BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002D12

Length=568
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009592542.1|  PREDICTED: pectinesterase-like                     143   1e-36   Nicotiana tomentosiformis
ref|XP_011015915.1|  PREDICTED: pectinesterase-like                     136   5e-34   Populus euphratica
ref|XP_002271665.2|  PREDICTED: pectinesterase-like                     134   3e-33   Vitis vinifera
emb|CBI36883.3|  unnamed protein product                                134   3e-33   Vitis vinifera
ref|XP_010269596.1|  PREDICTED: pectinesterase-like                     133   5e-33   Nelumbo nucifera [Indian lotus]
gb|EPS62329.1|  pectinesterase                                          133   7e-33   Genlisea aurea
ref|XP_011010963.1|  PREDICTED: pectinesterase-like                     132   9e-33   Populus euphratica
ref|XP_010259481.1|  PREDICTED: pectinesterase-like                     131   3e-32   Nelumbo nucifera [Indian lotus]
ref|XP_011079629.1|  PREDICTED: pectinesterase-like                     131   3e-32   Sesamum indicum [beniseed]
gb|EYU46746.1|  hypothetical protein MIMGU_mgv1a0044632mg               124   1e-31   Erythranthe guttata [common monkey flower]
ref|XP_002301486.2|  hypothetical protein POPTR_0002s20370g             127   9e-31   
gb|AHB84678.1|  pectin methylesterase                                   126   2e-30   Citrus reticulata [mandarin orange]
ref|XP_009783075.1|  PREDICTED: pectinesterase-like                     126   2e-30   Nicotiana sylvestris
emb|CDP15269.1|  unnamed protein product                                124   4e-30   Coffea canephora [robusta coffee]
emb|CDP15270.1|  unnamed protein product                                125   6e-30   Coffea canephora [robusta coffee]
ref|XP_003519757.1|  PREDICTED: probable pectinesterase/pectinest...    124   2e-29   Glycine max [soybeans]
ref|XP_006444399.1|  hypothetical protein CICLE_v100237231mg            123   2e-29   
ref|XP_006480001.1|  PREDICTED: probable pectinesterase/pectinest...    123   2e-29   Citrus sinensis [apfelsine]
ref|XP_002523113.1|  Pectinesterase-3 precursor, putative               122   5e-29   Ricinus communis
ref|XP_009614504.1|  PREDICTED: pectinesterase-like                     122   8e-29   Nicotiana tomentosiformis
ref|XP_007163135.1|  hypothetical protein PHAVU_001G209400g             121   1e-28   Phaseolus vulgaris [French bean]
ref|XP_010321856.1|  PREDICTED: pectinesterase                          120   2e-28   Solanum lycopersicum
ref|XP_009628637.1|  PREDICTED: pectinesterase-like                     119   6e-28   Nicotiana tomentosiformis
ref|XP_007145198.1|  hypothetical protein PHAVU_007G218500g             118   1e-27   Phaseolus vulgaris [French bean]
ref|XP_007201179.1|  hypothetical protein PRUPE_ppa003400mg             116   8e-27   
ref|XP_008235121.1|  PREDICTED: pectinesterase-like                     115   1e-26   Prunus mume [ume]
ref|XP_009765668.1|  PREDICTED: pectinesterase-like                     115   1e-26   Nicotiana sylvestris
ref|XP_009771845.1|  PREDICTED: pectinesterase-like                     114   4e-26   Nicotiana sylvestris
ref|XP_003553658.2|  PREDICTED: probable pectinesterase/pectinest...    114   1e-25   Glycine max [soybeans]
gb|KHG05999.1|  putative pectinesterase/pectinesterase inhibitor ...    112   3e-25   Gossypium arboreum [tree cotton]
ref|XP_004290811.1|  PREDICTED: pectinesterase-like                     111   5e-25   Fragaria vesca subsp. vesca
ref|XP_004494389.1|  PREDICTED: probable pectinesterase/pectinest...    109   2e-24   Cicer arietinum [garbanzo]
gb|KJB41904.1|  hypothetical protein B456_007G127000                    108   7e-24   Gossypium raimondii
ref|XP_010069896.1|  PREDICTED: pectinesterase-like                     107   2e-23   Eucalyptus grandis [rose gum]
ref|XP_008359413.1|  PREDICTED: pectinesterase-like                     103   4e-22   
gb|KJB09419.1|  hypothetical protein B456_001G140500                    102   7e-22   Gossypium raimondii
gb|KEH24404.1|  pectinesterase/pectinesterase inhibitor                 102   7e-22   Medicago truncatula
ref|XP_004247400.1|  PREDICTED: pectinesterase-like                     102   1e-21   Solanum lycopersicum
gb|EPS67066.1|  pectinesterase                                          100   7e-21   Genlisea aurea
ref|XP_006359860.1|  PREDICTED: probable pectinesterase/pectinest...  99.4    1e-20   Solanum tuberosum [potatoes]
ref|XP_010910828.1|  PREDICTED: pectinesterase 3-like                 92.4    5e-19   
ref|XP_008795768.1|  PREDICTED: pectinesterase-like                   91.7    5e-18   Phoenix dactylifera
ref|XP_009383893.1|  PREDICTED: pectinesterase-like                   90.5    1e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010556724.1|  PREDICTED: pectinesterase-like                   89.4    3e-17   Tarenaya hassleriana [spider flower]
ref|XP_009401623.1|  PREDICTED: pectinesterase 3-like                 87.4    3e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010230835.1|  PREDICTED: pectinesterase-like                   86.3    3e-16   Brachypodium distachyon [annual false brome]
gb|KJB49889.1|  hypothetical protein B456_008G143700                  85.9    5e-16   Gossypium raimondii
gb|EEE54425.1|  hypothetical protein OsJ_01485                        84.7    1e-15   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009382521.1|  PREDICTED: pectinesterase-like                   84.3    2e-15   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACQ85264.1|  pectin methylesterase                                 84.0    2e-15   Musa acuminata AAA Group [Cavendish banana]
gb|AGG23325.1|  pectin methylesterase 1                               83.6    3e-15   Musa acuminata AAA Group [Cavendish banana]
gb|EEC70505.1|  hypothetical protein OsI_01594                        83.6    3e-15   Oryza sativa Indica Group [Indian rice]
ref|XP_002455538.1|  hypothetical protein SORBIDRAFT_03g012830        83.2    4e-15   Sorghum bicolor [broomcorn]
tpg|DAA54386.1|  TPA: hypothetical protein ZEAMMB73_825660            80.1    1e-14   
ref|NP_001146685.1|  pectinesterase precursor                         80.9    3e-14   Zea mays [maize]
ref|XP_010056842.1|  PREDICTED: pectinesterase-like                   78.2    2e-13   Eucalyptus grandis [rose gum]
ref|XP_010058837.1|  PREDICTED: uncharacterized protein LOC104446716  77.4    8e-13   
ref|XP_010684346.1|  PREDICTED: pectinesterase-like                   75.9    1e-12   Beta vulgaris subsp. vulgaris [field beet]
dbj|BAJ96804.1|  predicted protein                                    75.1    2e-12   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KHN43496.1|  Putative pectinesterase/pectinesterase inhibitor 40   74.3    3e-12   Glycine soja [wild soybean]
ref|XP_010042403.1|  PREDICTED: probable pectinesterase/pectinest...  70.9    1e-11   Eucalyptus grandis [rose gum]
ref|XP_010058840.1|  PREDICTED: pectinesterase-like                   71.6    3e-11   
gb|EMS68834.1|  Pectinesterase 1                                      70.5    6e-11   Triticum urartu
gb|EMT05022.1|  Pectinesterase 3                                      69.3    1e-10   
ref|XP_006355852.1|  PREDICTED: probable pectinesterase/pectinest...  67.4    2e-10   
ref|XP_006355816.1|  PREDICTED: pectinesterase-like                   68.9    2e-10   
gb|KHN08672.1|  Putative pectinesterase/pectinesterase inhibitor 40   66.2    1e-09   Glycine soja [wild soybean]
gb|ABQ42392.1|  pectin methylesterase-like protein                    65.5    3e-09   Taiwania cryptomerioides
emb|CDX97564.1|  BnaA05g25150D                                        65.1    5e-09   
gb|KGN44975.1|  Pectinesterase                                        65.1    5e-09   Cucumis sativus [cucumbers]
ref|XP_009146386.1|  PREDICTED: pectinesterase/pectinesterase inh...  64.7    5e-09   Brassica rapa
ref|XP_009117000.1|  PREDICTED: pectinesterase/pectinesterase inh...  64.7    6e-09   Brassica rapa
emb|CDX75765.1|  BnaC03g38480D                                        63.9    1e-08   
emb|CDX98441.1|  BnaC05g39340D                                        63.2    2e-08   
ref|XP_010489830.1|  PREDICTED: pectinesterase/pectinesterase inh...  60.8    2e-08   Camelina sativa [gold-of-pleasure]
gb|ABG46324.1|  putative pectin methylesterase                        62.4    2e-08   Picea abies
emb|CDY60700.1|  BnaA01g37100D                                        62.8    2e-08   Brassica napus [oilseed rape]
ref|XP_004136014.1|  PREDICTED: probable pectinesterase/pectinest...  62.4    3e-08   Cucumis sativus [cucumbers]
gb|KFK38797.1|  hypothetical protein AALP_AA3G161500                  62.4    3e-08   Arabis alpina [alpine rockcress]
ref|XP_010465323.1|  PREDICTED: pectinesterase/pectinesterase inh...  62.0    5e-08   Camelina sativa [gold-of-pleasure]
ref|XP_006407094.1|  hypothetical protein EUTSA_v10020354mg           61.6    7e-08   Eutrema salsugineum [saltwater cress]
emb|CDY33229.1|  BnaC01g37020D                                        61.2    7e-08   Brassica napus [oilseed rape]
gb|ACN40984.1|  unknown                                               61.2    8e-08   Picea sitchensis
ref|XP_010685210.1|  PREDICTED: pectinesterase-like                   61.2    8e-08   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006297218.1|  hypothetical protein CARUB_v10013226mg           61.2    8e-08   
ref|XP_010501842.1|  PREDICTED: pectinesterase/pectinesterase inh...  61.2    9e-08   Camelina sativa [gold-of-pleasure]
ref|XP_004171768.1|  PREDICTED: probable pectinesterase/pectinest...  61.2    9e-08   
ref|XP_007012502.1|  Pectin methylesterase 3                          60.8    1e-07   
emb|CDY39109.1|  BnaA01g29470D                                        60.1    2e-07   Brassica napus [oilseed rape]
emb|CDY33228.1|  BnaC01g37010D                                        60.1    2e-07   Brassica napus [oilseed rape]
ref|XP_009116991.1|  PREDICTED: pectinesterase/pectinesterase inh...  60.1    2e-07   Brassica rapa
ref|XP_002885033.1|  ATPME3                                           59.3    3e-07   
ref|XP_010273995.1|  PREDICTED: pectinesterase 1-like                 57.8    3e-07   
ref|NP_188048.1|  pectin methylesterase 3                             59.3    3e-07   Arabidopsis thaliana [mouse-ear cress]
gb|ABZ89800.1|  pectin methylesterase-like protein                    59.3    3e-07   Taiwania cryptomerioides
gb|KDP33984.1|  hypothetical protein JCGZ_07555                       59.3    4e-07   Jatropha curcas
ref|XP_010047425.1|  PREDICTED: pectinesterase-like                   58.9    4e-07   Eucalyptus grandis [rose gum]
emb|CDY67447.1|  BnaA03g57460D                                        57.4    4e-07   Brassica napus [oilseed rape]
gb|AAC50023.1|  ATPME2 precursor                                      58.9    4e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009606552.1|  PREDICTED: pectinesterase/pectinesterase inh...  58.9    5e-07   Nicotiana tomentosiformis
ref|XP_002891774.1|  ATPME2                                           58.9    5e-07   Arabidopsis lyrata subsp. lyrata
emb|CAB95025.1|  pectin methylesterase                                58.9    5e-07   Nicotiana tabacum [American tobacco]
gb|AAO85706.1|  pectin methyl-esterase                                58.9    5e-07   Nicotiana benthamiana
ref|XP_009762395.1|  PREDICTED: pectinesterase/pectinesterase inh...  58.5    5e-07   Nicotiana sylvestris
gb|KHN03710.1|  Putative pectinesterase/pectinesterase inhibitor 40   58.5    5e-07   Glycine soja [wild soybean]
gb|AAC72288.1|  putative pectin methylesterase                        58.5    5e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006658118.1|  PREDICTED: pectinesterase 3-like                 58.5    5e-07   
ref|XP_010656074.1|  PREDICTED: pectinesterase-like                   58.5    5e-07   Vitis vinifera
gb|KHF97383.1|  Pectinesterase/pectinesterase inhibitor U1            58.5    6e-07   Gossypium arboreum [tree cotton]
gb|KDP33985.1|  hypothetical protein JCGZ_07556                       58.2    8e-07   Jatropha curcas
ref|NP_175786.1|  pectin methylesterase 2                             58.2    9e-07   Arabidopsis thaliana [mouse-ear cress]
gb|KJB54563.1|  hypothetical protein B456_009G039100                  57.8    1e-06   Gossypium raimondii
gb|KJB54564.1|  hypothetical protein B456_009G039100                  57.4    1e-06   Gossypium raimondii
gb|KDO53765.1|  hypothetical protein CISIN_1g018173mg                 57.0    1e-06   Citrus sinensis [apfelsine]
ref|XP_009135376.1|  PREDICTED: pectinesterase/pectinesterase inh...  57.4    1e-06   Brassica rapa
gb|KHG08631.1|  Pectinesterase 3                                      57.4    1e-06   Gossypium arboreum [tree cotton]
gb|AFB77928.1|  pectin methylesterase                                 57.4    1e-06   Gossypium hirsutum [American cotton]
ref|NP_001275859.1|  pectinesterase 1 precursor                       57.4    1e-06   Citrus sinensis [apfelsine]
sp|O04886.1|PME1_CITSI  RecName: Full=Pectinesterase 1; Short=PE ...  57.4    2e-06   Citrus sinensis [apfelsine]
sp|P83948.1|PME3_CITSI  RecName: Full=Pectinesterase 3; Short=PE ...  57.4    2e-06   Citrus sinensis [apfelsine]
gb|AFW03476.1|  pectin methylesterase 2                               57.0    2e-06   Gossypium barbadense [Egyptian cotton]
ref|XP_010458855.1|  PREDICTED: 21 kDa protein-like                   55.1    2e-06   Camelina sativa [gold-of-pleasure]
ref|XP_002516186.1|  Pectinesterase-3 precursor, putative             56.6    2e-06   Ricinus communis
ref|XP_007139063.1|  hypothetical protein PHAVU_009G261700g           56.6    2e-06   Phaseolus vulgaris [French bean]
emb|CDY51798.1|  BnaC06g41940D                                        56.6    3e-06   Brassica napus [oilseed rape]
ref|XP_010483948.1|  PREDICTED: 21 kDa protein-like isoform X1        54.7    3e-06   Camelina sativa [gold-of-pleasure]
gb|KDO65437.1|  hypothetical protein CISIN_1g029238mg                 54.7    3e-06   Citrus sinensis [apfelsine]
ref|XP_010047424.1|  PREDICTED: pectinesterase-like                   56.2    3e-06   Eucalyptus grandis [rose gum]
gb|ADE76337.1|  unknown                                               54.3    4e-06   Picea sitchensis
ref|XP_004298672.1|  PREDICTED: 21 kDa protein                        54.3    4e-06   Fragaria vesca subsp. vesca
gb|AFW03480.1|  pectin methylesterase 1                               55.8    4e-06   Gossypium hirsutum [American cotton]
ref|NP_001274969.1|  pectin methyl esterase                           55.8    4e-06   Solanum tuberosum [potatoes]
gb|AER38243.1|  PME2                                                  55.8    4e-06   Gossypium barbadense [Egyptian cotton]
gb|KJB57093.1|  hypothetical protein B456_009G147900                  55.8    5e-06   Gossypium raimondii
ref|XP_010444081.1|  PREDICTED: 21 kDa protein-like                   53.9    5e-06   Camelina sativa [gold-of-pleasure]
ref|XP_011072691.1|  PREDICTED: pectinesterase-like                   55.8    5e-06   Sesamum indicum [beniseed]
gb|AFB77929.1|  pectin methylesterase                                 55.8    5e-06   Gossypium hirsutum [American cotton]
gb|AFW03475.1|  pectin methylesterase 1                               55.8    5e-06   Gossypium barbadense [Egyptian cotton]
ref|XP_002324773.2|  hypothetical protein POPTR_0018s05360g           55.1    6e-06   
ref|XP_006369078.1|  hypothetical protein POPTR_0001s162502g          55.1    6e-06   
ref|XP_006490093.1|  PREDICTED: 21 kDa protein-like                   53.5    7e-06   Citrus sinensis [apfelsine]
ref|XP_006281048.1|  hypothetical protein CARUB_v10027064mg           53.9    8e-06   Capsella rubella
gb|KJB19687.1|  hypothetical protein B456_003G114500                  53.5    9e-06   Gossypium raimondii
gb|AFW03481.1|  pectin methylesterase 2                               54.7    9e-06   Gossypium hirsutum [American cotton]
ref|NP_001233857.1|  pectinesterase/pectinesterase inhibitor U1 p...  55.1    9e-06   
ref|XP_006421707.1|  hypothetical protein CICLE_v10005946mg           53.1    9e-06   Citrus clementina [clementine]
ref|XP_004144447.1|  PREDICTED: pectinesterase 3-like                 54.7    9e-06   
ref|XP_004168887.1|  PREDICTED: pectinesterase 3-like                 54.7    1e-05   
emb|CDY08206.1|  BnaA05g14130D                                        54.7    1e-05   Brassica napus [oilseed rape]
ref|XP_002277473.1|  PREDICTED: pectinesterase                        54.7    1e-05   
ref|XP_010261668.1|  PREDICTED: pectinesterase-like                   54.7    1e-05   Nelumbo nucifera [Indian lotus]
ref|NP_001060620.1|  Os07g0675100                                     54.7    1e-05   
ref|XP_002864788.1|  invertase/pectin methylesterase inhibitor fa...  53.1    1e-05   Arabidopsis lyrata subsp. lyrata
ref|XP_011031815.1|  PREDICTED: pectinesterase-like                   54.3    1e-05   Populus euphratica
ref|XP_010420924.1|  PREDICTED: 21 kDa protein-like                   53.1    1e-05   Camelina sativa [gold-of-pleasure]
ref|XP_007038418.1|  DC1.2-like, putative                             53.1    1e-05   
ref|XP_008368265.1|  PREDICTED: pectinesterase 3-like                 53.9    2e-05   
emb|CBI27756.3|  unnamed protein product                              53.9    2e-05   Vitis vinifera
ref|XP_010029512.1|  PREDICTED: pectinesterase-like                   53.9    2e-05   Eucalyptus grandis [rose gum]
ref|XP_006388348.1|  hypothetical protein POPTR_0214s00200g           53.5    2e-05   Populus trichocarpa [western balsam poplar]
emb|CAC01624.1|  putative pectin methylesterase                       53.5    3e-05   Populus tremula x Populus tremuloides
ref|XP_006490094.1|  PREDICTED: 21 kDa protein-like                   52.4    3e-05   
ref|XP_006421706.1|  hypothetical protein CICLE_v10005926mg           52.0    3e-05   Citrus clementina [clementine]
gb|ABK22757.1|  unknown                                               52.0    3e-05   Picea sitchensis
gb|ACN40648.1|  unknown                                               52.0    3e-05   Picea sitchensis
gb|AAC05147.1|  21 kD protein precursor                               52.0    4e-05   Pinus radiata
ref|XP_010939846.1|  PREDICTED: pectinesterase-like                   53.1    4e-05   Elaeis guineensis
ref|XP_004245727.1|  PREDICTED: 21 kDa protein-like                   51.6    4e-05   Solanum lycopersicum
ref|XP_002322405.2|  ripening-related family protein                  51.6    4e-05   Populus trichocarpa [western balsam poplar]
ref|XP_011048630.1|  PREDICTED: pectinesterase-like                   52.8    4e-05   Populus euphratica
gb|ABK22631.1|  unknown                                               51.6    4e-05   Picea sitchensis
gb|KFK35693.1|  hypothetical protein AALP_AA4G024900                  52.4    6e-05   Arabis alpina [alpine rockcress]
gb|ABK24883.1|  unknown                                               52.4    6e-05   Picea sitchensis
ref|XP_003625921.1|  Pectinesterase/pectinesterase inhibitor          51.2    7e-05   Medicago truncatula
ref|XP_002304257.2|  pectinesterase family protein                    52.4    7e-05   Populus trichocarpa [western balsam poplar]
ref|XP_002265171.1|  PREDICTED: pectinesterase                        52.4    7e-05   Vitis vinifera
gb|KFK27963.1|  hypothetical protein AALP_AA8G454300                  51.2    7e-05   Arabis alpina [alpine rockcress]
ref|XP_008340373.1|  PREDICTED: pectinesterase 3-like                 52.4    7e-05   
ref|XP_006355502.1|  PREDICTED: 21 kDa protein-like                   51.2    7e-05   Solanum tuberosum [potatoes]
ref|XP_009601611.1|  PREDICTED: pectinesterase-like                   52.4    7e-05   Nicotiana tomentosiformis
ref|XP_009151355.1|  PREDICTED: 21 kDa protein                        50.8    7e-05   Brassica rapa
gb|KDP22409.1|  hypothetical protein JCGZ_26240                       51.2    7e-05   Jatropha curcas
ref|XP_008460358.1|  PREDICTED: pectinesterase-like                   52.0    8e-05   Cucumis melo [Oriental melon]
ref|XP_008242331.1|  PREDICTED: pectinesterase-like                   52.0    9e-05   Prunus mume [ume]
ref|XP_008228105.1|  PREDICTED: pectinesterase                        52.0    9e-05   Prunus mume [ume]
ref|NP_201042.2|  plant invertase/pectin methylesterase inhibitor...  50.4    1e-04   Arabidopsis thaliana [mouse-ear cress]
gb|AAN60276.1|  unknown                                               50.4    1e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011078159.1|  PREDICTED: pectinesterase-like isoform X1        51.6    1e-04   Sesamum indicum [beniseed]
gb|KHN32444.1|  21 kDa protein                                        50.4    1e-04   Glycine soja [wild soybean]
ref|XP_007217169.1|  hypothetical protein PRUPE_ppa003285mg           51.2    1e-04   Prunus persica
ref|XP_004506603.1|  PREDICTED: 21 kDa protein-like                   50.1    1e-04   Cicer arietinum [garbanzo]
ref|XP_008462453.1|  PREDICTED: pectinesterase-like                   51.2    1e-04   
ref|XP_006828586.1|  hypothetical protein AMTR_s00129p00044320        51.2    1e-04   Amborella trichopoda
ref|XP_003528739.1|  PREDICTED: pectinesterase/pectinesterase inh...  51.2    2e-04   
ref|XP_003627458.1|  Pectinesterase                                   51.2    2e-04   Medicago truncatula
gb|EEC82670.1|  hypothetical protein OsI_27314                        51.2    2e-04   Oryza sativa Indica Group [Indian rice]
ref|XP_011078160.1|  PREDICTED: pectinesterase-like isoform X2        51.2    2e-04   
gb|EYU25806.1|  hypothetical protein MIMGU_mgv1a003215mg              51.2    2e-04   Erythranthe guttata [common monkey flower]
ref|XP_009123661.1|  PREDICTED: pectinesterase 2                      51.2    2e-04   
ref|NP_001265901.1|  pectinesterase 3-like                            51.2    2e-04   Cicer arietinum [garbanzo]
ref|XP_006307088.1|  hypothetical protein CARUB_v10008673mg           50.8    2e-04   Capsella rubella
ref|XP_010029511.1|  PREDICTED: pectinesterase-like                   50.8    2e-04   Eucalyptus grandis [rose gum]
ref|XP_010534986.1|  PREDICTED: pectinesterase/pectinesterase inh...  50.8    2e-04   Tarenaya hassleriana [spider flower]
ref|XP_010264195.1|  PREDICTED: 21 kDa protein-like                   50.1    2e-04   Nelumbo nucifera [Indian lotus]
ref|XP_003541070.2|  PREDICTED: 21 kDa protein-like                   50.4    2e-04   
ref|XP_002532944.1|  Pectinesterase-3 precursor, putative             50.8    2e-04   Ricinus communis
ref|XP_008348472.1|  PREDICTED: pectinesterase-like                   50.8    2e-04   
ref|XP_010462289.1|  PREDICTED: pectinesterase 2                      50.8    2e-04   Camelina sativa [gold-of-pleasure]
ref|XP_009335681.1|  PREDICTED: 21 kDa protein-like                   49.7    2e-04   Pyrus x bretschneideri [bai li]
gb|AJH66132.1|  pectin methylesterase                                 50.8    2e-04   Malus domestica [apple tree]
ref|XP_010273801.1|  PREDICTED: pectinesterase                        50.8    2e-04   Nelumbo nucifera [Indian lotus]
ref|XP_009335740.1|  PREDICTED: 21 kDa protein                        49.7    2e-04   Pyrus x bretschneideri [bai li]
ref|XP_006828574.1|  hypothetical protein AMTR_s00129p00028250        50.4    3e-04   Amborella trichopoda
ref|XP_003627459.1|  Pectinesterase                                   50.1    3e-04   
ref|XP_010937249.1|  PREDICTED: pectinesterase-like                   50.4    3e-04   Elaeis guineensis
ref|XP_002510935.1|  21 kDa protein precursor, putative               49.3    3e-04   Ricinus communis
emb|CDX86901.1|  BnaC03g51710D                                        49.3    3e-04   
gb|AFI23411.1|  pectin methylesterase                                 50.4    3e-04   Coffea arabica [arabica coffee]
ref|XP_010088304.1|  putative pectinesterase/pectinesterase inhib...  50.1    3e-04   
ref|XP_010454384.1|  PREDICTED: 21 kDa protein-like                   49.3    3e-04   Camelina sativa [gold-of-pleasure]
ref|XP_006394407.1|  hypothetical protein EUTSA_v10004950mg           49.3    3e-04   Eutrema salsugineum [saltwater cress]
ref|XP_010543030.1|  PREDICTED: pectinesterase 2-like                 50.1    4e-04   Tarenaya hassleriana [spider flower]
ref|XP_011012638.1|  PREDICTED: pectinesterase-like                   50.1    4e-04   Populus euphratica
emb|CDX87244.1|  BnaC09g05590D                                        49.3    4e-04   
ref|XP_010047423.1|  PREDICTED: pectinesterase-like                   50.1    4e-04   Eucalyptus grandis [rose gum]
ref|XP_009767827.1|  PREDICTED: pectinesterase-like                   50.1    4e-04   Nicotiana sylvestris
ref|XP_010493188.1|  PREDICTED: 21 kDa protein-like                   49.3    4e-04   Camelina sativa [gold-of-pleasure]
ref|XP_010096537.1|  Pectinesterase 3                                 49.7    4e-04   
ref|XP_011094019.1|  PREDICTED: pectinesterase-like                   49.7    5e-04   Sesamum indicum [beniseed]
ref|XP_007204488.1|  hypothetical protein PRUPE_ppa019698mg           49.7    5e-04   
gb|AAG17110.1|AF188895_1  putative pectin methylesterase 3            49.7    5e-04   Linum usitatissimum
ref|XP_006357906.1|  PREDICTED: 21 kDa protein-like                   48.5    6e-04   Solanum tuberosum [potatoes]
gb|EYU29496.1|  hypothetical protein MIMGU_mgv1a003055mg              49.3    6e-04   Erythranthe guttata [common monkey flower]
gb|EYU21270.1|  hypothetical protein MIMGU_mgv1a003278mg              49.3    7e-04   Erythranthe guttata [common monkey flower]
gb|AFK47771.1|  unknown                                               48.5    7e-04   Lotus japonicus
ref|XP_010479961.1|  PREDICTED: pectinesterase 2-like                 49.3    7e-04   Camelina sativa [gold-of-pleasure]
emb|CDY00279.1|  BnaA06g21800D                                        48.1    8e-04   
ref|XP_008238630.1|  PREDICTED: 21 kDa protein                        48.1    8e-04   Prunus mume [ume]
gb|AFK37116.1|  unknown                                               48.1    8e-04   Lotus japonicus
ref|XP_009767669.1|  PREDICTED: 21 kDa protein                        48.1    9e-04   Nicotiana sylvestris
ref|XP_003588521.1|  Pectinesterase                                   48.9    9e-04   Medicago truncatula
ref|XP_004172115.1|  PREDICTED: pectinesterase 3-like                 48.9    9e-04   
ref|XP_004141734.1|  PREDICTED: pectinesterase 3-like                 48.9    9e-04   Cucumis sativus [cucumbers]
ref|XP_007218426.1|  hypothetical protein PRUPE_ppa011607mg           48.1    0.001   Prunus persica
ref|XP_011010936.1|  PREDICTED: 21 kDa protein-like isoform X1        47.8    0.001   Populus euphratica



>ref|XP_009592542.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=568

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 78/168 (46%), Positives = 110/168 (65%), Gaps = 9/168 (5%)
 Frame = +1

Query  64   MHNLKQKATLFFTISGCSAIVLLAFLSVTSFNSLFTKDGISSSTGPTHLDLNLNIHRQKL  243
            M+N++ K +L  TI   +A++LL F  + S       +  SSS+      +  +IH  K 
Sbjct  1    MYNIRHKPSLILTILASTALILLTFFVLLS-------NPKSSSSRAAEKTMTPHIHVHKN  53

