BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002D10

Length=586
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009790112.1|  PREDICTED: aldehyde dehydrogenase                  241   9e-74   Nicotiana sylvestris
ref|XP_009593287.1|  PREDICTED: aldehyde dehydrogenase                  241   1e-73   Nicotiana tomentosiformis
ref|XP_006363887.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    239   1e-72   Solanum tuberosum [potatoes]
ref|XP_004242034.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    236   1e-71   
ref|XP_008219616.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    223   1e-66   Prunus mume [ume]
gb|EYU23872.1|  hypothetical protein MIMGU_mgv1a005640mg                219   3e-65   Erythranthe guttata [common monkey flower]
sp|Q8VXQ2.1|ALDH_CRAPL  RecName: Full=Aldehyde dehydrogenase; Alt...    218   7e-65   Craterostigma plantagineum
ref|XP_004290886.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    218   8e-65   Fragaria vesca subsp. vesca
ref|XP_011069490.1|  PREDICTED: aldehyde dehydrogenase-like             218   2e-64   Sesamum indicum [beniseed]
ref|XP_004290887.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    216   1e-63   Fragaria vesca subsp. vesca
ref|XP_003544699.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    215   1e-63   Glycine max [soybeans]
ref|XP_011074837.1|  PREDICTED: aldehyde dehydrogenase                  214   2e-63   Sesamum indicum [beniseed]
gb|ACJ85852.1|  unknown                                                 214   4e-63   Medicago truncatula
gb|KEH40518.1|  NAD-dependent aldehyde dehydrogenase family protein     214   4e-63   Medicago truncatula
ref|XP_009379028.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    213   1e-62   Pyrus x bretschneideri [bai li]
gb|KGN54554.1|  hypothetical protein Csa_4G361880                       213   2e-62   Cucumis sativus [cucumbers]
ref|XP_008378442.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    213   2e-62   
gb|AGC65583.1|  fatty aldehyde dehydrogenase                            211   5e-62   Simmondsia chinensis [goatnut]
ref|XP_008365201.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    211   7e-62   Malus domestica [apple tree]
ref|XP_007222253.1|  hypothetical protein PRUPE_ppa004751mg             211   7e-62   Prunus persica
ref|XP_010243504.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    213   8e-62   Nelumbo nucifera [Indian lotus]
ref|XP_010243505.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    212   9e-62   
ref|XP_004498346.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    210   1e-61   Cicer arietinum [garbanzo]
ref|XP_003544698.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    210   2e-61   Glycine max [soybeans]
ref|XP_007019116.1|  Aldehyde dehydrogenase 3H1 isoform 1               210   2e-61   
ref|XP_007019117.1|  Aldehyde dehydrogenase 3H1 isoform 2               210   3e-61   
ref|XP_002306641.1|  the aldehyde dehydrogenase cp-ADH from C.pla...    209   3e-61   Populus trichocarpa [western balsam poplar]
ref|XP_007048537.1|  Aldehyde dehydrogenase 3I1 isoform 3               209   4e-61   
ref|XP_010674357.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    210   5e-61   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010674356.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    210   6e-61   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008444179.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    208   8e-61   Cucumis melo [Oriental melon]
ref|XP_004161166.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    208   8e-61   
ref|XP_007048536.1|  Aldehyde dehydrogenase 3I1 isoform 2               209   8e-61   
ref|XP_007048535.1|  Aldehyde dehydrogenase 3I1 isoform 1               209   1e-60   
gb|KJB64494.1|  hypothetical protein B456_010G051500                    204   1e-60   Gossypium raimondii
ref|XP_009379029.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    207   1e-60   Pyrus x bretschneideri [bai li]
ref|XP_010674968.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    207   1e-60   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006370386.1|  hypothetical protein POPTR_0001s421501g            206   2e-60   
ref|XP_006575169.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    207   2e-60   Glycine max [soybeans]
ref|NP_974679.1|  aldehyde dehydrogenase 3I1                            204   2e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008338656.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    207   2e-60   
ref|XP_011031097.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    208   2e-60   Populus euphratica
gb|EPS67420.1|  aldehyde dehydrogenase                                  199   3e-60   Genlisea aurea
gb|KCW70625.1|  hypothetical protein EUGRSUZ_F03800                     206   5e-60   Eucalyptus grandis [rose gum]
ref|XP_002302229.2|  the aldehyde dehydrogenase cp-ADH from C.pla...    206   5e-60   
ref|XP_007161479.1|  hypothetical protein PHAVU_001G072600g             206   5e-60   Phaseolus vulgaris [French bean]
ref|XP_010095408.1|  Aldehyde dehydrogenase family 3 member H1          206   6e-60   
ref|XP_002307060.1|  hypothetical protein POPTR_0005s07090g             206   6e-60   Populus trichocarpa [western balsam poplar]
ref|XP_002520352.1|  Aldehyde dehydrogenase, putative                   206   7e-60   
ref|XP_010063405.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    206   7e-60   Eucalyptus grandis [rose gum]
ref|XP_011003449.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    206   8e-60   Populus euphratica
ref|XP_010268979.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    205   9e-60   Nelumbo nucifera [Indian lotus]
ref|XP_010999403.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    205   9e-60   Populus euphratica
gb|KCW70623.1|  hypothetical protein EUGRSUZ_F03800                     206   1e-59   Eucalyptus grandis [rose gum]
ref|XP_006283479.1|  hypothetical protein CARUB_v10004527mg             206   2e-59   Capsella rubella
ref|XP_011027504.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    204   2e-59   Populus euphratica
gb|KEH40517.1|  NAD-dependent aldehyde dehydrogenase family protein     204   2e-59   Medicago truncatula
emb|CAN73659.1|  hypothetical protein VITISV_044129                     206   2e-59   Vitis vinifera
gb|KHN20611.1|  Aldehyde dehydrogenase family 3 member H1               207   2e-59   Glycine soja [wild soybean]
emb|CBI21614.3|  unnamed protein product                                205   3e-59   Vitis vinifera
ref|XP_002869163.1|  ALDH3I1                                            205   3e-59   Arabidopsis lyrata subsp. lyrata
ref|XP_002273730.2|  PREDICTED: aldehyde dehydrogenase family 3 m...    205   3e-59   Vitis vinifera
ref|NP_001288985.1|  aldehyde dehydrogenase family 3 member I1, c...    205   4e-59   Brassica rapa
ref|XP_009115077.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    205   4e-59   
gb|AID60136.1|  aldehyde dehydrogenase 3                                205   4e-59   Brassica napus [oilseed rape]
ref|XP_009115014.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    205   4e-59   
emb|CDX75414.1|  BnaA01g02880D                                          205   4e-59   
emb|CBI19000.3|  unnamed protein product                                205   4e-59   Vitis vinifera
gb|KFK30059.1|  hypothetical protein AALP_AA7G211500                    205   4e-59   Arabis alpina [alpine rockcress]
gb|KJB64493.1|  hypothetical protein B456_010G051500                    203   5e-59   Gossypium raimondii
gb|AAY23279.1|  aldehyde dehydrogenase, putative                        199   5e-59   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004498347.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    204   5e-59   
emb|CAC84903.1|  aldehyde dehydrogenase                                 204   8e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010664200.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    202   8e-59   Vitis vinifera
ref|NP_567962.1|  aldehyde dehydrogenase 3I1                            204   1e-58   Arabidopsis thaliana [mouse-ear cress]
gb|KJB75341.1|  hypothetical protein B456_012G037500                    202   1e-58   Gossypium raimondii
gb|EYU22982.1|  hypothetical protein MIMGU_mgv1a005625mg                202   1e-58   Erythranthe guttata [common monkey flower]
ref|XP_010664198.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    203   1e-58   Vitis vinifera
gb|KDP32847.1|  hypothetical protein JCGZ_12139                         202   2e-58   Jatropha curcas
ref|XP_010530214.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    202   2e-58   Tarenaya hassleriana [spider flower]
ref|XP_008227606.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    199   2e-58   Prunus mume [ume]
gb|KCW62442.1|  hypothetical protein EUGRSUZ_H05081                     199   2e-58   Eucalyptus grandis [rose gum]
ref|XP_004502485.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    201   2e-58   Cicer arietinum [garbanzo]
gb|KHG30796.1|  Aldehyde dehydrogenase family 3 member H1               202   2e-58   Gossypium arboreum [tree cotton]
ref|XP_010447116.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    202   3e-58   Camelina sativa [gold-of-pleasure]
ref|XP_008781593.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    201   3e-58   Phoenix dactylifera
gb|KCW62441.1|  hypothetical protein EUGRSUZ_H05081                     199   3e-58   Eucalyptus grandis [rose gum]
ref|XP_004502484.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    199   3e-58   
gb|KJB75338.1|  hypothetical protein B456_012G037500                    202   5e-58   Gossypium raimondii
ref|XP_008444183.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    201   5e-58   Cucumis melo [Oriental melon]
gb|KJB75340.1|  hypothetical protein B456_012G037500                    202   6e-58   Gossypium raimondii
gb|KJB75339.1|  hypothetical protein B456_012G037500                    202   6e-58   Gossypium raimondii
ref|XP_010432443.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    201   8e-58   Camelina sativa [gold-of-pleasure]
emb|CDX69039.1|  BnaC01g04140D                                          201   8e-58   
ref|XP_011002476.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    204   9e-58   Populus euphratica
gb|AES72293.2|  NAD-dependent aldehyde dehydrogenase family protein     200   1e-57   Medicago truncatula
ref|XP_004142628.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    199   1e-57   Cucumis sativus [cucumbers]
gb|KHN47009.1|  Aldehyde dehydrogenase family 3 member H1               199   1e-57   Glycine soja [wild soybean]
ref|XP_004502482.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    199   2e-57   Cicer arietinum [garbanzo]
ref|XP_008227591.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    199   2e-57   Prunus mume [ume]
gb|KJB29204.1|  hypothetical protein B456_005G089100                    197   2e-57   Gossypium raimondii
ref|XP_009420563.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    199   3e-57   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001065921.1|  Os11g0186200                                       198   3e-57   
ref|XP_006412252.1|  hypothetical protein EUTSA_v10024844mg             199   4e-57   Eutrema salsugineum [saltwater cress]
ref|XP_010437650.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    199   4e-57   Camelina sativa [gold-of-pleasure]
gb|KDO80593.1|  hypothetical protein CISIN_1g011107mg                   193   4e-57   Citrus sinensis [apfelsine]
ref|XP_009414877.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    198   6e-57   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006393739.1|  hypothetical protein EUTSA_v10011438mg             197   8e-57   Eutrema salsugineum [saltwater cress]
ref|XP_010025726.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    198   1e-56   Eucalyptus grandis [rose gum]
ref|XP_010025727.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    198   1e-56   Eucalyptus grandis [rose gum]
ref|XP_010539000.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    197   1e-56   Tarenaya hassleriana [spider flower]
ref|XP_008227590.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    198   1e-56   Prunus mume [ume]
gb|ACU23701.1|  unknown                                                 193   1e-56   Glycine max [soybeans]
gb|KDO80592.1|  hypothetical protein CISIN_1g011107mg                   194   1e-56   Citrus sinensis [apfelsine]
ref|XP_006434228.1|  hypothetical protein CICLE_v10000949mg             194   1e-56   
gb|KJB29202.1|  hypothetical protein B456_005G089100                    197   2e-56   Gossypium raimondii
gb|KHG28299.1|  Aldehyde dehydrogenase family 3 member H1               197   2e-56   Gossypium arboreum [tree cotton]
emb|CDY36336.1|  BnaC08g05150D                                          196   3e-56   Brassica napus [oilseed rape]
gb|ACJ85715.1|  unknown                                                 191   5e-56   Medicago truncatula
ref|XP_004503900.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    196   6e-56   Cicer arietinum [garbanzo]
gb|KDO80591.1|  hypothetical protein CISIN_1g011107mg                   194   6e-56   Citrus sinensis [apfelsine]
gb|KJB59280.1|  hypothetical protein B456_009G247000                    195   6e-56   Gossypium raimondii
ref|XP_003526638.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    195   7e-56   
ref|XP_008444182.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    195   8e-56   Cucumis melo [Oriental melon]
ref|XP_006662789.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    195   8e-56   Oryza brachyantha
ref|XP_004503899.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    196   8e-56   Cicer arietinum [garbanzo]
ref|XP_011468213.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    196   1e-55   Fragaria vesca subsp. vesca
ref|XP_009383529.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    195   1e-55   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY36018.1|  BnaA08g04430D                                          194   1e-55   Brassica napus [oilseed rape]
ref|XP_006472804.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    194   2e-55   Citrus sinensis [apfelsine]
ref|XP_006434229.1|  hypothetical protein CICLE_v10000949mg             194   2e-55   Citrus clementina [clementine]
ref|XP_008387507.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    194   3e-55   
ref|XP_003602042.1|  Aldehyde dehydrogenase family 3 member H1          193   4e-55   
ref|XP_008367720.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    194   4e-55   
ref|XP_010461437.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    193   5e-55   Camelina sativa [gold-of-pleasure]
gb|ACG29168.1|  aldehyde dehydrogenase, dimeric NADP-preferring         192   5e-55   Zea mays [maize]
ref|XP_004502483.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    193   5e-55   
ref|XP_003523436.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    192   5e-55   
ref|NP_001148092.1|  aldehyde dehydrogenase, dimeric NADP-preferring    192   5e-55   
ref|XP_010500136.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    192   6e-55   Camelina sativa [gold-of-pleasure]
ref|XP_010479042.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    192   6e-55   Camelina sativa [gold-of-pleasure]
ref|XP_009107480.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    192   6e-55   Brassica rapa
gb|ACF85700.1|  unknown                                                 192   7e-55   Zea mays [maize]
ref|XP_002888606.1|  ALDH3H1                                            192   1e-54   
ref|XP_003630349.1|  Aldehyde dehydrogenase family 3 member H1          193   1e-54   
gb|AET04825.2|  NAD-dependent aldehyde dehydrogenase family protein     193   1e-54   Medicago truncatula
gb|KHG30273.1|  Aldehyde dehydrogenase family 3 member H1               192   1e-54   Gossypium arboreum [tree cotton]
gb|KFK24209.1|  hypothetical protein AALP_AAs42301U000200               191   2e-54   Arabis alpina [alpine rockcress]
emb|CDY25655.1|  BnaC05g25340D                                          189   2e-54   Brassica napus [oilseed rape]
tpg|DAA38940.1|  TPA: hypothetical protein ZEAMMB73_547503              187   2e-54   
ref|XP_007137428.1|  hypothetical protein PHAVU_009G126400g             191   4e-54   Phaseolus vulgaris [French bean]
gb|AAX96338.1|  aldehyde dehydrogenase, putative                        190   6e-54   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009145048.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    190   7e-54   Brassica rapa
ref|XP_010930724.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    190   7e-54   Elaeis guineensis
gb|ABR16899.1|  unknown                                                 190   1e-53   Picea sitchensis
ref|XP_006663868.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    189   2e-53   
ref|XP_003532071.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    189   2e-53   
emb|CAE51203.1|  putative aldehyde dehydrogenase                        188   3e-53   Arabidopsis thaliana [mouse-ear cress]
gb|AAM61211.1|  aldehyde dehydrogenase, putative                        188   4e-53   Arabidopsis thaliana [mouse-ear cress]
ref|NP_175081.1|  aldehyde dehydrogenase 3H1                            188   4e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006304446.1|  hypothetical protein CARUB_v10011079mg             187   4e-53   Capsella rubella
gb|KDO52217.1|  hypothetical protein CISIN_1g009109mg                   186   7e-53   Citrus sinensis [apfelsine]
ref|XP_006432085.1|  hypothetical protein CICLE_v10000776mg             186   7e-53   
ref|NP_001168661.1|  hypothetical protein                               187   8e-53   Zea mays [maize]
gb|EPS67391.1|  aldehyde dehydrogenase                                  186   8e-53   Genlisea aurea
gb|ABA96616.1|  aldehyde dehydrogenase family protein, expressed        187   8e-53   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008668343.1|  PREDICTED: hypothetical protein isoform X1         187   2e-52   Zea mays [maize]
ref|XP_007159875.1|  hypothetical protein PHAVU_002G275200g             187   2e-52   Phaseolus vulgaris [French bean]
gb|KDO52216.1|  hypothetical protein CISIN_1g009109mg                   186   3e-52   Citrus sinensis [apfelsine]
dbj|BAK01937.1|  predicted protein                                      185   5e-52   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KDO52215.1|  hypothetical protein CISIN_1g009109mg                   186   5e-52   Citrus sinensis [apfelsine]
ref|XP_006432086.1|  hypothetical protein CICLE_v10000776mg             186   6e-52   Citrus clementina [clementine]
ref|XP_003577758.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    184   6e-52   Brachypodium distachyon [annual false brome]
ref|XP_009355864.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    183   3e-51   
ref|XP_009355863.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    182   1e-50   Pyrus x bretschneideri [bai li]
ref|XP_010547357.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    181   5e-50   Tarenaya hassleriana [spider flower]
ref|XP_004977224.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    179   5e-50   Setaria italica
ref|XP_004977223.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    179   9e-50   
ref|XP_009404859.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    179   1e-49   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO80584.1|  hypothetical protein CISIN_1g011107mg                   178   2e-49   Citrus sinensis [apfelsine]
gb|ABK24239.1|  unknown                                                 177   2e-49   Picea sitchensis
ref|XP_010238657.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    175   3e-48   Brachypodium distachyon [annual false brome]
ref|XP_002449124.1|  hypothetical protein SORBIDRAFT_05g005470          175   3e-48   
ref|XP_002441918.1|  hypothetical protein SORBIDRAFT_08g004840          174   7e-48   Sorghum bicolor [broomcorn]
gb|EMT33845.1|  Aldehyde dehydrogenase family 3 member H1               174   8e-48   
ref|XP_008368060.1|  PREDICTED: aldehyde dehydrogenase-like             161   2e-46   
gb|ACL53721.1|  unknown                                                 170   2e-46   Zea mays [maize]
ref|NP_001152171.1|  aldehyde dehydrogenase, dimeric NADP-preferring    170   2e-46   Zea mays [maize]
ref|XP_007213817.1|  hypothetical protein PRUPE_ppa005609mg             164   1e-44   
ref|XP_001764841.1|  variable substrate                                 164   4e-44   
gb|EEC67815.1|  hypothetical protein OsI_35392                          154   6e-44   Oryza sativa Indica Group [Indian rice]
ref|XP_001780129.1|  variable substrate                                 162   2e-43   
gb|KJB75337.1|  hypothetical protein B456_012G037500                    158   3e-42   Gossypium raimondii
ref|XP_002978104.1|  hypothetical protein SELMODRAFT_271300             157   9e-42   
ref|XP_002966639.1|  hypothetical protein SELMODRAFT_227647             157   9e-42   
ref|XP_001757163.1|  variable substrate                                 153   3e-40   
gb|EMS62407.1|  Aldehyde dehydrogenase family 3 member H1               152   5e-40   Triticum urartu
gb|EMS67814.1|  Aldehyde dehydrogenase family 3 member I1, chloro...    143   2e-39   Triticum urartu
ref|XP_010679827.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    150   2e-39   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_001197038.2|  PREDICTED: aldehyde dehydrogenase-like             144   4e-39   
ref|XP_004142629.1|  PREDICTED: LOW QUALITY PROTEIN: aldehyde deh...    146   6e-38   
gb|EAZ19830.1|  hypothetical protein OsJ_35414                          145   2e-37   Oryza sativa Japonica Group [Japonica rice]
ref|WP_006011635.1|  aldehyde dehydrogenase                             144   4e-37   Glaciecola pallidula
gb|EAY82454.1|  hypothetical protein OsI_37671                          144   4e-37   Oryza sativa Indica Group [Indian rice]
ref|XP_010651247.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    143   5e-37   Vitis vinifera
ref|XP_010651245.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    143   6e-37   Vitis vinifera
ref|XP_010651246.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    143   7e-37   Vitis vinifera
ref|XP_004170348.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    140   1e-36   
ref|XP_006596209.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    142   1e-36   Glycine max [soybeans]
ref|XP_002285466.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    143   1e-36   Vitis vinifera
ref|WP_009627619.1|  Aldehyde Dehydrogenase                             142   2e-36   Pseudanabaena biceps
emb|CDP01945.1|  unnamed protein product                                142   2e-36   Coffea canephora [robusta coffee]
ref|XP_009109317.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    142   2e-36   Brassica rapa
ref|XP_002978037.1|  hypothetical protein SELMODRAFT_268146             142   3e-36   
ref|XP_002966702.1|  hypothetical protein SELMODRAFT_168397             141   5e-36   
ref|XP_001767194.1|  variable substrate                                 141   5e-36   
emb|CDY35463.1|  BnaC03g61970D                                          141   7e-36   Brassica napus [oilseed rape]
emb|CDY24790.1|  BnaA08g15200D                                          141   8e-36   Brassica napus [oilseed rape]
ref|XP_009768441.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    140   9e-36   Nicotiana sylvestris
gb|KGN54173.1|  hypothetical protein Csa_4G291370                       140   1e-35   Cucumis sativus [cucumbers]
ref|XP_004142118.1|  PREDICTED: LOW QUALITY PROTEIN: aldehyde deh...    140   1e-35   
ref|WP_041246595.1|  aldehyde dehydrogenase                             140   1e-35   
gb|AEP28780.1|  NAD-dependent aldehyde dehydrogenase                    140   2e-35   Glaciecola nitratireducens FR1064
ref|XP_010547359.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    139   2e-35   Tarenaya hassleriana [spider flower]
ref|WP_005142534.1|  aldehyde dehydrogenase                             139   3e-35   Mycolicibacterium rhodesiae
ref|XP_009138416.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    139   4e-35   Brassica rapa
ref|XP_009138415.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    139   4e-35   Brassica rapa
