits (218),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            +G VLGRPMEDV STY  G ELGRGQFGVT L TH+ T ++ ACK+I+ RKL +K+D++D
Sbjct  56   IGPVLGRPMEDVKSTYTVGKELGRGQFGVTSLCTHKATGQKFACKTISKRKLSTKEDIED  115

Query  339  VR  344
            VR
Sbjct  116  VR  117



>gb|AGT17376.1| calcium-dependent protein kinase [Saccharum hybrid cultivar R570]
Length=540

 Score = 88.6 bits (218),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            +G VLGRPMEDV STY  G ELGRGQFGVT L TH+ T ++ ACK+I+ RKL +K+D++D
Sbjct  56   IGPVLGRPMEDVKSTYTVGKELGRGQFGVTSLCTHKATGQKFACKTISKRKLSTKEDIED  115

Query  339  VR  344
            VR
Sbjct  116  VR  117



>gb|AGT17455.1| hypothetical protein SHCRBa_258_F08_F_40 [Saccharum hybrid cultivar 
R570]
Length=519

 Score = 88.6 bits (218),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            +G VLGRPMEDV STY  G ELGRGQFGVT L TH+ T ++ ACK+I+ RKL +K+D++D
Sbjct  56   IGPVLGRPMEDVKSTYTVGKELGRGQFGVTSLCTHKATGQKFACKTISKRKLSTKEDIED  115

Query  339  VR  344
            VR
Sbjct  116  VR  117



>ref|XP_010419806.1| PREDICTED: calcium-dependent protein kinase 17-like isoform X2 
[Camelina sativa]
Length=528

 Score = 88.6 bits (218),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 39/62 (63%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            +G VLGRPMEDV S+Y  G ELGRGQFGVT+L T + T ++ ACK+IA RKL++K+D++D
Sbjct  58   IGPVLGRPMEDVKSSYSLGKELGRGQFGVTHLCTQKATGQQFACKTIAKRKLVNKEDIED  117

Query  339  VR  344
            VR
Sbjct  118  VR  119



>ref|XP_010419805.1| PREDICTED: calcium-dependent protein kinase 17-like isoform X1 
[Camelina sativa]
 ref|XP_010491975.1| PREDICTED: calcium-dependent protein kinase 17-like [Camelina 
sativa]
Length=527

 Score = 88.6 bits (218),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 39/62 (63%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            +G VLGRPMEDV S+Y  G ELGRGQFGVT+L T + T ++ ACK+IA RKL++K+D++D
Sbjct  57   IGPVLGRPMEDVKSSYSLGKELGRGQFGVTHLCTQKATGQQFACKTIAKRKLVNKEDIED  116

Query  339  VR  344
            VR
Sbjct  117  VR  118



>ref|XP_010453282.1| PREDICTED: calcium-dependent protein kinase 17 [Camelina sativa]
Length=530

 Score = 88.6 bits (218),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 39/62 (63%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            +G VLGRPMEDV S+Y  G ELGRGQFGVT+L T + T ++ ACK+IA RKL++K+D++D
Sbjct  60   IGPVLGRPMEDVKSSYSLGKELGRGQFGVTHLCTQKATGQQFACKTIAKRKLVNKEDIED  119

Query  339  VR  344
            VR
Sbjct  120  VR  121



>ref|XP_006289327.1| hypothetical protein CARUB_v10002812mg [Capsella rubella]
 gb|EOA22225.1| hypothetical protein CARUB_v10002812mg [Capsella rubella]
Length=530

 Score = 88.6 bits (218),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 39/62 (63%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            +G VLGRPMEDV S+Y  G ELGRGQFGVT+L T + T ++ ACK+IA RKL++K+D++D
Sbjct  60   IGPVLGRPMEDVKSSYSLGKELGRGQFGVTHLCTQKATGQQFACKTIAKRKLVNKEDIED  119

Query  339  VR  344
            VR
Sbjct  120  VR  121



>ref|XP_004961659.1| PREDICTED: calcium-dependent protein kinase 34-like [Setaria 
italica]
Length=573

 Score = 88.6 bits (218),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            VG VLGRPMEDV STY  G ELGRGQFGVT L TH+ T ++ ACK+I+ RKL +K+D++D
Sbjct  101  VGPVLGRPMEDVKSTYTVGKELGRGQFGVTSLCTHKATGQKFACKTISKRKLSTKEDIED  160