Query  244  LQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIR  423
            +Q+A +  CEGTL+PELCVSTL++  P+   K+I EII++TV + V EV+ASA NCS +R
Sbjct  54   IQIAQSH-CEGTLHPELCVSTLSS-FPNLHRKSIAEIISSTVKIAVGEVRASAHNCSDLR  111

Query  424  RKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDL  567
            R +P+L P+EKRAL DC+EL  ET  ELR  LSDL+   S+SKHY D+
Sbjct  112  RHVPKLEPIEKRALQDCVELLGETIAELRTALSDLSPKKSASKHYNDI  159



>ref|XP_011015915.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=558

 Score =   136 bits (342),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 90/114 (79%), Gaps = 3/114 (3%)
 Frame = +1

Query  226  IHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAA  405
            +H  K +Q+AH+ AC+GTLYPELCVSTL + LPD  +K++PE I+AT+N T+DEV+AS+A
Sbjct  43   LHIHKHIQIAHS-ACKGTLYPELCVSTLVS-LPDLASKSLPEFISATLNKTMDEVRASSA  100

Query  406  NCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDL  567
            NC+ IR K+ +LGPLEK AL DC+ELF +T  EL+  +SDLA   S+SKHY DL
Sbjct  101  NCNAIRNKI-KLGPLEKVALKDCIELFDDTIAELKSAISDLAPRKSTSKHYHDL  153



>ref|XP_002271665.2| PREDICTED: pectinesterase-like [Vitis vinifera]
Length=561

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 76/150 (51%), Positives = 100/150 (67%), Gaps = 3/150 (2%)
 Frame = +1

Query  118  AIVLLAFLSVTSFNSLFTKDGISSSTGPTHLDLNLNIHRQKLLQVAHTEACEGTLYPELC  297
            A  LL+ LS+++F  L           P + ++   +H  K +Q+AH+  CEGTLYPELC
Sbjct  8    AKFLLSLLSISAFAFLLLTTVKPLKKSPKNTEIP-QLHLHKHVQIAHSH-CEGTLYPELC  65

Query  298  VSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGPLEKRALDDCL  477
            VSTL+T  PD  +KT+PE+IAATV+ TV EVK SA+NCSGIRRKL  L  LE RA++DCL
Sbjct  66   VSTLST-FPDLASKTVPEVIAATVSHTVGEVKLSASNCSGIRRKLKNLNTLEGRAINDCL  124

Query  478  ELFSETRDELRKVLSDLATTASSSKHYVDL  567
            EL   T  +L+  +SDL+   S +KHY DL
Sbjct  125  ELHDCTIAQLQSTISDLSHNNSPAKHYHDL  154



>emb|CBI36883.3| unnamed protein product [Vitis vinifera]
Length=549

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 76/150 (51%), Positives = 100/150 (67%), Gaps = 3/150 (2%)
 Frame = +1

Query  118  AIVLLAFLSVTSFNSLFTKDGISSSTGPTHLDLNLNIHRQKLLQVAHTEACEGTLYPELC  297
            A  LL+ LS+++F  L           P + ++   +H  K +Q+AH+  CEGTLYPELC
Sbjct  18   AKFLLSLLSISAFAFLLLTTVKPLKKSPKNTEIP-QLHLHKHVQIAHSH-CEGTLYPELC  75

Query  298  VSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGPLEKRALDDCL  477
            VSTL+T  PD  +KT+PE+IAATV+ TV EVK SA+NCSGIRRKL  L  LE RA++DCL
Sbjct  76   VSTLST-FPDLASKTVPEVIAATVSHTVGEVKLSASNCSGIRRKLKNLNTLEGRAINDCL  134

Query  478  ELFSETRDELRKVLSDLATTASSSKHYVDL  567
            EL   T  +L+  +SDL+   S +KHY DL
Sbjct  135  ELHDCTIAQLQSTISDLSHNNSPAKHYHDL  164



>ref|XP_010269596.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=561

 Score =   133 bits (335),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 85/114 (75%), Gaps = 2/114 (2%)
 Frame = +1

Query  226  IHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAA  405
            +H  K LQ+AH+ ACEGTLYPELCVST+++  PD  +KTIP+II+ATV  TV+EV+ SA+
Sbjct  44   LHLHKHLQIAHS-ACEGTLYPELCVSTVSS-FPDLASKTIPDIISATVQHTVNEVRTSAS  101

Query  406  NCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDL  567
            NC+G R K   L PL++ ALDDCLEL  ET  EL+  LSDL+   S S+HY DL
Sbjct  102  NCTGJRMKRRTLDPLQQMALDDCLELLDETVAELKSALSDLSPKNSPSRHYNDL  155



>gb|EPS62329.1| pectinesterase [Genlisea aurea]
Length=560

 Score =   133 bits (334),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 89/115 (77%), Gaps = 2/115 (2%)
 Frame = +1

Query  226  IHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAA  405
            IH  + +QVA + AC+GTLYP+LCVST++  LP+ R KT+PEIIAAT+NVT+ EV+ +++
Sbjct  34   IHAYEHVQVAES-ACDGTLYPDLCVSTVSAVLPELRRKTLPEIIAATINVTMKEVRTASS  92

Query  406  NCSGIRRKL-PRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDL  567
            NCS +RRKL  +L PLE RAL+DCLELFS T  +L K+ SDL  +++  K+Y DL
Sbjct  93   NCSSLRRKLNKKLEPLELRALEDCLELFSYTASDLSKIFSDLKASSAQEKYYDDL  147



>ref|XP_011010963.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=558

 Score =   132 bits (333),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 89/114 (78%), Gaps = 3/114 (3%)
 Frame = +1

Query  226  IHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAA  405
            +H  K +Q+AH+ AC+GTLYPELCVSTL + L D  +K++PE I+AT+N T+DEV+AS+A
Sbjct  43   LHIHKHIQIAHS-ACKGTLYPELCVSTLVS-LSDLASKSLPEFISATLNKTMDEVRASSA  100

Query  406  NCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDL  567
            NC+ IR K+ +LGPLEK AL DC+ELF +T  EL+  +SDLA   S+SKHY DL
Sbjct  101  NCNAIRNKI-KLGPLEKVALKDCIELFDDTIAELKSAISDLAPRKSTSKHYHDL  153



>ref|XP_010259481.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=583

 Score =   131 bits (330),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 67/108 (62%), Positives = 84/108 (78%), Gaps = 2/108 (2%)
 Frame = +1

Query  244  LQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIR  423
            LQ+AH+ ACEGTLYPELCVSTL++  PD  +KTI ++I++TVN TV EV+ SA+NC+ IR
Sbjct  71   LQIAHS-ACEGTLYPELCVSTLSS-FPDLTSKTISQMISSTVNYTVKEVEISASNCTDIR  128

Query  424  RKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDL  567
            + L    PLE+RALDDCLELF ET  EL+  LSDL+  +S SKHY DL
Sbjct  129  KNLKAQDPLEQRALDDCLELFDETISELQTALSDLSPKSSPSKHYNDL  176



>ref|XP_011079629.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=566

 Score =   131 bits (329),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 90/115 (78%), Gaps = 3/115 (3%)
 Frame = +1

Query  226  IHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAA  405
            IH  + +Q+A +  CEGTLYP+LCVST+A A P+ R KT+PEII+ T+NVT+ EV+ASA+
Sbjct  41   IHVYRHVQIAKS-TCEGTLYPDLCVSTVA-AFPELRRKTLPEIISGTINVTMKEVRASAS  98

Query  406  NCSGIRRKL-PRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDL  567
            NCS +RRKL  +L PL+ +ALDDCLELFS+T  EL+++L++L+   S  K+Y DL
Sbjct  99   NCSSLRRKLMKKLAPLDLQALDDCLELFSDTVGELKRILAELSAGNSPEKYYDDL  153



>gb|EYU46746.1| hypothetical protein MIMGU_mgv1a0044632mg, partial [Erythranthe 
guttata]
Length=201

 Score =   124 bits (312),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/116 (56%), Positives = 83/116 (72%), Gaps = 2/116 (2%)
 Frame = +1

Query  223  NIHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASA  402
             +H  K  QV     C+GTLYP LCVST+A A P+ R KT+PEIIA T+NVT+ EV+ SA
Sbjct  41   KLHVYKHAQVIAESTCDGTLYPGLCVSTVA-AFPELRQKTLPEIIAGTINVTMKEVRDSA  99

Query  403  ANCSGIRRK-LPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDL  567
             NCSG+RRK L +L P +  ALDDCLELF++T  EL+K LSDL++ +   K+Y DL
Sbjct  100  TNCSGLRRKLLKKLDPRDLIALDDCLELFADTVAELKKTLSDLSSGSPPEKYYDDL  155



>ref|XP_002301486.2| hypothetical protein POPTR_0002s20370g [Populus trichocarpa]
 gb|EEE80759.2| hypothetical protein POPTR_0002s20370g [Populus trichocarpa]
Length=558

 Score =   127 bits (318),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 88/114 (77%), Gaps = 3/114 (3%)
 Frame = +1

Query  226  IHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAA  405
            +H  K +Q+AH+ AC+GTLYPELCVSTL + LPD  +K++ E I+AT+N T+DEV+AS+A
Sbjct  43   LHIHKHIQIAHS-ACKGTLYPELCVSTLVS-LPDLASKSLQEFISATLNKTMDEVRASSA  100

Query  406  NCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDL  567
            +C+ IR K+ +LGPLEK AL DC+ELF +T  EL+  +S+LA    +SKHY DL
Sbjct  101  DCNAIRNKM-KLGPLEKVALKDCIELFDDTIAELKSAISNLALRKPTSKHYHDL  153



>gb|AHB84678.1| pectin methylesterase [Citrus reticulata]
Length=569

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 74/152 (49%), Positives = 100/152 (66%), Gaps = 12/152 (8%)
 Frame = +1

Query  115  SAIVLLAF-LSVTSFNSLFTKDGISSSTGPTHLDLNLNIHRQKLLQVAHTEACEGTLYPE  291
            SAI LL F LS  S  +L  K    ++  P     +L +H+    QVAH+ ACEGTLYPE
Sbjct  22   SAIFLLLFVLSAVSVTTL--KKNPKTTDAP-----HLRVHKH--FQVAHS-ACEGTLYPE  71

Query  292  LCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGPLEKRALDD  471
            LCVSTL + +PD  +K +PE+I+ T+N T+ E++AS++NCS I +  P    LEKRA++D
Sbjct  72   LCVSTLLS-VPDLASKRVPELISVTINRTLSELRASSSNCSSIGQSYPNFNTLEKRAIND  130

Query  472  CLELFSETRDELRKVLSDLATTASSSKHYVDL  567
            CLELF +T  EL+  L+DL+   S SKHY DL
Sbjct  131  CLELFHDTIVELKSALNDLSPKKSPSKHYHDL  162



>ref|XP_009783075.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=567

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/115 (55%), Positives = 84/115 (73%), Gaps = 2/115 (2%)
 Frame = +1

Query  223  NIHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASA  402
            +IH  K +Q+A +  CEGTL+PELCVSTL++  P+   K+I EII++TV V V EV+ SA
Sbjct  46   HIHVHKNIQIAQSH-CEGTLHPELCVSTLSS-FPNLHRKSIAEIISSTVKVAVGEVRDSA  103

Query  403  ANCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDL  567
             NCS +RR +P+L P+EKRAL DC+EL  ET  ELR  L+DL+   S+SKHY D+
Sbjct  104  HNCSDLRRNVPKLEPIEKRALQDCVELLGETIAELRTALTDLSPKKSASKHYNDI  158



>emb|CDP15269.1| unnamed protein product [Coffea canephora]
Length=385

 Score =   124 bits (311),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 83/114 (73%), Gaps = 2/114 (2%)
 Frame = +1

Query  226  IHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAA  405
            IH  + LQ+AH+  C+ T YP+LCVSTLAT  PD R +T+PEII+  VN TV EV+ S  
Sbjct  69   IHVHQHLQIAHS-TCQDTFYPDLCVSTLAT-FPDLRQRTLPEIISGMVNSTVFEVRDSKQ  126

Query  406  NCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDL  567
            NC+ IRRKL  L PL++RAL+DCL+L  +T  +L+  +SDL++  S+ +HY+DL
Sbjct  127  NCTRIRRKLQNLDPLDRRALEDCLQLLDDTVAQLKAAISDLSSNKSALQHYMDL  180



>emb|CDP15270.1| unnamed protein product [Coffea canephora]
Length=587

 Score =   125 bits (314),  Expect = 6e-30, Method: Composition-based stats.
 Identities = 60/114 (53%), Positives = 83/114 (73%), Gaps = 2/114 (2%)
 Frame = +1

Query  226  IHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAA  405
            IH  + LQ+AH+  C+ T YP+LCVSTLAT  PD R +T+PEII+  VN TV EV+ S  
Sbjct  61   IHVHQHLQIAHS-TCQDTFYPDLCVSTLAT-FPDLRQRTLPEIISGMVNSTVFEVRDSKQ  118

Query  406  NCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDL  567
            NC+ IRRKL  L PL++RAL+DCL+L  +T  +L+  +SDL++  S+ +HY+DL
Sbjct  119  NCTRIRRKLQNLDPLDRRALEDCLQLLDDTFAQLKAAISDLSSNKSALQHYMDL  172



>ref|XP_003519757.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 40-like 
[Glycine max]
Length=562

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/147 (45%), Positives = 94/147 (64%), Gaps = 8/147 (5%)
 Frame = +1

Query  127  LLAFLSVTSFNSLFTKDGISSSTGPTHLDLNLNIHRQKLLQVAHTEACEGTLYPELCVST  306
            LL FL  T F    T   I+ +  P    L+   H QK +QV     C+GTLYP+LCVST
Sbjct  16   LLLFLGTTHF----TNTPITITRAPDQKHLH---HFQKHIQVVAKSTCQGTLYPDLCVST  68

Query  307  LATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGPLEKRALDDCLELF  486
            LAT  PD   K++P++I++ VN T+ EV++S+ NCSG+++ L  L PL++RALDDCL+LF
Sbjct  69   LAT-FPDLATKSVPQVISSVVNHTMYEVRSSSYNCSGLKKMLKNLNPLDQRALDDCLKLF  127

Query  487  SETRDELRKVLSDLATTASSSKHYVDL  567
             +T  EL+  + DL+ +   SK + DL
Sbjct  128  EDTNVELKATIDDLSKSTIGSKRHHDL  154



>ref|XP_006444399.1| hypothetical protein CICLE_v100237231mg, partial [Citrus clementina]
 gb|ESR57639.1| hypothetical protein CICLE_v100237231mg, partial [Citrus clementina]
Length=548

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 99/152 (65%), Gaps = 12/152 (8%)
 Frame = +1

Query  115  SAIVLLAF-LSVTSFNSLFTKDGISSSTGPTHLDLNLNIHRQKLLQVAHTEACEGTLYPE  291
            SAI LL F LS  S  +L  K    ++  P     +L +H+    QVAH+ ACEGTLYPE
Sbjct  1    SAIFLLLFVLSAVSVTTL--KKNPKTTDAP-----HLRVHKH--FQVAHS-ACEGTLYPE  50

Query  292  LCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGPLEKRALDD  471
            LCVSTL  ++PD  +K +PE+I+ T+N T+ E++AS++NCS I +  P    LEKRA++D
Sbjct  51   LCVSTL-LSVPDLASKRVPELISVTINRTLSELRASSSNCSSIGQSYPNFNTLEKRAIND  109

Query  472  CLELFSETRDELRKVLSDLATTASSSKHYVDL  567
            CLELF +T  EL+  L+DL+     SKHY DL
Sbjct  110  CLELFHDTIVELKSALNDLSPKKLPSKHYHDL  141



>ref|XP_006480001.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 40-like 
[Citrus sinensis]
Length=569

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 99/152 (65%), Gaps = 12/152 (8%)
 Frame = +1

Query  115  SAIVLLAF-LSVTSFNSLFTKDGISSSTGPTHLDLNLNIHRQKLLQVAHTEACEGTLYPE  291
            SAI LL F LS  S  +L  K    ++  P     +L +H+    QVAH+ ACEGTLYPE
Sbjct  22   SAIFLLLFVLSAVSVTTL--KKNPKTTDAP-----HLRVHKH--FQVAHS-ACEGTLYPE  71

Query  292  LCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGPLEKRALDD  471
            LCVSTL + +PD  +K +PE+I+ T+N T+ E++AS++NCS I +  P    LEKRA++D
Sbjct  72   LCVSTLLS-VPDLASKRVPELISVTINRTLSELRASSSNCSSIGQSYPNFNTLEKRAIND  130

Query  472  CLELFSETRDELRKVLSDLATTASSSKHYVDL  567
            CLELF +T  EL+  L+DL+     SKHY DL
Sbjct  131  CLELFHDTIVELKSALNDLSPKKLPSKHYHDL  162



>ref|XP_002523113.1| Pectinesterase-3 precursor, putative [Ricinus communis]
 gb|EEF39298.1| Pectinesterase-3 precursor, putative [Ricinus communis]
Length=557

 Score =   122 bits (306),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 88/115 (77%), Gaps = 2/115 (2%)
 Frame = +1

Query  223  NIHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASA  402
            ++H QK  Q+AH+ ACEGTLYPELCVSTL++ LPD   +++ ++I++T++ T+ EV+ S 
Sbjct  39   HLHIQKHNQIAHS-ACEGTLYPELCVSTLSS-LPDLTYRSLQQLISSTISRTMYEVRVSY  96

Query  403  ANCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDL  567
            +NCSGI+ KL +L  +E+ AL+DCLELF+ET DEL   +SDL +  S S+H+ DL
Sbjct  97   SNCSGIKNKLRKLNKIERVALNDCLELFTETMDELNVAISDLTSRKSVSQHHHDL  151



>ref|XP_009614504.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=563

 Score =   122 bits (305),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 75/172 (44%), Positives = 104/172 (60%), Gaps = 32/172 (19%)
 Frame = +1

Query  64   MHNLKQKATLFFTISGCSAIVLLAFLSVTSFNSLFTKDGISSSTGPTHLDLNLNIHRQKL  243
            M+N ++K +L  T+S   AI+LL F S                       L +++  Q +
Sbjct  1    MYNQRRKPSLLLTLS---AIILLIFFS-----------------------LPISLQTQNI  34

Query  244  -LQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGI  420
             L++AH+  C+ TLYP+LC+STL+  +P+   KTIPEII++TVN TVDEVKAS  NC+ I
Sbjct  35   QLEIAHSH-CQDTLYPQLCISTLS-LIPNLHQKTIPEIISSTVNTTVDEVKASTENCTNI  92

Query  421  RRKLPRLGPLEKRALDDCLELFSE-TRDELRKVLSDLATTASSS--KHYVDL  567
              K+ +L P+EKRALDDC+EL  + T  EL   L DL+T   +S  KHY DL
Sbjct  93   LHKMSKLDPIEKRALDDCIELLGDSTISELNTTLYDLSTKNHNSPYKHYNDL  144



>ref|XP_007163135.1| hypothetical protein PHAVU_001G209400g [Phaseolus vulgaris]
 gb|ESW35129.1| hypothetical protein PHAVU_001G209400g [Phaseolus vulgaris]
Length=601

 Score =   121 bits (304),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 70/150 (47%), Positives = 93/150 (62%), Gaps = 15/150 (10%)
 Frame = +1

Query  115  SAIVLLAFLSVTSFNSLFTKDGISSSTGPTHLDLNLNIHRQKLLQVAHTEACEGTLYPEL  294
            SA+ +L   SVT F+      G + S    HL  +          VA++  CEGTLYP+L
Sbjct  60   SAVHVLLLFSVTQFS---ITAGATRSLQQNHLHFH----------VANS-TCEGTLYPDL  105

Query  295  CVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGPLEKRALDDC  474
            CVSTL T+ PD  +KT+PE+I + VN T+ EV  S++NCS +R+KLP L  LEKRALDDC
Sbjct  106  CVSTL-TSFPDLTSKTVPEMIRSVVNHTIYEVTLSSSNCSSLRKKLPGLNKLEKRALDDC  164

Query  475  LELFSETRDELRKVLSDLATTASSSKHYVD  564
            L LF ET +EL+  + DL+ +   SK Y D
Sbjct  165  LNLFDETVEELKTTVKDLSQSTIGSKRYHD  194



>ref|XP_010321856.1| PREDICTED: pectinesterase [Solanum lycopersicum]
Length=564

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 87/118 (74%), Gaps = 6/118 (5%)
 Frame = +1

Query  226  IHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAA  405
            IH  K +Q+A++  C+ TLYP+LC+STL+  +P+   K+IPEII++ VNVT++EVK+SA 
Sbjct  37   IHVHKNIQIANSH-CQDTLYPKLCISTLSL-IPNLHKKSIPEIISSNVNVTMNEVKSSAE  94

Query  406  NCSGIRRKLPRLGPLEKRALDDCLELFSETR-DELRKVLSDLATTASSS---KHYVDL  567
            NCS I   + +L P+EKRALDDC+EL  +T  DEL+  L+DL+T  SS+   KHY DL
Sbjct  95   NCSNILHHMSKLDPIEKRALDDCIELLGDTTIDELQTTLNDLSTKNSSNSPLKHYNDL  152



>ref|XP_009628637.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=567

 Score =   119 bits (299),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 78/168 (46%), Positives = 104/168 (62%), Gaps = 11/168 (7%)
 Frame = +1

Query  64   MHNLKQKATLFFTISGCSAIVLLAFLSVTSFNSLFTKDGISSSTGPTHLDLNLNIHRQKL  243
            M+NL++K +L  T+   SAIV L F         FT      S+  T L    +IH  K 
Sbjct  1    MYNLRRKTSLLLTLFALSAIVSLTF---------FTLSNNPKSSSKTVLTTTPHIHVHKN  51

Query  244  LQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIR  423
            +Q+AH+  C+ T YP+LCVSTL + +PD   K+I +II++T+NVTV EVKASA NC+ IR
Sbjct  52   IQIAHSH-CQDTRYPKLCVSTL-SLIPDLAQKSISQIISSTINVTVAEVKASARNCTDIR  109

Query  424  RKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDL  567
              LP+L P EKRAL+DC++L   T  ELR  LSDL      S++Y DL
Sbjct  110  EDLPQLEPYEKRALEDCVQLLDNTIIELRTTLSDLNPKKPPSQNYNDL  157



>ref|XP_007145198.1| hypothetical protein PHAVU_007G218500g [Phaseolus vulgaris]
 gb|ESW17192.1| hypothetical protein PHAVU_007G218500g [Phaseolus vulgaris]
Length=553

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/115 (49%), Positives = 85/115 (74%), Gaps = 2/115 (2%)
 Frame = +1

Query  223  NIHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASA  402
            ++H  K +QVA +  C+GTLYP+LCVSTLAT  PD  +K++P++I++ VN T+ EVK+S 
Sbjct  34   HLHFHKHMQVAQS-TCQGTLYPDLCVSTLAT-FPDLTSKSVPQVISSVVNHTMYEVKSSF  91

Query  403  ANCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDL  567
             NCS +++K+  L PL++RALDDCL+LF +T  EL+  + DL+ ++  SK + DL
Sbjct  92   YNCSSLKKKIRNLNPLDQRALDDCLKLFQDTNLELKTTIDDLSKSSIGSKRHHDL  146



>ref|XP_007201179.1| hypothetical protein PRUPE_ppa003400mg [Prunus persica]
 gb|EMJ02378.1| hypothetical protein PRUPE_ppa003400mg [Prunus persica]
Length=578

 Score =   116 bits (291),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 69/171 (40%), Positives = 104/171 (61%), Gaps = 16/171 (9%)
 Frame = +1

Query  58   TRMHNLKQKATLFFTISGCSAIVLLAFLSVTSFNSLFTKDGISSSTGPTHLDLNLNIHRQ  237
            T M+NL+++  L  ++   SA++L+   S T   +       S+S  P         H  
Sbjct  11   TTMYNLRRRTKLLLSVLPTSALLLILLFSNTHLRN-------SNSITP-------KTHVH  56

Query  238  KLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSG  417
              +Q+A   AC+ TLY +LCVSTL+T  PD   K++P+II+ TV+ TV EV+AS++NC+G
Sbjct  57   NRIQLAAHSACQDTLYKDLCVSTLST-FPDLSTKSVPQIISYTVSHTVSEVQASSSNCTG  115

Query  418  I-RRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDL  567
            I +++  +L  L++ ALDDCLELF +T  EL+ V+SDL+    SS  Y DL
Sbjct  116  IIKKQFKKLDALQQIALDDCLELFDDTIAELKAVISDLSVEKLSSDRYYDL  166



>ref|XP_008235121.1| PREDICTED: pectinesterase-like [Prunus mume]
Length=562

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 72/170 (42%), Positives = 107/170 (63%), Gaps = 18/170 (11%)
 Frame = +1

Query  64   MHNLKQKATLFFTISGCSAIVLLAFLSVTSF-NSLFTKDGISSSTGPTHLDLNLNIHRQK  240
            M+NL+++  L  ++   SA++L+   S T F NS       +S+T  TH      +H + 
Sbjct  1    MYNLRRRTKLLLSVLPTSALLLILLFSNTHFRNS-------NSNTPKTH------VHNR-  46

Query  241  LLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGI  420
             +Q+A   AC+ TLY  LCVSTL+T  PD   K++P+II+ TV+ TV EV+AS++NC+GI
Sbjct  47   -IQLAAHSACQDTLYKLLCVSTLST-FPDLTTKSVPQIISYTVSHTVSEVQASSSNCTGI  104

Query  421  -RRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDL  567
             +++  +L  L++ ALDDCLELF +T  EL  V+SDL+    SS  Y DL
Sbjct  105  IKKQFKKLDALQQIALDDCLELFDDTIAELNAVISDLSIKKLSSNRYYDL  154



>ref|XP_009765668.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=566

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 76/168 (45%), Positives = 106/168 (63%), Gaps = 12/168 (7%)
 Frame = +1

Query  64   MHNLKQKATLFFTISGCSAIVLLAFLSVTSFNSLFTKDGISSSTGPTHLDLNLNIHRQKL  243
            M+NL++K  L  T+   SAIV + F  +++     +K   +  T P       +IH  K 
Sbjct  1    MYNLRRKTPLLLTLFALSAIVSVTFFGLSNNPKSSSK---TVQTTP-------HIHVHKN  50

Query  244  LQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIR  423
            +Q+AH+  C+ T YP+LCVSTL + +PD   K+I +II++T+NVTV EVKASA NC+ IR
Sbjct  51   IQIAHSH-CQDTRYPKLCVSTL-SLIPDLAQKSISQIISSTINVTVAEVKASAKNCTEIR  108

Query  424  RKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDL  567
              LPRL P EKRAL+DC++L   T  EL+  LSDL    S S++Y DL
Sbjct  109  EDLPRLEPYEKRALEDCVQLLDNTIIELKTTLSDLHPKKSPSQNYNDL  156



>ref|XP_009771845.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=561

 Score =   114 bits (285),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 79/111 (71%), Gaps = 5/111 (5%)
 Frame = +1

Query  244  LQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIR  423
            L++AH+  C+ TLYP+LC+STL+  +P+   KTIPEII++TVN T+DEVK S  NC+ I 
Sbjct  36   LEIAHSH-CQDTLYPQLCISTLSL-IPNLHQKTIPEIISSTVNATIDEVKGSTENCTKIL  93

Query  424  RKLPRLGPLEKRALDDCLELFSE-TRDELRKVLSDLATTASSS--KHYVDL  567
             K+ +L P+EKRALDDC+EL  + T  EL   L DL+T   +S  KHY DL
Sbjct  94   HKMSKLDPIEKRALDDCIELLGDSTISELNTTLYDLSTKNHNSPYKHYNDL  144



>ref|XP_003553658.2| PREDICTED: probable pectinesterase/pectinesterase inhibitor 39-like 
[Glycine max]
Length=615

 Score =   114 bits (284),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 76/107 (71%), Gaps = 2/107 (2%)
 Frame = +1

Query  244  LQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIR  423
             QVA++  CEGTLY +LCVSTLA+  PD  +KT+P++I + VN T+ EV  SA+NCSG+R
Sbjct  102  FQVANS-TCEGTLYSDLCVSTLAS-FPDLTSKTLPQMIRSVVNHTIYEVTLSASNCSGLR  159

Query  424  RKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVD  564
            R LP+L  LE+RALDDCL LF +T  EL   ++DL+ +    K Y D
Sbjct  160  RNLPKLDKLEQRALDDCLNLFDDTVSELETTIADLSQSTIGPKRYHD  206



>gb|KHG05999.1| putative pectinesterase/pectinesterase inhibitor 40 -like protein 
[Gossypium arboreum]
Length=560

 Score =   112 bits (279),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 57/115 (50%), Positives = 84/115 (73%), Gaps = 3/115 (3%)
 Frame = +1

Query  226  IHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAA  405
            +H    LQ+AH+ ACEGTLYP+LCVST+ + LPD  +KT+PE+I AT+N T+ EV+ S+A
Sbjct  43   LHVHNHLQIAHS-ACEGTLYPDLCVSTI-SVLPDLASKTLPELIQATLNQTMYEVRLSSA  100

Query  406  NCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTA-SSSKHYVDL  567
            NC+GI +++      E+ A++DCLELF +T +EL+  L+DLA    + S++Y DL
Sbjct  101  NCTGIEKRIKSYSKREEAAINDCLELFDDTLEELKVALADLAPKKLAVSRNYHDL  155