emb|CDX72584.1|  BnaC07g46060D                                          139   4e-35   
ref|WP_006946046.1|  Aldehyde dehydrogenase                             138   5e-35   Rhodococcus sp. EsD8
ref|WP_043390663.1|  aldehyde dehydrogenase                             138   7e-35   Mycobacterium sp. UNC280MFTsu5.1
ref|XP_006370384.1|  hypothetical protein POPTR_0001s421501g            136   8e-35   
ref|WP_043983956.1|  aldehyde dehydrogenase                             138   8e-35   Mycolicibacterium llatzerense
ref|XP_008449722.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    138   8e-35   Cucumis melo [Oriental melon]
ref|WP_015772232.1|  aldehyde dehydrogenase                             137   1e-34   Jonesia denitrificans
ref|XP_002452841.1|  hypothetical protein SORBIDRAFT_04g033420          137   1e-34   Sorghum bicolor [broomcorn]
ref|XP_008219617.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    137   1e-34   
emb|CDY59717.1|  BnaA03g59170D                                          137   1e-34   Brassica napus [oilseed rape]
emb|CDX77447.1|  BnaA07g05850D                                          137   1e-34   
emb|CDX69216.1|  BnaC01g02370D                                          137   2e-34   
ref|WP_026413602.1|  aldehyde dehydrogenase                             137   2e-34   Actinomadura oligospora
ref|WP_020098975.1|  hypothetical protein                               137   2e-34   Mycobacterium sp. 360MFTsu5.1
ref|XP_003580245.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    137   2e-34   Brachypodium distachyon [annual false brome]
ref|WP_008182868.1|  aldehyde dehydrogenase                             136   3e-34   Moorea producens
gb|KJB17707.1|  hypothetical protein B456_003G011600                    134   3e-34   Gossypium raimondii
ref|XP_009145598.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    136   4e-34   Brassica rapa
ref|WP_044449982.1|  aldehyde dehydrogenase                             136   4e-34   Mastigocladus laminosus
ref|WP_019148953.1|  hypothetical protein                               136   4e-34   Timonella senegalensis
ref|WP_036342552.1|  aldehyde dehydrogenase                             136   4e-34   Mycolicibacterium aromaticivorans
gb|KJB64495.1|  hypothetical protein B456_010G051500                    135   4e-34   Gossypium raimondii
gb|AFW72558.1|  hypothetical protein ZEAMMB73_265586                    134   5e-34   
ref|WP_034714402.1|  aldehyde dehydrogenase                             135   5e-34   Intrasporangium chromatireducens
ref|WP_026294544.1|  aldehyde dehydrogenase                             135   6e-34   
ref|XP_008337865.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    135   6e-34   
ref|WP_029121416.1|  aldehyde dehydrogenase                             135   7e-34   Mycobacterium
ref|WP_040863110.1|  aldehyde dehydrogenase                             135   7e-34   Nocardia niigatensis
gb|KJB17709.1|  hypothetical protein B456_003G011600                    134   8e-34   Gossypium raimondii
gb|KJB17708.1|  hypothetical protein B456_003G011600                    134   9e-34   Gossypium raimondii
ref|WP_043058938.1|  hypothetical protein                               135   9e-34   
ref|XP_002115478.1|  hypothetical protein TRIADDRAFT_59449              135   9e-34   Trichoplax adhaerens
ref|XP_008803615.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    135   1e-33   Phoenix dactylifera
ref|WP_028953736.1|  aldehyde dehydrogenase                             134   1e-33   Synechococcus sp. CC9616
gb|EEC73696.1|  hypothetical protein OsI_08280                          134   1e-33   Oryza sativa Indica Group [Indian rice]
ref|WP_018088578.1|  hypothetical protein                               134   1e-33   
ref|XP_010919365.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    134   2e-33   Elaeis guineensis
ref|NP_001147083.1|  LOC100280692                                       134   2e-33   Zea mays [maize]
gb|KJB17706.1|  hypothetical protein B456_003G011600                    134   2e-33   Gossypium raimondii
ref|WP_041308647.1|  aldehyde dehydrogenase                             134   2e-33   
ref|XP_001770374.1|  variable substrate                                 134   2e-33   
ref|WP_002673810.1|  hypothetical protein                               134   2e-33   Treponema denticola
ref|WP_026722884.1|  aldehyde dehydrogenase                             134   2e-33   Fischerella sp. PCC 9431
gb|KFK30260.1|  hypothetical protein AALP_AA7G238000                    134   3e-33   Arabis alpina [alpine rockcress]
ref|WP_037194680.1|  aldehyde dehydrogenase                             133   3e-33   
ref|XP_006340688.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    134   3e-33   Solanum tuberosum [potatoes]
gb|KEH39462.1|  NAD-dependent aldehyde dehydrogenase family protein     134   3e-33   Medicago truncatula
ref|WP_043403838.1|  aldehyde dehydrogenase                             134   3e-33   
ref|XP_003597427.1|  Aldehyde dehydrogenase family 3 member F1          134   3e-33   
ref|WP_017310244.1|  aldehyde dehydrogenase                             133   3e-33   Fischerella sp. PCC 9339
ref|WP_002688230.1|  hypothetical protein                               133   3e-33   Treponema denticola
gb|EPS59682.1|  aldehyde dehydrogenase                                  133   4e-33   Genlisea aurea
gb|AAR21278.1|  fatty aldehyde dehydrogenase 1                          133   4e-33   
gb|AFW65463.1|  hypothetical protein ZEAMMB73_893012                    133   4e-33   
ref|XP_011090413.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    133   4e-33   
ref|XP_007202020.1|  hypothetical protein PRUPE_ppa004971mg             133   4e-33   
ref|XP_006412015.1|  hypothetical protein EUTSA_v10025045mg             133   4e-33   
gb|KHG21488.1|  Aldehyde dehydrogenase family 3 member F1               133   5e-33   
ref|WP_029114337.1|  aldehyde dehydrogenase                             133   5e-33   
ref|NP_001047575.1|  Os02g0646500                                       133   5e-33   
ref|XP_008643572.1|  PREDICTED: LOC100280692 isoform X1                 134   5e-33   
gb|EEE57473.1|  hypothetical protein OsJ_07716                          133   5e-33   
ref|WP_010698015.1|  hypothetical protein                               132   6e-33   
ref|WP_012954453.1|  aldehyde dehydrogenase                             132   6e-33   
ref|XP_003520274.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    133   6e-33   
ref|WP_025157096.1|  aldehyde dehydrogenase                             132   7e-33   
gb|ADU48656.1|  Aldehyde Dehydrogenase                                  132   7e-33   
ref|XP_006652592.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    132   7e-33   
ref|WP_014210046.1|  aldehyde dehydrogenase                             132   7e-33   
ref|WP_038543308.1|  aldehyde dehydrogenase                             132   8e-33   
ref|WP_010353711.1|  aldehyde dehydrogenase                             132   8e-33   
ref|XP_006283636.1|  hypothetical protein CARUB_v10004694mg             132   8e-33   
ref|WP_036972443.1|  aldehyde dehydrogenase                             127   8e-33   
ref|XP_006829153.1|  hypothetical protein AMTR_s00001p00269720          132   9e-33   
gb|AAD35089.1|AF148877_1  putative aldehyde dehydrogenase OS-ALDH       132   9e-33   
ref|WP_015244977.1|  aldehyde dehydrogenase                             132   1e-32   
ref|WP_012597585.1|  aldehyde dehydrogenase                             132   1e-32   
gb|EEC73694.1|  hypothetical protein OsI_08277                          132   1e-32   
emb|CAA18131.1|  aldehyde dehydrogenase like protein                    132   1e-32   
ref|WP_032367167.1|  aldehyde dehydrogenase                             132   1e-32   
gb|AFK48458.1|  unknown                                                 132   1e-32   
ref|NP_195348.2|  aldehyde dehydrogenase 3F1                            132   1e-32   
ref|XP_009378224.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    132   1e-32   
ref|XP_003629375.1|  Aldehyde dehydrogenase family 3 member F1          132   1e-32   
gb|AAB33154.1|  class-3 aldehyde dehydrogenase, class-3 ALDH            132   1e-32   
ref|WP_011243342.1|  MULTISPECIES: aldehyde dehydrogenase               132   1e-32   
ref|XP_003547955.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    132   1e-32   
ref|WP_005141490.1|  aldehyde dehydrogenase                             131   1e-32   
ref|XP_006647606.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    132   2e-32   
ref|WP_017654159.1|  aldehyde dehydrogenase                             131   2e-32   
ref|WP_038001567.1|  aldehyde dehydrogenase                             131   2e-32   
gb|AII42523.1|  aldehyde dehydrogenase                                  131   2e-32   
gb|EAQ68197.1|  Putative aldehyde dehydrogenase                         131   2e-32   
emb|CAE48163.1|  putative aldehyde dehydrogenase                        131   2e-32   
gb|KDP22085.1|  hypothetical protein JCGZ_25916                         131   2e-32   
ref|XP_011025893.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    131   2e-32   
dbj|BAJ89426.1|  predicted protein                                      129   2e-32   
ref|WP_010154891.1|  aldehyde dehydrogenase                             131   2e-32   
ref|XP_002869039.1|  ALDH3F1                                            131   2e-32   
ref|NP_001047578.1|  Os02g0647900                                       131   2e-32   
gb|AIN92873.1|  aldehyde dehydrogenase                                  131   2e-32   
ref|WP_010689581.1|  hypothetical protein                               131   2e-32   
ref|WP_002691376.1|  hypothetical protein                               131   2e-32   
dbj|BAD25530.1|  putative aldehyde dehydrogenase                        131   3e-32   
ref|WP_002675966.1|  aldehyde dehydrogenase                             131   3e-32   
ref|WP_011124529.1|  aldehyde dehydrogenase                             131   3e-32   
ref|WP_036891691.1|  MULTISPECIES: aldehyde dehydrogenase               130   3e-32   
ref|WP_002667397.1|  aldehyde dehydrogenase                             130   3e-32   
ref|WP_010694958.1|  hypothetical protein                               130   3e-32   
ref|WP_020171844.1|  aldehyde dehydrogenase                             130   3e-32   
ref|WP_006373067.1|  aldehyde dehydrogenase                             130   3e-32   
ref|WP_019509869.1|  MULTISPECIES: aldehyde dehydrogenase               130   3e-32   
ref|WP_036471060.1|  aldehyde dehydrogenase                             130   3e-32   
ref|XP_008241772.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    130   3e-32   
ref|WP_012689728.1|  aldehyde dehydrogenase                             130   4e-32   
ref|XP_009346294.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    130   4e-32   
ref|WP_002684196.1|  hypothetical protein                               130   5e-32   
ref|WP_013785591.1|  aldehyde dehydrogenase                             130   5e-32   
ref|WP_033220514.1|  aldehyde dehydrogenase                             130   5e-32   
ref|XP_002310836.1|  mRNA for putative aldehyde dehydrogenase fam...    130   6e-32   
gb|KJB29203.1|  hypothetical protein B456_005G089100                    129   7e-32   
ref|WP_043415890.1|  aldehyde dehydrogenase                             129   8e-32   
gb|EUA67893.1|  aldehyde dehydrogenase, dimeric NADP-preferring         128   8e-32   
ref|XP_006647605.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    129   9e-32   
ref|XP_010093107.1|  Aldehyde dehydrogenase family 3 member I1          130   1e-31   
ref|WP_006242686.1|  aldehyde dehydrogenase                             129   1e-31   
ref|WP_015221757.1|  aldehyde dehydrogenase                             129   1e-31   
ref|XP_006466887.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    129   1e-31   
ref|WP_015130982.1|  aldehyde dehydrogenase                             129   1e-31   
ref|WP_036006670.1|  aldehyde dehydrogenase                             129   1e-31   
ref|WP_014678898.1|  aldehyde dehydrogenase                             129   2e-31   
ref|WP_031677664.1|  aldehyde dehydrogenase                             129   2e-31   
gb|KAW99412.1|  aldehyde dehydrogenase (NAD+)                           129   2e-31   
ref|XP_007156099.1|  hypothetical protein PHAVU_003G258500g             129   2e-31   
ref|XP_004146483.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    129   2e-31   
gb|KHG24071.1|  Aldehyde dehydrogenase family 3 member F1               128   2e-31   
gb|EWM24499.1|  aldehyde dehydrogenase                                  124   2e-31   
ref|XP_003569983.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    128   2e-31   
ref|XP_008338017.1|  PREDICTED: LOW QUALITY PROTEIN: aldehyde deh...    128   2e-31   
gb|EHI14476.1|  aldehyde dehydrogenase                                  128   2e-31   
ref|WP_013032890.1|  aldehyde dehydrogenase                             128   3e-31   
ref|WP_026549354.1|  aldehyde dehydrogenase                             128   3e-31   
ref|WP_040546047.1|  aldehyde dehydrogenase                             128   3e-31   
gb|ACU23437.1|  unknown                                                 124   3e-31   
ref|XP_011080288.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    128   3e-31   
ref|WP_036776366.1|  aldehyde dehydrogenase                             128   3e-31   
ref|XP_004976400.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    128   3e-31   
ref|WP_010283230.1|  aldehyde dehydrogenase                             128   3e-31   
ref|WP_029068306.1|  aldehyde dehydrogenase                             128   3e-31   
gb|EUA71493.1|  aldehyde dehydrogenase family protein                   125   3e-31   
ref|XP_010102335.1|  Aldehyde dehydrogenase family 3 member F1          128   3e-31   
ref|WP_026860473.1|  aldehyde dehydrogenase                             127   4e-31   
ref|WP_021763396.1|  aldehyde dehydrogenase family protein              127   4e-31   
ref|XP_004486968.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    128   4e-31   
ref|WP_026733532.1|  aldehyde dehydrogenase                             127   4e-31   
dbj|BAJ86301.1|  predicted protein                                      128   4e-31   
ref|WP_036910655.1|  MULTISPECIES: aldehyde dehydrogenase               127   4e-31   
gb|KDP32663.1|  hypothetical protein JCGZ_13661                         127   4e-31   
ref|XP_009411491.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    127   5e-31   
ref|WP_030550478.1|  aldehyde dehydrogenase                             127   5e-31   
ref|XP_002298405.2|  hypothetical protein POPTR_0001s26630g             127   5e-31   
ref|XP_009411490.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    127   5e-31   
ref|XP_004507095.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    127   5e-31   
ref|XP_006847205.1|  hypothetical protein AMTR_s00017p00253390          127   5e-31   
ref|WP_030279505.1|  aldehyde dehydrogenase                             127   5e-31   
ref|WP_016862719.1|  aldehyde dehydrogenase                             127   5e-31   
ref|WP_005063807.1|  aldehyde dehydrogenase                             127   6e-31   
ref|XP_004228361.2|  PREDICTED: aldehyde dehydrogenase family 3 m...    127   6e-31   
gb|AGM31234.1|  aldehyde dehydrogenase                                  127   6e-31   
ref|WP_034771455.1|  aldehyde dehydrogenase                             127   6e-31   
ref|WP_043568121.1|  aldehyde dehydrogenase                             127   6e-31   
ref|WP_005079749.1|  MULTISPECIES: aldehyde dehydrogenase               127   6e-31   
ref|WP_034776546.1|  aldehyde dehydrogenase                             127   6e-31   
ref|WP_030855051.1|  aldehyde dehydrogenase                             127   7e-31   
ref|XP_008453718.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    127   7e-31   
ref|WP_033268258.1|  aldehyde dehydrogenase                             127   7e-31   
ref|WP_030282498.1|  aldehyde dehydrogenase                             127   7e-31   
gb|EKC37261.1|  Aldehyde dehydrogenase family 3 member B1               121   8e-31   
ref|WP_038023881.1|  aldehyde dehydrogenase                             127   8e-31   
ref|WP_009457992.1|  aldehyde dehydrogenase                             127   8e-31   
ref|XP_010271510.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    127   8e-31   
ref|XP_006425564.1|  hypothetical protein CICLE_v10025492mg             127   9e-31   
ref|WP_041630354.1|  aldehyde dehydrogenase                             126   9e-31   
dbj|GAB56820.1|  aldehyde dehydrogenase                                 127   9e-31   
ref|WP_005078793.1|  aldehyde dehydrogenase                             126   9e-31   
ref|WP_017740423.1|  hypothetical protein                               126   9e-31   
gb|KHN25245.1|  Aldehyde dehydrogenase family 3 member F1               126   9e-31   
ref|WP_006861193.1|  aldehyde dehydrogenase                             126   9e-31   
ref|WP_016887716.1|  aldehyde dehydrogenase                             126   1e-30   
ref|WP_040521178.1|  aldehyde dehydrogenase                             126   1e-30   
gb|EAU72958.1|  Putative aldehyde dehydrogenase                         126   1e-30   
ref|WP_008846550.1|  aldehyde dehydrogenase                             126   1e-30   
ref|WP_033347589.1|  aldehyde dehydrogenase                             126   1e-30   
ref|XP_009060246.1|  hypothetical protein LOTGIDRAFT_229102             126   1e-30   
ref|WP_020075164.1|  hypothetical protein                               126   1e-30   
ref|WP_017681582.1|  aldehyde dehydrogenase                             126   1e-30   
ref|WP_020745285.1|  NAD-dependent aldehyde dehydrogenase               126   1e-30   
ref|WP_023369511.1|  aldehyde dehydrogenase                             126   1e-30   
gb|EJF10084.1|  aldehyde dehydrogenase                                  122   2e-30   
ref|XP_003539464.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    126   2e-30   
ref|XP_001629556.1|  predicted protein                                  126   2e-30   
ref|WP_012517091.1|  aldehyde dehydrogenase                             126   2e-30   
ref|WP_024015640.1|  NAD-dependent aldehyde dehydrogenase               126   2e-30   
ref|WP_011128814.1|  aldehyde dehydrogenase                             125   2e-30   
ref|WP_021255569.1|  aldehyde dehydrogenase                             125   2e-30   
ref|WP_020742797.1|  NAD-dependent aldehyde dehydrogenase               125   2e-30   
ref|WP_036667375.1|  aldehyde dehydrogenase                             125   2e-30   
ref|WP_025982115.1|  aldehyde dehydrogenase                             125   2e-30   
ref|WP_005101546.1|  aldehyde dehydrogenase                             125   2e-30   
ref|WP_028788951.1|  aldehyde dehydrogenase                             125   2e-30   
ref|WP_017321468.1|  hypothetical protein                               125   2e-30   
gb|EAQ74199.1|  Putative aldehyde dehydrogenase                         125   2e-30   
ref|WP_005066283.1|  aldehyde dehydrogenase                             125   2e-30   
ref|WP_042788680.1|  aldehyde dehydrogenase                             125   2e-30   
dbj|BAJ96457.1|  predicted protein                                      125   2e-30   
ref|WP_016866084.1|  aldehyde dehydrogenase                             125   2e-30   
ref|WP_037681124.1|  aldehyde dehydrogenase                             125   3e-30   
ref|WP_011129570.1|  aldehyde dehydrogenase                             125   3e-30   
ref|XP_004287846.2|  PREDICTED: aldehyde dehydrogenase family 3 m...    126   3e-30   
gb|KHN00502.1|  Aldehyde dehydrogenase family 3 member F1               125   3e-30   
ref|WP_006367226.1|  aldehyde dehydrogenase                             125   3e-30   
gb|EPS70846.1|  aldehyde dehydrogenase                                  124   3e-30   
ref|XP_003569985.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    125   3e-30   
ref|XP_010673629.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    125   3e-30   
ref|WP_044473555.1|  aldehyde dehydrogenase                             125   3e-30   
ref|WP_016871050.1|  aldehyde dehydrogenase                             125   3e-30   
ref|WP_010595361.1|  MULTISPECIES: aldehyde dehydrogenase               125   4e-30   
gb|AEK35689.1|  hypothetical protein CVAR_0341                          125   4e-30   
ref|XP_004953284.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    125   4e-30   
ref|WP_030983991.1|  aldehyde dehydrogenase                             125   4e-30   
gb|ELP63500.1|  aldehyde dehydrogenase (NAD) family protein             125   4e-30   
ref|WP_035882987.1|  aldehyde dehydrogenase                             124   4e-30   
ref|WP_011360599.1|  aldehyde dehydrogenase                             124   4e-30   
ref|WP_037979919.1|  aldehyde dehydrogenase                             124   5e-30   
ref|WP_006936525.1|  MULTISPECIES: Aldehyde dehydrogenase               124   5e-30   
ref|WP_029543913.1|  aldehyde dehydrogenase                             124   5e-30   
ref|WP_014997181.1|  aldehyde dehydrogenase                             124   5e-30   
ref|XP_010316396.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    124   5e-30   
ref|XP_002164581.1|  PREDICTED: aldehyde dehydrogenase, dimeric N...    124   5e-30   
ref|WP_036057889.1|  aldehyde dehydrogenase                             124   5e-30   
ref|XP_007046778.1|  Aldehyde dehydrogenase 3F1 isoform 1               124   5e-30   
ref|WP_004019430.1|  aldehyde dehydrogenase                             124   5e-30   
ref|WP_026533124.1|  aldehyde dehydrogenase                             124   6e-30   
ref|WP_037875564.1|  aldehyde dehydrogenase                             124   6e-30   
ref|WP_010933544.1|  aldehyde dehydrogenase                             124   6e-30   
ref|WP_041391013.1|  aldehyde dehydrogenase                             124   6e-30   
gb|ACF46930.1|  Aldehyde Dehydrogenase                                  124   6e-30   
ref|WP_037227376.1|  aldehyde dehydrogenase                             124   6e-30   
ref|XP_003964356.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    119   6e-30   
ref|WP_018190431.1|  hypothetical protein                               124   6e-30   
ref|WP_015116802.1|  NAD-dependent aldehyde dehydrogenase               124   6e-30   
ref|XP_010432186.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    124   6e-30   
ref|WP_025256720.1|  aldehyde dehydrogenase                             124   7e-30   
gb|AEH09325.1|  Aldehyde Dehydrogenase                                  124   7e-30   
ref|WP_036462219.1|  aldehyde dehydrogenase                             124   7e-30   
ref|WP_015157396.1|  aldehyde dehydrogenase                             124   8e-30   
ref|WP_025737394.1|  aldehyde dehydrogenase                             124   8e-30   
ref|WP_030357521.1|  MULTISPECIES: aldehyde dehydrogenase               124   8e-30   
ref|XP_005822267.1|  hypothetical protein GUITHDRAFT_146595             126   8e-30   
ref|WP_037988062.1|  aldehyde dehydrogenase                             124   9e-30   
ref|WP_039225033.1|  aldehyde dehydrogenase                             124   9e-30   
ref|WP_014978186.1|  aldehyde dehydrogenase                             124   9e-30   
ref|WP_014948110.1|  aldehyde dehydrogenase                             124   9e-30   
ref|XP_011430143.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    124   9e-30   
ref|WP_014975532.1|  aldehyde dehydrogenase                             124   9e-30   
ref|WP_039219343.1|  aldehyde dehydrogenase                             124   9e-30   
ref|WP_017316439.1|  aldehyde dehydrogenase                             124   1e-29   
ref|XP_009023429.1|  hypothetical protein HELRODRAFT_185832             124   1e-29   
ref|WP_012392341.1|  aldehyde dehydrogenase                             124   1e-29   
ref|WP_017598870.1|  aldehyde dehydrogenase                             124   1e-29   
ref|WP_030559087.1|  aldehyde dehydrogenase                             123   1e-29   
ref|WP_006854756.1|  aldehyde dehydrogenase                             124   1e-29   
gb|AGC60457.1|  aldehyde dehydrogenase                                  124   1e-29   