Query  339  VR  344
            VR
Sbjct  161  VR  162



>ref|XP_003564438.1| PREDICTED: calcium-dependent protein kinase 34 [Brachypodium 
distachyon]
Length=514

 Score = 88.2 bits (217),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            +G VLGRPMEDV S Y  G ELGRGQFGVT L TH+ T ++ ACK+IA RKL +K+DV+D
Sbjct  44   IGPVLGRPMEDVRSIYTVGKELGRGQFGVTSLCTHKATGQKFACKTIAKRKLSTKEDVED  103

Query  339  VR  344
            VR
Sbjct  104  VR  105



>ref|XP_010269425.1| PREDICTED: calcium-dependent protein kinase 34-like isoform X2 
[Nelumbo nucifera]
Length=530

 Score = 88.2 bits (217),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 40/62 (65%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            +G VL RPMEDV S Y  G ELGRGQFGVT+L TH+ T E+ ACK IA RKL +K+D++D
Sbjct  61   MGTVLNRPMEDVRSVYTIGKELGRGQFGVTHLCTHKVTGEQFACKMIAKRKLANKEDIED  120

Query  339  VR  344
            VR
Sbjct  121  VR  122



>ref|XP_010269424.1| PREDICTED: calcium-dependent protein kinase 34-like isoform X1 
[Nelumbo nucifera]
Length=534

 Score = 88.2 bits (217),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 40/62 (65%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            +G VL RPMEDV S Y  G ELGRGQFGVT+L TH+ T E+ ACK IA RKL +K+D++D
Sbjct  61   MGTVLNRPMEDVRSVYTIGKELGRGQFGVTHLCTHKVTGEQFACKMIAKRKLANKEDIED  120

Query  339  VR  344
            VR
Sbjct  121  VR  122



>ref|XP_006644875.1| PREDICTED: calcium-dependent protein kinase 34-like [Oryza brachyantha]
Length=518

 Score = 88.2 bits (217),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            +G VLGRPMEDV S Y  G ELGRGQFGVT L TH+ T ++ ACK+IA RKL +K+DV+D
Sbjct  49   IGPVLGRPMEDVRSIYTVGKELGRGQFGVTSLCTHKATGQKFACKTIAKRKLSTKEDVED  108

Query  339  VR  344
            VR
Sbjct  109  VR  110



>ref|XP_007146136.1| hypothetical protein PHAVU_006G015300g [Phaseolus vulgaris]
 gb|ESW18130.1| hypothetical protein PHAVU_006G015300g [Phaseolus vulgaris]
Length=544

 Score = 88.2 bits (217),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 40/64 (63%), Positives = 50/64 (78%), Gaps = 0/64 (0%)
 Frame = +3

Query  153  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  332
            S +G VL RPMEDV + Y  G ELGRGQFGVT+L T + T E+ ACK+IA RKL+SK+D+
Sbjct  71   SAMGPVLQRPMEDVRAAYTIGKELGRGQFGVTHLCTDKTTGEQFACKTIAKRKLVSKEDI  130

Query  333  DDVR  344
            +DVR
Sbjct  131  EDVR  134



>emb|CDX70450.1| BnaC03g05340D [Brassica napus]
Length=523

 Score = 88.2 bits (217),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            +G VLGRPMEDV S+Y  G ELGRGQFGVT+L T + T ++ ACK+IA RKL++K+D++D
Sbjct  53   IGPVLGRPMEDVKSSYSLGKELGRGQFGVTHLCTQKATGQQFACKTIAKRKLVNKEDIED  112

Query  339  VR  344
            VR
Sbjct  113  VR  114



>ref|XP_009121874.1| PREDICTED: calcium-dependent protein kinase 17 [Brassica rapa]
Length=522

 Score = 88.2 bits (217),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            +G VLGRPMEDV S+Y  G ELGRGQFGVT+L T + T ++ ACK+IA RKL++K+D++D
Sbjct  52   IGPVLGRPMEDVKSSYSLGKELGRGQFGVTHLCTQKATGQQFACKTIAKRKLVNKEDIED  111

Query  339  VR  344
            VR
Sbjct  112  VR  113



>ref|XP_009125853.1| PREDICTED: calcium-dependent protein kinase 17-like [Brassica 
rapa]
Length=522

 Score = 88.2 bits (217),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            +G VLGRPMEDV S+Y  G ELGRGQFGVT+L T + T ++ ACK+IA RKL++K+D++D
Sbjct  52   IGPVLGRPMEDVKSSYSLGKELGRGQFGVTHLCTQKATGQQFACKTIAKRKLVNKEDIED  111