>ref|XP_004290811.1| PREDICTED: pectinesterase-like [Fragaria vesca subsp. vesca]
Length=567

 Score =   111 bits (278),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 67/171 (39%), Positives = 111/171 (65%), Gaps = 15/171 (9%)
 Frame = +1

Query  64   MHNLKQKATLFFTISGCSAIVLLAFLSVTSFNSLFTKDGISSSTGPT-HLDLNLNIHRQK  240
            M++L+++  L  ++   SA +L+ F S+  F         ++S  PT    +++  H Q 
Sbjct  1    MYSLRRRTKLLLSLLPTSAFILIIFFSLNHF---------TNSPKPTKEFTIHVEKHNQ-  50

Query  241  LLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGI  420
            L QVAH+  C+ TLY +LCVSTL T+ P+  +KT+P+II++TVN T+ EV AS +NC+GI
Sbjct  51   LNQVAHS-TCQNTLYKDLCVSTL-TSFPNLSSKTVPQIISSTVNKTMYEVIASNSNCTGI  108

Query  421  RR-KLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTAS-SSKHYVDL  567
            ++    +L  ++++ALDDCLELF +T  +L+  +S+L++  S ++KHY  L
Sbjct  109  KKHNKNKLAAVQQQALDDCLELFDDTVAQLKVTMSELSSKKSPAAKHYNHL  159



>ref|XP_004494389.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 40-like 
[Cicer arietinum]
Length=549

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 79/105 (75%), Gaps = 3/105 (3%)
 Frame = +1

Query  244  LQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIR  423
            LQVAH+  C+GTLYP LCVSTL+T   D  +K++P+II +T+N T++EVK+S+ NC+ ++
Sbjct  38   LQVAHS-TCQGTLYPNLCVSTLST-FQDLASKSVPQIICSTLNSTINEVKSSSFNCTRLK  95

Query  424  RKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHY  558
            ++ P L P ++RALDDCL LF  T +EL+  ++DL+ T  +SK Y
Sbjct  96   KR-PSLHPYDQRALDDCLNLFDNTIEELKSTINDLSQTKITSKPY  139



>gb|KJB41904.1| hypothetical protein B456_007G127000 [Gossypium raimondii]
Length=560

 Score =   108 bits (269),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 84/116 (72%), Gaps = 3/116 (3%)
 Frame = +1

Query  223  NIHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASA  402
            ++H    LQ+AH+ ACE TLYP+LCVST+ + LPD  +K++PE+I AT+N T+ EV+ S+
Sbjct  42   HLHVHNHLQIAHS-ACEATLYPDLCVSTI-SVLPDLASKSLPELIQATLNQTMYEVRLSS  99

Query  403  ANCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTA-SSSKHYVDL  567
            ANC+GI +++      E+ A++DCLELF +T +EL+  L+DLA    + S++Y DL
Sbjct  100  ANCTGIEKRIKSYSKREEAAINDCLELFDDTLEELKVALADLAPKKLAVSRNYHDL  155



>ref|XP_010069896.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=561

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 58/119 (49%), Positives = 89/119 (75%), Gaps = 6/119 (5%)
 Frame = +1

Query  223  NIHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASA  402
            + H ++ LQVAH+  C+GTLYP+LCVSTLA+  PD  +K++PEII++TVN+T  + ++++
Sbjct  33   HFHTRRHLQVAHS-TCQGTLYPDLCVSTLAS-FPDLASKSVPEIISSTVNLTSAQARSAS  90

Query  403  ANCSGIRRKLP-RLGPLEKRALDDCLELFSETRDELRKVLSDLATT---ASSSKHYVDL  567
            ++CS + R+L  +LGPLE+RALDDCLEL + T DE  K +SDL++     + + H+ DL
Sbjct  91   SSCSALERRLAAKLGPLERRALDDCLELLARTVDEFGKAISDLSSANGPTAPAAHFHDL  149



>ref|XP_008359413.1| PREDICTED: pectinesterase-like [Malus domestica]
Length=579

 Score =   103 bits (257),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 69/171 (40%), Positives = 103/171 (60%), Gaps = 15/171 (9%)
 Frame = +1

Query  64   MHNLKQKATLFFTISGCSAIVLLAFLSVTSFNSLFTKDGISSSTGPTHLDLNLNIHRQK-  240
            M+NL++   L  T+   S + L    S   F +       S+S  P    ++   H QK 
Sbjct  1    MYNLRRTKILLSTLFLTSILFLSLLFSKPHFKN-------SNSKSP---KIHFQNHIQKQ  50

Query  241  LLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGI  420
            +L+ AH  AC+ TLY  LC+STLAT  P+  +KT+P+II++TV+ TV EVKAS++NC+ I
Sbjct  51   VLETAHW-ACQDTLYKSLCLSTLAT-FPNLASKTLPQIISSTVSHTVLEVKASSSNCTSI  108

Query  421  RRKL-PRLGPLEKRALDDCLELFSETRDELRKVLSDLATTAS-SSKHYVDL  567
            +++   +L  L++ ALDDCLEL   T DEL+  +SDL+   + +S  Y DL
Sbjct  109  KKQFSKKLSSLQQWALDDCLELLDNTIDELKSAISDLSXNKTLNSNRYYDL  159



>gb|KJB09419.1| hypothetical protein B456_001G140500 [Gossypium raimondii]
Length=561

 Score =   102 bits (255),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 57/115 (50%), Positives = 78/115 (68%), Gaps = 3/115 (3%)
 Frame = +1

Query  226  IHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAA  405
             H    LQ A + AC+GTLYPELCVST+ + LPD  +K++PE+I+AT+N T+ EV+ S+A
Sbjct  43   FHVHNHLQRA-SSACDGTLYPELCVSTI-SVLPDLASKSLPELISATLNQTMHEVRLSSA  100

Query  406  NCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASS-SKHYVDL  567
            N + I +KL     LE+ A++DCLELF  T  EL+ V S L    SS S++Y DL
Sbjct  101  NITNIEKKLKSYNTLEEAAINDCLELFDNTMAELKVVRSGLGPKGSSVSENYHDL  155



>gb|KEH24404.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=557

 Score =   102 bits (254),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 78/109 (72%), Gaps = 7/109 (6%)
 Frame = +1

Query  244  LQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIR  423
            +QVA + ACEGTLY +LCVSTL+T LPD  +KT+P+II + +N T+ EVK S++NC+G+R
Sbjct  42   IQVAQS-ACEGTLYQDLCVSTLST-LPDLTSKTVPQIICSVLNNTIKEVKQSSSNCTGLR  99

Query  424  -RKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLA----TTASSSKH  555
             R       L++RAL+DC+ LF  T DEL+  +SDL+    T ASSSK 
Sbjct  100  IRGRSAQSILDQRALEDCVNLFDTTIDELKTTISDLSQTQTTVASSSKR  148



>ref|XP_004247400.1| PREDICTED: pectinesterase-like [Solanum lycopersicum]
Length=562

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 71/168 (42%), Positives = 99/168 (59%), Gaps = 18/168 (11%)
 Frame = +1

Query  64   MHNLKQKATLFFTISGCSAIVLLAFLSVTSFNSLFTKDGISSSTGPTHLDLNLNIHRQKL  243
            M++L+ K  L  ++     IV L F +  S NS                   ++IH  K 
Sbjct  1    MYSLQWKTPLLLSLLAIFIIVSLTFFTSLSKNS----------------SEIVHIHVHKN  44

Query  244  LQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIR  423
            +Q+AH+  CE  LY +LCVSTLA+ +PD   K+I +II++T+NVTV EVKASA NC+ IR
Sbjct  45   IQIAHSH-CEDALYKQLCVSTLAS-IPDLPQKSISQIISSTINVTVVEVKASAKNCTDIR  102

Query  424  RKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDL  567
              LP+L P EKRAL+DC++L  +T  EL+  L  L    S S++Y DL
Sbjct  103  EDLPKLEPYEKRALEDCIQLLDDTIIELKSSLVALHPNRSLSQNYNDL  150



>gb|EPS67066.1| pectinesterase [Genlisea aurea]
Length=955

 Score =   100 bits (250),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 53/101 (52%), Positives = 69/101 (68%), Gaps = 2/101 (2%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLG  444
            AC+G LY +LCVST+ T L  RR  T+PE+IAATV+V + EV ++++N   +RRKL +  
Sbjct  451  ACDGALYDDLCVSTVVTKL--RRNTTLPEMIAATVDVAMAEVMSASSNFRNLRRKLKKAE  508

Query  445  PLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDL  567
             L+ RALDDCLEL S T +EL +VL      AS  KHY DL
Sbjct  509  LLDVRALDDCLELLSSTAEELSEVLEMTTAPASPVKHYDDL  549



>ref|XP_006359860.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 40-like 
[Solanum tuberosum]
Length=562

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 74/168 (44%), Positives = 102/168 (61%), Gaps = 18/168 (11%)
 Frame = +1

Query  64   MHNLKQKATLFFTISGCSAIVLLAFLSVTSFNSLFTKDGISSSTGPTHLDLNLNIHRQKL  243
            M+NLK K  L  ++   SAIV L F +  S NS  T                ++IH  K 
Sbjct  1    MYNLKWKTPLLLSLLAISAIVCLTFFTSLSKNSSET----------------VHIHVHKN  44

Query  244  LQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIR  423
            +Q+AH+  CE  LY +LCVSTL++ +PD   K+I +II++T+NVTV EVKASA NC+ IR
Sbjct  45   IQIAHSH-CEDALYKQLCVSTLSS-IPDLPQKSISQIISSTINVTVVEVKASAKNCTDIR  102

Query  424  RKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDL  567
              LP+L P EKRAL+DC++L   T  +L+  L  L+   S S++Y DL
Sbjct  103  EDLPKLEPYEKRALEDCIQLLDNTIIDLKSSLLALSPNRSLSQNYNDL  150



>ref|XP_010910828.1| PREDICTED: pectinesterase 3-like [Elaeis guineensis]
Length=338

 Score = 92.4 bits (228),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 50/114 (44%), Positives = 75/114 (66%), Gaps = 3/114 (3%)
 Frame = +1

Query  226  IHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAA  405
            +H    LQ A    C+GTLYP+LCVSTLA  +P+  +K++P++IAA VN T ++V+ SA+
Sbjct  41   LHVHSHLQAA-ARHCDGTLYPDLCVSTLAD-IPNLTSKSLPDVIAAVVNRTANDVRFSAS  98

Query  406  NCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDL  567
            NCS   R+   +   ++ AL+DCLEL  +T D+LR   +DL T  ++S H  D+
Sbjct  99   NCSSYLRRRGYMDSRQRLALNDCLELLDQTLDDLRTAAADL-TCGNASVHVSDI  151



>ref|XP_008795768.1| PREDICTED: pectinesterase-like [Phoenix dactylifera]
Length=557

 Score = 91.7 bits (226),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 77/115 (67%), Gaps = 3/115 (3%)
 Frame = +1

Query  223  NIHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASA  402
            ++H +  LQVA +  C+GTLYP+LCVSTLA  +P+  +K +P++IAA VN T   V++SA
Sbjct  42   HLHIRSDLQVA-SRHCDGTLYPDLCVSTLAD-IPNLSSKPLPDVIAAVVNRTAAAVRSSA  99

Query  403  ANCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDL  567
            +NC+    +   +   ++ AL+DCLEL  +T D+LR  ++DLA   +SS H  DL
Sbjct  100  SNCTSYLHRRGHMDFRQRLALNDCLELLDQTLDDLRTAIADLA-GCNSSAHVSDL  153



>ref|XP_009383893.1| PREDICTED: pectinesterase-like [Musa acuminata subsp. malaccensis]
Length=567

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 66/96 (69%), Gaps = 2/96 (2%)
 Frame = +1

Query  220  LNIHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKAS  399
            L++H  +L   A  + C+GTLYP+LCVSTL+T +PD  AK++PE+I A+VN T   V+ +
Sbjct  47   LHVH-SRLQATAAADHCDGTLYPDLCVSTLST-IPDLHAKSLPEVICASVNTTAAAVRNA  104

Query  400  AANCSGIRRKLPRLGPLEKRALDDCLELFSETRDEL  507
            A NC+    +   L P ++ A+ DCL+LFS+T DEL
Sbjct  105  AKNCTNFLHRRGYLDPRQRLAVTDCLDLFSQTLDEL  140



>ref|XP_010556724.1| PREDICTED: pectinesterase-like [Tarenaya hassleriana]
Length=547

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 71/102 (70%), Gaps = 3/102 (3%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKL-PRL  441
            ACE T + +LC S L++ LP   + ++PE+IAATVN T+ EV  S++NCSG++R+L P L
Sbjct  50   ACERTRFKDLCFSPLSS-LPPGNSSSVPELIAATVNETISEVMISSSNCSGLQRRLGPDL  108

Query  442  GPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDL  567
             P + RAL+DCLEL  +T  +L   L+DL  + S+++ + DL
Sbjct  109  SPRDSRALEDCLELLGDTAGDLDDALADLH-SPSAAREFYDL  149



>ref|XP_009401623.1| PREDICTED: pectinesterase 3-like [Musa acuminata subsp. malaccensis]
Length=352

 Score = 87.4 bits (215),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 71/121 (59%), Gaps = 2/121 (2%)
 Frame = +1

Query  187  SSTGPTHLDLNLNIHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAAT  366
            S+  P      L +H       A  + C+GT+YPELCVSTL +  PD  +K++P +I AT
Sbjct  31   SAPKPVAYHHKLRVHSHLHAAAAAVDHCDGTIYPELCVSTL-SVFPDLHSKSLPAVICAT  89

Query  367  VNVTVDEVKASAANCSG-IRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTAS  543
            +N T   V+ SA NC+  + R+   L   ++ A+ DCL+LFS+T DELR   + L + AS
Sbjct  90   INATEAAVRGSAKNCTDYLNRRGYNLDGRQRLAIGDCLDLFSQTLDELRAASAGLTSGAS  149

Query  544  S  546
            +
Sbjct  150  A  150



>ref|XP_010230835.1| PREDICTED: pectinesterase-like [Brachypodium distachyon]
Length=561

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 58/87 (67%), Gaps = 1/87 (1%)
 Frame = +1

Query  268  CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGP  447
            CEGTLYPELC+STLAT +PD   K +P++I ATVN T  EV   A+NCS   ++   L P
Sbjct  43   CEGTLYPELCLSTLAT-VPDLHKKPLPDVICATVNRTEVEVADMASNCSSFLQQGKSLPP  101

Query  448  LEKRALDDCLELFSETRDELRKVLSDL  528
             ++ A+ DC+EL   T DEL+   SDL
Sbjct  102  RDRVAIADCIELLGTTMDELQATTSDL  128



>gb|KJB49889.1| hypothetical protein B456_008G143700 [Gossypium raimondii]
Length=558

 Score = 85.9 bits (211),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 49/115 (43%), Positives = 75/115 (65%), Gaps = 7/115 (6%)
 Frame = +1

Query  184  SSSTGPTHLDLNLNIHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAA  363
            S  T  TH     + H    LQ+A+T ACEGTLYP+LCV+T++  L +  ++++P++I+A
Sbjct  31   SPETSETH-----HFHVNNNLQIAYT-ACEGTLYPDLCVATVSI-LQNLASRSLPDLISA  83

Query  364  TVNVTVDEVKASAANCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDL  528
             +  T+DEV+ S ANC+ I + L     LE  A++DC+ELF+ T  ELR  L++L
Sbjct  84   ILIQTMDEVRLSCANCTEIEKGLKSNTTLEWAAINDCIELFNHTLAELRVALAEL  138



>gb|EEE54425.1| hypothetical protein OsJ_01485 [Oryza sativa Japonica Group]
Length=584

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 46/92 (50%), Positives = 60/92 (65%), Gaps = 4/92 (4%)
 Frame = +1

Query  268  CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSG-IRRKLPRLG  444
            CEGTLYPELC+STLA  +PD   K++P++I  TVN T D V A++ NCS  I  K   L 
Sbjct  49   CEGTLYPELCLSTLAD-IPDLHTKSLPDVICGTVNRTKDAVAATSYNCSHYINSKY--LT  105

Query  445  PLEKRALDDCLELFSETRDELRKVLSDLATTA  540
            P ++ A+ DC+EL   T DEL+   SDL + A
Sbjct  106  PRDRLAISDCMELLDTTMDELQATTSDLESPA  137



>ref|XP_009382521.1| PREDICTED: pectinesterase-like [Musa acuminata subsp. malaccensis]
Length=566

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 72/120 (60%), Gaps = 9/120 (8%)
 Frame = +1

Query  199  PTHLDLNLNIHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVT  378
            P H  L+++ H Q       T+ C+GTLYP+LC STL+T +PD  +K++PE+I AT+N +
Sbjct  42   PYHHRLHVHSHLQDA-----TDHCDGTLYPDLCASTLST-IPDLHSKSLPEVICATINAS  95

Query  379  VDEVKASAANCSG-IRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKH  555
               V  SA NC+  +      L   ++ AL DCL+LFS+T DEL    SDL  TA+   H
Sbjct  96   EAAVIKSAKNCTKYLHHHNYTLDTRQRYALTDCLDLFSQTLDELLDATSDL--TANPGSH  153



>gb|ACQ85264.1| pectin methylesterase [Musa acuminata AAA Group]
Length=565

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 71/120 (59%), Gaps = 9/120 (8%)
 Frame = +1

Query  199  PTHLDLNLNIHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVT  378
            P H  L+++ H Q       T  C+GTLYP+LC STL+T +PD  +K++PE+I AT+N +
Sbjct  41   PYHHRLHVHSHLQDA-----TGHCDGTLYPDLCASTLST-IPDLHSKSLPEVICATINAS  94

Query  379  VDEVKASAANCSG-IRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKH  555
               V  SA NC+  +      L   ++ AL DCL+LFS+T DEL    SDL  TA+   H
Sbjct  95   EGAVIKSAKNCTKYLHHHNYTLDTRQRYALTDCLDLFSQTLDELLDATSDL--TANPGSH  152



>gb|AGG23325.1| pectin methylesterase 1 [Musa acuminata AAA Group]
Length=566

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 71/120 (59%), Gaps = 9/120 (8%)
 Frame = +1

Query  199  PTHLDLNLNIHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVT  378
            P H  L+++ H Q       T  C+GTLYP+LC STL+T +PD  +K++PE+I AT+N +
Sbjct  42   PYHHRLHVHSHLQDA-----TXHCDGTLYPDLCASTLST-IPDLHSKSLPEVICATINAS  95

Query  379  VDEVKASAANCSG-IRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKH  555
               V  SA NC+  +      L   ++ AL DCL+LFS+T DEL    SDL  TA+   H
Sbjct  96   EXAVIKSAKNCTKYLHHHNYTLDTRQRYALTDCLDLFSQTLDELLDATSDL--TANPGSH  153



>gb|EEC70505.1| hypothetical protein OsI_01594 [Oryza sativa Indica Group]
Length=565

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 46/92 (50%), Positives = 60/92 (65%), Gaps = 4/92 (4%)
 Frame = +1

Query  268  CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSG-IRRKLPRLG  444
            CEGTLYPELC+STLA  +PD   K++P++I  TVN T D V A++ NCS  I  K   L 
Sbjct  49   CEGTLYPELCLSTLAD-IPDLHTKSLPDVICGTVNRTKDAVAATSYNCSHYINSKY--LT  105

Query  445  PLEKRALDDCLELFSETRDELRKVLSDLATTA  540
            P ++ A+ DC+EL   T DEL+   SDL + A
Sbjct  106  PRDRLAISDCMELLDTTMDELQATTSDLESPA  137



>ref|XP_002455538.1| hypothetical protein SORBIDRAFT_03g012830 [Sorghum bicolor]
 gb|EES00658.1| hypothetical protein SORBIDRAFT_03g012830 [Sorghum bicolor]
Length=576

 Score = 83.2 bits (204),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 44/91 (48%), Positives = 61/91 (67%), Gaps = 2/91 (2%)
 Frame = +1

Query  268  CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGP  447
            C+GTLYPELC+STLA  +PD   K +P++I A VN T D V A++ NCS   +    L  
Sbjct  49   CDGTLYPELCLSTLAD-IPDLHKKPLPDVICAAVNHTEDVVTATSTNCSYYLQD-RSLSA  106

Query  448  LEKRALDDCLELFSETRDELRKVLSDLATTA  540
             ++ A++DCLEL S T DELR   +DL+T++
Sbjct  107  RDRLAINDCLELLSTTMDELRATTADLSTSS  137



>tpg|DAA54386.1| TPA: hypothetical protein ZEAMMB73_825660 [Zea mays]
Length=347

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 61/92 (66%), Gaps = 2/92 (2%)
 Frame = +1

Query  268  CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGP  447
            C+GTLYPELC+STLA  +PD   K +P++I A VN T D V A+++NCS   +    L  
Sbjct  44   CDGTLYPELCLSTLAD-IPDLHKKPLPDVICAAVNRTEDVVVATSSNCSYYLQDR-SLSA  101

Query  448  LEKRALDDCLELFSETRDELRKVLSDLATTAS  543
             ++ A++DCLEL S T DELR   +DLA+ A 
Sbjct  102  RDRLAINDCLELLSTTMDELRASTADLASPAG  133



>ref|NP_001146685.1| pectinesterase precursor [Zea mays]
 gb|ACL54524.1| unknown [Zea mays]
 tpg|DAA54385.1| TPA: pectinesterase [Zea mays]
Length=563

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 61/92 (66%), Gaps = 2/92 (2%)
 Frame = +1

Query  268  CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGP  447
            C+GTLYPELC+STLA  +PD   K +P++I A VN T D V A+++NCS   +    L  
Sbjct  44   CDGTLYPELCLSTLAD-IPDLHKKPLPDVICAAVNRTEDVVVATSSNCSYYLQDR-SLSA  101

Query  448  LEKRALDDCLELFSETRDELRKVLSDLATTAS  543
             ++ A++DCLEL S T DELR   +DLA+ A 
Sbjct  102  RDRLAINDCLELLSTTMDELRASTADLASPAG  133



>ref|XP_010056842.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=538

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 69/109 (63%), Gaps = 3/109 (3%)
 Frame = +1

Query  244  LQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIR  423
            LQV H+  C GT Y +LCVSTLA+      + + PEII+A ++ +  EV+A++ +C+ ++
Sbjct  31   LQVTHSR-CRGTPYSDLCVSTLAS-FTGLASMSFPEIISAMLHQSASEVRAASTHCTVMK  88

Query  424  RK-LPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDL  567
               L +L  LE++ALD CLELF +  D+    +S L ++  + +HY DL
Sbjct  89   NHFLGKLSMLERQALDICLELFRDIFDDFDNAVSYLESSKVTVRHYYDL  137



>ref|XP_010058837.1| PREDICTED: uncharacterized protein LOC104446716 [Eucalyptus grandis]
Length=1688

 Score = 77.4 bits (189),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 42/121 (35%), Positives = 69/121 (57%), Gaps = 7/121 (6%)
 Frame = +1

Query  223   NIHRQKLLQVAHTEAC-----EGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDE  387
             N H+ +     HT+ C      GT Y +LCVSTLA+        + PEII+A ++ +  E
Sbjct  1169  NYHKDQYSHTRHTQPCPLPRCRGTPYSDLCVSTLAS-FTGLATMSFPEIISAMLHQSASE  1227

Query  388   VKASAANCSGIRRKLP-RLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVD  564
             V+A++ +C+ ++   P +L  LE++ALD CLEL  +  D+    +S L ++  + +HY D
Sbjct  1228  VRAASTHCTVMKNHFPEKLSMLERQALDICLELSRDILDDFDNAVSYLESSKVTIRHYYD  1287

Query  565   L  567
             L
Sbjct  1288  L  1288



>ref|XP_010684346.1| PREDICTED: pectinesterase-like [Beta vulgaris subsp. vulgaris]
Length=576

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 68/107 (64%), Gaps = 9/107 (8%)
 Frame = +1

Query  220  LNIHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKAS  399
            +++H Q  LQ+A +  C+GTLY +LC+STL+  +P    K++ EI+   ++VT  EV+AS
Sbjct  38   IHLHVQNHLQLAQSH-CDGTLYTDLCISTLSN-IPHLHKKSLTEILRYVISVTEAEVRAS  95

Query  400  AANCSGI----RRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDL  528
            A N SG+    R  L R   L+  A+ DCLEL ++T DEL  VL ++
Sbjct  96   ATNISGLESVNRHTLSR---LQHFAVRDCLELLADTTDELDTVLDEM  139



>dbj|BAJ96804.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=566

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 61/99 (62%), Gaps = 2/99 (2%)
 Frame = +1

Query  268  CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGP  447
            C+GTLYPELC+STLA  +PD   K +P++I A VN T  EV   +ANCSG  R+   L  
Sbjct  55   CDGTLYPELCLSTLAD-IPDLHKKPLPDVICAAVNRTETEVTTMSANCSGYLRER-SLSG  112

Query  448  LEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVD  564
             +  A+ DC+EL   T +EL    +DL + +++ +  +D
Sbjct  113  RDHLAVTDCMELLETTMEELVATTADLESPSAARRPTMD  151



>gb|KHN43496.1| Putative pectinesterase/pectinesterase inhibitor 40 [Glycine 
soja]
Length=481

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 47/71 (66%), Gaps = 0/71 (0%)
 Frame = +1

Query  352  IIAATVNVTVDEVKASAANCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLA  531
            +I + VN T+ EV  SA+NCSG+RR LP L  LE+RALDDCL LF +T  EL   ++DL+
Sbjct  1    MIRSVVNHTIYEVTLSASNCSGLRRNLPELDKLEQRALDDCLNLFDDTVSELETTIADLS  60

Query  532  TTASSSKHYVD  564
             +    K Y D
Sbjct  61   QSTIGPKRYHD  71



>ref|XP_010042403.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 40, 
partial [Eucalyptus grandis]
Length=253

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/109 (38%), Positives = 66/109 (61%), Gaps = 3/109 (3%)
 Frame = +1

Query  244  LQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIR  423
            LQV H+  C GT Y +LCVSTLA +       +  EII+A ++ +  EV+A++ +C+ ++
Sbjct  31   LQVTHSR-CRGTPYSDLCVSTLA-SFTGLATMSFLEIISAMLHQSASEVRAASTHCTVMK  88

Query  424  RKLP-RLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDL  567
               P +L  LE++ALD CLEL  +  D+    +S L ++  + +HY DL
Sbjct  89   NHFPEKLSMLERQALDICLELSRDILDDFDNAVSYLESSKVTIRHYYDL  137



>ref|XP_010058840.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=599

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 47/154 (31%), Positives = 77/154 (50%), Gaps = 15/154 (10%)
 Frame = +1

Query  148  TSFNSLFTKDGISSSTGPTHLDLNLNIHRQKLL--------QVAHTEAC-----EGTLYP  288
            +SF+  F  +       P H+    N+  +K             HT+ C      GT Y 
Sbjct  46   SSFSVEFNAESFLLGIKPNHVYFMDNVDEKKKSYSMDNGESHTQHTQPCPLPRCRGTPYS  105

Query  289  ELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRK-LPRLGPLEKRAL  465
             LCVSTLA+      + + PEII+  ++ +  EV+A++ +C+ ++   L +L  LE++AL
Sbjct  106  GLCVSTLAS-FTGLASMSFPEIISGMLHQSASEVRAASTHCTVMKNHFLEKLSMLERQAL  164

Query  466  DDCLELFSETRDELRKVLSDLATTASSSKHYVDL  567
            D CLELF +  D+    +S L +   + +HY DL
Sbjct  165  DICLELFRDILDDFDNTVSYLDSLKVTIRHYYDL  198



>gb|EMS68834.1| Pectinesterase 1 [Triticum urartu]
Length=449

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 56/95 (59%), Gaps = 2/95 (2%)
 Frame = +1

Query  268  CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGP  447
            CEGTLYPELC+STLA  +PD   K +P++I A VN T  EV   +ANCS        L  
Sbjct  54   CEGTLYPELCLSTLAD-IPDLHKKPLPDVICAAVNRTETEVTTMSANCSAYLHGR-SLTS  111

Query  448  LEKRALDDCLELFSETRDELRKVLSDLATTASSSK  552
             +  A+ DC+EL   T DEL    +DL + +++ +
Sbjct  112  RDHLAVMDCMELLDTTMDELVATTADLQSPSAARR  146



>gb|EMT05022.1| Pectinesterase 3 [Aegilops tauschii]
Length=472

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 56/95 (59%), Gaps = 2/95 (2%)
 Frame = +1

Query  268  CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGP  447
            C+GTLYPELC+STLA  +PD   K +P++I A VN T  EV   +ANCS        L  
Sbjct  52   CDGTLYPELCLSTLAD-IPDLHKKPLPDVICAAVNRTETEVTTMSANCSAYLHGR-SLTS  109

Query  448  LEKRALDDCLELFSETRDELRKVLSDLATTASSSK  552
             +  A+ DC+EL   T DEL    +DL + +++ +
Sbjct  110  RDHLAVMDCMELLDTTMDELVATTADLQSPSAARR  144



>ref|XP_006355852.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 40-like 
[Solanum tuberosum]
Length=264

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 46/67 (69%), Gaps = 4/67 (6%)
 Frame = +1

Query  379  VDEVKASAANCSGIRRKLPRLGPLEKRALDDCLELFSETR-DELRKVLSDLATTASSS--  549
            ++EVK+SA NCS I   + +L P+EKRALDDC+EL  +T  DEL+  L DL+T   S+  
Sbjct  1    MNEVKSSAENCSNILHHVSKLDPIEKRALDDCIELLGDTTIDELQTTLYDLSTKNISNSP  60