>ref|XP_009790112.1| PREDICTED: aldehyde dehydrogenase [Nicotiana sylvestris]
Length=477

 Score =   241 bits (616),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 128/163 (79%), Positives = 146/163 (90%), Gaps = 0/163 (0%)
 Frame = +1

Query  97   MDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFV  276
            +DA A V ELRET+A+GKTK+YEWRVSQLKA+LKIAEHHEK I+DAL SDLSKPELE FV
Sbjct  4    VDAEAIVKELRETYASGKTKNYEWRVSQLKALLKIAEHHEKEIVDALNSDLSKPELECFV  63

Query  277  HEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLS  456
            HEI+ +K SCK ALKELKRWMKPE VK++  T+PSSA+IV EP GVVLVISAWNYPF+LS
Sbjct  64   HEISMMKTSCKHALKELKRWMKPEKVKTSLTTFPSSAEIVPEPFGVVLVISAWNYPFLLS  123

Query  457  LDPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            LDPVIGAIAAGNAVVLKPSE+APATSS+LAKL  +YMD TA++
Sbjct  124  LDPVIGAIAAGNAVVLKPSEVAPATSSVLAKLLGEYMDVTAIR  166



>ref|XP_009593287.1| PREDICTED: aldehyde dehydrogenase [Nicotiana tomentosiformis]
Length=477

 Score =   241 bits (615),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 128/163 (79%), Positives = 146/163 (90%), Gaps = 0/163 (0%)
 Frame = +1

Query  97   MDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFV  276
            +DA A V ELRET+A+GKTK+YEWRVSQLKA+LKIAEHHEK I+DAL SDLSKPELE FV
Sbjct  4    VDAEAIVKELRETYASGKTKNYEWRVSQLKALLKIAEHHEKEIVDALNSDLSKPELECFV  63

Query  277  HEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLS  456
            HEI+ +K SCK ALK+LKRWMKPE VK++  T+PSSA+IV EP GVVLVISAWNYPF+LS
Sbjct  64   HEISMMKTSCKHALKQLKRWMKPEKVKTSLTTFPSSAEIVPEPFGVVLVISAWNYPFLLS  123

Query  457  LDPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            LDPVIGAIAAGNAVVLKPSEIAPATSS+LAKL  +YMD TA++
Sbjct  124  LDPVIGAIAAGNAVVLKPSEIAPATSSVLAKLLGEYMDATAIR  166



>ref|XP_006363887.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Solanum 
tuberosum]
Length=474

 Score =   239 bits (609),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 125/163 (77%), Positives = 144/163 (88%), Gaps = 0/163 (0%)
 Frame = +1

Query  97   MDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFV  276
            MDA A V ELR T+  GKTKSYEWRVSQLKA+ KIAE+HEK I DAL+SDLSKPELE+F+
Sbjct  1    MDAEAIVKELRGTYGTGKTKSYEWRVSQLKALFKIAENHEKEITDALYSDLSKPELEAFI  60

Query  277  HEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLS  456
            HEI+ +K +CKLALKELKRWMKPE VK++  ++PSSA+IV EPLGVVLVISAWNYPF+LS
Sbjct  61   HEISMMKTACKLALKELKRWMKPEKVKTSLTSFPSSAEIVPEPLGVVLVISAWNYPFLLS  120

Query  457  LDPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            LDPVIGAIAAGNAVVLKPSEIAPATSS+LAKL   YMD +A++
Sbjct  121  LDPVIGAIAAGNAVVLKPSEIAPATSSVLAKLLGQYMDVSAIR  163



>ref|XP_004242034.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Solanum 
lycopersicum]
Length=474

 Score =   236 bits (601),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 124/163 (76%), Positives = 145/163 (89%), Gaps = 0/163 (0%)
 Frame = +1

Query  97   MDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFV  276
            MDA A V ELR T+ +GKTKSYEWRVSQLKA+LKIAE+HEK I DAL+SDLSKPELE+F+
Sbjct  1    MDAEAIVKELRGTYGSGKTKSYEWRVSQLKALLKIAENHEKEITDALYSDLSKPELEAFI  60

Query  277  HEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLS  456
            HE++ +K +CKLALKELK WMKPE VK++  ++PSSA+IV EPLGVVLVISAWNYPF+LS
Sbjct  61   HEVSMMKTACKLALKELKWWMKPEKVKTSLTSFPSSAEIVPEPLGVVLVISAWNYPFLLS  120

Query  457  LDPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            LDPVIGAIAAGNAVVLKPSEIAPATSS+LAKL   YMD +A++
Sbjct  121  LDPVIGAIAAGNAVVLKPSEIAPATSSVLAKLLGQYMDVSAIR  163



>ref|XP_008219616.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 isoform 
X1 [Prunus mume]
Length=491

 Score =   223 bits (569),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 113/162 (70%), Positives = 142/162 (88%), Gaps = 0/162 (0%)
 Frame = +1

Query  100  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  279
            DA   V ELR ++ +GKT+SYEWR SQLK +LK+AEHHE+ I+DAL SDLSKPE E++V 
Sbjct  16   DALTMVEELRGSYGSGKTRSYEWRESQLKNLLKVAEHHEQEIVDALRSDLSKPEFEAYVQ  75

Query  280  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  459
            EI+ +K+SCKLALKEL+ WMKPE  K++  T+PSSA+IVSEPLGV+L+ISAWNYPF+LSL
Sbjct  76   EISMLKSSCKLALKELRNWMKPEKAKTSLTTFPSSAEIVSEPLGVILIISAWNYPFLLSL  135

Query  460  DPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            DPV+GAIAAGNAVVLKPSE+APATSSLLAKL  +YMD+++++
Sbjct  136  DPVVGAIAAGNAVVLKPSELAPATSSLLAKLVGEYMDSSSIR  177



>gb|EYU23872.1| hypothetical protein MIMGU_mgv1a005640mg [Erythranthe guttata]
Length=476

 Score =   219 bits (558),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 115/165 (70%), Positives = 141/165 (85%), Gaps = 0/165 (0%)
 Frame = +1

Query  91   LEMDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELES  270
            +E  A AAV ELR T ++GKTKSYEWR+SQLKA+LKI  HHE  I++AL SDL+KPE E+
Sbjct  1    MENMAEAAVKELRSTVSSGKTKSYEWRISQLKAILKIVTHHENEIIEALRSDLNKPEHEA  60

Query  271  FVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFM  450
            F+HEI  V +SCKLALKEL+RWMKP+ VK+   T+PSS +IV EPLGVVLVIS WNYPF+
Sbjct  61   FIHEIFSVASSCKLALKELRRWMKPQKVKTGMLTFPSSGEIVPEPLGVVLVISTWNYPFL  120

Query  451  LSLDPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            +++DPVIGAIAAGNAVVLKPSE+APATS+LL+KL  +Y+DT+AVK
Sbjct  121  IAVDPVIGAIAAGNAVVLKPSEVAPATSALLSKLLGEYLDTSAVK  165



>sp|Q8VXQ2.1|ALDH_CRAPL RecName: Full=Aldehyde dehydrogenase; AltName: Full=Cp-ALDH [Craterostigma 
plantagineum]
 emb|CAC84900.1| aldehyde dehydrogenase [Craterostigma plantagineum]
Length=479

 Score =   218 bits (556),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 140/164 (85%), Gaps = 0/164 (0%)
 Frame = +1

Query  94   EMDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESF  273
            ++DA   V  LR T+ +GKTKSYEWRVSQLKA+LKI  HH+K +++AL +DL KPE E++
Sbjct  3    QVDAEGVVDGLRRTYISGKTKSYEWRVSQLKALLKITTHHDKEVVEALRADLKKPEHEAY  62

Query  274  VHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFML  453
            VHEI  V  +CK ALKEL +WMKP+ VK++ ATYPSSA+IVSEPLGVVLVI+AWNYPF+L
Sbjct  63   VHEIFMVSNACKSALKELHQWMKPQKVKTSLATYPSSAEIVSEPLGVVLVITAWNYPFLL  122

Query  454  SLDPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            +LDP+IGAIAAGN VVLKPSEIAPATS+LLAKL N Y+DT+A++
Sbjct  123  ALDPMIGAIAAGNCVVLKPSEIAPATSALLAKLLNQYVDTSAIR  166



>ref|XP_004290886.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Fragaria vesca subsp. vesca]
Length=489

 Score =   218 bits (556),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 114/162 (70%), Positives = 141/162 (87%), Gaps = 0/162 (0%)
 Frame = +1

Query  100  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  279
            +AAA V ELR ++ +GKT+SYEWRVSQLK + KI E HEK I++AL SDLSKPE ESFV 
Sbjct  14   EAAAMVEELRGSYRSGKTRSYEWRVSQLKKLKKITEFHEKEIVEALRSDLSKPETESFVQ  73

Query  280  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  459
            EI  +K++CKLA+K+LK WMKPE  K++  T+PSSA+IVSEPLGV+L+ISAWNYPF+LSL
Sbjct  74   EIGMLKSACKLAIKQLKSWMKPETAKTSMTTFPSSAEIVSEPLGVILIISAWNYPFLLSL  133