Query  339  VR  344
            VR
Sbjct  112  VR  113



>emb|CDX97174.1| BnaC09g44510D [Brassica napus]
 emb|CDX69700.1| BnaA10g20490D [Brassica napus]
Length=522

 Score = 88.2 bits (217),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            +G VLGRPMEDV S+Y  G ELGRGQFGVT+L T + T ++ ACK+IA RKL++K+D++D
Sbjct  52   IGPVLGRPMEDVKSSYSLGKELGRGQFGVTHLCTQKATGQQFACKTIAKRKLVNKEDIED  111

Query  339  VR  344
            VR
Sbjct  112  VR  113



>ref|XP_011014420.1| PREDICTED: calcium-dependent protein kinase 34-like [Populus 
euphratica]
Length=525

 Score = 88.2 bits (217),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 39/65 (60%), Positives = 52/65 (80%), Gaps = 0/65 (0%)
 Frame = +3

Query  150  LSGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDD  329
            ++ +G VLGRPMED  S Y  G ELGRGQFG+T+L T++ T E+ ACK+IA RKL++K+D
Sbjct  52   VTPIGPVLGRPMEDAKSIYTIGKELGRGQFGITHLCTNKVTGEQFACKTIAKRKLVNKED  111

Query  330  VDDVR  344
            V+DVR
Sbjct  112  VEDVR  116



>ref|XP_002313265.1| calcium-dependent protein kinase [Populus trichocarpa]
 gb|EEE87220.1| calcium-dependent protein kinase [Populus trichocarpa]
Length=525

 Score = 88.2 bits (217),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 39/65 (60%), Positives = 52/65 (80%), Gaps = 0/65 (0%)
 Frame = +3

Query  150  LSGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDD  329
            ++ +G VLGRPMED  S Y  G ELGRGQFG+T+L T++ T E+ ACK+IA RKL++K+D
Sbjct  52   VTPIGPVLGRPMEDAKSIYTIGKELGRGQFGITHLCTNKVTGEQFACKTIAKRKLVNKED  111

Query  330  VDDVR  344
            V+DVR
Sbjct  112  VEDVR  116



>ref|XP_011009111.1| PREDICTED: calcium-dependent protein kinase 34-like [Populus 
euphratica]
Length=525

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 39/65 (60%), Positives = 52/65 (80%), Gaps = 0/65 (0%)
 Frame = +3

Query  150  LSGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDD  329
            ++ +G VLGRPMED  S Y  G ELGRGQFG+T+L T++ T E+ ACK+IA RKL++K+D
Sbjct  52   VTPIGPVLGRPMEDAKSIYTIGKELGRGQFGITHLCTNKVTGEQFACKTIAKRKLVNKED  111

Query  330  VDDVR  344
            V+DVR
Sbjct  112  VEDVR  116



>ref|XP_002276630.2| PREDICTED: calcium-dependent protein kinase 34-like [Vitis vinifera]
Length=534

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 39/62 (63%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            +G VLGRPMEDV + Y  G ELGRGQFGVT+L T + T E+ ACK+IA RKL++K+D++D
Sbjct  65   IGPVLGRPMEDVRTLYTIGKELGRGQFGVTHLCTSKATGEQFACKTIAKRKLVNKEDIED  124

Query  339  VR  344
            VR
Sbjct  125  VR  126



>gb|AFW82381.1| putative calcium-dependent protein kinase family protein [Zea 
mays]
Length=613

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +3

Query  159  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  338
            +G VLGRPMEDV +TY  G ELGRGQFGVT L TH+ T  R ACK+I+ RKL +K+DV+D
Sbjct  143  IGPVLGRPMEDVRATYAVGKELGRGQFGVTSLCTHKATGHRFACKTISKRKLSTKEDVED  202

Query  339  VR  344
            VR
Sbjct  203  VR  204



>gb|EMT23982.1| Calcium-dependent protein kinase 17 [Aegilops tauschii]
Length=546

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 41/59 (69%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +3

Query  168  VLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVR  344
            VLGR MEDV +TY  G ELGRGQFGV  L THR T E+LACK+IA RKL +K+DV+DVR
Sbjct  62   VLGRAMEDVRTTYSIGKELGRGQFGVPRLCTHRSTGEKLACKTIAKRKLANKEDVEDVR  120



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 556620951360