Query  550  -KHYVDL  567
             KHY DL
Sbjct  61   LKHYYDL  67



>ref|XP_006355816.1| PREDICTED: pectinesterase-like [Solanum tuberosum]
Length=479

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 47/67 (70%), Gaps = 4/67 (6%)
 Frame = +1

Query  379  VDEVKASAANCSGIRRKLPRLGPLEKRALDDCLELFSETR-DELRKVLSDLATTASSS--  549
            ++EVK+SA NCS I   + +L P+EKRALDDC+EL  +T  DEL+  L DL+T  SS+  
Sbjct  1    MNEVKSSAENCSNILHHVSKLDPIEKRALDDCIELLGDTTIDELQTTLYDLSTKNSSNSP  60

Query  550  -KHYVDL  567
             KHY DL
Sbjct  61   LKHYNDL  67



>gb|KHN08672.1| Putative pectinesterase/pectinesterase inhibitor 40 [Glycine 
soja]
Length=471

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +1

Query  385  EVKASAANCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVD  564
            EV++S+ NCSG+++ L  L PL++RALDDCL+LF +T  EL+  + DL+ +   SK + D
Sbjct  3    EVRSSSYNCSGLKKMLKNLNPLDQRALDDCLKLFEDTNVELKATIDDLSKSTIGSKRHHD  62

Query  565  L  567
            L
Sbjct  63   L  63



>gb|ABQ42392.1| pectin methylesterase-like protein [Taiwania cryptomerioides]
Length=595

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 43/117 (37%), Positives = 62/117 (53%), Gaps = 4/117 (3%)
 Frame = +1

Query  223  NIHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASA  402
            ++ R K    A   AC  TLY ELCVS++++           EI+ A VNV ++ VK   
Sbjct  63   HVRRWKSTSNAVKNACSSTLYQELCVSSISSYEGLSSQAGHMEILDAAVNVAINAVKKGQ  122

Query  403  ANCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDL--ATTASSSKHYVDL  567
            A+   +  +   L   ++ AL+DC+E++ +T DEL   LSDL  AT  S  KH  DL
Sbjct  123  AHTRSLFSR--DLDSRQRGALNDCMEMYDDTLDELHDTLSDLHNATFLSMPKHAADL  177



>emb|CDX97564.1| BnaA05g25150D [Brassica napus]
Length=592

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 51/88 (58%), Gaps = 1/88 (1%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLG  444
            AC  TLYPELC+S +ATA    +  +  ++I A++N+T   V+ +      + +K   L 
Sbjct  64   ACSSTLYPELCISAVATA-GGVKLTSQKDVIEASLNLTTTAVEHNYFGVKKLIKKTKGLT  122

Query  445  PLEKRALDDCLELFSETRDELRKVLSDL  528
            P EK AL DCLE   ET DEL + L DL
Sbjct  123  PREKTALHDCLETIDETLDELHEALEDL  150



>gb|KGN44975.1| Pectinesterase [Cucumis sativus]
Length=614

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 61/113 (54%), Gaps = 5/113 (4%)
 Frame = +1

Query  241  LLQVAHTEA---CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANC  411
            L Q  H  A   C GTL+P+LC S L++  P   + +  ++  + +N T  EV  +  NC
Sbjct  93   LFQTFHQTARSLCNGTLFPDLCFSKLSS-FPQLASLSPEKLAGSALNFTSREVLLAYTNC  151

Query  412  SGIRRKL-PRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDL  567
            + ++  L   L P ++ ALDDCLEL   +  EL+  + DLA + S + H  DL
Sbjct  152  TNLKTHLYSGLNPTDRHALDDCLELLDGSIAELKASIFDLAPSQSPALHSHDL  204



>ref|XP_009146386.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3 [Brassica 
rapa]
Length=592

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 51/88 (58%), Gaps = 1/88 (1%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLG  444
            AC  TLYPELC+S +ATA    +  +  ++I A++N+T   V+ +      + +K   L 
Sbjct  64   ACSSTLYPELCISAVATA-GGVKLTSQKDVIEASLNLTTTAVEHNYFGVKKLIKKTKGLT  122

Query  445  PLEKRALDDCLELFSETRDELRKVLSDL  528
            P EK AL DCLE   ET DEL + L DL
Sbjct  123  PREKTALHDCLETIDETLDELHEALEDL  150



>ref|XP_009117000.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3-like [Brassica 
rapa]
Length=592

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 35/88 (40%), Positives = 51/88 (58%), Gaps = 1/88 (1%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLG  444
            AC  TLYPELC+S +AT+    +  +  ++I A++N+T   V+ +      + + +  L 
Sbjct  64   ACSSTLYPELCISAVATS-GGVKLTSQKDVIEASLNLTTTAVEHNYFTVKKLIKNMKGLT  122

Query  445  PLEKRALDDCLELFSETRDELRKVLSDL  528
            P EK AL DCLE   ET DEL + L DL
Sbjct  123  PREKTALHDCLETIDETLDELHETLEDL  150



>emb|CDX75765.1| BnaC03g38480D [Brassica napus]
Length=479

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 52/90 (58%), Gaps = 1/90 (1%)
 Frame = +1

Query  259  TEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPR  438
            T AC  T YPELC+STLAT+    +  +  ++I A++N+T   V+ +      + +K   
Sbjct  51   TSACSSTRYPELCISTLATS-GGVKLTSQKDVIEASLNLTTTAVEHNYFTVKKLIKKRKG  109

Query  439  LGPLEKRALDDCLELFSETRDELRKVLSDL  528
            L P EK AL DCLE   ET DEL + + DL
Sbjct  110  LTPREKTALHDCLETIDETLDELHEAVEDL  139



>emb|CDX98441.1| BnaC05g39340D [Brassica napus]
Length=572

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 36/88 (41%), Positives = 50/88 (57%), Gaps = 1/88 (1%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLG  444
            AC  TLYPELC+S +ATA    +  +  ++I A++N+T   V+ +      + +    L 
Sbjct  64   ACSSTLYPELCISAVATA-GGVKLMSQKDVIEASLNLTTTAVEHNYFGVKKLIKNTKGLT  122

Query  445  PLEKRALDDCLELFSETRDELRKVLSDL  528
            P EK AL DCLE   ET DEL + L DL
Sbjct  123  PREKTALHDCLETIDETLDELHEALEDL  150



>ref|XP_010489830.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3-like [Camelina 
sativa]
Length=213

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 50/88 (57%), Gaps = 1/88 (1%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLG  444
            +C  TLYPELC+S +ATA    +  +  ++I A++N+T   V+ +      + +K   L 
Sbjct  62   SCSSTLYPELCISAVATA-GGVKLTSQKDVIEASLNLTTTAVEHNYFTVKKLIKKRKGLT  120

Query  445  PLEKRALDDCLELFSETRDELRKVLSDL  528
            P EK AL DCLE   ET DEL   + DL
Sbjct  121  PREKTALHDCLETIDETLDELHDAVEDL  148



>gb|ABG46324.1| putative pectin methylesterase [Picea abies]
Length=393

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 52/100 (52%), Gaps = 4/100 (4%)
 Frame = +1

Query  232  RQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIP-EIIAATVNVTVDEVKASAAN  408
            R K    A   AC  TLYPE CVS++++  P    +  P EI+   V +++  V+   AN
Sbjct  26   RWKSTSKAVHHACSSTLYPEFCVSSVSS-FPGLSKRPGPMEILKVVVKLSIAAVEK--AN  82

Query  409  CSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDL  528
                R   P L   ++ AL DC ELF ET DEL   LSDL
Sbjct  83   ARARRLSRPGLDQRQRGALQDCFELFDETLDELYSTLSDL  122



>emb|CDY60700.1| BnaA01g37100D [Brassica napus]
Length=556

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 51/88 (58%), Gaps = 1/88 (1%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLG  444
            AC  TLYPELC+S +AT+    +  +  ++I A++N+T   V+ +      + + +  L 
Sbjct  64   ACSSTLYPELCISAVATS-GGVKLTSQKDVIEASLNLTTTAVEHNYFTVKKLIKNMKGLT  122

Query  445  PLEKRALDDCLELFSETRDELRKVLSDL  528
            P EK AL DCLE   ET DEL + L DL
Sbjct  123  PREKTALHDCLETIDETLDELHETLEDL  150



>ref|XP_004136014.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 40-like 
[Cucumis sativus]
Length=561

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 57/101 (56%), Gaps = 2/101 (2%)
 Frame = +1

Query  268  CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKL-PRLG  444
            C GTL+P+LC S L++  P   + +  ++  + +N T  EV  +  NC+ ++  L   L 
Sbjct  52   CNGTLFPDLCFSKLSS-FPQLASLSPEKLAGSALNFTSREVLLAYTNCTNLKTHLYSGLN  110

Query  445  PLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDL  567
            P ++ ALDDCLEL   +  EL+  + DLA + S + H  DL
Sbjct  111  PTDRHALDDCLELLDGSIAELKASIFDLAPSQSPALHSHDL  151



>gb|KFK38797.1| hypothetical protein AALP_AA3G161500 [Arabis alpina]
Length=593

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 51/88 (58%), Gaps = 1/88 (1%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLG  444
            AC  TLYPELC+S LAT+  D +  +  ++I A++N+T   V+ +      + +    L 
Sbjct  64   ACSPTLYPELCISALATS-GDVKLTSQKDVIEASLNLTTTVVEHNYFTVKKLIKNRKGLT  122

Query  445  PLEKRALDDCLELFSETRDELRKVLSDL  528
            P EK AL DCLE   ET DEL + + DL
Sbjct  123  PREKTALHDCLETIDETLDELHEAVEDL  150



>ref|XP_010465323.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3 [Camelina 
sativa]
Length=592

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 57/104 (55%), Gaps = 4/104 (4%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLG  444
            +C  TLYPELC+S +ATA    +  +  ++I A++N+T   V+ +      + +K   L 
Sbjct  62   SCSSTLYPELCISAVATA-GGVKLTSQKDVIEASLNLTTTAVEHNYFTVKKLIKKRKGLT  120

Query  445  PLEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDL  567
            P EK AL DCLE   ET DEL + + DL    T  +  +H  DL
Sbjct  121  PREKTALHDCLETIDETLDELHEAVEDLHLYPTKKTLREHAADL  164



>ref|XP_006407094.1| hypothetical protein EUTSA_v10020354mg [Eutrema salsugineum]
 gb|ESQ48547.1| hypothetical protein EUTSA_v10020354mg [Eutrema salsugineum]
Length=592

 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 51/88 (58%), Gaps = 1/88 (1%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLG  444
            +C  TLYPELCVS +AT+  D +  +  ++I A++N+T   V+ +      + +    L 
Sbjct  64   SCSSTLYPELCVSAVATS-GDVKLTSQKDVIEASLNLTTIAVEHNYFTVKKLIKNRKGLT  122

Query  445  PLEKRALDDCLELFSETRDELRKVLSDL  528
            P EK AL DCLE   ET DEL + + DL
Sbjct  123  PREKTALHDCLETIDETLDELHEAVEDL  150



>emb|CDY33229.1| BnaC01g37020D [Brassica napus]
Length=570

 Score = 61.2 bits (147),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 35/88 (40%), Positives = 49/88 (56%), Gaps = 1/88 (1%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLG  444
            AC  TLYPELCVS +A +    +  +  ++I A++N+T   V+ +      + +    L 
Sbjct  64   ACSSTLYPELCVSAVAIS-GGVKLTSQKDVIEASLNLTTTAVEHNYFTVKKLIKNKKGLT  122

Query  445  PLEKRALDDCLELFSETRDELRKVLSDL  528
            P EK AL DCLE   ET DEL + L DL
Sbjct  123  PREKTALHDCLETIDETLDELHETLEDL  150



>gb|ACN40984.1| unknown [Picea sitchensis]
Length=601

 Score = 61.2 bits (147),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 38/98 (39%), Positives = 57/98 (58%), Gaps = 5/98 (5%)
 Frame = +1

Query  262  EACEGTLYPELCVSTLAT--ALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLP  435
            +AC  TLYPELCVS++++   L DR      EI+   ++V++  V+ + A  + I    P
Sbjct  83   DACSSTLYPELCVSSVSSFPGLSDRAGPI--EIVHVVLSVSIAAVEKANA-LARIMWTRP  139

Query  436  RLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSS  549
             L   ++ AL DCLELF ET DEL + +S+L   +  S
Sbjct  140  GLSHRKRGALQDCLELFDETLDELYETVSNLKNGSCMS  177



>ref|XP_010685210.1| PREDICTED: pectinesterase-like [Beta vulgaris subsp. vulgaris]
Length=592

 Score = 61.2 bits (147),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 40/107 (37%), Positives = 54/107 (50%), Gaps = 5/107 (5%)
 Frame = +1

Query  223  NIHRQKLLQVAHT---EACEGTLYPELCVSTLATALPDRRAK--TIPEIIAATVNVTVDE  387
            N H  KL    HT    +C  T YP+LC S +A+A      K  T  ++IAA++N+T   
Sbjct  41   NNHNPKLSHETHTILKASCSNTKYPDLCYSAIASAPSSTTTKISTQKDVIAASLNLTTLA  100

Query  388  VKASAANCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDL  528
            V+ +      +      L   E+ AL DCLE   ET DELR+ L DL
Sbjct  101  VEHNFFTVEKLIETRKNLTVRERNALHDCLESIDETLDELRRTLQDL  147



>ref|XP_006297218.1| hypothetical protein CARUB_v10013226mg, partial [Capsella rubella]
 gb|EOA30116.1| hypothetical protein CARUB_v10013226mg, partial [Capsella rubella]
Length=623

 Score = 61.2 bits (147),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 39/104 (38%), Positives = 55/104 (53%), Gaps = 4/104 (4%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLG  444
            +C  TLYPELC+S +ATA       +  ++I A++N+T   V+ +      + +K   L 
Sbjct  93   SCSSTLYPELCISAVATA-GGVELTSQKDVIEASLNLTKTAVEHNYFTVRKLIKKRKGLT  151

Query  445  PLEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDL  567
            P EK AL DCLE   ET DEL   + DL    T  +  +H  DL
Sbjct  152  PREKTALHDCLETIDETLDELHDAVEDLHLYPTKKTLRQHAGDL  195



>ref|XP_010501842.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3-like [Camelina 
sativa]
Length=592

 Score = 61.2 bits (147),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 50/88 (57%), Gaps = 1/88 (1%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLG  444
            +C  TLYPELC+S +ATA    +  +  ++I A++N+T   V+ +      + +K   L 
Sbjct  62   SCSSTLYPELCISAVATA-GGVKLTSQKDVIEASLNLTTTAVEHNYFTVKKLIKKRKGLT  120

Query  445  PLEKRALDDCLELFSETRDELRKVLSDL  528
            P EK AL DCLE   ET DEL   + DL
Sbjct  121  PREKTALHDCLETIDETLDELHDAVEDL  148



>ref|XP_004171768.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 40-like 
[Cucumis sativus]
Length=591

 Score = 61.2 bits (147),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 57/101 (56%), Gaps = 2/101 (2%)
 Frame = +1

Query  268  CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKL-PRLG  444
            C GTL+P+LC S L++  P   + +  ++  + +N T  EV  +  NC+ ++  L   L 
Sbjct  82   CNGTLFPDLCFSKLSS-FPLLASLSPEKLAGSALNFTSREVLLAYTNCTNLKTHLYSGLN  140

Query  445  PLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDL  567
            P ++ ALDDCLEL   +  EL+  + DLA + S + H  DL
Sbjct  141  PTDRHALDDCLELLDGSIAELKASIFDLAPSQSPALHSHDL  181



>ref|XP_007012502.1| Pectin methylesterase 3 [Theobroma cacao]
 gb|EOY30121.1| Pectin methylesterase 3 [Theobroma cacao]
Length=573

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/91 (40%), Positives = 55/91 (60%), Gaps = 3/91 (3%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATALPD--RRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPR  438
            +C  TLYPELC+ST++ A PD   + K+  ++I  ++N+T+  V+++  +   +      
Sbjct  61   SCSSTLYPELCLSTISAA-PDAETKIKSPKDVIVTSMNLTITAVQSNYLSIKKLISTNKN  119

Query  439  LGPLEKRALDDCLELFSETRDELRKVLSDLA  531
            L   EK AL+DCLEL  ET DEL K   DL+
Sbjct  120  LPKREKTALNDCLELEDETLDELYKAEQDLS  150



>emb|CDY39109.1| BnaA01g29470D [Brassica napus]
Length=558

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 50/88 (57%), Gaps = 1/88 (1%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLG  444
            AC  TLYPELC+S +AT+    +  +  ++I A++N+T   V+ +      + +    L 
Sbjct  64   ACSSTLYPELCISAVATS-GGVKLTSQKDVIEASLNLTTIAVEHNYFTVKKLIKNRKGLT  122

Query  445  PLEKRALDDCLELFSETRDELRKVLSDL  528
            P EK AL DCLE   ET DEL + L DL
Sbjct  123  PREKTALHDCLETIDETLDELHETLEDL  150



>emb|CDY33228.1| BnaC01g37010D [Brassica napus]
Length=592

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 50/88 (57%), Gaps = 1/88 (1%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLG  444
            AC  TLYPELC+S +AT+    +  +  ++I A++N+T   V+ +      + +    L 
Sbjct  64   ACSSTLYPELCISAVATS-GGVKLTSQKDVIEASLNLTTIAVEHNYFTVKKLIKNRKGLT  122

Query  445  PLEKRALDDCLELFSETRDELRKVLSDL  528
            P EK AL DCLE   ET DEL + L DL
Sbjct  123  PREKTALHDCLETIDETLDELHETLEDL  150



>ref|XP_009116991.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3-like [Brassica 
rapa]
Length=592

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 34/88 (39%), Positives = 50/88 (57%), Gaps = 1/88 (1%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLG  444
            AC  TLY ELC+S +AT+    +  +  ++I A++N+T   V+ +      + + +  L 
Sbjct  64   ACSSTLYTELCISAVATS-GGVKLTSQKDVIEASLNLTTIAVEHNYFTVKKLIKNMKGLT  122

Query  445  PLEKRALDDCLELFSETRDELRKVLSDL  528
            P EK AL DCLE   ET DEL + L DL
Sbjct  123  PREKTALHDCLETIDETLDELHETLEDL  150



>ref|XP_002885033.1| ATPME3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61292.1| ATPME3 [Arabidopsis lyrata subsp. lyrata]
Length=590

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 33/88 (38%), Positives = 49/88 (56%), Gaps = 1/88 (1%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLG  444
            +C  T YPELC+S +A         +  ++I A++N+T+  V+ +  N   + +K   L 
Sbjct  61   SCSSTRYPELCISAVANT-GGVEITSQKDVIEASLNLTIIAVEHNYFNVKKLIKKRKGLT  119

Query  445  PLEKRALDDCLELFSETRDELRKVLSDL  528
            P EK AL DCLE   ET DEL + + DL
Sbjct  120  PREKTALHDCLETIDETLDELHETVEDL  147



>ref|XP_010273995.1| PREDICTED: pectinesterase 1-like [Nelumbo nucifera]
Length=226

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 55/97 (57%), Gaps = 5/97 (5%)
 Frame = +1

Query  268  CEGTLYPELCVSTLATALPDRRAKTIP-EIIAATVNVTVDEVKASAANCSGIRRKLPRLG  444
            C  TLYP LC STL +++P  +  T P  I+   +N+T + V  S  +  G+  +   L 
Sbjct  72   CAKTLYPSLCFSTL-SSIPSSKNATHPRHILVIAINLTFNSVNISQTHIMGLLTR-QDLN  129

Query  445  PLEKRALDDCLELFSETRDELR--KVLSDLATTASSS  549
            P E+ AL DCLE+  +T+ EL+  + L DL   +S+S
Sbjct  130  PQERNALQDCLEMLDQTQYELQQAQALQDLRYFSSAS  166



>ref|NP_188048.1| pectin methylesterase 3 [Arabidopsis thaliana]
 sp|O49006.2|PME3_ARATH RecName: Full=Pectinesterase/pectinesterase inhibitor 3; Includes: 
RecName: Full=Pectinesterase inhibitor 3; AltName: Full=Pectin 
methylesterase inhibitor 3; Includes: RecName: Full=Pectinesterase 
3; Short=PE 3; AltName: Full=Pectin methylesterase 
27; Short=AtPME27; AltName: Full=Pectin methylesterase 
3; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB01037.1| pectinesterase [Arabidopsis thaliana]
 gb|AAK59769.1| AT3g14310/MLN21_9 [Arabidopsis thaliana]
 gb|AAK97722.1| AT3g14310/MLN21_9 [Arabidopsis thaliana]
 gb|AAN28889.1| At3g14310/MLN21_9 [Arabidopsis thaliana]
 gb|AEE75500.1| pectin methylesterase 3 [Arabidopsis thaliana]
Length=592

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 49/88 (56%), Gaps = 1/88 (1%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLG  444
            +C  T YPELC+S + TA       +  ++I A+VN+T+  V+ +      + +K   L 
Sbjct  62   SCSSTRYPELCISAVVTA-GGVELTSQKDVIEASVNLTITAVEHNYFTVKKLIKKRKGLT  120

Query  445  PLEKRALDDCLELFSETRDELRKVLSDL  528
            P EK AL DCLE   ET DEL + + DL
Sbjct  121  PREKTALHDCLETIDETLDELHETVEDL  148



>gb|ABZ89800.1| pectin methylesterase-like protein [Taiwania cryptomerioides]
Length=584

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 38/104 (37%), Positives = 59/104 (57%), Gaps = 4/104 (4%)
 Frame = +1

Query  262  EACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRL  441
            +AC  TL+PELCVS++A+           EI+ + V V +  V+ + A+   + R  P L
Sbjct  65   DACSSTLHPELCVSSIASYGGLSSKADHMEIVESAVRVGIGAVEKAKAHVRRLSR--PGL  122

Query  442  GPLEKRALDDCLELFSETRDELRKVLSDL--ATTASSSKHYVDL  567
               ++ AL DC+E+F +T +EL+  L+DL  AT  S  K+  DL
Sbjct  123  DFRQRGALKDCMEMFDDTLEELQDTLTDLQNATFMSLPKYADDL  166



>gb|KDP33984.1| hypothetical protein JCGZ_07555 [Jatropha curcas]
Length=583

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 37/113 (33%), Positives = 59/113 (52%), Gaps = 7/113 (6%)
 Frame = +1

Query  232  RQKLLQVAHT---EACEGTLYPELCVSTLATALPD---RRAKTIPEIIAATVNVTVDEVK  393
            + +  Q AH     +C  TLYP+LC ST++T LP+    + +   ++I  ++NVT + V 
Sbjct  51   KNEYHQAAHAIIKSSCSATLYPDLCFSTIST-LPNAAISKVRNTRDVIGLSLNVTKESVT  109

Query  394  ASAANCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSK  552
             +    + I   L +L P EK A  DC EL ++T  ++ KV   L +  S  K
Sbjct  110  KAYLKINRISSGLKKLTPREKIAFGDCFELLNQTIVQINKVARKLHSYPSLKK  162



>ref|XP_010047425.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=585

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 54/90 (60%), Gaps = 2/90 (2%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATA--LPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPR  438
            +C  TLYP+LC+S L ++  L     KT  ++IA ++N+T+  V+ +  +   +    P 
Sbjct  63   SCSSTLYPDLCLSQLTSSPSLASNAVKTPKDVIALSLNLTIAYVQHNYFSIKKVAAVRPG  122

Query  439  LGPLEKRALDDCLELFSETRDELRKVLSDL  528
            L   E+ AL DCLE+  ET DE+R+ L++L
Sbjct  123  LTARERTALHDCLEMVDETLDEVRETLAEL  152



>emb|CDY67447.1| BnaA03g57460D [Brassica napus]
Length=220

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 50/90 (56%), Gaps = 1/90 (1%)
 Frame = +1

Query  259  TEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPR  438
            T AC  T YPELC+S +AT+       +  ++I A++N+T   V+ +      + +K   
Sbjct  62   TSACISTRYPELCISAVATS-GGVELTSQKDVIEASLNLTKTVVEHNYFTVKKLIKKRKG  120

Query  439  LGPLEKRALDDCLELFSETRDELRKVLSDL  528
            L P EK AL DCLE   ET DEL + + DL
Sbjct  121  LTPREKTALHDCLETIDETLDELHEAVEDL  150



>gb|AAC50023.1| ATPME2 precursor, partial [Arabidopsis thaliana]
Length=582

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 47/136 (35%), Positives = 62/136 (46%), Gaps = 11/136 (8%)
 Frame = +1

Query  178  GISSSTGPTHLDLNLNIHRQKLLQVAHT---EACEGTLYPELCVSTLATALPDRRAKTIP  348
            GI+++T     + N N     L   +H      C  TLYPELC S +A A   +   +  
Sbjct  32   GIAATT----TNQNKNQKITTLFSTSHAILKSVCSSTLYPELCFSAVA-ATGGKELTSQK  86

Query  349  EIIAATVNVTVDEVKASAANCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDL  528
            E+I A++N+T   VK +      +  K   L P E  AL DCLE   ET DEL   + DL
Sbjct  87   EVIEASLNLTTKAVKHNYFAVKKLIAKRKGLTPREVTALHDCLETIDETLDELHVAVEDL  146

Query  529  ---ATTASSSKHYVDL  567
                   S  KH  DL
Sbjct  147  HQYPKQKSLRKHADDL  162



>ref|XP_009606552.1| PREDICTED: pectinesterase/pectinesterase inhibitor U1 [Nicotiana 
tomentosiformis]
Length=589

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 56/110 (51%), Gaps = 6/110 (5%)
 Frame = +1

Query  217  NLNIHR--QKLLQVAHT---EACEGTLYPELCVSTLATALP-DRRAKTIPEIIAATVNVT  378
            N N H   Q +   AH     ACE TL+PELC ST+A+     ++  +  ++I  ++N+T
Sbjct  54   NSNDHADIQAITSAAHAIVKSACENTLHPELCYSTIASVSDFSKKVTSQKDVIELSLNIT  113

Query  379  VDEVKASAANCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDL  528
               V+ +      + +    L P EK AL DCLE   ET DEL   + DL
Sbjct  114  CKAVQHNFFTVEKLIKTRKGLTPREKVALHDCLETIDETLDELHTAIDDL  163



>ref|XP_002891774.1| ATPME2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68033.1| ATPME2 [Arabidopsis lyrata subsp. lyrata]
Length=586

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 50/161 (31%), Positives = 74/161 (46%), Gaps = 21/161 (13%)
 Frame = +1

Query  55   VTRMHNLKQKATLFFTISGCSAIVLLAFLSVTSFNSLFTKDGISSSTGPTHLDLNLNIHR  234
            +++  + K    L  +    +AI LL F +V          GI+++T     + N N   
Sbjct  8    ISKFSDFKNNKKLILS---SAAIALLLFATVV---------GIAATT-----NQNKNKKI  50

Query  235  QKLLQVAHT---EACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAA  405
              L   +H      C  TLYPELC ST+A A   ++  +  E+I A++N+T   VK +  
Sbjct  51   TTLSSTSHAVLKSVCSSTLYPELCFSTVA-ATGGKQLTSQKEVIEASLNLTTKAVKHNYF  109

Query  406  NCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDL  528
                +  K   L P E  AL DCLE   ET DEL   + D+
Sbjct  110  AVKKLIAKRKGLTPREVTALHDCLETIDETLDELHVAVEDI  150



>emb|CAB95025.1| pectin methylesterase [Nicotiana tabacum]
Length=579

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 53/102 (52%), Gaps = 4/102 (4%)
 Frame = +1

Query  235  QKLLQVAHT---EACEGTLYPELCVSTLATALP-DRRAKTIPEIIAATVNVTVDEVKASA  402
            Q +   AH     ACE TL+PELC ST+A+     ++  +  ++I  ++N+T   V+ + 
Sbjct  52   QAITSAAHAIVKSACENTLHPELCYSTIASVSDFSKKVTSQKDVIELSLNITCRAVQHNF  111

Query  403  ANCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDL  528
                 + +    L P EK AL DCLE   ET DEL   + DL
Sbjct  112  FKVEKLIKTRKGLKPREKVALHDCLETIDETLDELHTAIKDL  153



>gb|AAO85706.1| pectin methyl-esterase [Nicotiana benthamiana]
Length=579

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 53/102 (52%), Gaps = 4/102 (4%)
 Frame = +1

Query  235  QKLLQVAHT---EACEGTLYPELCVSTLATALP-DRRAKTIPEIIAATVNVTVDEVKASA  402
            Q +   AH     ACE TL+PELC ST+A+     ++  +  ++I  ++N+T   V+ + 
Sbjct  52   QAITSAAHAIVKSACENTLHPELCYSTIASVSDFSKKVTSQKDVIELSLNITCRAVQHNF  111

Query  403  ANCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDL  528
                 + +    L P EK AL DCLE   ET DEL   + DL
Sbjct  112  FKVEKLIKTRKGLKPREKVALHDCLETIDETLDELHTAIKDL  153



>ref|XP_009762395.1| PREDICTED: pectinesterase/pectinesterase inhibitor U1 [Nicotiana 
sylvestris]
Length=589

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 53/102 (52%), Gaps = 4/102 (4%)
 Frame = +1