Query  460  DPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            DPV+GAIAAGNAVVLKPSE+APATSSLLAKL  +YMD+++V+
Sbjct  134  DPVVGAIAAGNAVVLKPSELAPATSSLLAKLLGEYMDSSSVR  175



>ref|XP_011069490.1| PREDICTED: aldehyde dehydrogenase-like [Sesamum indicum]
Length=476

 Score =   218 bits (554),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 116/165 (70%), Positives = 137/165 (83%), Gaps = 0/165 (0%)
 Frame = +1

Query  91   LEMDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELES  270
            + +       ELR  +A GKTK++EWRVSQLKA+LKI  HHEK I++AL SDL KPELE+
Sbjct  1    MALGVEGVAGELRSIYATGKTKTFEWRVSQLKAILKITAHHEKEIVEALHSDLKKPELEA  60

Query  271  FVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFM  450
            F++E++ V + CK ALKEL RWM PE VK++ ATYPSSA+IVSEPLGVVLVIS WNYPF+
Sbjct  61   FLYEVSGVSSVCKYALKELHRWMMPEKVKTSMATYPSSAEIVSEPLGVVLVISTWNYPFL  120

Query  451  LSLDPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            LSL+PVIGAIAAGNAVVLKPSEIAPATSSLL KL  +YMDT+AVK
Sbjct  121  LSLEPVIGAIAAGNAVVLKPSEIAPATSSLLLKLLGEYMDTSAVK  165



>ref|XP_004290887.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X2 [Fragaria vesca subsp. vesca]
Length=486

 Score =   216 bits (549),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 112/161 (70%), Positives = 141/161 (88%), Gaps = 0/161 (0%)
 Frame = +1

Query  103  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  282
            AAA V +LR +FA+ KT+SY+WRVSQLKA+LK+A  HE  I+DAL SDLSKPE E+ V+E
Sbjct  12   AAALVKDLRASFASSKTRSYQWRVSQLKALLKLATDHEAEIVDALSSDLSKPEFETIVYE  71

Query  283  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  462
            I  +K++CKLA+K+LK WMKPE  K++  T+PSSA+IVSEPLGV+L+ISAWNYPF+LSLD
Sbjct  72   IGMLKSACKLAIKQLKSWMKPETAKTSMTTFPSSAEIVSEPLGVILIISAWNYPFLLSLD  131

Query  463  PvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            PV+GAIAAGNAVVLKPSE+APATSSLLAKL  +YMD+++V+
Sbjct  132  PVVGAIAAGNAVVLKPSELAPATSSLLAKLLGEYMDSSSVR  172



>ref|XP_003544699.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoformX2 
[Glycine max]
Length=487

 Score =   215 bits (548),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 116/162 (72%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = +1

Query  100  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  279
            +A   V ELR TF  GKT+SYEWR+SQLKA++K+ E +E+ I  AL SDLSK E E+FV 
Sbjct  15   EALMMVKELRVTFDCGKTRSYEWRISQLKAIIKLTEENEQQIYQALHSDLSKCETEAFVQ  74

Query  280  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  459
            EIA +K SC++ALKELK WM PE VK++ AT+PSSA+IVSEPLGVVLVISAWNYPF+LSL
Sbjct  75   EIAMLKNSCRIALKELKHWMTPEKVKTSIATFPSSAEIVSEPLGVVLVISAWNYPFLLSL  134

Query  460  DPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            DPVIGAIAAGNAVVLKPSEIAPATSSLLAKL  DY+D + +K
Sbjct  135  DPVIGAIAAGNAVVLKPSEIAPATSSLLAKLLGDYLDNSCIK  176



>ref|XP_011074837.1| PREDICTED: aldehyde dehydrogenase [Sesamum indicum]
Length=476

 Score =   214 bits (546),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 134/157 (85%), Gaps = 0/157 (0%)
 Frame = +1

Query  115  VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFV  294
            V ELR T+ +GKTK+ EWR SQLKA+++IA HHE  I++AL SDL KPELESFVHEI  V
Sbjct  9    VKELRSTYTSGKTKTLEWRASQLKAIIRIATHHENEIVEALRSDLKKPELESFVHEICAV  68

Query  295  KASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLDPvig  474
             ++CKLALKEL RWMKP+ VK++  T+P+S +IV EPLGVVLVIS WNYPF+LSL+PVIG
Sbjct  69   LSACKLALKELHRWMKPQKVKTSMTTFPASGEIVPEPLGVVLVISTWNYPFLLSLEPVIG  128

Query  475  aiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            AIAAGN VVLKPSE+APATSS+L+KL  +YMDTTAVK
Sbjct  129  AIAAGNVVVLKPSEVAPATSSVLSKLLGEYMDTTAVK  165



>gb|ACJ85852.1| unknown [Medicago truncatula]
Length=488

 Score =   214 bits (545),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 113/162 (70%), Positives = 138/162 (85%), Gaps = 0/162 (0%)
 Frame = +1

Query  100  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  279
            +A+  V +LR TF +GKT+SYEW+VSQLKA+L++ E HEK I++AL+SDLSK E ESF+ 
Sbjct  15   EASTTVKDLRITFDSGKTRSYEWKVSQLKALLELTEKHEKEIVEALYSDLSKSEAESFIQ  74

Query  280  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  459
            E+  +K SCK ALKELK WM PE VK++  T+PSSA+IVSEP GVVLVISAWNYPF+LSL
Sbjct  75   EVGMLKNSCKTALKELKHWMAPEKVKTSITTFPSSAEIVSEPFGVVLVISAWNYPFLLSL  134

Query  460  DPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            DPVIGAIAAGNAVVLKPSEIAPATSSLLAKL  +YMD ++++
Sbjct  135  DPVIGAIAAGNAVVLKPSEIAPATSSLLAKLLGEYMDNSSIR  176



>gb|KEH40518.1| NAD-dependent aldehyde dehydrogenase family protein [Medicago 
truncatula]
Length=488

 Score =   214 bits (545),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 113/162 (70%), Positives = 138/162 (85%), Gaps = 0/162 (0%)
 Frame = +1

Query  100  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  279
            +A+  V +LR TF +GKT+SYEW+VSQLKA+L++ E HEK I++AL+SDLSK E ESF+ 
Sbjct  15   EASTTVKDLRITFDSGKTRSYEWKVSQLKALLELTEKHEKEIVEALYSDLSKSEAESFIQ  74

Query  280  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  459
            E+  +K SCK ALKELK WM PE VK++  T+PSSA+IVSEP GVVLVISAWNYPF+LSL
Sbjct  75   EVGMLKNSCKTALKELKHWMAPEKVKTSITTFPSSAEIVSEPFGVVLVISAWNYPFLLSL  134

Query  460  DPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            DPVIGAIAAGNAVVLKPSEIAPATSSLLAKL  +YMD ++++
Sbjct  135  DPVIGAIAAGNAVVLKPSEIAPATSSLLAKLLGEYMDNSSIR  176



>ref|XP_009379028.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009379041.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Pyrus x bretschneideri]
Length=491

 Score =   213 bits (541),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 111/173 (64%), Positives = 141/173 (82%), Gaps = 3/173 (2%)
 Frame = +1

Query  76   EERK*LEMDAAAA---VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSD  246
            EE+K +  D+  A   V ELR ++ +GKT+SYEWR SQL  +LK+ EHHE+ I+DAL SD
Sbjct  5    EEQKRMYFDSKYALTMVEELRASYNSGKTRSYEWRESQLNNLLKVVEHHEQEIVDALRSD  64

Query  247  LSKPELESFVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVI  426
            LSKPE E++V EIA +K SC LA+KEL++WMKPE VK++   +P+SA+IVSEPLG +LVI
Sbjct  65   LSKPEFEAYVQEIAMIKNSCNLAIKELRKWMKPEKVKTSITVFPASAEIVSEPLGAILVI  124

Query  427  SAWNYPFMLSLDPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            SAWNYPF+LSLDPV+GAIAAGN VVLKPSE+APATSSLLAKL   YMD++ ++
Sbjct  125  SAWNYPFLLSLDPVVGAIAAGNVVVLKPSELAPATSSLLAKLVGKYMDSSCIR  177



>gb|KGN54554.1| hypothetical protein Csa_4G361880 [Cucumis sativus]
Length=484

 Score =   213 bits (541),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 115/165 (70%), Positives = 135/165 (82%), Gaps = 3/165 (2%)
 Frame = +1

Query  100  DAAAA---VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELES  270
            DAAAA   V+ELR  F +G T+SYEWRVSQL+++LK+   HE+ I DAL SDLSKP LES
Sbjct  8    DAAAATDLVNELRAIFNSGNTRSYEWRVSQLESLLKLCVDHEEDICDALRSDLSKPALES  67

Query  271  FVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFM  450
             +HEI  VK SCKLA+KE+  WMKPE V++   ++PSSA IVSEPLGVVL+IS WNYPF 
Sbjct  68   IIHEIGMVKGSCKLAIKEIGNWMKPEKVQTTMTSFPSSAAIVSEPLGVVLIISPWNYPFF  127

Query  451  LSLDPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            LSLDPVIGAIAAGN VVLKPSEI+PATSSL+AKLF  Y+DT+AVK
Sbjct  128  LSLDPVIGAIAAGNTVVLKPSEISPATSSLIAKLFEKYLDTSAVK  172



>ref|XP_008378442.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Malus 
domestica]
 ref|XP_008365200.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Malus domestica]
Length=491

 Score =   213 bits (541),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 109/162 (67%), Positives = 137/162 (85%), Gaps = 0/162 (0%)
 Frame = +1

Query  100  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  279
            DA   V ELR ++ +GKT+SYEWR SQL  +LK+AE HE+ I+DAL SDLSKPE E++V 
Sbjct  16   DALTMVEELRASYNSGKTRSYEWRESQLNNLLKVAELHEQEIVDALRSDLSKPEFEAYVQ  75

Query  280  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  459
            EIA +K SC LA+KEL++WMKPE VK++ A +P+SA+IVSEPLG +LVISAWNYPF+LSL
Sbjct  76   EIAMLKNSCNLAIKELRKWMKPEKVKTSIAVFPASAEIVSEPLGAILVISAWNYPFLLSL  135

Query  460  DPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            DPV+GAIAAGN VVLKPSE+APATSSLLAKL  +YMD++ ++
Sbjct  136  DPVVGAIAAGNVVVLKPSELAPATSSLLAKLVGEYMDSSCIR  177



>gb|AGC65583.1| fatty aldehyde dehydrogenase [Simmondsia chinensis]
Length=492

 Score =   211 bits (538),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 111/170 (65%), Positives = 140/170 (82%), Gaps = 0/170 (0%)
 Frame = +1

Query  76   EERK*LEMDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSK  255
            EE+K     AA+ V+ELR TFAAGKT+SYEWRV+QL  ++K+ E+HE+ I++AL  DL+K
Sbjct  2    EEKKFDTEAAASTVTELRRTFAAGKTRSYEWRVAQLNGMIKMVENHEQEIVEALRLDLNK  61

Query  256  PELESFVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAW  435
            PE ES ++EI  +K+SCK+ALKELK+WM PE VK++  T+PSSA+IV EPLG+VLVISAW
Sbjct  62   PEFESILYEIMLLKSSCKVALKELKQWMMPEKVKTSLTTFPSSAEIVPEPLGIVLVISAW  121

Query  436  NYPFMLSLDPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            NYP +LSLDP++GAIAAGN VVLKPSEIAPATSS LAK    YMD +A+K
Sbjct  122  NYPLLLSLDPIVGAIAAGNVVVLKPSEIAPATSSFLAKFVEKYMDNSAIK  171



>ref|XP_008365201.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X2 [Malus domestica]
Length=486

 Score =   211 bits (536),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 140/164 (85%), Gaps = 0/164 (0%)
 Frame = +1

Query  94   EMDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESF  273
            E  A+A V ELR TFA+GKT+SY+WRVSQL+ +LK+   +E  I++AL SDLSKPELES 
Sbjct  9    EEAASAVVKELRVTFASGKTRSYQWRVSQLECILKLLTENELEIVNALRSDLSKPELESK  68

Query  274  VHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFML  453
            V+EIA +K SC LA+KEL++WMKPE VK++ A +P+SA+IVSEPLG +LVISAWNYPF+L
Sbjct  69   VYEIAMLKNSCNLAIKELRKWMKPEKVKTSIAVFPASAEIVSEPLGAILVISAWNYPFLL  128

Query  454  SLDPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            SLDPV+GAIAAGN VVLKPSE+APATSSLLAKL  +YMD++ ++
Sbjct  129  SLDPVVGAIAAGNVVVLKPSELAPATSSLLAKLVGEYMDSSCIR  172



>ref|XP_007222253.1| hypothetical protein PRUPE_ppa004751mg [Prunus persica]
 gb|EMJ23452.1| hypothetical protein PRUPE_ppa004751mg [Prunus persica]
Length=493

 Score =   211 bits (537),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 141/164 (86%), Gaps = 0/164 (0%)
 Frame = +1

Query  94   EMDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESF  273
            E  A+A   ELR TFA+ KT+SY+WR SQLK++LK+   +E AI+DAL SDLSKPELES 
Sbjct  16   EEAASALAKELRATFASAKTRSYQWRESQLKSLLKLTTSNEPAIVDALRSDLSKPELESQ  75

Query  274  VHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFML  453
            V+EI+ +K SCKLALKEL+ WMKPE  K++  T+PSSA+IVSEPLGV+L+ISAWNYPF+L
Sbjct  76   VYEISMLKNSCKLALKELRNWMKPEKAKTSLTTFPSSAEIVSEPLGVILIISAWNYPFLL  135

Query  454  SLDPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            SLDPV+GAIAAGNAVVLKPSE+APATSSLLAKL  +YMD+++++
Sbjct  136  SLDPVVGAIAAGNAVVLKPSELAPATSSLLAKLVGEYMDSSSIR  179



>ref|XP_010243504.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Nelumbo nucifera]
Length=568

 Score =   213 bits (541),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 111/161 (69%), Positives = 137/161 (85%), Gaps = 0/161 (0%)
 Frame = +1

Query  103  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  282
            AA+ + ELR TFA+GKTKSYEWRV QLK ++K+ + +E+AIM+AL  DL+KP  ESFV E
Sbjct  91   AASLLKELRGTFASGKTKSYEWRVQQLKNMIKMIDDNERAIMEALQQDLAKPRFESFVSE  150

Query  283  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  462
            I+  KA+C  ALKELK WMKPE  K+A  T+PSSA+IVSEP G+VL+ISAWNYPF+LSLD
Sbjct  151  ISLTKAACNHALKELKHWMKPEKAKTAITTFPSSAEIVSEPFGIVLIISAWNYPFLLSLD  210

Query  463  PvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            PV+GAIAAGN+VVLKPSEI+PATSSLLAKL  DY+D++AV+
Sbjct  211  PVVGAIAAGNSVVLKPSEISPATSSLLAKLLEDYLDSSAVR  251



>ref|XP_010243505.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X2 [Nelumbo nucifera]
Length=567

 Score =   212 bits (540),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 111/161 (69%), Positives = 137/161 (85%), Gaps = 0/161 (0%)
 Frame = +1

Query  103  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  282
            AA+ + ELR TFA+GKTKSYEWRV QLK ++K+ + +E+AIM+AL  DL+KP  ESFV E
Sbjct  90   AASLLKELRGTFASGKTKSYEWRVQQLKNMIKMIDDNERAIMEALQQDLAKPRFESFVSE  149

Query  283  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  462
            I+  KA+C  ALKELK WMKPE  K+A  T+PSSA+IVSEP G+VL+ISAWNYPF+LSLD
Sbjct  150  ISLTKAACNHALKELKHWMKPEKAKTAITTFPSSAEIVSEPFGIVLIISAWNYPFLLSLD  209

Query  463  PvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            PV+GAIAAGN+VVLKPSEI+PATSSLLAKL  DY+D++AV+
Sbjct  210  PVVGAIAAGNSVVLKPSEISPATSSLLAKLLEDYLDSSAVR  250



>ref|XP_004498346.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Cicer arietinum]
Length=488

 Score =   210 bits (535),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 112/162 (69%), Positives = 137/162 (85%), Gaps = 0/162 (0%)
 Frame = +1

Query  100  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  279
            +A A V +LR TF +GKT+SY+WRVSQLKA+  + E HEK I+ +L+SDLSK E ESF+ 
Sbjct  15   EAFATVKDLRVTFDSGKTRSYKWRVSQLKALFDLTEGHEKEIVASLYSDLSKSETESFIQ  74

Query  280  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  459
            EIA +K SC+ A+KELK WM PE VK++  T+PSSA+IVSEPLGVVLVISAWNYPF+LSL
Sbjct  75   EIAMLKNSCQAAIKELKHWMAPEKVKTSLTTFPSSAEIVSEPLGVVLVISAWNYPFLLSL  134

Query  460  DPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            DPVIGAIAAGNAVVLKPSE+APATSSLLAKL  +YMD ++++
Sbjct  135  DPVIGAIAAGNAVVLKPSEMAPATSSLLAKLLGEYMDNSSIR  176



>ref|XP_003544698.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoformX1 
[Glycine max]
 gb|KHN20143.1| Aldehyde dehydrogenase family 3 member H1 [Glycine soja]
Length=496

 Score =   210 bits (535),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 115/165 (70%), Positives = 137/165 (83%), Gaps = 3/165 (2%)
 Frame = +1

Query  100  DAAAA---VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELES  270
            DA AA   V+ELR  FA+GKT+SYEWR+ QL A+ K+   HE+ I+DAL +DL KP LE+
Sbjct  21   DALAASRLVTELRGNFASGKTRSYEWRLLQLNAIAKLVVDHEQEIVDALRNDLGKPPLET  80

Query  271  FVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFM  450
              +EIA +K SC++ALKELK WM PE VK++ AT+PSSA+IVSEPLGVVLVISAWNYPF+
Sbjct  81   VAYEIAMLKNSCRIALKELKHWMTPEKVKTSIATFPSSAEIVSEPLGVVLVISAWNYPFL  140