Query  235  QKLLQVAHT---EACEGTLYPELCVSTLATALP-DRRAKTIPEIIAATVNVTVDEVKASA  402
            Q +   AH     ACE TL+PELC ST+A+     ++  +  ++I  ++N+T   V+ + 
Sbjct  62   QAITSAAHAIVKSACENTLHPELCYSTIASVSDFSKKVTSQKDVIELSLNITCRAVQHNF  121

Query  403  ANCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDL  528
                 + +    L P EK AL DCLE   ET DEL   + DL
Sbjct  122  FKVEKLIKTRKGLKPREKVALHDCLETIDETLDELHTAIKDL  163



>gb|KHN03710.1| Putative pectinesterase/pectinesterase inhibitor 40 [Glycine 
soja]
Length=415

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 43/60 (72%), Gaps = 2/60 (3%)
 Frame = +1

Query  385  EVKASAANCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLA--TTASSSKHY  558
            E+++++ NCSG+++ L  L PL++RALD CL+LF +T  EL+  + DL+  +T  S +H+
Sbjct  3    EIRSTSYNCSGLKKMLKNLNPLDQRALDYCLKLFEDTSVELKATIDDLSIKSTIGSKRHH  62



>gb|AAC72288.1| putative pectin methylesterase [Arabidopsis thaliana]
Length=592

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 51/92 (55%), Gaps = 9/92 (10%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATA----LPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKL  432
            +C  T YPELC+S + TA    L  ++     ++I A+VN+T+  V+ +      + +K 
Sbjct  62   SCSSTRYPELCISAVVTAGACELTSQK-----DVIEASVNLTITAVEHNYFTVKKLIKKR  116

Query  433  PRLGPLEKRALDDCLELFSETRDELRKVLSDL  528
              L P EK AL DCLE   ET DEL + + DL
Sbjct  117  KGLTPREKTALHDCLETIDETLDELHETVEDL  148



>ref|XP_006658118.1| PREDICTED: pectinesterase 3-like [Oryza brachyantha]
Length=577

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 36/98 (37%), Positives = 59/98 (60%), Gaps = 1/98 (1%)
 Frame = +1

Query  268  CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGP  447
            C GTL+ ++CVSTLAT +P+   K + ++I+  V      V+AS+ANCS   ++  +L  
Sbjct  63   CAGTLHRDVCVSTLAT-IPNLAQKPLRDVISEVVGRAASAVRASSANCSSYLQRSQQLRV  121

Query  448  LEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYV  561
             ++ AL DCLELF  T D+L    ++L+    S++  +
Sbjct  122  RDRLALSDCLELFGHTLDQLGTAAAELSAGNRSAEESI  159



>ref|XP_010656074.1| PREDICTED: pectinesterase-like [Vitis vinifera]
Length=578

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 38/105 (36%), Positives = 54/105 (51%), Gaps = 4/105 (4%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATALPDRRAKTIP-EIIAATVNVTVDEVKASAANCSGIRRKLPRL  441
            +C  TLYPELC S +++   +    T P ++I A +N T+  V+ +      I +    L
Sbjct  61   SCSATLYPELCFSAVSSREGEEAKITKPKDVIEAVLNFTITTVQHNYFTLQHIIKTRLGL  120

Query  442  GPLEKRALDDCLELFSETRDELRKV---LSDLATTASSSKHYVDL  567
             P EK AL DCLE+  +T DEL K    L D +   S S+   DL
Sbjct  121  SPREKAALHDCLEMVDDTLDELHKSALDLQDYSLNKSISQQADDL  165



>gb|KHF97383.1| Pectinesterase/pectinesterase inhibitor U1 [Gossypium arboreum]
Length=567

 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 41/101 (41%), Positives = 59/101 (58%), Gaps = 8/101 (8%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATALPD--RRAKTIPEIIAATVNVTVDEVKASAANCSGI---RRK  429
            +C  TLYPELC ST+++A PD   + K   ++I  ++N+TV  V+++  +   +   RRK
Sbjct  52   SCSSTLYPELCYSTISSA-PDAETKVKNPKDVIELSLNLTVTAVQSNYLSIKKLISTRRK  110

Query  430  LPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSK  552
               L   EK AL+DCLEL  ET DEL     DL+   S +K
Sbjct  111  --SLTEREKAALNDCLELVDETLDELFVAEHDLSDYPSFNK  149



>gb|KDP33985.1| hypothetical protein JCGZ_07556 [Jatropha curcas]
Length=583

 Score = 58.2 bits (139),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 39/113 (35%), Positives = 59/113 (52%), Gaps = 5/113 (4%)
 Frame = +1

Query  214  LNLNIHRQKLLQVAHTEACEGTLYPELCVSTLATALPDR---RAKTIPEIIAATVNVTVD  384
            ++ N H Q    V    +C  TLYPELC ST++T LPD    + K+  ++I  ++NVT D
Sbjct  51   ISANAHHQAA-HVVLKSSCSTTLYPELCFSTIST-LPDDAVTKIKSTRDVIDLSLNVTKD  108

Query  385  EVKASAANCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTAS  543
             VK + +    +          E+ A  DCL + +ET DE+ KV  +L   +S
Sbjct  109  SVKQTYSKIEKLAYSGTNYTQRERIAFHDCLLVLNETLDEINKVEDELKEYSS  161



>ref|NP_175786.1| pectin methylesterase 2 [Arabidopsis thaliana]
 sp|Q42534.2|PME2_ARATH RecName: Full=Pectinesterase 2; Short=PE 2; AltName: Full=Pectin 
methylesterase 2; Short=AtPME2; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF02856.1|AC009324_5 pectinesterase 2 [Arabidopsis thaliana]
 gb|AAK32805.1|AF361637_1 At1g53830/T18A20_6 [Arabidopsis thaliana]
 gb|AAM91439.1| At1g53830/T18A20_6 [Arabidopsis thaliana]
 gb|AEE33007.1| pectin methylesterase 2 [Arabidopsis thaliana]
Length=587

 Score = 58.2 bits (139),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 40/103 (39%), Positives = 50/103 (49%), Gaps = 4/103 (4%)
 Frame = +1

Query  268  CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGP  447
            C  TLYPELC S +A A   +   +  E+I A++N+T   VK +      +  K   L P
Sbjct  66   CSSTLYPELCFSAVA-ATGGKELTSQKEVIEASLNLTTKAVKHNYFAVKKLIAKRKGLTP  124

Query  448  LEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDL  567
             E  AL DCLE   ET DEL   + DL       S  KH  DL
Sbjct  125  REVTALHDCLETIDETLDELHVAVEDLHQYPKQKSLRKHADDL  167



>gb|KJB54563.1| hypothetical protein B456_009G039100 [Gossypium raimondii]
Length=567

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 42/109 (39%), Positives = 61/109 (56%), Gaps = 10/109 (9%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATA-LPDRRAKTIPEIIAATVNVTVDEVKASAANCSGI---RRKL  432
            +C  TLYPELC ST+++A   + + K   ++I  ++N+TV  V+++  +   +   RRK 
Sbjct  52   SCSSTLYPELCYSTISSAPHAETKVKNPKDVIEMSLNLTVTAVQSNYLSIKKLISTRRK-  110

Query  433  PRLGPLEKRALDDCLELFSETRDELRKVLSDLAT----TASSSKHYVDL  567
              L   EK AL+DCLEL  ET DEL     DL+       S S+H  DL
Sbjct  111  -SLTEREKAALNDCLELVDETLDELLVAEHDLSDYPSFNKSISQHAEDL  158



>gb|KJB54564.1| hypothetical protein B456_009G039100 [Gossypium raimondii]
Length=412

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 42/109 (39%), Positives = 61/109 (56%), Gaps = 10/109 (9%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATA-LPDRRAKTIPEIIAATVNVTVDEVKASAANCSGI---RRKL  432
            +C  TLYPELC ST+++A   + + K   ++I  ++N+TV  V+++  +   +   RRK 
Sbjct  52   SCSSTLYPELCYSTISSAPHAETKVKNPKDVIEMSLNLTVTAVQSNYLSIKKLISTRRK-  110

Query  433  PRLGPLEKRALDDCLELFSETRDELRKVLSDLAT----TASSSKHYVDL  567
              L   EK AL+DCLEL  ET DEL     DL+       S S+H  DL
Sbjct  111  -SLTEREKAALNDCLELVDETLDELLVAEHDLSDYPSFNKSISQHAEDL  158



>gb|KDO53765.1| hypothetical protein CISIN_1g018173mg [Citrus sinensis]
Length=360

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 59/108 (55%), Gaps = 11/108 (10%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATALPD--RRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPR  438
            +C  T YP+LC S +A A+P+  ++  +  ++I  ++N+T   V+    N  GI++ L R
Sbjct  72   SCSSTRYPDLCFSAIA-AVPEASKKVTSQKDVIEMSLNITTTAVEH---NYFGIQKLLKR  127

Query  439  --LGPLEKRALDDCLELFSETRDELRKVLSDLA---TTASSSKHYVDL  567
              L   EK AL DCLE   ET DEL K + DL       S S+H  DL
Sbjct  128  TNLTKREKVALHDCLETIDETLDELHKAVEDLEEYPNKKSLSQHADDL  175



>ref|XP_009135376.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3-like [Brassica 
rapa]
Length=591

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 50/90 (56%), Gaps = 1/90 (1%)
 Frame = +1

Query  259  TEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPR  438
            T AC  T YPELC+S +AT+       +  ++I A++N+T   V+ +      + +K   
Sbjct  62   TSACISTRYPELCISAVATS-GGVELTSQKDVIEASLNLTKTVVEHNYFTVKKLIKKRKG  120

Query  439  LGPLEKRALDDCLELFSETRDELRKVLSDL  528
            L P EK AL DCLE   ET DEL + + DL
Sbjct  121  LTPREKTALHDCLETIDETLDELHEAVEDL  150



>gb|KHG08631.1| Pectinesterase 3 [Gossypium arboreum]
Length=582

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 52/92 (57%), Gaps = 7/92 (8%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLAT--ALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPR  438
            AC GT YP+LC S +AT  A   ++ ++  ++I  ++N+T   V+    N   I++ L R
Sbjct  68   ACSGTFYPDLCFSAVATVPAGTAKKVRSQKDVIELSLNITTTAVEH---NYFKIKKLLAR  124

Query  439  --LGPLEKRALDDCLELFSETRDELRKVLSDL  528
              L   EK AL DCLE   ET DEL + + DL
Sbjct  125  KDLTTREKTALHDCLETIDETLDELHEAVEDL  156



>gb|AFB77928.1| pectin methylesterase [Gossypium hirsutum]
Length=567

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 57/99 (58%), Gaps = 4/99 (4%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATALPD--RRAKTIPEIIAATVNVTVDEVKASAANCSG-IRRKLP  435
            +C  TLYPELC ST+++A PD   + K   ++I  ++N+TV  V+++  +    I  +  
Sbjct  52   SCSSTLYPELCYSTISSA-PDAETKVKNPKDVIELSLNLTVTAVQSNYLSIKKLISTQRK  110

Query  436  RLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSK  552
             L   EK AL+DCLEL  ET DEL     DL+   S +K
Sbjct  111  SLTEREKAALNDCLELVDETLDELFVAEHDLSDYPSFNK  149



>ref|NP_001275859.1| pectinesterase 1 precursor [Citrus sinensis]
 ref|XP_006426800.1| hypothetical protein CICLE_v10025238mg [Citrus clementina]
 gb|AAB57670.1| pectinesterase [Citrus sinensis]
 gb|ESR40040.1| hypothetical protein CICLE_v10025238mg [Citrus clementina]
Length=584

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 41/108 (38%), Positives = 59/108 (55%), Gaps = 11/108 (10%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATALPD--RRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPR  438
            +C  T YP+LC S +A A+P+  ++  +  ++I  ++N+T   V+    N  GI++ L R
Sbjct  72   SCSSTRYPDLCFSAIA-AVPEASKKVTSQKDVIEMSLNITTTAVEH---NYFGIQKLLKR  127

Query  439  --LGPLEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDL  567
              L   EK AL DCLE   ET DEL K + DL       S S+H  DL
Sbjct  128  TNLTKREKVALHDCLETIDETLDELHKAVEDLEEYPNKKSLSQHADDL  175



>sp|O04886.1|PME1_CITSI RecName: Full=Pectinesterase 1; Short=PE 1; AltName: Full=Pectin 
methylesterase; Flags: Precursor [Citrus sinensis]
 gb|AAB57667.1| pectinesterase [Citrus sinensis]
Length=584

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 41/108 (38%), Positives = 59/108 (55%), Gaps = 11/108 (10%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATALPD--RRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPR  438
            +C  T YP+LC S +A A+P+  ++  +  ++I  ++N+T   V+    N  GI++ L R
Sbjct  72   SCSSTRYPDLCFSAIA-AVPEASKKVTSQKDVIEMSLNITTTAVEH---NYFGIQKLLKR  127

Query  439  --LGPLEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDL  567
              L   EK AL DCLE   ET DEL K + DL       S S+H  DL
Sbjct  128  TNLTKREKVALHDCLETIDETLDELHKAVEDLEEYPNKKSLSQHADDL  175



>sp|P83948.1|PME3_CITSI RecName: Full=Pectinesterase 3; Short=PE 3; AltName: Full=Pectin 
methylesterase 3; Flags: Precursor [Citrus sinensis]
Length=584

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 41/108 (38%), Positives = 59/108 (55%), Gaps = 11/108 (10%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATALPD--RRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPR  438
            +C  T YP+LC S +A A+P+  ++  +  ++I  ++N+T   V+    N  GI++ L R
Sbjct  72   SCSSTRYPDLCFSAIA-AVPEASKKVTSQKDVIEMSLNITTTAVEH---NYFGIQKLLKR  127

Query  439  --LGPLEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDL  567
              L   EK AL DCLE   ET DEL K + DL       S S+H  DL
Sbjct  128  TNLTKREKVALHDCLETIDETLDELHKAVEDLEEYPNKKSLSQHADDL  175



>gb|AFW03476.1| pectin methylesterase 2 [Gossypium barbadense]
Length=521

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 57/99 (58%), Gaps = 4/99 (4%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATALPD--RRAKTIPEIIAATVNVTVDEVKASAANCSG-IRRKLP  435
            +C  TLYPELC ST+++A PD   + K   ++I  ++N+TV  V+++  +    I  +  
Sbjct  52   SCSSTLYPELCYSTISSA-PDAETKVKNPKDVIELSLNLTVTAVQSNYLSIKKLISTQRK  110

Query  436  RLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSK  552
             L   EK AL+DCLEL  ET DEL     DL+   S +K
Sbjct  111  SLTEREKAALNDCLELVDETLDELFVAEHDLSDYPSFNK  149



>ref|XP_010458855.1| PREDICTED: 21 kDa protein-like [Camelina sativa]
Length=195

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 57/96 (59%), Gaps = 5/96 (5%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATALPDRRAKTIPEIIA-ATVNVTVDEVKASAANCSGIRRKLPRL  441
            +C  T YP LC ++L+T       +T P+++A A +N+T+   KA++A    +R    RL
Sbjct  39   SCTFTTYPRLCFTSLSTQAS--LIQTSPKLMAHAALNITLASAKATSAMM--VRLSSSRL  94

Query  442  GPLEKRALDDCLELFSETRDELRKVLSDLATTASSS  549
             P E  A+ DC+E  ++T DELRK + ++   +SS+
Sbjct  95   NPREAAAMRDCVEELADTLDELRKSIGEMCRLSSSN  130



>ref|XP_002516186.1| Pectinesterase-3 precursor, putative [Ricinus communis]
 gb|EEF46188.1| Pectinesterase-3 precursor, putative [Ricinus communis]
Length=589

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 48/88 (55%), Gaps = 4/88 (5%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATALP---DRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLP  435
            +C  TLYP+LC ST+ +ALP       KT  ++I  ++NVT   V  +     G+     
Sbjct  71   SCSSTLYPDLCFSTI-SALPADATSTIKTTKDVIILSLNVTESSVYQTYLKIQGLTLARR  129

Query  436  RLGPLEKRALDDCLELFSETRDELRKVL  519
               P E  AL DCL+  SET DE+RKV+
Sbjct  130  SYTPREVTALKDCLQTLSETVDEIRKVV  157



>ref|XP_007139063.1| hypothetical protein PHAVU_009G261700g [Phaseolus vulgaris]
 gb|ESW11057.1| hypothetical protein PHAVU_009G261700g [Phaseolus vulgaris]
Length=580

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 51/152 (34%), Positives = 75/152 (49%), Gaps = 13/152 (9%)
 Frame = +1

Query  127  LLAFLSVTSFNSLFTKDGISSSTGPTHLDLNLNIHRQKLLQVAHTEACEGTLYPELCVST  306
            LL  L+ T F +L    G+SS     H   + + H   +++     AC  TLYPELC+S+
Sbjct  25   LLFALAATLFIALAVVAGVSSRKNSAHNASSTSSH--AIIK----SACSSTLYPELCLSS  78

Query  307  LATALPDR--RAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGPLEKRALDDCLE  480
            +A+  P +  +  T   +I  ++N+TV  V+ +      + RK   L   +K AL DCLE
Sbjct  79   IASE-PGKADKVSTHKNVIEQSLNITVGIVERNYFTVEKLLRK-KGLTKRQKTALHDCLE  136

Query  481  LFSETRDELRKVLSDLATTASS---SKHYVDL  567
               ET DEL K + +L    S    S H  DL
Sbjct  137  TIDETLDELHKAIDELKEYPSKKSLSHHAEDL  168



>emb|CDY51798.1| BnaC06g41940D [Brassica napus]
Length=585

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 39/103 (38%), Positives = 51/103 (50%), Gaps = 5/103 (5%)
 Frame = +1

Query  268  CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGP  447
            C  TLYPELC S  A A   ++  +  ++I A++N+T + VK +      +  K   L  
Sbjct  66   CSSTLYPELCFS--AVAATGKKLTSDKDVIEASLNLTTNAVKHNYFAVKKLITKRKGLTA  123

Query  448  LEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDL  567
             E  AL DCLE+  ET DEL   L DL       S  KH  DL
Sbjct  124  RELTALHDCLEIIDETLDELHVALEDLHQYPKGKSLRKHADDL  166



>ref|XP_010483948.1| PREDICTED: 21 kDa protein-like isoform X1 [Camelina sativa]
 ref|XP_010483950.1| PREDICTED: 21 kDa protein-like isoform X2 [Camelina sativa]
Length=195

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 57/96 (59%), Gaps = 5/96 (5%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATALPDRRAKTIPEIIA-ATVNVTVDEVKASAANCSGIRRKLPRL  441
            +C  T YP LC ++L+T       +T P+++A A +N+T+   KA++A    +R    RL
Sbjct  39   SCTFTTYPRLCFTSLSTQAS--LIQTSPKLMAHAALNITLASAKATSAMM--VRLSSSRL  94

Query  442  GPLEKRALDDCLELFSETRDELRKVLSDLATTASSS  549
             P E  A+ DC+E  ++T DELRK + ++   +SS+
Sbjct  95   KPREAAAMRDCVEELADTLDELRKSIGEMCRLSSSN  130



>gb|KDO65437.1| hypothetical protein CISIN_1g029238mg [Citrus sinensis]
Length=196

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 55/93 (59%), Gaps = 10/93 (11%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATALPDRRA---KTIPEIIA-ATVNVTVDEVKASAANCSGIRRKL  432
            +C  T YP LC  +LA     R A   +T P+++A A++NVT+ + K+++A    + +  
Sbjct  42   SCSSTTYPTLCYKSLA-----RHASLIQTSPKLLAHASLNVTLAKAKSTSAVMLKMSKS-  95

Query  433  PRLGPLEKRALDDCLELFSETRDELRKVLSDLA  531
            P + P E  A+ DCLE  S++ DELRK + ++ 
Sbjct  96   PGMKPREADAMQDCLEELSDSVDELRKSIGEMG  128



>ref|XP_010047424.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=564

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 59/109 (54%), Gaps = 4/109 (4%)
 Frame = +1

Query  208  LDLNLNIHRQKLLQVAHTEACEGTLYPELCVSTLATA--LPDRRAKTIPEIIAATVNVTV  381
            L ++ N HR+    +    +C  TLYP+LC+S L ++  L     KT  +++A  +N+T+
Sbjct  27   LAIDDNRHREARSLIK--SSCSSTLYPDLCLSQLTSSPSLTSDAMKTPKDVVALALNLTI  84

Query  382  DEVKASAANCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDL  528
              V+ +      +      L   E+ AL DCLE+  ET DE+R+ L+DL
Sbjct  85   TSVQHNYFTIKKVAATRSGLTVRERTALHDCLEMVDETLDEVRETLADL  133



>gb|ADE76337.1| unknown [Picea sitchensis]
Length=204

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/88 (33%), Positives = 52/88 (59%), Gaps = 1/88 (1%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLG  444
            +C+ TLYP++CVS+L +     +A T  +I+ A V  ++   +  +   +G++ +   + 
Sbjct  42   SCKVTLYPQVCVSSLFSYAGSLKA-TQSDIVKAAVQASLVNARNISVWATGMKTRGATMS  100

Query  445  PLEKRALDDCLELFSETRDELRKVLSDL  528
              EK AL DC+E F  T D++R+ LS+L
Sbjct  101  KREKAALVDCIENFGVTTDQIRESLSEL  128



>ref|XP_004298672.1| PREDICTED: 21 kDa protein [Fragaria vesca subsp. vesca]
Length=197

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 37/103 (36%), Positives = 60/103 (58%), Gaps = 10/103 (10%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAAT-VNVTVDEVKASAA---NCSGIRRKL  432
            +C  TLYP+LC ++L+  +   + KT P+++A T +NVT+   KA++A    CS    K+
Sbjct  40   SCSVTLYPKLCYTSLS--IYAGKIKTSPKVLAHTALNVTLRATKATSAVINRCS----KV  93

Query  433  PRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYV  561
              L P+E  A  DC+E  S+  DELRK + +L      S+ ++
Sbjct  94   HGLKPIEVAATLDCVEEISDALDELRKSIGELGHAVKGSRSFL  136



>gb|AFW03480.1| pectin methylesterase 1 [Gossypium hirsutum]
Length=582

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 51/93 (55%), Gaps = 9/93 (10%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATALPDRRAKTI---PEIIAATVNVTVDEVKASAANCSGIRRKLP  435
            AC GT YP+LC S + TA+P   AK +    ++I  ++N T   V+    N   I++ L 
Sbjct  68   ACSGTFYPDLCFSAV-TAVPAGTAKKVRSQKDVIELSLNTTTTAVEH---NYFKIKKLLA  123

Query  436  R--LGPLEKRALDDCLELFSETRDELRKVLSDL  528
            R  L   EK AL DCLE   ET DEL + + DL
Sbjct  124  RKDLTTREKTALHDCLETIDETLDELHEAVEDL  156



>ref|NP_001274969.1| pectin methyl esterase [Solanum tuberosum]
 gb|AAF23892.1|AF152172_1 pectin methyl esterase [Solanum tuberosum]
Length=576

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 31/89 (35%), Positives = 47/89 (53%), Gaps = 1/89 (1%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATALP-DRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRL  441
            AC  TL+PELC S +       ++  +  ++I  ++N+TV  V+ +      + +    L
Sbjct  65   ACSNTLHPELCYSAIVNVTDFSKKVTSQKDVIELSLNITVKAVRRNYYAVKELIKTRKGL  124

Query  442  GPLEKRALDDCLELFSETRDELRKVLSDL  528
             P EK AL DCLE   ET DEL   ++DL
Sbjct  125  TPREKVALHDCLETMDETLDELHTAVADL  153



>gb|AER38243.1| PME2 [Gossypium barbadense]
Length=521

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 56/99 (57%), Gaps = 4/99 (4%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATALPD--RRAKTIPEIIAATVNVTVDEVKASAANCSG-IRRKLP  435
            +C  TLYPELC ST+++A PD   + K    +I  ++N+TV  V+++  +    I  +  
Sbjct  52   SCSSTLYPELCYSTISSA-PDAETKVKNPKGVIELSLNLTVTAVQSNYLSIKKLISTQRK  110

Query  436  RLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSK  552
             L   EK AL+DCLEL  ET DEL     DL+   S +K
Sbjct  111  SLTEREKAALNDCLELVDETLDELFVAEHDLSDYPSFNK  149



>gb|KJB57093.1| hypothetical protein B456_009G147900 [Gossypium raimondii]
Length=582

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 51/92 (55%), Gaps = 7/92 (8%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLAT--ALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPR  438
            AC GT YP+LC S + T  A   ++ ++  ++I  ++N+T   V+    N   I++ L R
Sbjct  68   ACSGTFYPDLCFSAVTTVPAGTAKKVRSQKDVIELSLNITTTAVEH---NYFKIKKLLAR  124

Query  439  --LGPLEKRALDDCLELFSETRDELRKVLSDL  528
              L   EK AL DCLE   ET DEL + + DL
Sbjct  125  KDLTTREKTALHDCLETIDETLDELHEAVEDL  156



>ref|XP_010444081.1| PREDICTED: 21 kDa protein-like [Camelina sativa]
Length=195

 Score = 53.9 bits (128),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 57/96 (59%), Gaps = 5/96 (5%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATALPDRRAKTIPEIIA-ATVNVTVDEVKASAANCSGIRRKLPRL  441
            +C  T YP LC ++L+T       +T P+++A A +N+T+   KA++A    +R    RL
Sbjct  39   SCTFTTYPRLCFTSLSTQAS--LIQTSPKLMAHAALNITLASAKATSAMM--VRLSSSRL  94

Query  442  GPLEKRALDDCLELFSETRDELRKVLSDLATTASSS  549
             P E  A+ DC+E  ++T DELRK + ++   ++S+
Sbjct  95   NPREAAAMRDCVEELADTLDELRKSIGEMCRLSTSN  130



>ref|XP_011072691.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=551

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 50/93 (54%), Gaps = 8/93 (9%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATALPD-RRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKL---  432
            +C  TLYPELC S +A +L D ++  +  ++I  ++NVT+  V+    N   I + L   
Sbjct  49   SCSSTLYPELCYSAIADSLSDNKKVTSKKDVIILSLNVTISSVQ---RNYFAIEKLLYAG  105

Query  433  -PRLGPLEKRALDDCLELFSETRDELRKVLSDL  528
               L   EK AL DCLE   ET DEL   + DL
Sbjct  106  KSNLTEREKTALHDCLETIDETLDELHTAVKDL  138



>gb|AFB77929.1| pectin methylesterase [Gossypium hirsutum]
Length=582

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 51/92 (55%), Gaps = 7/92 (8%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLAT--ALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPR  438
            AC GT YP+LC S + T  A   ++ ++  ++I  ++N+T   V+    N   I++ L R
Sbjct  68   ACSGTFYPDLCFSAVTTVPAGTAKKVRSQKDVIELSLNITTTAVEH---NYFKIKKLLAR  124

Query  439  --LGPLEKRALDDCLELFSETRDELRKVLSDL  528
              L   EK AL DCLE   ET DEL + + DL
Sbjct  125  KDLTTREKTALHDCLETIDETLDELHEAVEDL  156



>gb|AFW03475.1| pectin methylesterase 1 [Gossypium barbadense]
Length=582

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 51/92 (55%), Gaps = 7/92 (8%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLAT--ALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPR  438
            AC GT YP+LC S + T  A   ++ ++  ++I  ++N+T   V+    N   I++ L R
Sbjct  68   ACSGTFYPDLCFSAVTTVPAGTAKKVRSQKDVIELSLNITTTAVEH---NYFKIKKLLAR  124

Query  439  --LGPLEKRALDDCLELFSETRDELRKVLSDL  528
              L   EK AL DCLE   ET DEL + + DL
Sbjct  125  KDLTTREKTALHDCLETIDETLDELHEAVEDL  156



>ref|XP_002324773.2| hypothetical protein POPTR_0018s05360g [Populus trichocarpa]
 gb|EEF03338.2| hypothetical protein POPTR_0018s05360g [Populus trichocarpa]
Length=359

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 52/161 (32%), Positives = 79/161 (49%), Gaps = 26/161 (16%)
 Frame = +1

Query  67   HN-LKQKATLFFTISGCSAIVLL-AFLSVTSFNSLFTKDGISSSTGPTHLDLNLNIHRQK  240
            HN LK K  LF ++   S+I+L+ A +S+ +        G++SS   T  +   N H   
Sbjct  7    HNTLKNKKRLFLSL--FSSILLVTAIVSIVA--------GVTSSKNSTESN---NDH---  50

Query  241  LLQVAHT---EACEGTLYPELCVSTLATALPD--RRAKTIPEIIAATVNVTVDEVKASAA  405
              QVAHT    +C  TLYP LC S L+ A+PD   + K+  ++I  ++N T+   + S  
Sbjct  51   --QVAHTILKSSCSSTLYPHLCFSALS-AVPDATSKIKSKKDVIDLSLNRTMSATRHSYF  107

Query  406  NCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDL  528
                +          E  AL DCL + +ET D+L K   +L
Sbjct  108  KIQKLTSTRRSFTERENTALHDCLVMLNETLDQLSKAYQEL  148



>ref|XP_006369078.1| hypothetical protein POPTR_0001s162502g, partial [Populus trichocarpa]
 gb|ERP65647.1| hypothetical protein POPTR_0001s162502g, partial [Populus trichocarpa]
Length=349

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 57/108 (53%), Gaps = 7/108 (6%)
 Frame = +1

Query  220  LNIHRQKLLQVAHT---EACEGTLYPELCVSTLATALPDRRAK--TIPEIIAATVNVTVD  384
            +N H+    + AH     AC  TLYPELC S +AT +P   +   ++ ++I  ++N+T  
Sbjct  48   VNSHKNGKNEGAHAILKSACSSTLYPELCYSAIAT-VPGVTSNLASLKDVIELSINLTTK  106

Query  385  EVKASAANCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDL  528
             V+ +      +  K  +L   EK AL DCLE   ET DEL + L D+
Sbjct  107  TVQQNYFTVEKLIAK-TKLTKREKTALHDCLETIDETLDELHEALVDI  153



>ref|XP_006490093.1| PREDICTED: 21 kDa protein-like [Citrus sinensis]
Length=196

 Score = 53.5 bits (127),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 54/93 (58%), Gaps = 10/93 (11%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATALPDRRA---KTIPEIIA-ATVNVTVDEVKASAANCSGIRRKL  432
            +C  T YP LC  +LA     R A   +T P+++A A++NVT+   K+++A    I + L
Sbjct  42   SCSSTTYPTLCYKSLA-----RHASLIQTSPKLLAHASLNVTLAMAKSTSAVMLKISKSL  96

Query  433  PRLGPLEKRALDDCLELFSETRDELRKVLSDLA  531
              + P E  A+ DCLE  S++ DELRK + ++ 
Sbjct  97   G-MKPREAEAMQDCLEELSDSVDELRKSIGEMG  128



>ref|XP_006281048.1| hypothetical protein CARUB_v10027064mg [Capsella rubella]
 gb|EOA13946.1| hypothetical protein CARUB_v10027064mg [Capsella rubella]
Length=228

 Score = 53.9 bits (128),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 56/96 (58%), Gaps = 5/96 (5%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATALPDRRAKTIPEIIA-ATVNVTVDEVKASAANCSGIRRKLPRL  441
            +C  T YP LC ++LAT       +T P+++A A +N+T+   KA++A    +R    RL
Sbjct  72   SCTFTTYPRLCFTSLATQAS--LIQTSPKLMAHAALNITLASAKATSAMM--VRLSNTRL  127

Query  442  GPLEKRALDDCLELFSETRDELRKVLSDLATTASSS  549
             P E  A+ DC+E   +T DELRK + ++   ++S+
Sbjct  128  KPREVAAMRDCVEELGDTLDELRKSIGEMCRLSNSN  163



>gb|KJB19687.1| hypothetical protein B456_003G114500 [Gossypium raimondii]
 gb|KJB19688.1| hypothetical protein B456_003G114500 [Gossypium raimondii]
Length=201

 Score = 53.5 bits (127),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 53/93 (57%), Gaps = 10/93 (11%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATALPDRRAKTIPEIIA-ATVNVTVDEVKASAANCSGIRRKLPR-  438
            +C  T YP+LC  +L T       +T P++IA A +NVT+   K+++A    +  KL + 
Sbjct  44   SCSSTTYPKLCYESLLT--QASMIQTSPQLIAHAALNVTLSTAKSTSA----LMVKLAKS  97

Query  439  --LGPLEKRALDDCLELFSETRDELRKVLSDLA  531
              L P E  A+ DC+E   +T DELRK +S++ 
Sbjct  98   QGLKPTEVGAMQDCVEELEDTIDELRKSISEMG  130



>gb|AFW03481.1| pectin methylesterase 2, partial [Gossypium hirsutum]
Length=521

 Score = 54.7 bits (130),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 56/99 (57%), Gaps = 4/99 (4%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATALPD--RRAKTIPEIIAATVNVTVDEVKASAANCSG-IRRKLP  435
            +C  TLYPELC ST+++A PD   + K   ++   ++N+TV  V+++  +    I  +  
Sbjct  52   SCSSTLYPELCYSTISSA-PDAETKVKNPKDVTELSLNLTVTAVQSNYLSIKKLISTQRK  110

Query  436  RLGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSK  552
             L   EK AL+DCLEL  ET DEL     DL+   S +K
Sbjct  111  SLTEREKAALNDCLELVDETLDELFVAEHDLSDYPSFNK  149



>ref|NP_001233857.1| pectinesterase/pectinesterase inhibitor U1 precursor [Solanum 
lycopersicum]
 sp|Q43143.1|PMEU1_SOLLC RecName: Full=Pectinesterase/pectinesterase inhibitor U1; Includes: 
RecName: Full=Pectinesterase inhibitor U1; AltName: Full=Pectin 
methylesterase inhibitor U1; Includes: RecName: Full=Pectinesterase 
U1; Short=PE U1; AltName: Full=Pectin methylesterase 
U1; Flags: Precursor [Solanum lycopersicum]
 gb|AAD09283.1| pectin methylesterase [Solanum lycopersicum]
 gb|AAL02367.1| pectin methylesterase [Solanum lycopersicum]
Length=583

 Score = 55.1 bits (131),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 31/89 (35%), Positives = 46/89 (52%), Gaps = 1/89 (1%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATALP-DRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRL  441
            AC  TL+PELC S +       ++  +  ++I  ++N+TV  V+ +      + +    L
Sbjct  69   ACSNTLHPELCYSAIVNVSDFSKKVTSQKDVIELSLNITVKAVRRNYYAVKELIKTRKGL  128

Query  442  GPLEKRALDDCLELFSETRDELRKVLSDL  528
             P EK AL DCLE   ET DEL   + DL
Sbjct  129  TPREKVALHDCLETMDETLDELHTAVEDL  157



>ref|XP_006421707.1| hypothetical protein CICLE_v10005946mg [Citrus clementina]
 gb|ESR34947.1| hypothetical protein CICLE_v10005946mg [Citrus clementina]
Length=196

 Score = 53.1 bits (126),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 54/93 (58%), Gaps = 10/93 (11%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATALPDRRA---KTIPEIIA-ATVNVTVDEVKASAANCSGIRRKL  432
            +C  T YP LC  +LA     R A   +T P+++A A++NVT+   K+++A    + +  
Sbjct  42   SCSSTTYPTLCYKSLA-----RHASLIQTSPKLLAHASLNVTLAMAKSTSAVMLKMSKS-  95

Query  433  PRLGPLEKRALDDCLELFSETRDELRKVLSDLA  531
            P + P E  A+ DCLE  S++ DELRK + ++ 
Sbjct  96   PGMKPREADAMQDCLEELSDSVDELRKSIGEMG  128



>ref|XP_004144447.1| PREDICTED: pectinesterase 3-like [Cucumis sativus]
Length=556

 Score = 54.7 bits (130),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 48/87 (55%), Gaps = 4/87 (5%)
 Frame = +1

Query  268  CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGP  447
            C  TLYPELC +T++TA+      +  E I A+VN+T+  VK +      + + +  L  
Sbjct  46   CAMTLYPELCETTISTAV----GSSSKEAIEASVNITISAVKDNYKRVQKLLKTVKNLTK  101

Query  448  LEKRALDDCLELFSETRDELRKVLSDL  528
             +K A  DCLE   ET  EL +V+ D+
Sbjct  102  RQKIAFHDCLETGEETLRELYEVVEDV  128



>ref|XP_004168887.1| PREDICTED: pectinesterase 3-like [Cucumis sativus]
 gb|KGN58477.1| hypothetical protein Csa_3G646640 [Cucumis sativus]
Length=561

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 48/87 (55%), Gaps = 4/87 (5%)
 Frame = +1

Query  268  CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGP  447
            C  TLYPELC +T++TA+      +  E I A+VN+T+  VK +      + + +  L  
Sbjct  46   CAMTLYPELCETTISTAV----GSSSKEAIEASVNITISAVKDNYKRVQKLLKTVKNLTK  101

Query  448  LEKRALDDCLELFSETRDELRKVLSDL  528
             +K A  DCLE   ET  EL +V+ D+
Sbjct  102  RQKIAFHDCLETGEETLRELYEVVEDV  128



>emb|CDY08206.1| BnaA05g14130D [Brassica napus]
Length=585

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 46/87 (53%), Gaps = 2/87 (2%)
 Frame = +1

Query  268  CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGP  447
            C  TLYPELC S  A A   ++  +  ++I A++N+T + VK +      +  K   L  
Sbjct  66   CSSTLYPELCFS--AVAATGKKLTSDKDVIEASLNLTTNAVKHNYFAVKKLITKRKGLTA  123

Query  448  LEKRALDDCLELFSETRDELRKVLSDL  528
             E  AL DCLE+  ET DEL   L DL
Sbjct  124  REVTALHDCLEIIDETLDELHVALEDL  150



>ref|XP_002277473.1| PREDICTED: pectinesterase [Vitis vinifera]
Length=582

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 46/144 (32%), Positives = 69/144 (48%), Gaps = 21/144 (15%)
 Frame = +1

Query  121  IVLLAFLSVTS---FNSLFTKDG----ISSSTGPTHLDLNLNIHRQKLLQVAHTEACEGT  279
            IVL  FL++ +   F S   ++G    + SST P  L          L++     AC  T
Sbjct  25   IVLGVFLTLPTLILFASFLNEEGDQELVRSSTQPQPL--------HPLIK----NACTNT  72

Query  280  LYPELCVSTLATA-LPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGPLEK  456
            LYP LC +TL++A    +   T+  I+   VN TV  V  S ++   +      L   EK
Sbjct  73   LYPSLCFTTLSSAPATSKNTTTLHHILEIAVNATVSSVMDSGSDIKAL-FTYQDLNSQEK  131

Query  457  RALDDCLELFSETRDELRKVLSDL  528
             AL+DC+E+  +T  EL + + DL
Sbjct  132  NALNDCMEMTDQTLYELGQAIDDL  155



>ref|XP_010261668.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=576

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 38/98 (39%), Positives = 49/98 (50%), Gaps = 4/98 (4%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATALPDR--RAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPR  438
            +C  TLYP+LC S +AT +P       T  +II  ++N+T   V+ +      I      
Sbjct  66   SCRSTLYPDLCYSAIAT-VPGAMDNLSTQKDIIEMSLNITTTAVEHNYFTIEKIIGS-KN  123

Query  439  LGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSK  552
            L   EK AL DCLE+  ET DEL K   DL    SS K
Sbjct  124  LTKREKTALHDCLEMVDETLDELHKTADDLKDYPSSKK  161



>ref|NP_001060620.1| Os07g0675100 [Oryza sativa Japonica Group]
 dbj|BAC83543.1| putative pectinesterase [Oryza sativa Japonica Group]
 dbj|BAD31979.1| putative pectinesterase [Oryza sativa Japonica Group]
 dbj|BAF22534.1| Os07g0675100 [Oryza sativa Japonica Group]
 dbj|BAG94978.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE67808.1| hypothetical protein OsJ_25560 [Oryza sativa Japonica Group]
Length=579

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 33/95 (35%), Positives = 58/95 (61%), Gaps = 1/95 (1%)
 Frame = +1

Query  268  CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGP  447
            C GTL+ ++CVSTL+T +P+   K + ++I+  V      V+AS++NC+   ++  +L  
Sbjct  72   CAGTLHRDVCVSTLST-IPNLARKPLRDVISEVVGRAASAVRASSSNCTSYLQRPRQLRT  130

Query  448  LEKRALDDCLELFSETRDELRKVLSDLATTASSSK  552
             ++ AL DCLELF  T D L    ++L+   S+++
Sbjct  131  RDRLALSDCLELFGHTLDLLGTAAAELSAGNSTAE  165



>ref|XP_002864788.1| invertase/pectin methylesterase inhibitor family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH41047.1| invertase/pectin methylesterase inhibitor family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=196

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 55/96 (57%), Gaps = 5/96 (5%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATALPDRRAKTIPEIIA-ATVNVTVDEVKASAANCSGIRRKLPRL  441
            +C  T YP LC S+L+T       +T P+I+A A +N+T+   KA++A    +R    RL
Sbjct  40   SCTFTTYPRLCFSSLSTHAS--LIQTSPKIMAHAALNITLASAKATSAMM--VRLSNSRL  95

Query  442  GPLEKRALDDCLELFSETRDELRKVLSDLATTASSS  549
             P E  A+ DC+E   +T +ELRK + ++   + S+
Sbjct  96   KPREISAMRDCVEELGDTLEELRKSIGEMCRLSGSN  131



>ref|XP_011031815.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=580

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 62/126 (49%), Gaps = 14/126 (11%)
 Frame = +1

Query  220  LNIHRQKLLQVAHT---EACEGTLYPELCVSTLATALPDRRAK--TIPEIIAATVNVTVD  384
            +N HR    +  H     +C  TLYPELC S +AT +P   +   +  ++I  ++N+T  
Sbjct  48   VNSHRNSKNEGTHAILKSSCSSTLYPELCYSAVAT-VPGATSNLASQKDVIELSINLTT-  105

Query  385  EVKASAANCSGIRRKLP--RLGPLEKRALDDCLELFSETRDELRKVLSDL---ATTASSS  549
              KA   N   + + +   +L   EK AL DCLE+  ET DEL + L DL       S  
Sbjct  106  --KAVQHNFFTVEKLIATKKLSKREKTALHDCLEIIDETLDELHEALVDLNEYPNNKSLK  163

Query  550  KHYVDL  567
            KH  DL
Sbjct  164  KHADDL  169



>ref|XP_010420924.1| PREDICTED: 21 kDa protein-like [Camelina sativa]
Length=206

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/101 (31%), Positives = 53/101 (52%), Gaps = 4/101 (4%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLG  444
            +CE   YP LCV TL++  P        ++  A V +++   +++A   + +R  + +  
Sbjct  38   SCEHASYPSLCVRTLSS-YPGPTITNSRDLAQAAVKISLSHAQSAAKKLAAVRDSVGKKK  96

Query  445  PLEKRALDDCLELFSETRDELRK---VLSDLATTASSSKHY  558
             LEK AL DC+E+  ++ DEL +   VL  L  T  S+K +
Sbjct  97   KLEKGALVDCVEMIGDSVDELSRTLGVLKHLRVTGGSAKEF  137



>ref|XP_007038418.1| DC1.2-like, putative [Theobroma cacao]
 gb|EOY22919.1| DC1.2-like, putative [Theobroma cacao]
Length=201

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 55/96 (57%), Gaps = 4/96 (4%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATALPDRRAKTIPEIIA-ATVNVTVDEVKASAANCSGIRRKLPRL  441
            +C  T YP+LC  TL+T       +T P+++A A +NVT+   ++++A    + +    L
Sbjct  44   SCSSTTYPKLCFETLSTHAS--LIQTSPQLLAHAALNVTLSTTESTSAMMVTLSKS-HGL  100

Query  442  GPLEKRALDDCLELFSETRDELRKVLSDLATTASSS  549
             P E  A+ DC+E  S++ DELRK +S++     S+
Sbjct  101  KPREAEAMQDCVEELSDSIDELRKSISEMGQVKGSN  136



>ref|XP_008368265.1| PREDICTED: pectinesterase 3-like [Malus domestica]
Length=375

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 50/91 (55%), Gaps = 4/91 (4%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATALPD--RRAKTIPEIIAATVNVTVDEVKASAANCSGI-RRKLP  435
            +C  TLYPELC STLA   P+  ++  +  ++I  ++N+T   V+ +      + + +  
Sbjct  70   SCSSTLYPELCFSTLALH-PEAAKKVSSQKDVIELSLNITTKAVQHNFFTVEKLLKSRKN  128

Query  436  RLGPLEKRALDDCLELFSETRDELRKVLSDL  528
            +L   EK AL DCLE   ET DEL   + DL
Sbjct  129  KLTKREKGALHDCLETIDETLDELHDAVEDL  159



>emb|CBI27756.3| unnamed protein product [Vitis vinifera]
Length=537

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 46/144 (32%), Positives = 69/144 (48%), Gaps = 21/144 (15%)
 Frame = +1

Query  121  IVLLAFLSVTS---FNSLFTKDG----ISSSTGPTHLDLNLNIHRQKLLQVAHTEACEGT  279
            IVL  FL++ +   F S   ++G    + SST P  L          L++     AC  T
Sbjct  22   IVLGVFLTLPTLILFASFLNEEGDQELVRSSTQPQPL--------HPLIK----NACTNT  69

Query  280  LYPELCVSTLATA-LPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGPLEK  456
            LYP LC +TL++A    +   T+  I+   VN TV  V  S ++   +      L   EK
Sbjct  70   LYPSLCFTTLSSAPATSKNTTTLHHILEIAVNATVSSVMDSGSDIKAL-FTYQDLNSQEK  128

Query  457  RALDDCLELFSETRDELRKVLSDL  528
             AL+DC+E+  +T  EL + + DL
Sbjct  129  NALNDCMEMTDQTLYELGQAIDDL  152



>ref|XP_010029512.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=587

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 52/164 (32%), Positives = 75/164 (46%), Gaps = 20/164 (12%)
 Frame = +1

Query  76   KQKATLFFTISGCSAIVLLAFLSVTSFNSLFTKDGISSSTGPTHLDLNLNIHRQKLLQVA  255
            K+   L  +ISGC    LL   +V          GI +     H D NL++    L    
Sbjct  16   KRNRKLLLSISGC----LLLVAAVI---------GIVAGVHSGHHDRNLDV--STLTPPT  60

Query  256  HT---EACEGTLYPELCVSTLATALPDRRAK-TIPEIIAATVNVTVDEVKASAANCSGIR  423
            H     +C  T YP+LC S +A          T  ++I A++N+T   V+ +      + 
Sbjct  61   HAILKSSCSSTRYPDLCYSAVAAFPGAAAGLATQKDVIEASLNITTVAVEHNFFAVEKLL  120

Query  424  RKLPR-LGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSK  552
             K  + L   EKRAL DCLE   ET DELR+   DL++  S++K
Sbjct  121  SKRSKSLTKREKRALHDCLETIDETLDELREAERDLSSYPSAAK  164



>ref|XP_006388348.1| hypothetical protein POPTR_0214s00200g [Populus trichocarpa]
 gb|ERP47262.1| hypothetical protein POPTR_0214s00200g [Populus trichocarpa]
Length=579

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 56/108 (52%), Gaps = 7/108 (6%)
 Frame = +1

Query  220  LNIHRQKLLQVAHT---EACEGTLYPELCVSTLATALPDRRAK--TIPEIIAATVNVTVD  384
            +N H+    + AH     AC  TLYPELC S +AT +P   +   ++ ++I  ++N+T  
Sbjct  48   VNSHKNGKNEGAHAILKSACSSTLYPELCYSAIAT-VPGVTSNLASLKDVIELSINLTTK  106

Query  385  EVKASAANCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDL  528
             V+ +      +  K  +L   EK AL DCLE   ET DEL +   D+
Sbjct  107  TVQQNYFTVEKLIAK-TKLTKREKTALHDCLETIDETLDELHEAQVDI  153



>emb|CAC01624.1| putative pectin methylesterase [Populus tremula x Populus tremuloides]
Length=579

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 37/109 (34%), Positives = 56/109 (51%), Gaps = 7/109 (6%)
 Frame = +1

Query  220  LNIHRQKLLQVAHT---EACEGTLYPELCVSTLATALPDRRAK--TIPEIIAATVNVTVD  384
            +N H+    + AH     AC  TLYPELC S +AT +P       ++ ++I  ++N+T  
Sbjct  48   VNSHKNGENEGAHAVLKSACSSTLYPELCYSAIAT-VPGVTGNLASLKDVIELSINLTTK  106

Query  385  EVKASAANCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLA  531
             V+ +      +  K  +L   EK AL DCLE   ET DEL +   D++
Sbjct  107  TVQQNYFTVEKLIAKT-KLTKREKTALHDCLETIDETLDELHEAQVDIS  154



>ref|XP_006490094.1| PREDICTED: 21 kDa protein-like [Citrus sinensis]
 gb|KDO65438.1| hypothetical protein CISIN_1g027094mg [Citrus sinensis]
Length=228

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 54/93 (58%), Gaps = 10/93 (11%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATALPDRRA---KTIPEIIA-ATVNVTVDEVKASAANCSGIRRKL  432
            +C  T YP LC  +LA     R A   +T P+++A A++NVT+   K+++A    +  K 
Sbjct  74   SCSSTTYPTLCYKSLA-----RHASLIQTSPKLLAHASLNVTLAMAKSTSAVMLKMS-KS  127

Query  433  PRLGPLEKRALDDCLELFSETRDELRKVLSDLA  531
            P + P E  A+ DCLE  S++ DELRK + ++ 
Sbjct  128  PGMKPREVDAMQDCLEELSDSVDELRKSIGEMG  160



>ref|XP_006421706.1| hypothetical protein CICLE_v10005926mg [Citrus clementina]
 gb|ESR34946.1| hypothetical protein CICLE_v10005926mg [Citrus clementina]
Length=200

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 54/93 (58%), Gaps = 10/93 (11%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATALPDRRA---KTIPEIIA-ATVNVTVDEVKASAANCSGIRRKL  432
            +C  T YP LC  +LA     R A   +T P+++A A++NVT+   K+++A    +  K 
Sbjct  46   SCSSTTYPTLCYKSLA-----RHASLIQTSPKLLAHASLNVTLAMAKSTSAVMLKMS-KS  99

Query  433  PRLGPLEKRALDDCLELFSETRDELRKVLSDLA  531
            P + P E  A+ DCLE  S++ DELRK + ++ 
Sbjct  100  PGMKPREVDAMQDCLEELSDSVDELRKSIGEMG  132



>gb|ABK22757.1| unknown [Picea sitchensis]
Length=199

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 56/106 (53%), Gaps = 10/106 (9%)
 Frame = +1

Query  238  KLLQVAHTEA---------CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEV  390
            K+L   H++A         C  TLYP++CVS+L++     + K   +++ A V V++   
Sbjct  24   KVLNPVHSDAQMAEFIRTSCNVTLYPQVCVSSLSSYAGPLKPKQ-SDLVNAAVQVSLVNT  82

Query  391  KASAANCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDL  528
               +   +G++ +   +   EK AL DC+E F  T D++ + L++L
Sbjct  83   HNVSVWAAGLKTRRATMSKREKAALKDCMENFGTTMDQIHQSLAEL  128



>gb|ACN40648.1| unknown [Picea sitchensis]
Length=199

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 56/106 (53%), Gaps = 10/106 (9%)
 Frame = +1

Query  238  KLLQVAHTEA---------CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEV  390
            K+L   H++A         C  TLYP++CVS+L++     + K   +++ A V V++   
Sbjct  24   KVLNPVHSDAQMAEFIRTSCNVTLYPQVCVSSLSSYAGPLKPKQ-SDLVNAAVQVSLVNT  82

Query  391  KASAANCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDL  528
               +   +G++ +   +   EK AL DC+E F  T D++ + L++L
Sbjct  83   HNVSVWAAGLKTRRATMSKREKAALKDCMENFGTTMDQIHQSLAEL  128



>gb|AAC05147.1| 21 kD protein precursor [Pinus radiata]
Length=211

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 54/88 (61%), Gaps = 1/88 (1%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLG  444
            +C+ + YP+LCVS+L+      +  T+ +++ A +NV++   +  +   +G++ +   + 
Sbjct  41   SCQVSRYPQLCVSSLSPYAGSLK-PTLCDLVKAAMNVSLVNARTVSVWAAGLKGRSAEMS  99

Query  445  PLEKRALDDCLELFSETRDELRKVLSDL  528
              E+ AL+DC++ F +T DE++K L +L
Sbjct  100  ERERAALNDCIQNFDDTVDEIQKSLKEL  127



>ref|XP_010939846.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=591

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 55/105 (52%), Gaps = 4/105 (4%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATALPDRRAKTIP-EIIAATVNVTVDEVKASAANCSGIRRKLPRL  441
            +C  T YP+LC S +A      +  + P ++I A++N+T+  ++ S  +   +    P L
Sbjct  65   SCRSTRYPDLCYSAVAATPALIQTISKPKDVIHASINLTITAIQRSFRHVERLSASYPNL  124

Query  442  GPLEKRALDDCLELFSETRDELRKVLSDLATTASSS---KHYVDL  567
               E+ AL DCLE+F E+ DEL    +DL    +     +H +DL
Sbjct  125  TTRERTALHDCLEMFDESLDELNLTDADLRAYPAGKPLRRHALDL  169



>ref|XP_004245727.1| PREDICTED: 21 kDa protein-like [Solanum lycopersicum]
Length=206

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 56/95 (59%), Gaps = 2/95 (2%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLG  444
            +C+ TLYP LCV  L +A  +   ++  ++  A ++V++ + K++    S + R +  L 
Sbjct  42   SCKATLYPVLCVQCL-SAFANTVKQSEKQLAHAALSVSLSKAKSTIIFVSKLNR-MRGLK  99

Query  445  PLEKRALDDCLELFSETRDELRKVLSDLATTASSS  549
            P+EK+A+ DC++  S++ D++ K + +L  T   S
Sbjct  100  PIEKQAVKDCMDTMSDSVDQINKSIPELGHTGQFS  134



>ref|XP_002322405.2| ripening-related family protein [Populus trichocarpa]
 gb|EEF06532.2| ripening-related family protein [Populus trichocarpa]
Length=197

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 55/90 (61%), Gaps = 4/90 (4%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATALPDRRAKTIPEIIA-ATVNVTVDEVKASAANCSGIRRKLPRL  441
            +C  T+YP+LC S+L  ++     +T PE++A A +NVT+   K+++A  S + +    L
Sbjct  40   SCSTTIYPKLCYSSL--SIHSSTIQTSPELLANAALNVTLSSAKSTSAKMSTLSQS-HGL  96

Query  442  GPLEKRALDDCLELFSETRDELRKVLSDLA  531
             P E  A++DC+E  ++   EL+K + +++
Sbjct  97   KPREVSAMEDCVEELTDAVYELKKSIDEMS  126



>ref|XP_011048630.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=579

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 56/108 (52%), Gaps = 7/108 (6%)
 Frame = +1

Query  220  LNIHRQKLLQVAHT---EACEGTLYPELCVSTLATALPDRRAK--TIPEIIAATVNVTVD  384
            +N H+    + AH     AC  TLYPELC S +AT +P   +   ++ ++I  ++N+T  
Sbjct  48   VNSHKNGKNEGAHAILKSACSSTLYPELCYSAIAT-VPGVTSNLASLRDVIELSINLTTK  106

Query  385  EVKASAANCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDL  528
             V+ +      +  K  +L   EK AL DCLE   ET DEL +   D+
Sbjct  107  TVQQNFFTVEKLIAK-TKLTKREKTALHDCLETIDETLDELHEAQVDI  153



>gb|ABK22631.1| unknown [Picea sitchensis]
 gb|ACN40721.1| unknown [Picea sitchensis]
Length=204

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/88 (30%), Positives = 52/88 (59%), Gaps = 1/88 (1%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLG  444
            +C  TLYP+LCVS+L++     +A T   ++   + V++   +  +   +G++ +   + 
Sbjct  42   SCNVTLYPQLCVSSLSSYAGSLKA-TQSNLVNVALQVSLVTARNVSVWAAGMKSRRALMS  100

Query  445  PLEKRALDDCLELFSETRDELRKVLSDL  528
              E+ AL DC+E F +T D++R+ L++L
Sbjct  101  RRERAALGDCIEDFGDTADQIRQSLAEL  128



>gb|KFK35693.1| hypothetical protein AALP_AA4G024900 [Arabis alpina]
Length=588

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 50/90 (56%), Gaps = 8/90 (9%)
 Frame = +1

Query  268  CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGP  447
            C  TLYPELC S ++T    ++  +  ++I A++N+T + V     N   ++++L +   
Sbjct  66   CSSTLYPELCFSAVSTT--GKKLTSQKDVIEASLNLTRNAV---TNNYLDVKKQLAKRKG  120

Query  448  LEKR---ALDDCLELFSETRDELRKVLSDL  528
            L  R   AL DCLE   ET DEL K + DL
Sbjct  121  LTVREVTALHDCLETMDETLDELYKAVKDL  150



>gb|ABK24883.1| unknown [Picea sitchensis]
Length=571

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 36/116 (31%), Positives = 61/116 (53%), Gaps = 4/116 (3%)
 Frame = +1

Query  202  THLDLN---LNIHRQKLLQVAHTEA-CEGTLYPELCVSTLATALPDRRAKTIPEIIAATV  369
            TH ++N   + ++R++L   A  E+ C  TLYP++CVS+L      R+A +  E+    V
Sbjct  43   THSNVNEHGVVMNRRELEGTAVFESVCSVTLYPDVCVSSLLAHPESRKAASSKELATIVV  102

Query  370  NVTVDEVKASAANCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATT  537
             VT+ E+K  +A+      +        + A+DDCLELF  +  +L   L  L ++
Sbjct  103  KVTLYELKNLSASLGSEMSRQRITDQRSQSAVDDCLELFGYSLRQLNDSLGSLQSS  158



>ref|XP_003625921.1| Pectinesterase/pectinesterase inhibitor [Medicago truncatula]
 ref|XP_003628462.1| Pectinesterase/pectinesterase inhibitor [Medicago truncatula]
 gb|AES82139.1| plant invertase/pectin methylesterase inhibitor [Medicago truncatula]
Length=197

 Score = 51.2 bits (121),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 45/92 (49%), Gaps = 8/92 (9%)
 Frame = +1

Query  262  EACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRL  441
            EAC  T Y  LC+ TLA    +   +T  +   A V+VT+ EVK    N      KL + 
Sbjct  36   EACSVTRYQNLCIHTLA-QFSNTAGRTPSKWARAGVSVTISEVK----NVQAYLTKLKKN  90