Query  451  LSLDPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            LSLDPVIGAIAAGNAVVLKPSEIAPATSSLLAKL  DY+D + +K
Sbjct  141  LSLDPVIGAIAAGNAVVLKPSEIAPATSSLLAKLLGDYLDNSCIK  185



>ref|XP_007019116.1| Aldehyde dehydrogenase 3H1 isoform 1 [Theobroma cacao]
 gb|EOY16341.1| Aldehyde dehydrogenase 3H1 isoform 1 [Theobroma cacao]
Length=489

 Score =   210 bits (534),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 115/171 (67%), Positives = 143/171 (84%), Gaps = 1/171 (1%)
 Frame = +1

Query  76   EERK*LEMDAAA-AVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLS  252
            E++   + D+A   V ELR +F AGKTKSYEWRV+QLKA+LK+ E +E  I  AL  DLS
Sbjct  6    EKKAVFDTDSAKEVVKELRASFVAGKTKSYEWRVAQLKALLKMTEENEPQIAAALRDDLS  65

Query  253  KPELESFVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISA  432
            KPELES+++EIA +K SC+LALKE+KRW+ PE  K++  T+PSSA+IVSEPLGVVLVISA
Sbjct  66   KPELESYIYEIAMLKNSCRLALKEMKRWIMPEKAKTSLTTFPSSAEIVSEPLGVVLVISA  125

Query  433  WNYPFMLSLDPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            WNYPF+LSLDPV+GAIAAGNAVVLKPSEIAPAT+SLLAKL  +Y+D++ +K
Sbjct  126  WNYPFLLSLDPVVGAIAAGNAVVLKPSEIAPATASLLAKLVANYLDSSCIK  176



>ref|XP_007019117.1| Aldehyde dehydrogenase 3H1 isoform 2 [Theobroma cacao]
 gb|EOY16342.1| Aldehyde dehydrogenase 3H1 isoform 2 [Theobroma cacao]
Length=515

 Score =   210 bits (534),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 115/171 (67%), Positives = 143/171 (84%), Gaps = 1/171 (1%)
 Frame = +1

Query  76   EERK*LEMDAAA-AVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLS  252
            E++   + D+A   V ELR +F AGKTKSYEWRV+QLKA+LK+ E +E  I  AL  DLS
Sbjct  6    EKKAVFDTDSAKEVVKELRASFVAGKTKSYEWRVAQLKALLKMTEENEPQIAAALRDDLS  65

Query  253  KPELESFVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISA  432
            KPELES+++EIA +K SC+LALKE+KRW+ PE  K++  T+PSSA+IVSEPLGVVLVISA
Sbjct  66   KPELESYIYEIAMLKNSCRLALKEMKRWIMPEKAKTSLTTFPSSAEIVSEPLGVVLVISA  125

Query  433  WNYPFMLSLDPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            WNYPF+LSLDPV+GAIAAGNAVVLKPSEIAPAT+SLLAKL  +Y+D++ +K
Sbjct  126  WNYPFLLSLDPVVGAIAAGNAVVLKPSEIAPATASLLAKLVANYLDSSCIK  176



>ref|XP_002306641.1| the aldehyde dehydrogenase cp-ADH from C.plantagineum family 
protein [Populus trichocarpa]
 gb|EEE93637.1| the aldehyde dehydrogenase cp-ADH from C.plantagineum family 
protein [Populus trichocarpa]
Length=488

 Score =   209 bits (532),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 143/171 (84%), Gaps = 1/171 (1%)
 Frame = +1

Query  76   EERK*LEMDAAAAVS-ELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLS  252
            EE    +++AA  ++ ELR+ FA+GKT+SYEWR+SQLK+++K+ + HE+ I+DAL  DLS
Sbjct  6    EENTVFDVEAANVLTKELRDVFASGKTRSYEWRISQLKSIVKMCDEHEEDIVDALRQDLS  65

Query  253  KPELESFVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISA  432
            KP+LES V+E+  VK SC LA+KELK WM PE  K++  T+PSSA+IVSEPLG VL+ISA
Sbjct  66   KPQLESIVYELTMVKNSCTLAIKELKHWMMPEKAKTSLTTFPSSAEIVSEPLGAVLIISA  125

Query  433  WNYPFMLSLDPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            WNYPF+LS+DP+IGAIAAGNA+VLKPSE+APATSSLLAKL  +Y+D +++K
Sbjct  126  WNYPFLLSMDPLIGAIAAGNAMVLKPSEVAPATSSLLAKLLPEYLDCSSIK  176



>ref|XP_007048537.1| Aldehyde dehydrogenase 3I1 isoform 3 [Theobroma cacao]
 gb|EOX92694.1| Aldehyde dehydrogenase 3I1 isoform 3 [Theobroma cacao]
Length=487

 Score =   209 bits (532),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 115/171 (67%), Positives = 145/171 (85%), Gaps = 1/171 (1%)
 Frame = +1

Query  76   EERK*LEMDAAAA-VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLS  252
            E ++  ++D AA  V ELR+TF++GKTKSYEWR+SQL+++ K+ +  EK I++AL  DLS
Sbjct  3    EAKQTFDVDKAAVLVKELRKTFSSGKTKSYEWRMSQLESISKMIDEKEKEIIEALHKDLS  62

Query  253  KPELESFVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISA  432
            KPELE+F+ EI+  K+SCKLALKELK WM P+ V+++ ATYPSSAKIVSEPLGVVLVIS 
Sbjct  63   KPELEAFISEISMTKSSCKLALKELKHWMMPKKVETSMATYPSSAKIVSEPLGVVLVIST  122

Query  433  WNYPFMLSLDPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            WN+PF+LSLDPVIGAIAAGNAVVLKPSEIAPATSSLLA+L  +Y D +A++
Sbjct  123  WNFPFLLSLDPVIGAIAAGNAVVLKPSEIAPATSSLLARLLVEYADESAIR  173



>ref|XP_010674357.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=549

 Score =   210 bits (534),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 118/189 (62%), Positives = 147/189 (78%), Gaps = 9/189 (5%)
 Frame = +1

Query  46   IYKYIYC-------LGREERK*L--EMDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLK  198
            I  +I+C       +  E+RK L    +A   V ELR  F +GKTK+YEWR +Q+K++ +
Sbjct  47   ISTHIHCSTAAVPIMAEEKRKSLFDANEAGILVKELRRQFGSGKTKTYEWREAQIKSLSQ  106

Query  199  IAEHHEKAIMDALFSDLSKPELESFVHEIAFVKASCKLALKELKRWMKPENVKSAFATYP  378
            + +  EK I++AL  DL KPE E FV EIA +K+SCKLAL++LK+WMKPE VK++  TYP
Sbjct  107  MIDDREKEIIEALHEDLCKPEFEGFVAEIAMIKSSCKLALRDLKQWMKPEKVKTSLTTYP  166

Query  379  SSAKIVSEPLGVVLVISAWNYPFMLSLDPvigaiaagnavvLKPSEIAPATSSLLAKLFN  558
            SSA+IVSEPLGVVLVISAWNYPF+LSLDPVIGAIAAGNAVVLKPSEIAPATSSLLAKL  
Sbjct  167  SSAEIVSEPLGVVLVISAWNYPFLLSLDPVIGAIAAGNAVVLKPSEIAPATSSLLAKLLQ  226

Query  559  DYMDTTAVK  585
            +Y+D+T +K
Sbjct  227  EYVDSTLIK  235



>ref|XP_010674356.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=550

 Score =   210 bits (534),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 118/189 (62%), Positives = 147/189 (78%), Gaps = 9/189 (5%)
 Frame = +1

Query  46   IYKYIYC-------LGREERK*L--EMDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLK  198
            I  +I+C       +  E+RK L    +A   V ELR  F +GKTK+YEWR +Q+K++ +
Sbjct  48   ISTHIHCSTAAVPIMAEEKRKSLFDANEAGILVKELRRQFGSGKTKTYEWREAQIKSLSQ  107

Query  199  IAEHHEKAIMDALFSDLSKPELESFVHEIAFVKASCKLALKELKRWMKPENVKSAFATYP  378
            + +  EK I++AL  DL KPE E FV EIA +K+SCKLAL++LK+WMKPE VK++  TYP
Sbjct  108  MIDDREKEIIEALHEDLCKPEFEGFVAEIAMIKSSCKLALRDLKQWMKPEKVKTSLTTYP  167

Query  379  SSAKIVSEPLGVVLVISAWNYPFMLSLDPvigaiaagnavvLKPSEIAPATSSLLAKLFN  558
            SSA+IVSEPLGVVLVISAWNYPF+LSLDPVIGAIAAGNAVVLKPSEIAPATSSLLAKL  
Sbjct  168  SSAEIVSEPLGVVLVISAWNYPFLLSLDPVIGAIAAGNAVVLKPSEIAPATSSLLAKLLQ  227

Query  559  DYMDTTAVK  585
            +Y+D+T +K
Sbjct  228  EYVDSTLIK  236



>ref|XP_008444179.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Cucumis 
melo]
 ref|XP_008444180.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Cucumis 
melo]
Length=484

 Score =   208 bits (529),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 113/166 (68%), Positives = 134/166 (81%), Gaps = 3/166 (2%)
 Frame = +1

Query  97   MDAAAA---VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELE  267
             DAAAA   V ELR  F +G T+SYEWRVSQL+++LK+   HE+ I DAL SDLSKP LE
Sbjct  7    FDAAAATELVKELRAIFISGNTRSYEWRVSQLESLLKLCVDHEEDICDALRSDLSKPALE  66

Query  268  SFVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPF  447
            S +HEI  VK SCKLA+KE++ WMKPE V++   ++PS+A IV EPLGVVL+IS WNYPF
Sbjct  67   SIIHEIGMVKGSCKLAIKEIRNWMKPEKVQTTITSFPSTAAIVPEPLGVVLIISPWNYPF  126

Query  448  MLSLDPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
             LSLDPVIGAIAAGNAVVLKPSEI+PATSSL+ KLF  Y+DT+AVK
Sbjct  127  FLSLDPVIGAIAAGNAVVLKPSEISPATSSLIVKLFEKYLDTSAVK  172



>ref|XP_004161166.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Cucumis 
sativus]
Length=484

 Score =   208 bits (529),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 113/165 (68%), Positives = 134/165 (81%), Gaps = 3/165 (2%)
 Frame = +1

Query  100  DAAAA---VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELES  270
            DAAAA   V+ELR  F +G T+SYEWRVSQL+++LK+   HE+ I DAL SDLS+  LES
Sbjct  8    DAAAATDLVNELRAIFNSGNTRSYEWRVSQLESLLKLCVDHEEDICDALRSDLSQAALES  67

Query  271  FVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFM  450
             +HEI  VK SCKLA+KE+  WMKPE V++   ++PSSA IVSEPLGVVL+IS WNYPF 
Sbjct  68   IIHEIGMVKGSCKLAIKEIGNWMKPEKVQTTMTSFPSSAAIVSEPLGVVLIISPWNYPFF  127

Query  451  LSLDPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            LSLDPVIGAIAAGN VVLKPSEI+PATSSL+AKLF  Y+DT+AVK
Sbjct  128  LSLDPVIGAIAAGNTVVLKPSEISPATSSLIAKLFEKYLDTSAVK  172



>ref|XP_007048536.1| Aldehyde dehydrogenase 3I1 isoform 2 [Theobroma cacao]
 gb|EOX92693.1| Aldehyde dehydrogenase 3I1 isoform 2 [Theobroma cacao]
Length=542

 Score =   209 bits (532),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 115/171 (67%), Positives = 145/171 (85%), Gaps = 1/171 (1%)
 Frame = +1

Query  76   EERK*LEMDAAAA-VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLS  252
            E ++  ++D AA  V ELR+TF++GKTKSYEWR+SQL+++ K+ +  EK I++AL  DLS
Sbjct  58   EAKQTFDVDKAAVLVKELRKTFSSGKTKSYEWRMSQLESISKMIDEKEKEIIEALHKDLS  117

Query  253  KPELESFVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISA  432
            KPELE+F+ EI+  K+SCKLALKELK WM P+ V+++ ATYPSSAKIVSEPLGVVLVIS 
Sbjct  118  KPELEAFISEISMTKSSCKLALKELKHWMMPKKVETSMATYPSSAKIVSEPLGVVLVIST  177

Query  433  WNYPFMLSLDPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            WN+PF+LSLDPVIGAIAAGNAVVLKPSEIAPATSSLLA+L  +Y D +A++
Sbjct  178  WNFPFLLSLDPVIGAIAAGNAVVLKPSEIAPATSSLLARLLVEYADESAIR  228



>ref|XP_007048535.1| Aldehyde dehydrogenase 3I1 isoform 1 [Theobroma cacao]
 gb|EOX92692.1| Aldehyde dehydrogenase 3I1 isoform 1 [Theobroma cacao]
Length=547

 Score =   209 bits (532),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 115/171 (67%), Positives = 145/171 (85%), Gaps = 1/171 (1%)
 Frame = +1

Query  76   EERK*LEMDAAAA-VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLS  252
            E ++  ++D AA  V ELR+TF++GKTKSYEWR+SQL+++ K+ +  EK I++AL  DLS
Sbjct  63   EAKQTFDVDKAAVLVKELRKTFSSGKTKSYEWRMSQLESISKMIDEKEKEIIEALHKDLS  122

Query  253  KPELESFVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISA  432
            KPELE+F+ EI+  K+SCKLALKELK WM P+ V+++ ATYPSSAKIVSEPLGVVLVIS 
Sbjct  123  KPELEAFISEISMTKSSCKLALKELKHWMMPKKVETSMATYPSSAKIVSEPLGVVLVIST  182

Query  433  WNYPFMLSLDPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            WN+PF+LSLDPVIGAIAAGNAVVLKPSEIAPATSSLLA+L  +Y D +A++
Sbjct  183  WNFPFLLSLDPVIGAIAAGNAVVLKPSEIAPATSSLLARLLVEYADESAIR  233



>gb|KJB64494.1| hypothetical protein B456_010G051500 [Gossypium raimondii]
Length=344

 Score =   204 bits (518),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 112/171 (65%), Positives = 141/171 (82%), Gaps = 1/171 (1%)
 Frame = +1

Query  76   EERK*LEMDAAA-AVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLS  252
            E++   ++D+A   V ELR +F AGKTK YEWR +QLKA+LK+ + +E  I+ AL  DLS
Sbjct  6    EKKAVFDIDSAKEVVQELRASFVAGKTKDYEWRRTQLKAMLKMMDENEPQIVAALRDDLS  65

Query  253  KPELESFVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISA  432
            KPELES ++EIA +K SCKLALK++K WM PE  K++ AT+PSSA+IVSEPLGVVLVISA
Sbjct  66   KPELESSIYEIAMLKNSCKLALKKMKHWMMPEKAKTSLATFPSSAEIVSEPLGVVLVISA  125

Query  433  WNYPFMLSLDPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            WNYPF+LSLDP IGAIAAGNA+VLKPSEI+PAT+SLLAKL  +YMD++ +K
Sbjct  126  WNYPFLLSLDPFIGAIAAGNAIVLKPSEISPATASLLAKLVANYMDSSCIK  176



>ref|XP_009379029.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X2 [Pyrus x bretschneideri]
 ref|XP_009379042.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X2 [Pyrus x bretschneideri]
Length=486

 Score =   207 bits (528),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 109/164 (66%), Positives = 137/164 (84%), Gaps = 0/164 (0%)
 Frame = +1

Query  94   EMDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESF  273
            E  A+A   ELR TFA+GKT+SY+WRVSQL+ +LK+   +E  I++AL SDLSKPELES 
Sbjct  9    EEAASAVAKELRVTFASGKTRSYQWRVSQLECILKLLTENELEIVNALRSDLSKPELESQ  68

Query  274  VHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFML  453
            V+EIA +K SC LA+KEL++WMKPE VK++   +P+SA+IVSEPLG +LVISAWNYPF+L
Sbjct  69   VYEIAMIKNSCNLAIKELRKWMKPEKVKTSITVFPASAEIVSEPLGAILVISAWNYPFLL  128

Query  454  SLDPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            SLDPV+GAIAAGN VVLKPSE+APATSSLLAKL   YMD++ ++
Sbjct  129  SLDPVVGAIAAGNVVVLKPSELAPATSSLLAKLVGKYMDSSCIR  172



>ref|XP_010674968.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Beta vulgaris 
subsp. vulgaris]
Length=487

 Score =   207 bits (528),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 110/165 (67%), Positives = 139/165 (84%), Gaps = 0/165 (0%)
 Frame = +1

Query  91   LEMDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELES  270
            +E+  A  V+ELR TF +GKT+SYEWRVSQLK+++K+ E  E  I++AL SDL+KP  ES
Sbjct  1    MEVTTADMVNELRRTFVSGKTRSYEWRVSQLKSIVKMIEECETQIVEALRSDLNKPPFES  60

Query  271  FVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFM  450
             ++EI+ +K+SC++ALKELK+WMKPE VK+    +PSSA+IV+EPLGVVLVISAWNYP +
Sbjct  61   ILYEISMLKSSCRVALKELKQWMKPEKVKTPIVAFPSSAEIVAEPLGVVLVISAWNYPIL  120

Query  451  LSLDPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            LSLDPV+GAIAAGNAVVLKPSEIAPATSSLLAK    Y+DT+AV+
Sbjct  121  LSLDPVVGAIAAGNAVVLKPSEIAPATSSLLAKYVGQYLDTSAVR  165



>ref|XP_006370386.1| hypothetical protein POPTR_0001s421501g, partial [Populus trichocarpa]
 gb|ERP66955.1| hypothetical protein POPTR_0001s421501g, partial [Populus trichocarpa]
Length=423

 Score =   206 bits (523),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 114/162 (70%), Positives = 133/162 (82%), Gaps = 0/162 (0%)
 Frame = +1

Query  100  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  279
            +AA  V EL E+F  GKTKSYEWRVSQLK + K+    EK I +AL+ DLSKPE E+FV 
Sbjct  76   EAAWLVKELNESFRTGKTKSYEWRVSQLKGIEKMVVEREKDICEALYKDLSKPEYEAFVS  135