Query  442  GPLEKR---ALDDCLELFSETRDELRKVLSDL  528
            G ++ R   AL DC+E F    DEL K L  L
Sbjct  91   GKMKGRNRVALSDCIETFGYAVDELHKSLGVL  122



>ref|XP_002304257.2| pectinesterase family protein [Populus trichocarpa]
 gb|EEE79236.2| pectinesterase family protein [Populus trichocarpa]
Length=584

 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 62/126 (49%), Gaps = 14/126 (11%)
 Frame = +1

Query  220  LNIHRQKLLQVAHT---EACEGTLYPELCVSTLATALPDRRAK--TIPEIIAATVNVTVD  384
            +N H+    +  H     +C  TLYPELC S +AT +P   +   +  ++I  ++N+T  
Sbjct  53   VNSHKSSKNEGTHAILKSSCSSTLYPELCYSAVAT-VPGATSNLASQKDVIELSINLTT-  110

Query  385  EVKASAANCSGIRRKL--PRLGPLEKRALDDCLELFSETRDELRKVLSDL---ATTASSS  549
              KA   N   + + +   +L   EK AL DCLE+  ET DEL + L DL       S  
Sbjct  111  --KAVQHNFFTVEKLIATKKLTKREKTALHDCLEIIDETLDELHEALVDLNDYPNNKSLK  168

Query  550  KHYVDL  567
            KH  DL
Sbjct  169  KHADDL  174



>ref|XP_002265171.1| PREDICTED: pectinesterase [Vitis vinifera]
Length=611

 Score = 52.4 bits (124),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 32/89 (36%), Positives = 46/89 (52%), Gaps = 2/89 (2%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATAL-PDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRL  441
            AC  T YP+LC S +AT     ++  +  ++IA ++N+TV  V+ +      +      L
Sbjct  100  ACSSTRYPDLCYSAIATVPGASKKVTSQKDVIAVSLNITVTAVEHNYFTIEKLL-DFKNL  158

Query  442  GPLEKRALDDCLELFSETRDELRKVLSDL  528
               EK AL DCLE   ET DEL   + DL
Sbjct  159  TKREKAALHDCLETIDETLDELHVAMDDL  187



>gb|KFK27963.1| hypothetical protein AALP_AA8G454300 [Arabis alpina]
Length=199

 Score = 51.2 bits (121),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 56/96 (58%), Gaps = 4/96 (4%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATALPDRRAKTIPEIIA-ATVNVTVDEVKASAANCSGIRRKLPRL  441
            AC  T YP LC+++L+T       +T P+++A A +N+T+   KA++A    +   + +L
Sbjct  42   ACTYTTYPRLCIASLST--HATLIQTSPKLMAHAALNITLASAKATSAMMVRLSSNV-QL  98

Query  442  GPLEKRALDDCLELFSETRDELRKVLSDLATTASSS  549
             P E  A+ DC+E   +T +ELRK + ++    SS+
Sbjct  99   KPREVSAMRDCVEELGDTVEELRKSIGEMGQLNSSN  134



>ref|XP_008340373.1| PREDICTED: pectinesterase 3-like [Malus domestica]
Length=573

 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 49/91 (54%), Gaps = 4/91 (4%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATALPD--RRAKTIPEIIAATVNVTVDEVKASAANCSGI-RRKLP  435
            +C  TLYPELC STLA   P+  ++  +  + I  ++N+T   V+ +      + + +  
Sbjct  70   SCSSTLYPELCFSTLALH-PEAAKKVSSQKDXIELSLNITTKAVQHNFFTVEKLLKSRKN  128

Query  436  RLGPLEKRALDDCLELFSETRDELRKVLSDL  528
            +L   EK AL DCLE   ET DEL   + DL
Sbjct  129  KLTKREKGALHDCLETIDETLDELHDAVEDL  159



>ref|XP_006355502.1| PREDICTED: 21 kDa protein-like [Solanum tuberosum]
Length=206

 Score = 51.2 bits (121),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 29/95 (31%), Positives = 55/95 (58%), Gaps = 2/95 (2%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLG  444
            +C+ TLYP LCV  L +A  +   ++  ++  A ++V++ + K++    S + R +  L 
Sbjct  42   SCKATLYPVLCVQCL-SAFANTVKQSEQQLAHAALSVSLSKAKSTMIFVSKLNR-MRGLK  99

Query  445  PLEKRALDDCLELFSETRDELRKVLSDLATTASSS  549
            P EK+A+ DCL+  S++ D++ K + +L  T   S
Sbjct  100  PREKQAVKDCLDTMSDSIDQINKSIPELGHTGQFS  134



>ref|XP_009601611.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=592

 Score = 52.4 bits (124),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 34/104 (33%), Positives = 51/104 (49%), Gaps = 4/104 (4%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATALPDRRAKTI--PEIIAATVNVTVDEVKASAANCSGIRRKLPR  438
            +C  TL+ ELC ST+A  +P+   K     ++I  ++N+T   V+ +      + +    
Sbjct  75   SCSITLHQELCYSTIANNIPNSSKKVTNQKDVIELSLNITTKAVQRNYYAIDKLVKTRKG  134

Query  439  LGPLEKRALDDCLELFSETRDELRKVLSDLAT--TASSSKHYVD  564
            L   EK AL DCLE   ET DEL   + DL     A S + + D
Sbjct  135  LTEREKIALHDCLETIDETIDELHTAVEDLEKYPNAKSLRQHAD  178



>ref|XP_009151355.1| PREDICTED: 21 kDa protein [Brassica rapa]
Length=198

 Score = 50.8 bits (120),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 32/95 (34%), Positives = 54/95 (57%), Gaps = 4/95 (4%)
 Frame = +1

Query  268  CEGTLYPELCVSTLATALPDRRAKTIPEIIA-ATVNVTVDEVKASAANCSGIRRKLPRLG  444
            C  T YP LCV++L+T       +T  +++A A +N+T+   KA++A    + R   RL 
Sbjct  42   CTFTTYPRLCVTSLST--QSSLIQTSHKLMAHAALNITLASAKATSAMMVRVSRS-SRLK  98

Query  445  PLEKRALDDCLELFSETRDELRKVLSDLATTASSS  549
            P E  A+ DC+E   +T +ELRK + ++   + S+
Sbjct  99   PREVSAMRDCVEELGDTLEELRKSIGEMGQLSGSN  133



>gb|KDP22409.1| hypothetical protein JCGZ_26240 [Jatropha curcas]
Length=203

 Score = 51.2 bits (121),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 30/95 (32%), Positives = 56/95 (59%), Gaps = 4/95 (4%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATALPDRRAKTIPEIIA-ATVNVTVDEVKASAANCSGIRRKLPRL  441
            +C  T YP+LC ++L+  +     +T P+++A A +NVT+   K+++A  S + +    +
Sbjct  46   SCSTTTYPKLCYTSLS--VHANTIQTSPKLLANAALNVTLGSAKSTSAMMSKLSQS-HGM  102

Query  442  GPLEKRALDDCLELFSETRDELRKVLSDLATTASS  546
             P+E  A+ DC+E  S+T + LRK + ++ T   S
Sbjct  103  KPIEVEAMQDCVEELSDTVEGLRKSIGEMKTYKES  137



>ref|XP_008460358.1| PREDICTED: pectinesterase-like [Cucumis melo]
Length=559

 Score = 52.0 bits (123),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 47/87 (54%), Gaps = 4/87 (5%)
 Frame = +1

Query  268  CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGP  447
            C  TLYPELC +T++TA+      +  E I A+VN+T+  V  +      + +    L  
Sbjct  46   CAMTLYPELCETTISTAV----GSSSKEAIEASVNITIGAVGDNYRRVKKLLKTENSLTK  101

Query  448  LEKRALDDCLELFSETRDELRKVLSDL  528
             EK AL DCLE   ET  EL +V+ D+
Sbjct  102  REKIALHDCLETGEETLRELYEVVEDV  128



>ref|XP_008242331.1| PREDICTED: pectinesterase-like [Prunus mume]
Length=554

 Score = 52.0 bits (123),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 50/97 (52%), Gaps = 4/97 (4%)
 Frame = +1

Query  247  QVAH---TEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSG  417
            Q+ H     AC   L+P LC + LA+A       T   ++ A +N TV  V+++  +  G
Sbjct  40   QIPHPTIKNACTTLLHPSLCFTALASAKTHDHFTTFHHLLEANINQTVASVESTRQSIKG  99

Query  418  IRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDL  528
            +  KL  L   E+ AL DCLE+  +T  EL + + DL
Sbjct  100  L-LKLQDLYLQERNALKDCLEMLDQTLYELGQAVDDL  135



>ref|XP_008228105.1| PREDICTED: pectinesterase [Prunus mume]
Length=587

 Score = 52.0 bits (123),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 48/88 (55%), Gaps = 0/88 (0%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLG  444
            +C  TLYP+LC STLA     ++  +  ++I  ++N+T   V+ +      + +   +L 
Sbjct  73   SCSSTLYPDLCFSTLAAPGAAKKVSSQKDVIELSLNITTTAVEHNFFAVKKLLKSRKKLT  132

Query  445  PLEKRALDDCLELFSETRDELRKVLSDL  528
              EK AL DCLE   ET DEL   ++DL
Sbjct  133  KREKVALHDCLENIDETLDELHAAVADL  160



>ref|NP_201042.2| plant invertase/pectin methylesterase inhibitor superfamily protein 
[Arabidopsis thaliana]
 dbj|BAA97200.1| ripening-related protein-like; contains similarity to pectinesterase 
[Arabidopsis thaliana]
 gb|AAO41999.1| putative DC1.2 homolog [Arabidopsis thaliana]
 gb|AED97600.1| plant invertase/pectin methylesterase inhibitor superfamily protein 
[Arabidopsis thaliana]
Length=203

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 54/96 (56%), Gaps = 5/96 (5%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATALPDRRAKTIPEIIA-ATVNVTVDEVKASAANCSGIRRKLPRL  441
            +C  T YP LC S+L+T       +T P+++A A +N+T+   K ++A    +R    RL
Sbjct  47   SCTFTTYPRLCFSSLST--HASLIQTSPKLMAHAALNITLASAKVTSAMM--VRLSNSRL  102

Query  442  GPLEKRALDDCLELFSETRDELRKVLSDLATTASSS  549
             P E  A+ DC+E   +T +ELRK + ++   + S+
Sbjct  103  KPKEVSAMRDCVEELGDTLEELRKSIGEMCQLSGSN  138



>gb|AAN60276.1| unknown [Arabidopsis thaliana]
Length=204

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 54/96 (56%), Gaps = 5/96 (5%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATALPDRRAKTIPEIIA-ATVNVTVDEVKASAANCSGIRRKLPRL  441
            +C  T YP LC S+L+T       +T P+++A A +N+T+   K ++A    +R    RL
Sbjct  48   SCTFTTYPRLCFSSLST--HASLIQTSPKLMAHAALNITLASAKVTSAMM--VRLSNSRL  103

Query  442  GPLEKRALDDCLELFSETRDELRKVLSDLATTASSS  549
             P E  A+ DC+E   +T +ELRK + ++   + S+
Sbjct  104  KPKEVSAMRDCVEELGDTLEELRKSIGEMCQLSGSN  139



>ref|XP_011078159.1| PREDICTED: pectinesterase-like isoform X1 [Sesamum indicum]
Length=567

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/89 (35%), Positives = 47/89 (53%), Gaps = 2/89 (2%)
 Frame = +1

Query  268  CEGTLYPELCVSTLATALPDRRA--KTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRL  441
            C  TLYP+LCVST+  A        K+  +++   +N T+  V+ +      + R    L
Sbjct  54   CAATLYPKLCVSTINAAATAASVAIKSSKDVLITALNYTISTVERNYFTVKKLGRSRKSL  113

Query  442  GPLEKRALDDCLELFSETRDELRKVLSDL  528
               EK AL DCLE+  +T DELR+  ++L
Sbjct  114  TTREKGALHDCLEMIDDTLDELRRSAAEL  142



>gb|KHN32444.1| 21 kDa protein [Glycine soja]
Length=202

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 52/93 (56%), Gaps = 10/93 (11%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATALPDRRAKTIPE----IIAATVNVTVDEVKASAANCSGIRRKL  432
            +C  T YP LC S+L      + A  I      +  A +NVT+  VK+++A  S + +K 
Sbjct  47   SCSSTTYPRLCYSSLV-----KHADLIQTNRVVLTGAALNVTLASVKSTSAMMSTLAKK-  100

Query  433  PRLGPLEKRALDDCLELFSETRDELRKVLSDLA  531
              L P E  A+ DC+E  S+T DELR+ +++++
Sbjct  101  QGLKPREVAAMQDCVEQLSDTVDELRRSIAEMS  133



>ref|XP_007217169.1| hypothetical protein PRUPE_ppa003285mg [Prunus persica]
 gb|EMJ18368.1| hypothetical protein PRUPE_ppa003285mg [Prunus persica]
Length=587

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 52/103 (50%), Gaps = 3/103 (3%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLG  444
            +C  TLYP+LC STLA     ++  +  ++I  ++N+T   V  +      + +   +L 
Sbjct  73   SCSSTLYPDLCFSTLAAPGAAKKVSSQKDVIELSLNITTTAVGHNFFAVKKLLKSRKKLT  132

Query  445  PLEKRALDDCLELFSETRDELRKVLSDLATTASSSK---HYVD  564
              EK AL DCLE   ET DEL   ++DL    + +K    Y D
Sbjct  133  KREKVALHDCLENIDETLDELHAAVADLHEYPNKNKPLTQYAD  175



>ref|XP_004506603.1| PREDICTED: 21 kDa protein-like [Cicer arietinum]
Length=198

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 51/93 (55%), Gaps = 10/93 (11%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATALPDRRAKTIPE----IIAATVNVTVDEVKASAANCSGIRRKL  432
            +C  T YP LC ++L      + A +I      +    +NVT+  VK++ A  S +  K 
Sbjct  41   SCSSTTYPRLCYASLV-----KHANSIQTNRFLLTDTALNVTLATVKSTWAMMSSLA-KT  94

Query  433  PRLGPLEKRALDDCLELFSETRDELRKVLSDLA  531
              L P E  A+ DC+EL S++ DELRK +++++
Sbjct  95   RELKPRETAAMKDCIELLSDSIDELRKSINEMS  127



>ref|XP_008462453.1| PREDICTED: pectinesterase-like [Cucumis melo]
Length=598

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 36/106 (34%), Positives = 55/106 (52%), Gaps = 9/106 (8%)
 Frame = +1

Query  268  CEGTLYPELCVSTLATALPDR-RAKTIPEIIAATVNVTVDEVKASAANCSGIRR--KLPR  438
            C  TLYP++C S ++ +     + K+  ++I  ++N+TV   KA   N   +++   L  
Sbjct  78   CSSTLYPDMCYSAISKSEGAMLKVKSQKDVIEVSINITV---KAVEENYFRVKKLCGLKN  134

Query  439  LGPLEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDL  567
            +   EK AL DCLE   ET DEL K + DL       S ++H  DL
Sbjct  135  ISHREKIALHDCLETIDETLDELHKAIVDLNEYPNKKSLNQHADDL  180



>ref|XP_006828586.1| hypothetical protein AMTR_s00129p00044320 [Amborella trichopoda]
 gb|ERM96002.1| hypothetical protein AMTR_s00129p00044320 [Amborella trichopoda]
Length=564

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 45/133 (34%), Positives = 62/133 (47%), Gaps = 11/133 (8%)
 Frame = +1

Query  190  STGPTHLDLNLNIHRQKLLQVAHTEACEGTLYPELCVSTLATALPD--RRAKTIPEIIAA  363
            ST  TH   +     +         AC  TLYPELC S+L +A P    +A +  ++I A
Sbjct  23   STVATHKSRHHKAQPEPAFHAVVKSACSSTLYPELCFSSL-SAFPAAAEKASSQKDVIEA  81

Query  364  TVNVTVDEVKASAANCSGIRRKLPRLGPLEKR--ALDDCLELFSETRDELRKVLSDLA--  531
             +N+++    A       +++   R   LE    AL DCLEL  ET DELRK   +L   
Sbjct  82   ALNLSI---TAGEHAYFKLKKLYGRKDVLEAEHTALHDCLELVDETLDELRKTDEELELY  138

Query  532  -TTASSSKHYVDL  567
             +  S S H  DL
Sbjct  139  PSKKSISDHASDL  151



>ref|XP_003528739.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3-like [Glycine 
max]
Length=598

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 36/117 (31%), Positives = 57/117 (49%), Gaps = 7/117 (6%)
 Frame = +1

Query  184  SSSTGPTHLDLNLNIHRQKLLQVAHTEACEGTLYPELCVSTLATALPD--RRAKTIPEII  357
            +S    T   L+L+ H   +++     AC  T YPELC S +A+  P+   +  T  ++I
Sbjct  53   NSDNSATSTPLSLSHHSHTIVK----SACSSTFYPELCYSAIASE-PNVTHKITTNRDVI  107

Query  358  AATVNVTVDEVKASAANCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDL  528
              ++ +T   V+ +      +  +   L   EK AL DCLE   ET DELR+   +L
Sbjct  108  QLSLKITFRAVEQNYFTVKKLFTEHDDLTKREKTALHDCLETIDETLDELREAQHNL  164



>ref|XP_003627458.1| Pectinesterase [Medicago truncatula]
 gb|AET01934.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=589

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 37/102 (36%), Positives = 53/102 (52%), Gaps = 8/102 (8%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATALPDRRAKTI--PEIIAATVNVTVDEVKASAANCSGIRRKLPR  438
            AC  TLYPELC S +++  P+   K     ++I+ ++N+T    +A   N   + + L R
Sbjct  71   ACTTTLYPELCFSAISSE-PNITHKITNHKDVISLSLNITT---RAVEHNYFTVEKLLLR  126

Query  439  --LGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHY  558
              L   EK AL DCLE   ET DEL++  +DL    S    Y
Sbjct  127  KSLTKREKIALHDCLETIDETLDELKEAQNDLVLYPSKKTLY  168



>gb|EEC82670.1| hypothetical protein OsI_27314 [Oryza sativa Indica Group]
Length=579

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/95 (35%), Positives = 58/95 (61%), Gaps = 1/95 (1%)
 Frame = +1

Query  268  CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGP  447
            C GTL+ ++CVSTL+T +P+   K + ++I+  V      V+AS++NC+   ++  +L  
Sbjct  72   CAGTLHRDVCVSTLST-IPNLARKPLRDVISEVVGRAASAVRASSSNCTSYLQRPRQLRT  130

Query  448  LEKRALDDCLELFSETRDELRKVLSDLATTASSSK  552
             ++ AL DCLELF  T D L    ++L+   S+++
Sbjct  131  RDRLALSDCLELFGHTLDLLGTAAAELSAGNSTAE  165



>ref|XP_011078160.1| PREDICTED: pectinesterase-like isoform X2 [Sesamum indicum]
Length=567

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/89 (35%), Positives = 47/89 (53%), Gaps = 2/89 (2%)
 Frame = +1

Query  268  CEGTLYPELCVSTLATALPDRRA--KTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRL  441
            C  TLYP+LCVST+  A        K+  +++   +N T+  V+ +      + R    L
Sbjct  54   CAATLYPKLCVSTINAAATAASVAIKSSKDVLITALNYTISTVERNYFTVKKLVRSRKSL  113

Query  442  GPLEKRALDDCLELFSETRDELRKVLSDL  528
               EK AL DCLE+  +T DELR+  ++L
Sbjct  114  TTREKGALHDCLEMIDDTLDELRRSAAEL  142



>gb|EYU25806.1| hypothetical protein MIMGU_mgv1a003215mg [Erythranthe guttata]
Length=599

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 50/155 (32%), Positives = 71/155 (46%), Gaps = 28/155 (18%)
 Frame = +1

Query  121  IVLLAFLSVTS-FNSLFTKDGISSSTGPTHLDLNLNIHRQK---------LLQVAHTEAC  270
            I L+AFL+V + F SLF    I+SS          N HR++          LQ    ++C
Sbjct  18   IKLVAFLAVAAVFISLFL---INSS----------NHHRRRRPLPTTPPSPLQSFIKKSC  64

Query  271  EGTLYPELCVSTLATALP----DRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPR  438
              TLYP LC +TL+  +P    +  + T   I+   +N T   VK +    S    K   
Sbjct  65   SETLYPSLCHTTLSPLIPTSMNNNNSTTFQNILQFAINRTAGHVKNTQTRISA-NFKTQD  123

Query  439  LGPLEKRALDDCLELFSETRDELRKVLSDLATTAS  543
            L   EK AL DC+E+  +T  EL + L  L   +S
Sbjct  124  LTSPEKNALKDCMEMLDQTLYELEQALIQLGGGSS  158



>ref|XP_009123661.1| PREDICTED: pectinesterase 2 [Brassica rapa]
Length=604

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/104 (35%), Positives = 47/104 (45%), Gaps = 17/104 (16%)
 Frame = +1

Query  268  CEGTLYPELCVSTLATA----LPDRRAKTIP-------------EIIAATVNVTVDEVKA  396
            C  TLYPELC S +A       PD+     P             ++I A++N+T + VK 
Sbjct  66   CSSTLYPELCFSAVAATGKKLTPDKDVIEAPAVAATGKKLTSDKDVIEASLNLTTNAVKH  125

Query  397  SAANCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDL  528
            +      +  K   L   E  AL DCLE+  ET DEL   L DL
Sbjct  126  NYFAVKKLITKRKGLTAREVTALHDCLEIIDETLDELHVALEDL  169



>ref|NP_001265901.1| pectinesterase 3-like [Cicer arietinum]
 emb|CAE76633.2| pectin methylesterase [Cicer arietinum]
Length=584

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 48/162 (30%), Positives = 76/162 (47%), Gaps = 16/162 (10%)
 Frame = +1

Query  55   VTRMHNLKQKATLF--FTISGCSAIVLLAFLSVTSFNSLFTKDGISSSTGPTHLDLNLNI  228
            +TR+ N  +K   F  FT    +A ++    SVTS     TK+ I SS+       +  I
Sbjct  8    LTRISNSNKKKLFFSLFTALLITASIIAISASVTSSQKTKTKNNIVSSSLSLSHHSHTII  67

Query  229  HRQKLLQVAHTEACEGTLYPELCVSTLATALPD--RRAKTIPEIIAATVNVTVDEVKASA  402
                        AC  TLYP+LC S +++  P+   +     ++I+ ++N+T   V+ + 
Sbjct  68   ----------KTACTTTLYPDLCFSAISSE-PNITHKINNHKDVISLSLNITTRAVEHNF  116

Query  403  ANCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDL  528
                 + R+   L   EK AL DCLE   +T DEL++   DL
Sbjct  117  FTVENLLRR-KNLSEREKIALHDCLETIDDTLDELKEAQRDL  157



>ref|XP_006307088.1| hypothetical protein CARUB_v10008673mg [Capsella rubella]
 gb|EOA39986.1| hypothetical protein CARUB_v10008673mg [Capsella rubella]
Length=584

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 53/106 (50%), Gaps = 10/106 (9%)
 Frame = +1

Query  268  CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGP  447
            C  TLYPELC S +A A   +   +  ++I A++N+T    KA   N   +++ + +   
Sbjct  66   CSSTLYPELCYSAVA-ASGGKELTSHKDVIEASLNLTT---KAVTHNYFAVKKLITKRKG  121

Query  448  LEKR---ALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDL  567
            L  R   AL DCLE   ET DEL +   DL    T  S  KH  DL
Sbjct  122  LTAREVTALHDCLETIDETLDELHEAKEDLHMYPTQKSLRKHADDL  167



>ref|XP_010029511.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=577

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/98 (35%), Positives = 52/98 (53%), Gaps = 2/98 (2%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATALPDRRAK-TIPEIIAATVNVTVDEVKASAANCSGI-RRKLPR  438
            +C  T YP+LC S +A          T  ++I A++N+T   V+ +      +  ++  R
Sbjct  58   SCSSTRYPDLCYSAVAAFPGAAAGLATQKDVIEASLNITTVAVEQNFFTVEKLLSKRSKR  117

Query  439  LGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSK  552
            L   EKRAL DCLE   ET DEL++   DL +  S++K
Sbjct  118  LTKREKRALHDCLETIDETLDELQQAARDLNSYPSAAK  155



>ref|XP_010534986.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3-like [Tarenaya 
hassleriana]
 ref|XP_010534987.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3-like [Tarenaya 
hassleriana]
Length=587

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 46/89 (52%), Gaps = 1/89 (1%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLAT-ALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRL  441
            AC    Y +LCVS ++T AL      +  ++I A++N+T   V+ +      +  K   L
Sbjct  63   ACSSARYQDLCVSAISTSALTGVELTSQRDVIEASLNITTTAVEHNYFTIKKLLEKRKGL  122

Query  442  GPLEKRALDDCLELFSETRDELRKVLSDL  528
               EK AL DCLE   ET DEL + + DL
Sbjct  123  TKREKTALHDCLETIDETLDELHEAMDDL  151



>ref|XP_010264195.1| PREDICTED: 21 kDa protein-like [Nelumbo nucifera]
Length=210

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/94 (32%), Positives = 61/94 (65%), Gaps = 10/94 (11%)
 Frame = +1

Query  265  ACEGTLYPELCVSTL---ATALPDRRAKTIPEIIAAT-VNVTVDEVKASAANCSGIRR-K  429
            +C  T+YP+LC STL   A+A+     +T P+++A T ++V++   ++S+A  S + + +
Sbjct  51   SCGTTMYPKLCFSTLSGYASAI-----QTDPKLLADTALSVSLTNARSSSAMISELSKSQ  105

Query  430  LPRLGPLEKRALDDCLELFSETRDELRKVLSDLA  531
            L  + P E  A+ DC+E+  ++ DEL+K +++++
Sbjct  106  LATMKPREAAAMRDCVEMVGDSVDELQKSMAEMS  139



>ref|XP_003541070.2| PREDICTED: 21 kDa protein-like [Glycine max]
Length=251

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 52/93 (56%), Gaps = 10/93 (11%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATALPDRRAKTIPE----IIAATVNVTVDEVKASAANCSGIRRKL  432
            +C  T YP LC S+L      + A  I      +  A +NVT+  VK+++A  S + +K 
Sbjct  96   SCSSTTYPRLCYSSLV-----KHADLIQTNRVVLTGAALNVTLASVKSTSAMMSTLAKK-  149

Query  433  PRLGPLEKRALDDCLELFSETRDELRKVLSDLA  531
              L P E  A+ DC+E  S+T DELR+ +++++
Sbjct  150  QGLKPREVAAMQDCVEQLSDTVDELRRSIAEMS  182



>ref|XP_002532944.1| Pectinesterase-3 precursor, putative [Ricinus communis]
 gb|EEF29428.1| Pectinesterase-3 precursor, putative [Ricinus communis]
Length=577

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 56/106 (53%), Gaps = 7/106 (7%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATALPDRRAK--TIPEIIAATVNVTVDEVKASAANCSGIRRKLPR  438
            +C  T YP+LC S +A+A P   +K  ++ ++I  ++N+T   V+ +      + ++   
Sbjct  67   SCSTTRYPDLCFSAVASA-PGATSKLVSLKDVIEVSLNLTTTAVEHNFFTVEKLAKR-KG  124

Query  439  LGPLEKRALDDCLELFSETRDELRKVLSDLA---TTASSSKHYVDL  567
            L   EK AL DCLE   ET DEL K + DL       S S+H  DL
Sbjct  125  LTKREKTALHDCLETIDETLDELHKAMDDLKEYPNKKSLSQHADDL  170



>ref|XP_008348472.1| PREDICTED: pectinesterase-like [Malus domestica]
Length=585

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 50/91 (55%), Gaps = 4/91 (4%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATALPD--RRAKTIPEIIAATVNVTVDEVKASAANCSGI-RRKLP  435
            +C  TLYP+LC STLA   P+  ++  +  ++I  ++N+T   V+        + + +  
Sbjct  70   SCSSTLYPDLCFSTLALH-PEASKKVSSQKDVIELSLNITTTAVQHIFFTVEKLLKSRKN  128

Query  436  RLGPLEKRALDDCLELFSETRDELRKVLSDL  528
            +L   EK AL DCLE   ET DEL + + DL
Sbjct  129  KLTKREKGALHDCLETIDETLDELHEAVEDL  159



>ref|XP_010462289.1| PREDICTED: pectinesterase 2 [Camelina sativa]
Length=584

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 44/87 (51%), Gaps = 1/87 (1%)
 Frame = +1

Query  268  CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGP  447
            C  TLYPELC S +A A   +   +  ++I A++N+T   V+ +      +  K   L  
Sbjct  66   CSSTLYPELCFSAVA-ATGGKELASQKDVIEASLNLTTKAVRHNYFAVKKLITKRKGLTA  124

Query  448  LEKRALDDCLELFSETRDELRKVLSDL  528
             E  AL DCLE   ET DEL   + DL
Sbjct  125  REVTALHDCLETIDETLDELHVAVEDL  151



>ref|XP_009335681.1| PREDICTED: 21 kDa protein-like [Pyrus x bretschneideri]
Length=202

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 48/92 (52%), Gaps = 3/92 (3%)
 Frame = +1

Query  262  EACEGTLYPELCVSTLATALPDRRAKTIPEIIA-ATVNVTVDEVKASAANCSGIRRKLPR  438
            EAC  T Y +LC+ +LA+      AK  P   A A V+V++ E K++A     +++   R
Sbjct  39   EACSVTRYRDLCIHSLASF--STSAKNSPSRWARAGVSVSLSETKSAAHYLVTLKKHRRR  96