Query  280  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  459
            EIA VK+SC+ ALKELK+WMKPE  K++ ATYPSSA+IVSEPLG VLVIS WNYPF LS+
Sbjct  136  EIAMVKSSCEEALKELKQWMKPEKAKTSMATYPSSAEIVSEPLGAVLVISTWNYPFSLSV  195

Query  460  DPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
             PVIGAI AGNAVVLKPSEIAPATSSLL+KLF +Y+D +AV+
Sbjct  196  KPVIGAITAGNAVVLKPSEIAPATSSLLSKLFEEYLDRSAVR  237



>ref|XP_006575169.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Glycine 
max]
Length=496

 Score =   207 bits (528),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 113/165 (68%), Positives = 137/165 (83%), Gaps = 3/165 (2%)
 Frame = +1

Query  100  DAAAA---VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELES  270
            DA AA   V+ELR  FA+ KT+SYEWR+SQL A+ K+   HE+ I+DAL +DL KP LE+
Sbjct  21   DAEAASRLVNELRRNFASNKTRSYEWRLSQLNALEKLVVVHEQEIVDALRNDLGKPPLET  80

Query  271  FVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFM  450
              +EIA +K SC++ALKELK WM PE VK++ AT+PSSA+IVSEPLGVVLVISAWNYPF+
Sbjct  81   VAYEIAMLKNSCRIALKELKHWMTPEKVKTSIATFPSSAEIVSEPLGVVLVISAWNYPFL  140

Query  451  LSLDPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            LSLDPV+GAIAAGNAVVLKPSEIAPATSSLLAKL  DY+D + ++
Sbjct  141  LSLDPVVGAIAAGNAVVLKPSEIAPATSSLLAKLIGDYLDNSCIR  185



>ref|NP_974679.1| aldehyde dehydrogenase 3I1 [Arabidopsis thaliana]
 gb|AEE86346.1| aldehyde dehydrogenase 3I1 [Arabidopsis thaliana]
Length=390

 Score =   204 bits (520),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 107/162 (66%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = +1

Query  100  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  279
            +AA  V ELR  F +G+TKSYEWR+SQL+ + ++ +  EK I +AL+ DLSKPELE+F+ 
Sbjct  74   EAALLVDELRSNFNSGRTKSYEWRISQLQNIARMIDEKEKCITEALYQDLSKPELEAFLA  133

Query  280  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  459
            EI+  K+SC LA+KELK WM PE VK++  T+PSSA+IVSEPLGVVLVISAWN+PF+LS+
Sbjct  134  EISNTKSSCMLAIKELKNWMAPETVKTSVTTFPSSAQIVSEPLGVVLVISAWNFPFLLSV  193

Query  460  DPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            +PVIGAIAAGNAVVLKPSEIAPA SSLLAKLF++Y+D T ++
Sbjct  194  EPVIGAIAAGNAVVLKPSEIAPAASSLLAKLFSEYLDNTTIR  235



>ref|XP_008338656.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Malus 
domestica]
Length=496

 Score =   207 bits (527),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 108/164 (66%), Positives = 137/164 (84%), Gaps = 0/164 (0%)
 Frame = +1

Query  94   EMDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESF  273
            E  A+A V ELR +F +GKT+SY+WRVSQLK + K+    E+ I+DAL SDLSKPELES 
Sbjct  19   EEAASAVVKELRASFVSGKTRSYQWRVSQLKGIXKLITKKEREIVDALRSDLSKPELESQ  78

Query  274  VHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFML  453
            V+ I+ +  SCKLA+KELK+WMKPE VK++ A +P+SA+IVSEPLG +LVISAWNYPF+L
Sbjct  79   VYVISMLXNSCKLAIKELKKWMKPEKVKTSIAVFPASAEIVSEPLGAILVISAWNYPFLL  138

Query  454  SLDPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            SLDPV+GAIA+GN VVLKPSE+APATSSLLAKL  +YMD++ ++
Sbjct  139  SLDPVVGAIASGNVVVLKPSELAPATSSLLAKLLXEYMDSSCIR  182



>ref|XP_011031097.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Populus 
euphratica]
Length=553

 Score =   208 bits (530),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 112/162 (69%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = +1

Query  100  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  279
            +A + V EL+E+F  G+T+SYEWRVSQLK + KI E  EK I +AL+ DLSKPE E+FV 
Sbjct  78   EAPSLVKELKESFRTGRTRSYEWRVSQLKGIEKIVEEREKDISEALYKDLSKPEFEAFVS  137

Query  280  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  459
            EIA VK+SC+ ALKELK+WMKPE  K++   YPSSA+IVSEPLG VLVIS WNYPF+LS+
Sbjct  138  EIAAVKSSCEEALKELKQWMKPEKAKTSMTAYPSSAEIVSEPLGAVLVISTWNYPFLLSI  197

Query  460  DPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            DPVIGAIAAGNAVVLKPSEIAPATSSLL++LF +Y+D +AV+
Sbjct  198  DPVIGAIAAGNAVVLKPSEIAPATSSLLSELFEEYLDNSAVR  239



>gb|EPS67420.1| aldehyde dehydrogenase, partial [Genlisea aurea]
Length=225

 Score =   199 bits (506),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 104/163 (64%), Positives = 138/163 (85%), Gaps = 0/163 (0%)
 Frame = +1

Query  97   MDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFV  276
            +DA A V ELR TFA+G+T+S++WRVSQLKA +KI  +HE+ I++AL SDL+KP+LE+ V
Sbjct  2    VDAEALVGELRSTFASGRTRSFDWRVSQLKAFIKILTYHEEEIVEALRSDLNKPQLEAVV  61

Query  277  HEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLS  456
            HEIA + ++C  +LK+LK+WMKP+ V ++  T+PSSAK++ EPLGVVLVIS WNYP +LS
Sbjct  62   HEIAPLLSACTRSLKKLKQWMKPQKVNTSLLTFPSSAKLMMEPLGVVLVISTWNYPVLLS  121

Query  457  LDPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            L+PV+GAIAAGNAVVLKPSE+APATSSLLAK+   Y+D +A+K
Sbjct  122  LEPVVGAIAAGNAVVLKPSEVAPATSSLLAKVVGQYVDNSAIK  164



>gb|KCW70625.1| hypothetical protein EUGRSUZ_F03800 [Eucalyptus grandis]
Length=479

 Score =   206 bits (524),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 109/173 (63%), Positives = 143/173 (83%), Gaps = 3/173 (2%)
 Frame = +1

Query  76   EERK*LEMDAAAA---VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSD  246
            E++K    D+ AA   V+ELR  FA+G T+SY+WR SQL+ +L++ + HE+ I+ AL SD
Sbjct  4    EDKKQQPFDSKAASSLVAELRGAFASGTTRSYQWRESQLRGLLRMTDEHEQDIVAALRSD  63

Query  247  LSKPELESFVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVI  426
            L KPELES ++E A ++ SCK ALKEL+RWM PE VK++  T+PSSA+IVSEPLGVVL+I
Sbjct  64   LGKPELESVLYEAAMLRNSCKFALKELQRWMMPEKVKTSLTTFPSSAEIVSEPLGVVLII  123

Query  427  SAWNYPFMLSLDPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            SAWNYP++LSLDPV+GAIAAGNAVVLKPSEIAPATS+LLAKL  +YMD+++++
Sbjct  124  SAWNYPYLLSLDPVVGAIAAGNAVVLKPSEIAPATSALLAKLLGEYMDSSSIR  176



>ref|XP_002302229.2| the aldehyde dehydrogenase cp-ADH from C.plantagineum family 
protein [Populus trichocarpa]
 gb|EEE81502.2| the aldehyde dehydrogenase cp-ADH from C.plantagineum family 
protein [Populus trichocarpa]
Length=488

 Score =   206 bits (524),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 109/176 (62%), Positives = 142/176 (81%), Gaps = 3/176 (2%)
 Frame = +1

Query  67   LGREERK*LEMDAAAA---VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDAL  237
            +  EE K +  D  AA     ELR+ FA+GKT+SYEWR+SQLK+++K+ + HE+ I+DAL
Sbjct  1    MATEEEKQMVFDVEAANMLTKELRDVFASGKTRSYEWRISQLKSMIKMCDEHEEDIVDAL  60

Query  238  FSDLSKPELESFVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVV  417
              DLSKP+LES V+EI  +K SC LA+KELK+WM PE  K++  T+PSSA+IV EPLGVV
Sbjct  61   HQDLSKPKLESIVYEITMLKNSCTLAIKELKQWMMPEKAKTSLLTFPSSAEIVPEPLGVV  120

Query  418  LVISAWNYPFMLSLDPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            L+ISAWNYPF+LSLDP++GAIAAGNA+VLKPSE +PATSSLLAKL  +Y+D +++K
Sbjct  121  LIISAWNYPFLLSLDPLVGAIAAGNAMVLKPSEFSPATSSLLAKLLPEYLDISSIK  176



>ref|XP_007161479.1| hypothetical protein PHAVU_001G072600g [Phaseolus vulgaris]
 gb|ESW33473.1| hypothetical protein PHAVU_001G072600g [Phaseolus vulgaris]
Length=493

 Score =   206 bits (524),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 115/166 (69%), Positives = 137/166 (83%), Gaps = 3/166 (2%)
 Frame = +1

Query  97   MDAAAA---VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELE  267
             DA AA   V+ELR  FA+GK  SYEWRVSQ+KA+ K+   HE+ I+DAL  DL+KP LE
Sbjct  16   FDAPAASRLVTELRGAFASGKPSSYEWRVSQVKALAKLVADHEQEIVDALQKDLAKPPLE  75

Query  268  SFVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPF  447
            +  +EIA +K SCK+ALKELK W+ PE VK++ A++PSSA+IVSEPLGVVLVISAWNYPF
Sbjct  76   TVAYEIAMLKNSCKVALKELKHWITPEKVKTSLASFPSSAEIVSEPLGVVLVISAWNYPF  135

Query  448  MLSLDPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            +LSLDPVIGAIAAGNAVVLKPSEIAPATSSLLAKL  DYMD + ++
Sbjct  136  LLSLDPVIGAIAAGNAVVLKPSEIAPATSSLLAKLLGDYMDKSCIR  181



>ref|XP_010095408.1| Aldehyde dehydrogenase family 3 member H1 [Morus notabilis]
 gb|EXB60100.1| Aldehyde dehydrogenase family 3 member H1 [Morus notabilis]
Length=497

 Score =   206 bits (524),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 111/174 (64%), Positives = 140/174 (80%), Gaps = 1/174 (1%)
 Frame = +1

Query  67   LGREERK*LEM-DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFS  243
            +G EE    +  DA     ELRE+FA+GKT+SYEWR SQLK +LKI ++HE+ ++ AL S
Sbjct  1    MGSEEANAFDAKDAPKIAGELRESFASGKTRSYEWRTSQLKTILKILDNHEQDMILALRS  60

Query  244  DLSKPELESFVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLV  423
            DLSKPE+ES++ EIA +K SCK  LK LK WM PE  K++  T+PSSA+IVSEPLGV+L+
Sbjct  61   DLSKPEMESYIQEIAMLKNSCKATLKSLKGWMVPEKAKTSMTTFPSSAEIVSEPLGVILI  120

Query  424  ISAWNYPFMLSLDPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            ISAWNYPF LS+DPVIGAIAAGNAVVLKPSE++PA+S+LLAKL  +YMDT+ V+
Sbjct  121  ISAWNYPFYLSIDPVIGAIAAGNAVVLKPSEVSPASSALLAKLLKEYMDTSCVR  174



>ref|XP_002307060.1| hypothetical protein POPTR_0005s07090g [Populus trichocarpa]
 gb|EEE94056.1| hypothetical protein POPTR_0005s07090g [Populus trichocarpa]
Length=488

 Score =   206 bits (523),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 110/162 (68%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = +1

Query  100  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  279
            +A + V EL+E+F  G+T+SYEWRVSQLK + K+ E  EK I +AL+ DLSKPE E+FV 
Sbjct  13   EAPSLVKELKESFRTGRTRSYEWRVSQLKGIEKMVEEREKDISEALYKDLSKPEFEAFVS  72

Query  280  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  459
            EIA VK+SC+ ALKELK+WMKPE  K++   YPSSA+IVSEPLG VLVIS WNYPF+LS+
Sbjct  73   EIAAVKSSCEEALKELKQWMKPEKAKTSMTAYPSSAEIVSEPLGAVLVISTWNYPFLLSI  132

Query  460  DPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            DPVIGAIAAGNAVVLKPSEIAP TSSLL++LF +Y+D++AV+
Sbjct  133  DPVIGAIAAGNAVVLKPSEIAPVTSSLLSELFEEYLDSSAVR  174



>ref|XP_002520352.1| Aldehyde dehydrogenase, putative [Ricinus communis]
 gb|EEF42138.1| Aldehyde dehydrogenase, putative [Ricinus communis]
Length=495

 Score =   206 bits (523),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 138/162 (85%), Gaps = 0/162 (0%)
 Frame = +1

Query  100  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  279
            + ++ + ELR +F +GKT+SYEWRV+Q+K+++K+ + HEK I+DAL  DLSKPELES V+
Sbjct  19   EGSSMMKELRGSFGSGKTRSYEWRVTQIKSLVKLCDFHEKEIVDALRLDLSKPELESTVY  78

Query  280  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  459
            EI  +K SC++ALKELK WM+PE  K++ AT+PS+A+IV EP GVVL+ISAWNYPF+LSL
Sbjct  79   EIGMLKNSCRVALKELKHWMRPEKAKTSIATFPSAAEIVPEPFGVVLIISAWNYPFLLSL  138

Query  460  DPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            DP+IGAIAAGNAVVLKPSEIAPATSSLLAKL   Y+D++ ++
Sbjct  139  DPLIGAIAAGNAVVLKPSEIAPATSSLLAKLVTAYLDSSCIR  180



>ref|XP_010063405.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Eucalyptus 
grandis]
 gb|KCW70624.1| hypothetical protein EUGRSUZ_F03800 [Eucalyptus grandis]
Length=488

 Score =   206 bits (523),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 109/173 (63%), Positives = 143/173 (83%), Gaps = 3/173 (2%)
 Frame = +1

Query  76   EERK*LEMDAAAA---VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSD  246
            E++K    D+ AA   V+ELR  FA+G T+SY+WR SQL+ +L++ + HE+ I+ AL SD
Sbjct  4    EDKKQQPFDSKAASSLVAELRGAFASGTTRSYQWRESQLRGLLRMTDEHEQDIVAALRSD  63

Query  247  LSKPELESFVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVI  426
            L KPELES ++E A ++ SCK ALKEL+RWM PE VK++  T+PSSA+IVSEPLGVVL+I
Sbjct  64   LGKPELESVLYEAAMLRNSCKFALKELQRWMMPEKVKTSLTTFPSSAEIVSEPLGVVLII  123

Query  427  SAWNYPFMLSLDPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            SAWNYP++LSLDPV+GAIAAGNAVVLKPSEIAPATS+LLAKL  +YMD+++++
Sbjct  124  SAWNYPYLLSLDPVVGAIAAGNAVVLKPSEIAPATSALLAKLLGEYMDSSSIR  176



>ref|XP_011003449.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Populus 
euphratica]
Length=488

 Score =   206 bits (523),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 105/171 (61%), Positives = 144/171 (84%), Gaps = 1/171 (1%)
 Frame = +1

Query  76   EERK*LEMDAAAAVS-ELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLS  252
            EE    +++AA  ++ +LR+ FA+GKT+SYEWR+SQLK+++K+ + HE+ I+DAL  DLS
Sbjct  6    EENTVFDVEAANVLAKDLRDVFASGKTRSYEWRISQLKSIVKMCDEHEEDIVDALRQDLS  65

Query  253  KPELESFVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISA  432
            KP+LES V+E+  VK SC LA+KELKRWM PE  K++  T+PSSA+I+SEPLG VL+ISA
Sbjct  66   KPQLESIVYELTMVKNSCTLAIKELKRWMMPEKAKTSLTTFPSSAEILSEPLGAVLIISA  125

Query  433  WNYPFMLSLDPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            WNYPF+LS+DP+IGAIAAGNA+VLKPSE+APA+SS+LAKL  +Y+D +++K
Sbjct  126  WNYPFLLSMDPLIGAIAAGNAMVLKPSELAPASSSVLAKLLPEYLDCSSIK  176



>ref|XP_010268979.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Nelumbo 
nucifera]
Length=489

 Score =   205 bits (522),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 109/161 (68%), Positives = 137/161 (85%), Gaps = 0/161 (0%)
 Frame = +1

Query  103  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  282
            AAA + ELR +FA+GKTKSY WRV QLK VL++ + +EKAI++AL  DL+KP+ E+FV+E
Sbjct  15   AAALLKELRVSFASGKTKSYGWRVQQLKNVLRMVDENEKAIVEALRLDLAKPKFEAFVNE  74

Query  283  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  462
            I+ VKA+CK +L +LK WMKP+  K++  T+PSSAKIVSEPLGVVL+ISAWNYPF+LSLD
Sbjct  75   ISLVKAACKHSLTKLKHWMKPQKAKTSIITFPSSAKIVSEPLGVVLIISAWNYPFLLSLD  134

Query  463  PvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            PVIGAIAAGN VVLKPSEI+PATSSLLAKL  DY+D + ++
Sbjct  135  PVIGAIAAGNTVVLKPSEISPATSSLLAKLLKDYVDCSTIR  175



>ref|XP_010999403.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Populus 
euphratica]
Length=488

 Score =   205 bits (522),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 105/171 (61%), Positives = 144/171 (84%), Gaps = 1/171 (1%)
 Frame = +1

Query  76   EERK*LEMDAAAAVS-ELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLS  252
            EE    +++AA  ++ +LR+ FA+GKT+SYEWR+SQLK+++K+ + HE+ I+DAL  DLS
Sbjct  6    EENTVFDVEAANVLAKDLRDVFASGKTRSYEWRISQLKSIVKMCDEHEEDIVDALRQDLS  65

Query  253  KPELESFVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISA  432
            KP+LES V+E+  VK SC LA+KELKRWM PE  K++  T+PSSA+I+SEPLG VL+ISA
Sbjct  66   KPQLESIVYELTMVKNSCTLAIKELKRWMMPEKAKTSLTTFPSSAEILSEPLGAVLIISA  125