Query  439  LGPLEKRALDDCLELFSETRDELRKVLSDLAT  534
            +    K AL DC+E F    DEL K L  L T
Sbjct  97   MQGRNKVALSDCIECFGNAIDELHKSLGVLRT  128



>gb|AJH66132.1| pectin methylesterase [Malus domestica]
Length=585

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 50/91 (55%), Gaps = 4/91 (4%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATALPD--RRAKTIPEIIAATVNVTVDEVKASAANCSGI-RRKLP  435
            +C  TLYP+LC STLA   P+  ++  +  ++I  ++N+T   V+        + + +  
Sbjct  70   SCSSTLYPDLCFSTLALH-PEASKKVSSQKDVIELSLNITTTAVQHIFFTVEKLLKSRKN  128

Query  436  RLGPLEKRALDDCLELFSETRDELRKVLSDL  528
            +L   EK AL DCLE   ET DEL + + DL
Sbjct  129  KLTKREKGALHDCLETIDETLDELHEAVEDL  159



>ref|XP_010273801.1| PREDICTED: pectinesterase [Nelumbo nucifera]
Length=580

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 50/92 (54%), Gaps = 8/92 (9%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATALPD--RRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLP-  435
            +C  TLYP+LC S +AT +P       T  ++I  ++N+T   V+    N   I++ L  
Sbjct  68   SCSSTLYPDLCYSAIAT-VPGAADNLSTQKDVIEISLNITTTAVEH---NYFTIKKLLAH  123

Query  436  -RLGPLEKRALDDCLELFSETRDELRKVLSDL  528
             +L   EK AL DCLE+  ET DEL +   DL
Sbjct  124  EKLTEREKTALHDCLEMVDETLDELHETAEDL  155



>ref|XP_009335740.1| PREDICTED: 21 kDa protein [Pyrus x bretschneideri]
Length=202

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 48/92 (52%), Gaps = 3/92 (3%)
 Frame = +1

Query  262  EACEGTLYPELCVSTLATALPDRRAKTIPEIIA-ATVNVTVDEVKASAANCSGIRRKLPR  438
            EAC  T Y +LC+ +LA+      AK  P   A A V+V++ E K++A     +++   R
Sbjct  39   EACSVTRYRDLCIHSLASF--STSAKNSPSRWARAGVSVSLSETKSAAHYLVTLKKHRRR  96

Query  439  LGPLEKRALDDCLELFSETRDELRKVLSDLAT  534
            +    K AL DC+E F    DEL K L  L T
Sbjct  97   MQGRNKVALSDCIECFGNAIDELHKSLGVLRT  128



>ref|XP_006828574.1| hypothetical protein AMTR_s00129p00028250 [Amborella trichopoda]
 gb|ERM95990.1| hypothetical protein AMTR_s00129p00028250 [Amborella trichopoda]
Length=592

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 36/107 (34%), Positives = 54/107 (50%), Gaps = 11/107 (10%)
 Frame = +1

Query  268  CEGTLYPELCVSTLATALPDRRAKTIPE-IIAATVNVTVDEVKASAANCSGIRRKLPRLG  444
            C  T Y E CVS+L++A+    + T PE +I A + V   EV  +  + S +R+      
Sbjct  77   CSPTDYQEACVSSLSSAIKSNSSLTGPEDLIKAAIKVAKKEVIKAFDHASKLRKN--ARS  134

Query  445  PLEKRALDDCLELFSETRDELRKVLS--------DLATTASSSKHYV  561
             +EK AL +C EL S   DEL +  S        DLAT +   K+++
Sbjct  135  QMEKEALSNCKELLSYAMDELDETFSGVSVAGLKDLATVSQDLKNWL  181



>ref|XP_003627459.1| Pectinesterase [Medicago truncatula]
Length=391

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 53/102 (52%), Gaps = 8/102 (8%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATALPD--RRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPR  438
            AC  TLYPELC S +++  P+   +     ++I+ ++N+T    +A   N   + + L R
Sbjct  71   ACTTTLYPELCFSAISSE-PNITHKITNHKDVISLSLNITT---RAVEHNYFTVEKLLLR  126

Query  439  --LGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHY  558
              L   EK AL DCLE   ET DEL++  +DL    S    Y
Sbjct  127  KSLTKREKIALHDCLETIDETLDELKEAQNDLVLYPSKKTLY  168



>ref|XP_010937249.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=582

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 54/105 (51%), Gaps = 4/105 (4%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATALPDRRAKTIP-EIIAATVNVTVDEVKASAANCSGIRRKLPRL  441
            +C    +P+LC S +A   P     + P ++I A++N+T+  ++ S  +   +      L
Sbjct  58   SCRSARFPDLCYSAIAATPPLVHTISKPKDVIHASLNLTITAIERSFRHVERLSAAAANL  117

Query  442  GPLEKRALDDCLELFSETRDELRKVLSDLATTASSS---KHYVDL  567
               E+ AL DCLE+F E+ DELR   +DL    +     +H +DL
Sbjct  118  TARERTALHDCLEMFDESLDELRLTDADLRAYPAGKPLRRHALDL  162



>ref|XP_002510935.1| 21 kDa protein precursor, putative [Ricinus communis]
 gb|EEF51537.1| 21 kDa protein precursor, putative [Ricinus communis]
Length=201

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 35/107 (33%), Positives = 58/107 (54%), Gaps = 14/107 (13%)
 Frame = +1

Query  235  QKLLQVAHTE----ACEGTLYPELCVSTLATALPDRRAKTIPEIIA-ATVNVTVDEVKAS  399
            + L Q   TE    +C  T YP LC S+L   +   + +T P ++A A +NVT+    AS
Sbjct  30   RNLAQTTSTEFIRTSCSTTTYPRLCYSSLK--IHASKIQTSPMLLANAALNVTL----AS  83

Query  400  AANCSGIRRKLPR---LGPLEKRALDDCLELFSETRDELRKVLSDLA  531
              + S + +KL +   + P E  A+ DC++  +++ DELRK + +L 
Sbjct  84   TRSTSTMMQKLSKSHGMKPREVSAMQDCMDELTDSVDELRKSIDELG  130



>emb|CDX86901.1| BnaC03g51710D [Brassica napus]
Length=200

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 54/96 (56%), Gaps = 4/96 (4%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATALPDRRAKTIPEIIA-ATVNVTVDEVKASAANCSGIRRKLPRL  441
            +C  T YP LCV++L+T       +T  ++IA A +N+T+   KA++A    +     RL
Sbjct  43   SCTFTTYPRLCVTSLST--QSSLIQTSHKLIAHAALNITLASAKATSAMMVRLSSS-SRL  99

Query  442  GPLEKRALDDCLELFSETRDELRKVLSDLATTASSS  549
             P E  A+ DC+E   +T +ELRK + ++   + S+
Sbjct  100  KPREVSAMRDCVEELGDTLEELRKSIGEMGQLSGSN  135



>gb|AFI23411.1| pectin methylesterase [Coffea arabica]
Length=587

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 46/91 (51%), Gaps = 4/91 (4%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATALPDRRAKTI---PEIIAATVNVTVDEVKASAANCSGIRRKLP  435
            +C  TLYP+LC STLA  LP   ++ I    ++I   +N T   V+ +      +     
Sbjct  75   SCSNTLYPDLCFSTLAN-LPQAVSQKITSQKDVIELVLNHTTTTVEHNYFAVEHLIATHH  133

Query  436  RLGPLEKRALDDCLELFSETRDELRKVLSDL  528
             L   EK AL DCLE   ET DEL + + DL
Sbjct  134  NLTEREKTALHDCLETIDETLDELHQTVKDL  164



>ref|XP_010088304.1| putative pectinesterase/pectinesterase inhibitor 39 [Morus notabilis]
 gb|EXB33529.1| putative pectinesterase/pectinesterase inhibitor 39 [Morus notabilis]
Length=553

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 52/79 (66%), Gaps = 3/79 (4%)
 Frame = +1

Query  331  RAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGPLEKRALDDCLELFSETRDELR  510
            R  T+P   A  ++ T+ EVKAS+ NC+ I R L    P++KRALDDCLEL  +T  EL 
Sbjct  2    RRNTLP---ATLLSHTLKEVKASSTNCTNIERNLRSSDPVQKRALDDCLELLDDTIAELN  58

Query  511  KVLSDLATTASSSKHYVDL  567
             V+ DL++  S+SKH+ DL
Sbjct  59   DVVFDLSSRKSASKHFHDL  77



>ref|XP_010454384.1| PREDICTED: 21 kDa protein-like [Camelina sativa]
Length=206

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/105 (29%), Positives = 55/105 (52%), Gaps = 12/105 (11%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLAT----ALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKL  432
            +CE   YP LCV TL++     + + R     ++  A V +++   +++A   + +R  +
Sbjct  38   SCEHASYPSLCVRTLSSYSGPTITNSR-----DLAQAAVKISLSHAQSAAKKLAAVRDSV  92

Query  433  PRLGPLEKRALDDCLELFSETRDELRK---VLSDLATTASSSKHY  558
             +   LEK AL DC+E+  ++ DEL +   VL  L  +  S+K +
Sbjct  93   GKKKKLEKGALVDCVEMIGDSVDELSRTLGVLKHLRVSGGSAKEF  137



>ref|XP_006394407.1| hypothetical protein EUTSA_v10004950mg [Eutrema salsugineum]
 gb|ESQ31693.1| hypothetical protein EUTSA_v10004950mg [Eutrema salsugineum]
Length=198

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 54/96 (56%), Gaps = 4/96 (4%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATALPDRRAKTIPEIIA-ATVNVTVDEVKASAANCSGIRRKLPRL  441
            +C  T Y  LCV++L+T       +T P+++A A +N+T+   KA++     + R  P L
Sbjct  41   SCNFTQYQRLCVASLSTQAS--LIQTSPKLMAHAALNITLASAKATSVMMVRLSRTSP-L  97

Query  442  GPLEKRALDDCLELFSETRDELRKVLSDLATTASSS  549
             P E  A+ DC+E   +T +ELRK + ++   + S+
Sbjct  98   KPREASAMRDCVEELGDTLEELRKSIGEMGQLSGSN  133



>ref|XP_010543030.1| PREDICTED: pectinesterase 2-like [Tarenaya hassleriana]
Length=529

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 49/90 (54%), Gaps = 2/90 (2%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATA--LPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPR  438
            AC  T+Y +LCVS ++TA  +  +   +  ++I A++N+T   V+ +      + +    
Sbjct  69   ACSSTIYRDLCVSAVSTAAAVTGQELTSQRDVIEASLNITKIAVEHNYFTVKKLLKNRKG  128

Query  439  LGPLEKRALDDCLELFSETRDELRKVLSDL  528
            L   EK AL DCLE   ET DE+ + + DL
Sbjct  129  LTEREKTALHDCLETIDETLDEIHEAVEDL  158



>ref|XP_011012638.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=573

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 49/161 (30%), Positives = 80/161 (50%), Gaps = 26/161 (16%)
 Frame = +1

Query  67   HN-LKQKATLFFTISGCSAIVLLA-FLSVTSFNSLFTKDGISSSTGPTHLDLNLNIHRQK  240
            HN LK K  +F ++   S+I+L+A  +S+ +        G++SS   T  +   N H   
Sbjct  7    HNTLKNKKRVFLSL--FSSILLVAAIVSIVA--------GVTSSKNSTESN---NDH---  50

Query  241  LLQVAHT---EACEGTLYPELCVSTLATALPD--RRAKTIPEIIAATVNVTVDEVKASAA  405
              QVA+T    +C  TLYP LC S++ +A+PD   + K+  ++I  ++N T+   + S  
Sbjct  51   --QVAYTILKSSCSSTLYPHLCFSSI-SAVPDATSKIKSKKDVIDLSLNRTMSATRHSYF  107

Query  406  NCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDL  528
                +          E  AL DCL + +ET D+L K   +L
Sbjct  108  KIQKLTFTRRSFTERENTALHDCLVMLNETLDQLSKAYQEL  148



>emb|CDX87244.1| BnaC09g05590D [Brassica napus]
Length=199

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 53/96 (55%), Gaps = 4/96 (4%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATALPDRRAKTIPEIIA-ATVNVTVDEVKASAANCSGIRRKLPRL  441
            +C  T YP LCV++L+T       +T P+++A A +N+T+   KA++     +     +L
Sbjct  42   SCTVTTYPRLCVASLST--HASLIQTSPKLMAHAALNITLASAKATSVMMVRLSSS-SQL  98

Query  442  GPLEKRALDDCLELFSETRDELRKVLSDLATTASSS  549
             P E  A+ DC+E   +T DELRK + ++     SS
Sbjct  99   KPREVSAMRDCVEELGDTLDELRKSIGEMGQLIGSS  134



>ref|XP_010047423.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=578

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 31/90 (34%), Positives = 49/90 (54%), Gaps = 2/90 (2%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATALPDRR--AKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPR  438
            +C  TLYP+LC+S L ++        KT  ++IA  +N+T+  V+ +      +    P 
Sbjct  63   SCSSTLYPDLCLSQLTSSPSSTSLAVKTPKDVIALALNLTIAYVQHNYFTIKKVAAARPG  122

Query  439  LGPLEKRALDDCLELFSETRDELRKVLSDL  528
            L   ++ AL DCLE+  ET DE+ K L +L
Sbjct  123  LTARDRTALHDCLEMVDETLDEVHKTLVEL  152



>ref|XP_009767827.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=593

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 32/103 (31%), Positives = 51/103 (50%), Gaps = 5/103 (5%)
 Frame = +1

Query  235  QKLLQVAHT---EACEGTLYPELCVSTLATALPD--RRAKTIPEIIAATVNVTVDEVKAS  399
            Q +    HT    +C  TL+ +LC ST+A  +P+  ++     ++I  ++N+T   V+ +
Sbjct  63   QAISLATHTIVKSSCSITLHQQLCYSTIANNIPNFSKKVTNQKDVIELSLNITTKAVQRN  122

Query  400  AANCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDL  528
                  + +    L   EK AL DCLE   ET DEL   + DL
Sbjct  123  YYAIDKLIKTRKGLTEREKIALHDCLETIDETIDELHTAVEDL  165



>ref|XP_010493188.1| PREDICTED: 21 kDa protein-like [Camelina sativa]
Length=206

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/101 (29%), Positives = 52/101 (51%), Gaps = 4/101 (4%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLG  444
            +CE   YP LCV TL++           ++  A V +++   +++A   + +R  + +  
Sbjct  38   SCEHASYPSLCVRTLSS-YSGPTINNSRDLAQAAVRISLSHAQSAAKKLAAVRDSVGKKK  96

Query  445  PLEKRALDDCLELFSETRDELRK---VLSDLATTASSSKHY  558
             LEK AL DC+E+  ++ DEL +   VL  L  +  S+K +
Sbjct  97   KLEKGALVDCVEMIGDSVDELSRTLGVLKHLRVSGGSAKEF  137



>ref|XP_010096537.1| Pectinesterase 3 [Morus notabilis]
 gb|EXB64657.1| Pectinesterase 3 [Morus notabilis]
Length=362

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 49/93 (53%), Gaps = 8/93 (9%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATALPD---RRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLP  435
            AC  T YP+LC S +A +      ++   + ++I  +VN+T+  V+    N   I++   
Sbjct  68   ACSSTRYPDLCYSAVAASASSGGSKKVSNLKDVIGLSVNITITAVQE---NYFSIKKLTK  124

Query  436  RLG--PLEKRALDDCLELFSETRDELRKVLSDL  528
            R G    EK AL DCLE   ET DEL +V  DL
Sbjct  125  RKGLTKREKTALHDCLETIDETLDELHEVQDDL  157



>ref|XP_011094019.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=595

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 33/101 (33%), Positives = 53/101 (52%), Gaps = 1/101 (1%)
 Frame = +1

Query  262  EACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRL  441
            +AC  TLY  LC STL+T    +   +  +I+  T+N T   VK +  +      K   L
Sbjct  71   KACPETLYSSLCRSTLSTLPKSKNFTSFLKILEFTINRTASHVKGARYSIVAHFTK-QDL  129

Query  442  GPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVD  564
               EK AL DC+E+  +T  EL++  ++L + AS + + +D
Sbjct  130  NLHEKNALRDCMEMLDQTLYELQQATNELRSFASLTGYRLD  170



>ref|XP_007204488.1| hypothetical protein PRUPE_ppa019698mg [Prunus persica]
 gb|EMJ05687.1| hypothetical protein PRUPE_ppa019698mg [Prunus persica]
Length=530

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 32/97 (33%), Positives = 49/97 (51%), Gaps = 4/97 (4%)
 Frame = +1

Query  247  QVAH---TEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSG  417
            Q+ H     AC   L+P LC + LA+A           ++ A +N TV  V+++  +  G
Sbjct  16   QIPHPTIKNACTTLLHPSLCFTALASAKTHDHFTAFHHLLEANINQTVASVESTRQSIKG  75

Query  418  IRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDL  528
            +  KL  L   E+ AL DCLE+  +T  EL + + DL
Sbjct  76   L-LKLQDLYLQERNALKDCLEMLDQTLYELGQAVDDL  111



>gb|AAG17110.1|AF188895_1 putative pectin methylesterase 3 [Linum usitatissimum]
Length=555

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 47/90 (52%), Gaps = 0/90 (0%)
 Frame = +1

Query  259  TEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPR  438
            T +C  T +P+LC S+LA+A       T  ++I A++NVT   V  + A  +        
Sbjct  44   TSSCSNTRHPDLCFSSLASAPVHVSLNTQMDVIKASINVTCTSVLRNIAAVNKALSTRTD  103

Query  439  LGPLEKRALDDCLELFSETRDELRKVLSDL  528
            L P  + AL DC+E  S + DEL   L++L
Sbjct  104  LTPRSRSALKDCVETMSTSLDELHVALAEL  133



>ref|XP_006357906.1| PREDICTED: 21 kDa protein-like [Solanum tuberosum]
Length=192

 Score = 48.5 bits (114),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 32/95 (34%), Positives = 53/95 (56%), Gaps = 4/95 (4%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAAT-VNVTVDEVKASAANCSGIRRKLPRL  441
            +C+ T YP++CVS+LA   P    K  P+ +A T ++V++D  +++    + +  K   L
Sbjct  33   SCKITTYPQVCVSSLAVYAPT--IKRSPQQLAQTALSVSLDRAQSAHTFITKLN-KFKGL  89

Query  442  GPLEKRALDDCLELFSETRDELRKVLSDLATTASS  546
               E  AL DCLE  SET D + K + +L +  S+
Sbjct  90   KQREYAALKDCLEEMSETIDRINKSVKELKSMGSA  124



>gb|EYU29496.1| hypothetical protein MIMGU_mgv1a003055mg [Erythranthe guttata]
Length=611

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 29/88 (33%), Positives = 45/88 (51%), Gaps = 1/88 (1%)
 Frame = +1

Query  268  CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGI-RRKLPRLG  444
            C  TLYPELC+ T+  A P    K+  +++   +N T+  V+ +      +   +   L 
Sbjct  97   CSVTLYPELCIWTIQEAAPAASMKSSRDVLITALNYTIYTVERNYFTVKKVGSTRSKSLT  156

Query  445  PLEKRALDDCLELFSETRDELRKVLSDL  528
              EK AL DCLE+  +T +ELR    +L
Sbjct  157  AREKGALHDCLEVIDDTLEELRDTEMEL  184



>gb|EYU21270.1| hypothetical protein MIMGU_mgv1a003278mg [Erythranthe guttata]
Length=594

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 47/96 (49%), Gaps = 8/96 (8%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATAL--PDRRAKTIPEIIAATVNVTVDEVKAS------AANCSGI  420
            +C  TLYPELC S +A +L     + K+  ++I  ++NVT   V+ +           G 
Sbjct  72   SCSNTLYPELCYSAIADSLDGGKEKVKSKKDVIILSLNVTTAAVRRNYFAIEKLLAGGGG  131

Query  421  RRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDL  528
              K   L   EK AL DCLE   ET DEL   + DL
Sbjct  132  GAKSGNLTEREKSALHDCLETIGETLDELHAAVEDL  167



>gb|AFK47771.1| unknown [Lotus japonicus]
Length=205

 Score = 48.5 bits (114),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 53/92 (58%), Gaps = 10/92 (11%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATALPDRRAKTIP----EIIAATVNVTVDEVKASAANCSGIRRKL  432
            +C  T YP LC ++L      + A++I     ++    +NVT+   K+++A  S + +K 
Sbjct  45   SCSSTTYPRLCFASLV-----KHAESIQNDRLQLTCTALNVTLAAAKSTSAMISTMAKK-  98

Query  433  PRLGPLEKRALDDCLELFSETRDELRKVLSDL  528
              + P E  A+ DC+E+ S++ DELR+ +++L
Sbjct  99   QGMKPREVAAMQDCVEVLSDSVDELRRSIAEL  130



>ref|XP_010479961.1| PREDICTED: pectinesterase 2-like [Camelina sativa]
Length=594

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 31/87 (36%), Positives = 44/87 (51%), Gaps = 1/87 (1%)
 Frame = +1

Query  268  CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLGP  447
            C  TLYP+LC S +A A   +   +  ++I A++N+T   V+ +      +  K   L  
Sbjct  76   CSSTLYPDLCFSAVA-ATGGKELASQKDVIEASLNLTTKAVRHNYFAVKKLITKRKGLTA  134

Query  448  LEKRALDDCLELFSETRDELRKVLSDL  528
             E  AL DCLE   ET DEL   + DL
Sbjct  135  REVTALHDCLETIDETLDELHVAVEDL  161



>emb|CDY00279.1| BnaA06g21800D [Brassica napus]
Length=198

 Score = 48.1 bits (113),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 31/95 (33%), Positives = 53/95 (56%), Gaps = 4/95 (4%)
 Frame = +1

Query  268  CEGTLYPELCVSTLATALPDRRAKTIPEIIA-ATVNVTVDEVKASAANCSGIRRKLPRLG  444
            C  T YP LCV++L+T       +T  +++A A +N+T+   KA++A    +     RL 
Sbjct  42   CTFTTYPRLCVTSLST--QSSLIQTSHKLMAHAALNITLASAKATSAMMVRVSSS-SRLK  98

Query  445  PLEKRALDDCLELFSETRDELRKVLSDLATTASSS  549
            P E  A+ DC+E   +T +ELRK + ++   + S+
Sbjct  99   PREVSAMRDCVEELGDTLEELRKSIGEMGQLSGSN  133



>ref|XP_008238630.1| PREDICTED: 21 kDa protein [Prunus mume]
Length=200

 Score = 48.1 bits (113),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 55/105 (52%), Gaps = 10/105 (10%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAAT-VNVTVDEVKASAANCSGIRRKLPR-  438
            +C  T+YP LC  +L+  +   + KT P+++A T +NVT+    A+    S I R+L   
Sbjct  39   SCSVTIYPRLCYHSLS--IYAGKIKTDPKVLAHTALNVTL----AATQESSVIMRRLSEI  92

Query  439  --LGPLEKRALDDCLELFSETRDELRKVLSDLATTASSSKHYVDL  567
              L P+E  A+ DC+E   +  DEL++ L +L      S  +  +
Sbjct  93   HGLKPIETAAVHDCMEEIGDAIDELQQSLDELGHVLRGSNFWFQM  137



>gb|AFK37116.1| unknown [Lotus japonicus]
Length=206

 Score = 48.1 bits (113),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 53/92 (58%), Gaps = 10/92 (11%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATALPDRRAKTIP----EIIAATVNVTVDEVKASAANCSGIRRKL  432
            +C  T YP LC ++L      + A++I     ++    +NVT+   K+++A  S + +K 
Sbjct  45   SCSSTTYPRLCFASLV-----KHAESIQNDRLQLTCTALNVTLAAAKSTSAMISTMAKK-  98

Query  433  PRLGPLEKRALDDCLELFSETRDELRKVLSDL  528
              + P E  A+ DC+E+ S++ DELR+ +++L
Sbjct  99   QGMKPREVAAMQDCVEVLSDSVDELRRSIAEL  130



>ref|XP_009767669.1| PREDICTED: 21 kDa protein [Nicotiana sylvestris]
Length=210

 Score = 48.1 bits (113),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 53/92 (58%), Gaps = 2/92 (2%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANCSGIRRKLPRLG  444
            +C+ TLYP LCV  L +A  +   ++  ++  A ++V++ + K++    S +  K+  L 
Sbjct  41   SCKATLYPVLCVQCL-SAYANTVKQSEQQLARAALSVSLSKAKSTTIFVSKL-TKIRGLK  98

Query  445  PLEKRALDDCLELFSETRDELRKVLSDLATTA  540
            P EK+A+ DC +  S++ D++ K + +L  T 
Sbjct  99   PREKQAVKDCFDTMSDSVDQINKSIPELGQTG  130



>ref|XP_003588521.1| Pectinesterase [Medicago truncatula]
 gb|AES58772.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=609

 Score = 48.9 bits (115),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 32/110 (29%), Positives = 54/110 (49%), Gaps = 4/110 (4%)
 Frame = +1

Query  217  NLNIHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKA  396
            N N+   K  Q A +  C  T YP LC+++L    P   + +  E++  + N+T   +  
Sbjct  70   NSNLLHSKPTQ-AISRTCSKTRYPSLCINSLLD-FPGSTSASEQELVHISFNMTHRHISK  127

Query  397  SAANCSGIRRKLPRLGPLEKRALDDCLELFSETRDELRKVLSDLATTASS  546
            +    SG+   +    P  + A +DCLEL  E+ D +R  +  L TT+S+
Sbjct  128  ALFASSGLSYTVA--NPRVRAAYEDCLELMDESMDAIRSSMDSLMTTSST  175



>ref|XP_004172115.1| PREDICTED: pectinesterase 3-like, partial [Cucumis sativus]
Length=592

 Score = 48.9 bits (115),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 35/106 (33%), Positives = 54/106 (51%), Gaps = 9/106 (8%)
 Frame = +1

Query  268  CEGTLYPELCVSTLATALPDR-RAKTIPEIIAATVNVTVDEVKASAANCSGIRR--KLPR  438
            C  TLYP++C S ++ +     + K   ++I  ++N+TV   KA   N   +++   L  
Sbjct  72   CSSTLYPDMCYSAISRSEGAMLKVKNQKDVIEISINITV---KAVEENYFRVKKLCGLKN  128

Query  439  LGPLEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDL  567
            +   E+ AL DCLE   ET DEL K + DL       S ++H  DL
Sbjct  129  ISHRERIALHDCLETIDETLDELHKAIVDLNEYPNKKSLNQHADDL  174



>ref|XP_004141734.1| PREDICTED: pectinesterase 3-like [Cucumis sativus]
 gb|KGN45437.1| hypothetical protein Csa_7G447990 [Cucumis sativus]
Length=595

 Score = 48.9 bits (115),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 35/106 (33%), Positives = 54/106 (51%), Gaps = 9/106 (8%)
 Frame = +1

Query  268  CEGTLYPELCVSTLATALPDR-RAKTIPEIIAATVNVTVDEVKASAANCSGIRR--KLPR  438
            C  TLYP++C S ++ +     + K   ++I  ++N+TV   KA   N   +++   L  
Sbjct  75   CSSTLYPDMCYSAISRSEGAMLKVKNQKDVIEISINITV---KAVEENYFRVKKLCGLKN  131

Query  439  LGPLEKRALDDCLELFSETRDELRKVLSDL---ATTASSSKHYVDL  567
            +   E+ AL DCLE   ET DEL K + DL       S ++H  DL
Sbjct  132  ISHRERIALHDCLETIDETLDELHKAIVDLNEYPNKKSLNQHADDL  177



>ref|XP_007218426.1| hypothetical protein PRUPE_ppa011607mg [Prunus persica]
 gb|EMJ19625.1| hypothetical protein PRUPE_ppa011607mg [Prunus persica]
Length=203

 Score = 48.1 bits (113),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 56/93 (60%), Gaps = 10/93 (11%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATALPDRRAKTIPEIIA-ATVNVTVDEVKASAANCSGIRRKLPR-  438
            +C  T YP+LC+++L++       +T P+++A A +NVT+   K+++A    +  KL + 
Sbjct  46   SCSATTYPKLCLTSLSS--HASTIQTSPKLMAGAALNVTLSSAKSTSA----VMLKLSQS  99

Query  439  --LGPLEKRALDDCLELFSETRDELRKVLSDLA  531
              L P E  A+ DCLE  S++ DEL+  ++++ 
Sbjct  100  HGLKPKEVGAMRDCLEELSDSVDELQSSIAEMG  132



>ref|XP_011010936.1| PREDICTED: 21 kDa protein-like isoform X1 [Populus euphratica]
Length=197

 Score = 47.8 bits (112),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 55/90 (61%), Gaps = 4/90 (4%)
 Frame = +1

Query  265  ACEGTLYPELCVSTLATALPDRRAKTIPEIIA-ATVNVTVDEVKASAANCSGIRRKLPRL  441
            +C  T+YP+LC ++L  ++     +T P+++A A +NVT+   K+++A  S + ++   L
Sbjct  40   SCSTTIYPKLCYASL--SIHSSTIQTSPKLLANAALNVTLSSAKSTSAKMSTLSQR-HGL  96

Query  442  GPLEKRALDDCLELFSETRDELRKVLSDLA  531
             P E  A++DC+E  S+   EL+  + +++
Sbjct  97   KPREVSAMEDCVEELSDAVYELKNSIDEMS  126



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 672416417960