Query  433  WNYPFMLSLDPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            WNYPF+LS+DP+IGAIAAGNA+VLKPSE+APA+SS+LAKL  +Y+D +++K
Sbjct  126  WNYPFLLSMDPLIGAIAAGNAMVLKPSELAPASSSVLAKLLPEYLDCSSIK  176



>gb|KCW70623.1| hypothetical protein EUGRSUZ_F03800 [Eucalyptus grandis]
Length=514

 Score =   206 bits (523),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 109/173 (63%), Positives = 143/173 (83%), Gaps = 3/173 (2%)
 Frame = +1

Query  76   EERK*LEMDAAAA---VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSD  246
            E++K    D+ AA   V+ELR  FA+G T+SY+WR SQL+ +L++ + HE+ I+ AL SD
Sbjct  4    EDKKQQPFDSKAASSLVAELRGAFASGTTRSYQWRESQLRGLLRMTDEHEQDIVAALRSD  63

Query  247  LSKPELESFVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVI  426
            L KPELES ++E A ++ SCK ALKEL+RWM PE VK++  T+PSSA+IVSEPLGVVL+I
Sbjct  64   LGKPELESVLYEAAMLRNSCKFALKELQRWMMPEKVKTSLTTFPSSAEIVSEPLGVVLII  123

Query  427  SAWNYPFMLSLDPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            SAWNYP++LSLDPV+GAIAAGNAVVLKPSEIAPATS+LLAKL  +YMD+++++
Sbjct  124  SAWNYPYLLSLDPVVGAIAAGNAVVLKPSEIAPATSALLAKLLGEYMDSSSIR  176



>ref|XP_006283479.1| hypothetical protein CARUB_v10004527mg [Capsella rubella]
 gb|EOA16377.1| hypothetical protein CARUB_v10004527mg [Capsella rubella]
Length=546

 Score =   206 bits (524),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 107/162 (66%), Positives = 137/162 (85%), Gaps = 0/162 (0%)
 Frame = +1

Query  100  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  279
            +AA  V ELR  F  G+TKSYEWR+SQL+ + ++ +  EK I +AL+ DLSKPELE+F+ 
Sbjct  69   EAALLVDELRTNFNTGRTKSYEWRISQLQNISRMLDDKEKCITEALYQDLSKPELEAFLA  128

Query  280  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  459
            EI+  K+SC LA+KELK+WM PE VK++  T+PSSA+IVSEPLGVVLVISAWN+PF+LS+
Sbjct  129  EISNTKSSCTLAIKELKKWMAPETVKTSVTTFPSSAQIVSEPLGVVLVISAWNFPFLLSV  188

Query  460  DPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            +PVIGAI+AGNAVVLKPSEIAPATSSLLAKLF++Y+D T ++
Sbjct  189  EPVIGAISAGNAVVLKPSEIAPATSSLLAKLFSEYLDKTTIR  230



>ref|XP_011027504.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Populus 
euphratica]
Length=488

 Score =   204 bits (520),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 109/176 (62%), Positives = 141/176 (80%), Gaps = 3/176 (2%)
 Frame = +1

Query  67   LGREERK*LEMDAAAA---VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDAL  237
            +  EE K    D  AA     ELR+ FA+GKT+SYEWR+SQLK+++K+ + HE+ I+DAL
Sbjct  1    MATEEEKQTVFDVEAANMLTKELRDVFASGKTRSYEWRISQLKSMIKMCDEHEEDIVDAL  60

Query  238  FSDLSKPELESFVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVV  417
              DLSKP+LES V+EI  +K SC LA+KELK+WM PE  K++  T+PSSA+IV EPLGVV
Sbjct  61   HQDLSKPKLESIVYEITMLKNSCTLAIKELKQWMMPEKAKTSLLTFPSSAEIVPEPLGVV  120

Query  418  LVISAWNYPFMLSLDPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            L+ISAWNYPF+LSLDP++GAIAAGNA+VLKPSE +PATSSLLAKL  +Y+D +++K
Sbjct  121  LIISAWNYPFLLSLDPLVGAIAAGNAMVLKPSEFSPATSSLLAKLLPEYLDISSIK  176



>gb|KEH40517.1| NAD-dependent aldehyde dehydrogenase family protein [Medicago 
truncatula]
Length=488

 Score =   204 bits (520),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 110/171 (64%), Positives = 139/171 (81%), Gaps = 2/171 (1%)
 Frame = +1

Query  79   ERK*LEMDAAAA--VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLS  252
            ERK +  + A +  V+ELRETF +GKT++Y+W+VSQLK + K+   HE+ I+DAL +D+ 
Sbjct  6    ERKNMFDNEAGSMLVNELRETFGSGKTRNYDWKVSQLKQLFKLLNFHEEEIIDALRNDID  65

Query  253  KPELESFVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISA  432
            KP LE+  +E+  +K SCK ALKELK WM PE VK++  T+PSSA+IVSEP GVVLVISA
Sbjct  66   KPPLETVAYEVGMLKNSCKTALKELKHWMAPEKVKTSITTFPSSAEIVSEPFGVVLVISA  125

Query  433  WNYPFMLSLDPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            WNYPF+LSLDPVIGAIAAGNAVVLKPSEIAPATSSLLAKL  +YMD ++++
Sbjct  126  WNYPFLLSLDPVIGAIAAGNAVVLKPSEIAPATSSLLAKLLGEYMDNSSIR  176



>emb|CAN73659.1| hypothetical protein VITISV_044129 [Vitis vinifera]
Length=541

 Score =   206 bits (523),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 111/171 (65%), Positives = 142/171 (83%), Gaps = 1/171 (1%)
 Frame = +1

Query  76   EERK*LEMDAAAA-VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLS  252
            E++K  ++++AA+ V ELR +F AGKTKSYEWR++QLK + K+ +  EK I++AL  DLS
Sbjct  65   EKKKVFDVESAASLVKELRGSFNAGKTKSYEWRIAQLKGIEKMIDEREKDIIEALHEDLS  124

Query  253  KPELESFVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISA  432
            KPELE+FV EI+  K +CKLALKEL  WMKPE  K++  TYPSSA+IVSEPLGVVLVIS 
Sbjct  125  KPELEAFVSEISMSKGACKLALKELGHWMKPEKAKTSMTTYPSSAEIVSEPLGVVLVIST  184

Query  433  WNYPFMLSLDPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            WNYP +LS+DPVIGAIAAGNAVVLKPSEIAPATS+LL+KL  +Y+D ++++
Sbjct  185  WNYPLLLSIDPVIGAIAAGNAVVLKPSEIAPATSTLLSKLLEEYLDNSSIR  235



>gb|KHN20611.1| Aldehyde dehydrogenase family 3 member H1 [Glycine soja]
Length=614

 Score =   207 bits (526),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 113/166 (68%), Positives = 137/166 (83%), Gaps = 3/166 (2%)
 Frame = +1

Query  97   MDAAAA---VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELE  267
             DA AA   V+ELR  FA+ KT+SYEWR+SQL A+ K+   HE+ I+DAL +DL KP LE
Sbjct  138  FDAEAASRLVNELRRNFASNKTRSYEWRLSQLNALEKLVVVHEQEIVDALRNDLGKPPLE  197

Query  268  SFVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPF  447
            +  +EIA +K SC++ALKELK WM PE VK++ AT+PSSA+IVSEPLGVVLVISAWNYPF
Sbjct  198  TVAYEIAMLKNSCRIALKELKHWMTPEKVKTSIATFPSSAEIVSEPLGVVLVISAWNYPF  257

Query  448  MLSLDPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            +LSLDPV+GAIAAGNAVVLKPSEIAPATSSLLAKL  DY+D + ++
Sbjct  258  LLSLDPVVGAIAAGNAVVLKPSEIAPATSSLLAKLIGDYLDNSCIR  303



>emb|CBI21614.3| unnamed protein product [Vitis vinifera]
Length=548

 Score =   205 bits (522),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 111/171 (65%), Positives = 142/171 (83%), Gaps = 1/171 (1%)
 Frame = +1

Query  76   EERK*LEMDAAAA-VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLS  252
            E++K  ++++AA+ V ELR +F AGKTKSYEWR++QLK + K+ +  EK I++AL  DLS
Sbjct  64   EKKKVFDVESAASLVKELRGSFNAGKTKSYEWRIAQLKGIEKMIDEREKDIIEALHEDLS  123

Query  253  KPELESFVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISA  432
            KPELE+FV EI+  K +CKLALKEL  WMKPE  K++  TYPSSA+IVSEPLGVVLVIS 
Sbjct  124  KPELEAFVSEISMSKGACKLALKELGHWMKPEKAKTSMTTYPSSAEIVSEPLGVVLVIST  183

Query  433  WNYPFMLSLDPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            WNYP +LS+DPVIGAIAAGNAVVLKPSEIAPATS+LL+KL  +Y+D ++++
Sbjct  184  WNYPLLLSIDPVIGAIAAGNAVVLKPSEIAPATSTLLSKLLEEYLDNSSIR  234



>ref|XP_002869163.1| ALDH3I1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45422.1| ALDH3I1 [Arabidopsis lyrata subsp. lyrata]
Length=548

 Score =   205 bits (522),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 108/162 (67%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = +1

Query  100  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  279
            +AA  V ELR  F  G+TKSYEWR+SQL+++ K+ +  EK I +AL+ DLSKPELE+F+ 
Sbjct  72   EAALLVEELRSNFNTGRTKSYEWRISQLQSIAKMIDEKEKCITEALYQDLSKPELEAFLA  131

Query  280  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  459
            EI+  K+SC LA+KELK WM PE VK++  T+PSSA+IVSEPLGVVLVISAWN+PF+LS+
Sbjct  132  EISNTKSSCMLAIKELKNWMAPETVKTSVTTFPSSAQIVSEPLGVVLVISAWNFPFLLSV  191

Query  460  DPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            +PVIGAIAAGNAVVLKPSEIAPA SSLLAKLF++Y+D T ++
Sbjct  192  EPVIGAIAAGNAVVLKPSEIAPAASSLLAKLFSEYLDNTTIR  233



>ref|XP_002273730.2| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Vitis 
vinifera]
Length=549

 Score =   205 bits (522),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 111/171 (65%), Positives = 142/171 (83%), Gaps = 1/171 (1%)
 Frame = +1

Query  76   EERK*LEMDAAAA-VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLS  252
            E++K  ++++AA+ V ELR +F AGKTKSYEWR++QLK + K+ +  EK I++AL  DLS
Sbjct  65   EKKKVFDVESAASLVKELRGSFNAGKTKSYEWRIAQLKGIEKMIDEREKDIIEALHEDLS  124

Query  253  KPELESFVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISA  432
            KPELE+FV EI+  K +CKLALKEL  WMKPE  K++  TYPSSA+IVSEPLGVVLVIS 
Sbjct  125  KPELEAFVSEISMSKGACKLALKELGHWMKPEKAKTSMTTYPSSAEIVSEPLGVVLVIST  184

Query  433  WNYPFMLSLDPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            WNYP +LS+DPVIGAIAAGNAVVLKPSEIAPATS+LL+KL  +Y+D ++++
Sbjct  185  WNYPLLLSIDPVIGAIAAGNAVVLKPSEIAPATSTLLSKLLEEYLDNSSIR  235



>ref|NP_001288985.1| aldehyde dehydrogenase family 3 member I1, chloroplastic [Brassica 
rapa]
 gb|ABC41273.1| putative aldehyde dehydrogenase [Brassica rapa]
Length=555

 Score =   205 bits (522),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 107/162 (66%), Positives = 137/162 (85%), Gaps = 0/162 (0%)
 Frame = +1

Query  100  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  279
            +AA  V ELR  F  G+T+SYEWR+SQL+ + K+ +  EK I +AL+ DLSKPELE+F+ 
Sbjct  80   EAALLVDELRTNFNTGRTRSYEWRISQLQNIAKMIDEKEKCITEALYQDLSKPELEAFLA  139

Query  280  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  459
            E++  K+SC LA+KELK WM PE VK++  T+PSSA+IVSEPLGVVLVISAWN+PF+LS+
Sbjct  140  ELSNTKSSCMLAIKELKNWMAPETVKTSVTTFPSSAQIVSEPLGVVLVISAWNFPFLLSV  199

Query  460  DPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            +PVIGAI+AGNAVVLKPSEIAPATSSLLAKLF++Y+D TA++
Sbjct  200  EPVIGAISAGNAVVLKPSEIAPATSSLLAKLFSEYLDETAIR  241



>ref|XP_009115077.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic 
isoform X2 [Brassica rapa]
Length=554

 Score =   205 bits (522),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 107/162 (66%), Positives = 137/162 (85%), Gaps = 0/162 (0%)
 Frame = +1

Query  100  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  279
            +AA  V ELR  F  G+T+SYEWR+SQL+ + K+ +  EK I +AL+ DLSKPELE+F+ 
Sbjct  78   EAALLVDELRTNFNTGRTRSYEWRISQLQNIAKMIDEKEKCITEALYQDLSKPELEAFLA  137

Query  280  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  459
            E++  K+SC LA+KELK WM PE VK++  T+PSSA+IVSEPLGVVLVISAWN+PF+LS+
Sbjct  138  ELSNTKSSCMLAIKELKNWMAPETVKTSVTTFPSSAQIVSEPLGVVLVISAWNFPFLLSV  197

Query  460  DPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            +PVIGAI+AGNAVVLKPSEIAPATSSLLAKLF++Y+D TA++
Sbjct  198  EPVIGAISAGNAVVLKPSEIAPATSSLLAKLFSEYLDETAIR  239



>gb|AID60136.1| aldehyde dehydrogenase 3 [Brassica napus]
Length=554

 Score =   205 bits (521),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 107/162 (66%), Positives = 137/162 (85%), Gaps = 0/162 (0%)
 Frame = +1

Query  100  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  279
            +AA  V ELR  F  G+T+SYEWR+SQL+ + K+ +  EK I +AL+ DLSKPELE+F+ 
Sbjct  78   EAALLVDELRTNFNTGRTRSYEWRISQLQNIAKMIDEKEKCITEALYQDLSKPELEAFLA  137

Query  280  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  459
            E++  K+SC LA+KELK WM PE VK++  T+PSSA+IVSEPLGVVLVISAWN+PF+LS+
Sbjct  138  ELSNTKSSCMLAIKELKNWMAPETVKTSVTTFPSSAQIVSEPLGVVLVISAWNFPFLLSV  197

Query  460  DPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            +PVIGAI+AGNAVVLKPSEIAPATSSLLAKLF++Y+D TA++
Sbjct  198  EPVIGAISAGNAVVLKPSEIAPATSSLLAKLFSEYLDETAIR  239



>ref|XP_009115014.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic 
isoform X1 [Brassica rapa]
Length=556

 Score =   205 bits (521),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 107/162 (66%), Positives = 137/162 (85%), Gaps = 0/162 (0%)
 Frame = +1

Query  100  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  279
            +AA  V ELR  F  G+T+SYEWR+SQL+ + K+ +  EK I +AL+ DLSKPELE+F+ 
Sbjct  80   EAALLVDELRTNFNTGRTRSYEWRISQLQNIAKMIDEKEKCITEALYQDLSKPELEAFLA  139

Query  280  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  459
            E++  K+SC LA+KELK WM PE VK++  T+PSSA+IVSEPLGVVLVISAWN+PF+LS+
Sbjct  140  ELSNTKSSCMLAIKELKNWMAPETVKTSVTTFPSSAQIVSEPLGVVLVISAWNFPFLLSV  199

Query  460  DPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            +PVIGAI+AGNAVVLKPSEIAPATSSLLAKLF++Y+D TA++
Sbjct  200  EPVIGAISAGNAVVLKPSEIAPATSSLLAKLFSEYLDETAIR  241



>emb|CDX75414.1| BnaA01g02880D [Brassica napus]
Length=556

 Score =   205 bits (521),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 107/162 (66%), Positives = 137/162 (85%), Gaps = 0/162 (0%)
 Frame = +1

Query  100  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  279
            +AA  V ELR  F  G+T+SYEWR+SQL+ + K+ +  EK I +AL+ DLSKPELE+F+ 
Sbjct  80   EAALLVDELRTNFNTGRTRSYEWRISQLQNIAKMIDEKEKCITEALYQDLSKPELEAFLA  139

Query  280  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  459
            E++  K+SC LA+KELK WM PE VK++  T+PSSA+IVSEPLGVVLVISAWN+PF+LS+
Sbjct  140  ELSNTKSSCMLAIKELKNWMAPETVKTSVTTFPSSAQIVSEPLGVVLVISAWNFPFLLSV  199

Query  460  DPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            +PVIGAI+AGNAVVLKPSEIAPATSSLLAKLF++Y+D TA++
Sbjct  200  EPVIGAISAGNAVVLKPSEIAPATSSLLAKLFSEYLDETAIR  241



>emb|CBI19000.3| unnamed protein product [Vitis vinifera]
Length=550

 Score =   205 bits (521),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 110/183 (60%), Positives = 144/183 (79%), Gaps = 9/183 (5%)
 Frame = +1

Query  64   CLGR--------EERK*LEMDAAAAV-SELRETFAAGKTKSYEWRVSQLKAVLKIAEHHE  216
            C GR        E +K  + +AAA++  ELR T+A+GKT+SYEWRV+QLK ++KI + HE
Sbjct  56   CCGRKSSMAEDSETKKVFDAEAAASLMKELRGTYASGKTRSYEWRVAQLKNLMKIVDDHE  115

Query  217  KAIMDALFSDLSKPELESFVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIV  396
            K I+DA+ +DLSKPE ES++ EI+ +K+SC  AL EL RWMKPE VK++  T+PSSA+IV
Sbjct  116  KDILDAIRADLSKPEQESYIAEISIIKSSCTRALGELNRWMKPEKVKTSITTFPSSAEIV  175

Query  397  SEPLGVVLVISAWNYPFMLSLDPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTT  576
            SEPLGVVL+I AWN+P +L+LDP IGAIAAGNAVVLKPSE+ PATSSL+AKL   Y+D++
Sbjct  176  SEPLGVVLIIGAWNFPLLLALDPAIGAIAAGNAVVLKPSELCPATSSLIAKLVGKYLDSS  235

Query  577  AVK  585
             +K
Sbjct  236  CIK  238



>gb|KFK30059.1| hypothetical protein AALP_AA7G211500 [Arabis alpina]
Length=560

 Score =   205 bits (521),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 106/162 (65%), Positives = 139/162 (86%), Gaps = 0/162 (0%)
 Frame = +1

Query  100  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  279
            +AA+ V +LR  F  G+TKSYEWR+SQL+ ++++ +  EK I +AL+ DLSKPELE+F+ 
Sbjct  84   EAASLVGDLRSNFNTGRTKSYEWRISQLQNIVRMIDEKEKYITEALYQDLSKPELEAFLA  143

Query  280  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  459
            EI+  K+SC LA+K+LK WM PE VK++  T+PSSA+IVSEPLGVVLVISAWN+PF+LS+
Sbjct  144  EISNTKSSCTLAIKDLKTWMAPETVKTSVTTFPSSAQIVSEPLGVVLVISAWNFPFLLSV  203

Query  460  DPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            +PVIGAIAAGNAVVLKPSEIAPATSSLLAKLF++Y+D T+++
Sbjct  204  EPVIGAIAAGNAVVLKPSEIAPATSSLLAKLFSEYLDETSIR  245



>gb|KJB64493.1| hypothetical protein B456_010G051500 [Gossypium raimondii]
Length=490

 Score =   203 bits (517),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 112/171 (65%), Positives = 141/171 (82%), Gaps = 1/171 (1%)
 Frame = +1

Query  76   EERK*LEMDAAA-AVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLS  252
            E++   ++D+A   V ELR +F AGKTK YEWR +QLKA+LK+ + +E  I+ AL  DLS
Sbjct  6    EKKAVFDIDSAKEVVQELRASFVAGKTKDYEWRRTQLKAMLKMMDENEPQIVAALRDDLS  65

Query  253  KPELESFVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISA  432
            KPELES ++EIA +K SCKLALK++K WM PE  K++ AT+PSSA+IVSEPLGVVLVISA
Sbjct  66   KPELESSIYEIAMLKNSCKLALKKMKHWMMPEKAKTSLATFPSSAEIVSEPLGVVLVISA  125

Query  433  WNYPFMLSLDPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            WNYPF+LSLDP IGAIAAGNA+VLKPSEI+PAT+SLLAKL  +YMD++ +K
Sbjct  126  WNYPFLLSLDPFIGAIAAGNAIVLKPSEISPATASLLAKLVANYMDSSCIK  176



>gb|AAY23279.1| aldehyde dehydrogenase, putative [Oryza sativa Japonica Group]
 gb|ABA91776.2| aldehyde dehydrogenase family protein, expressed [Oryza sativa 
Japonica Group]
Length=321

 Score =   199 bits (505),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 103/164 (63%), Positives = 133/164 (81%), Gaps = 0/164 (0%)
 Frame = +1

Query  94   EMDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESF  273
            E + AA V ELR +F +G+T++ EWR +QL+ ++++ E  E  I DAL SDL+KP +ES+
Sbjct  3    EEEVAAVVGELRGSFRSGRTRAAEWRAAQLRGIVRMVEEREGDISDALHSDLAKPRMESY  62

Query  274  VHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFML  453
            +HEI+  KA+C  ALK LK WMKPE V +A  T+PS+A+IVSEPLGVVLVISAWNYPF+L
Sbjct  63   LHEISLAKAACTFALKGLKNWMKPEKVPAALTTFPSTAQIVSEPLGVVLVISAWNYPFLL  122

Query  454  SLDPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            S+DPVIGAIAAGNAVVLKPSEIAPATS+L AKL  +Y+D++ +K
Sbjct  123  SIDPVIGAIAAGNAVVLKPSEIAPATSALFAKLLPEYVDSSCIK  166



>ref|XP_004498347.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X2 [Cicer arietinum]
Length=526

 Score =   204 bits (519),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 106/162 (65%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = +1

Query  100  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  279
            DA + V+ELR +FA GKT+SY+WR+SQL  + ++ + HE+ I+DAL +D+ KP LE+  +
Sbjct  53   DAESTVNELRASFATGKTRSYKWRLSQLNQLFELTQFHEQEIVDALKNDIDKPPLETVTY  112

Query  280  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  459
            EIA +K SC+ A+KELK WM PE VK++  T+PSSA+IVSEPLGVVLVISAWNYPF+LSL
Sbjct  113  EIAMLKNSCQAAIKELKHWMAPEKVKTSLTTFPSSAEIVSEPLGVVLVISAWNYPFLLSL  172

Query  460  DPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            DPVIGAIAAGNAVVLKPSE+APATSSLLAKL  +YMD ++++
Sbjct  173  DPVIGAIAAGNAVVLKPSEMAPATSSLLAKLLGEYMDNSSIR  214



>emb|CAC84903.1| aldehyde dehydrogenase [Arabidopsis thaliana]
Length=550

 Score =   204 bits (519),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 107/162 (66%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = +1

Query  100  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  279
            +AA  V ELR  F +G+TKSYEWR+SQL+ + ++ +  EK I +AL+ DLSKPELE+F+ 
Sbjct  74   EAALLVDELRSNFNSGRTKSYEWRISQLQNIARMIDEKEKCITEALYQDLSKPELEAFLA  133

Query  280  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  459
            EI+  K+SC LA+KELK WM PE VK++  T+PSSA+IVSEPLGVVLVISAWN+PF+LS+
Sbjct  134  EISNTKSSCMLAIKELKNWMAPETVKTSVTTFPSSAQIVSEPLGVVLVISAWNFPFLLSV  193

Query  460  DPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            +PVIGAIAAGNAVVLKPSEIAPA SSLLAKLF++Y+D T ++
Sbjct  194  EPVIGAIAAGNAVVLKPSEIAPAASSLLAKLFSEYLDNTTIR  235



>ref|XP_010664200.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 isoform 
X2 [Vitis vinifera]
Length=488

 Score =   202 bits (515),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 107/171 (63%), Positives = 141/171 (82%), Gaps = 1/171 (1%)
 Frame = +1

Query  76   EERK*LEMDAAAAV-SELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLS  252
            E +K  + +AAA++  ELR T+A+GKT+SYEWRV+QLK ++KI + HEK I+DA+ +DLS
Sbjct  6    ETKKVFDAEAAASLMKELRGTYASGKTRSYEWRVAQLKNLMKIVDDHEKDILDAIRADLS  65

Query  253  KPELESFVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISA  432
            KPE ES++ EI+ +K+SC  AL EL RWMKPE VK++  T+PSSA+IVSEPLGVVL+I A
Sbjct  66   KPEQESYIAEISIIKSSCTRALGELNRWMKPEKVKTSITTFPSSAEIVSEPLGVVLIIGA  125

Query  433  WNYPFMLSLDPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            WN+P +L+LDP IGAIAAGNAVVLKPSE+ PATSSL+AKL   Y+D++ +K
Sbjct  126  WNFPLLLALDPAIGAIAAGNAVVLKPSELCPATSSLIAKLVGKYLDSSCIK  176



>ref|NP_567962.1| aldehyde dehydrogenase 3I1 [Arabidopsis thaliana]
 sp|Q8W033.2|AL3I1_ARATH RecName: Full=Aldehyde dehydrogenase family 3 member I1, chloroplastic; 
Short=AtALDH3; Short=Ath-ALDH3; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAK96824.1| putative aldehyde dehydrogenase [Arabidopsis thaliana]
 gb|AAM10094.1| putative aldehyde dehydrogenase [Arabidopsis thaliana]
 gb|AEE86347.1| aldehyde dehydrogenase 3I1 [Arabidopsis thaliana]
Length=550

 Score =   204 bits (518),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 107/162 (66%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = +1

Query  100  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  279
            +AA  V ELR  F +G+TKSYEWR+SQL+ + ++ +  EK I +AL+ DLSKPELE+F+ 
Sbjct  74   EAALLVDELRSNFNSGRTKSYEWRISQLQNIARMIDEKEKCITEALYQDLSKPELEAFLA  133

Query  280  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  459
            EI+  K+SC LA+KELK WM PE VK++  T+PSSA+IVSEPLGVVLVISAWN+PF+LS+
Sbjct  134  EISNTKSSCMLAIKELKNWMAPETVKTSVTTFPSSAQIVSEPLGVVLVISAWNFPFLLSV  193

Query  460  DPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            +PVIGAIAAGNAVVLKPSEIAPA SSLLAKLF++Y+D T ++
Sbjct  194  EPVIGAIAAGNAVVLKPSEIAPAASSLLAKLFSEYLDNTTIR  235



>gb|KJB75341.1| hypothetical protein B456_012G037500 [Gossypium raimondii]
 gb|KJB75342.1| hypothetical protein B456_012G037500 [Gossypium raimondii]
Length=488

 Score =   202 bits (514),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 109/160 (68%), Positives = 137/160 (86%), Gaps = 0/160 (0%)
 Frame = +1

Query  103  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  282
            AA  V+ELR+TF +GKTKSYEWR+SQL+++ K+ +  EK I++AL  DLSKPELE+F+ E
Sbjct  14   AAVLVNELRKTFNSGKTKSYEWRISQLESISKMIDEKEKEIVEALRKDLSKPELEAFLSE  73

Query  283  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  462
            I   ++SCKLALKELK+WM P+ V+++ ATYPSSA+IV+EPLGVVLVIS WN+PF LSLD
Sbjct  74   ILMARSSCKLALKELKQWMMPQKVETSLATYPSSAEIVAEPLGVVLVISTWNFPFSLSLD  133

Query  463  PvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAV  582
            PVIGAIAAGNAVVLKPSEIA ATSSLL++L  +YMD +A+
Sbjct  134  PVIGAIAAGNAVVLKPSEIASATSSLLSRLVGEYMDKSAI  173



>gb|EYU22982.1| hypothetical protein MIMGU_mgv1a005625mg [Erythranthe guttata]
Length=476

 Score =   202 bits (514),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 105/155 (68%), Positives = 129/155 (83%), Gaps = 0/155 (0%)
 Frame = +1

Query  121  ELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFVKA  300
            ELR  +  GKT+  EWRVSQLKA+LKI   HE  I++AL SDL+KPE E+FVHEIA   +
Sbjct  11   ELRAAYGGGKTRDLEWRVSQLKALLKIINLHENEIVEALRSDLNKPEYEAFVHEIAGASS  70

Query  301  SCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLDPvigai  480
            +CKLALKEL+RW  PE VK+   TYPSSA IVSEPLGVVLVIS WNYPF+LS++P+IGAI
Sbjct  71   ACKLALKELRRWTMPEKVKTTMTTYPSSAHIVSEPLGVVLVISTWNYPFILSIEPIIGAI  130

Query  481  aagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            +AGNAVVLKPSE++PATS++L+KL  +YMDT+AV+
Sbjct  131  SAGNAVVLKPSEVSPATSAVLSKLLGEYMDTSAVR  165



>ref|XP_010664198.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 isoform 
X1 [Vitis vinifera]
 ref|XP_010664199.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 isoform 
X1 [Vitis vinifera]
Length=516

 Score =   203 bits (516),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 107/171 (63%), Positives = 141/171 (82%), Gaps = 1/171 (1%)
 Frame = +1

Query  76   EERK*LEMDAAAAV-SELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLS  252
            E +K  + +AAA++  ELR T+A+GKT+SYEWRV+QLK ++KI + HEK I+DA+ +DLS
Sbjct  6    ETKKVFDAEAAASLMKELRGTYASGKTRSYEWRVAQLKNLMKIVDDHEKDILDAIRADLS  65

Query  253  KPELESFVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISA  432
            KPE ES++ EI+ +K+SC  AL EL RWMKPE VK++  T+PSSA+IVSEPLGVVL+I A
Sbjct  66   KPEQESYIAEISIIKSSCTRALGELNRWMKPEKVKTSITTFPSSAEIVSEPLGVVLIIGA  125

Query  433  WNYPFMLSLDPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            WN+P +L+LDP IGAIAAGNAVVLKPSE+ PATSSL+AKL   Y+D++ +K
Sbjct  126  WNFPLLLALDPAIGAIAAGNAVVLKPSELCPATSSLIAKLVGKYLDSSCIK  176



>gb|KDP32847.1| hypothetical protein JCGZ_12139 [Jatropha curcas]
Length=493

 Score =   202 bits (514),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 111/166 (67%), Positives = 140/166 (84%), Gaps = 3/166 (2%)
 Frame = +1

Query  97   MDAAAA---VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELE  267
             DA AA   V EL   FA+GKT+SYEWRV+QLK +LK+ + +EK I++AL  DLSKPELE
Sbjct  14   FDAEAARDLVKELTGNFASGKTRSYEWRVAQLKNMLKLCDENEKEIVEALRLDLSKPELE  73

Query  268  SFVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPF  447
            S ++EIA +K SCKLALKELK W+KPE V+++  T+PSSA+IVSEPLGVVL+ISAWNYPF
Sbjct  74   STIYEIALLKNSCKLALKELKHWIKPEKVRTSLTTFPSSAEIVSEPLGVVLIISAWNYPF  133

Query  448  MLSLDPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            +LSLDPVIGAIAAGNAVVLKPSE++PA+SSLL KL   Y+D+++++
Sbjct  134  LLSLDPVIGAIAAGNAVVLKPSEVSPASSSLLLKLATKYLDSSSIR  179



>ref|XP_010530214.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Tarenaya 
hassleriana]
 ref|XP_010530215.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Tarenaya 
hassleriana]
Length=482

 Score =   202 bits (513),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 108/163 (66%), Positives = 133/163 (82%), Gaps = 0/163 (0%)
 Frame = +1

Query  97   MDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFV  276
            +DA   V+ELR +F AG T+ YEWRV+QLK +LKI +HHE  I+ AL  DL KPELES V
Sbjct  8    VDAIELVTELRRSFDAGVTRGYEWRVAQLKNLLKICDHHEPEIVSALRDDLGKPELESSV  67

Query  277  HEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLS  456
            +E+A ++ S KLALK LK WM PE  K++  T+P+SA+IVSEPLGVVLVISAWNYPF+LS
Sbjct  68   YEVALLRNSIKLALKHLKDWMTPEKAKTSLTTFPASAEIVSEPLGVVLVISAWNYPFLLS  127

Query  457  LDPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            LDPV+GAIAAGNAVVLKPSEIAPA++SLLAKL   Y+D +A++
Sbjct  128  LDPVVGAIAAGNAVVLKPSEIAPASASLLAKLMEQYLDCSAIR  170



>ref|XP_008227606.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic-like 
[Prunus mume]
Length=368

 Score =   199 bits (505),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 137/171 (80%), Gaps = 1/171 (1%)
 Frame = +1

Query  76   EERK*LEMDAAAA-VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLS  252
            EE++    D A   V ELR +F +G+TKSYEWR+SQL+ + K+ E  EK I +AL+ DLS
Sbjct  66   EEKQTFNPDKAGELVKELRNSFNSGRTKSYEWRMSQLENIAKMLEEKEKEITEALYKDLS  125

Query  253  KPELESFVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISA  432
            KPE+E+F+ EI   K+SC  ALKEL++WM P+ V ++  T+PSSA+IVSEPLGVVLVIS 
Sbjct  126  KPEVEAFISEIVTAKSSCNEALKELRQWMIPQKVNTSITTFPSSAEIVSEPLGVVLVIST  185

Query  433  WNYPFMLSLDPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            WN+PF+LSLDPVIGAI+AGNAVVLKPSEIAPATSS+LAKL  +Y+D +AVK
Sbjct  186  WNFPFLLSLDPVIGAISAGNAVVLKPSEIAPATSSILAKLVEEYLDNSAVK  236



>gb|KCW62442.1| hypothetical protein EUGRSUZ_H05081 [Eucalyptus grandis]
Length=386

 Score =   199 bits (506),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 106/161 (66%), Positives = 133/161 (83%), Gaps = 0/161 (0%)
 Frame = +1

Query  103  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  282
            AA  V ELR++F +GKTKSYEWR +QL+++ K+ +  EK I+ AL  DLSKPELE+FV E
Sbjct  71   AALLVQELRKSFNSGKTKSYEWRAAQLQSISKMIDEREKEIIQALQLDLSKPELEAFVSE  130

Query  283  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  462
            I+  ++SC+ ALK+LKRWM PE V ++  TYPSSA+IVSEP GVVL+IS WNYPF+LSLD
Sbjct  131  ISMTQSSCQKALKDLKRWMAPEKVSTSITTYPSSAEIVSEPFGVVLIISTWNYPFLLSLD  190

Query  463  PvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            PVIGAIAAGNA+VLKPSEIAPATSSLLA L ++Y+D + +K
Sbjct  191  PVIGAIAAGNAIVLKPSEIAPATSSLLAGLLSEYVDRSTIK  231



>ref|XP_004502485.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Cicer 
arietinum]
Length=486

 Score =   201 bits (512),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 104/161 (65%), Positives = 133/161 (83%), Gaps = 0/161 (0%)
 Frame = +1

Query  103  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  282
            A++ V ELRE F++GKT+SYEWR+SQ+KA+LK+    +  I+DAL SDL+KP LE+  +E
Sbjct  16   ASSLVKELRENFSSGKTQSYEWRISQVKALLKMVVEQQDQIIDALRSDLAKPPLETVAYE  75

Query  283  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  462
            I  +K SCK+ LKELK+WM PE VK++  T+PSSA+IV EPLGVVLVISAWNYP +LSLD
Sbjct  76   IGMLKNSCKVTLKELKQWMSPEKVKTSITTFPSSAEIVPEPLGVVLVISAWNYPLLLSLD  135

Query  463  PvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            PV+GAIAAGN VVLKPSE+APA+SSLLAKL   YMD ++++
Sbjct  136  PVVGAIAAGNVVVLKPSEVAPASSSLLAKLLGKYMDNSSIR  176



>gb|KHG30796.1| Aldehyde dehydrogenase family 3 member H1 [Gossypium arboreum]
Length=490

 Score =   202 bits (513),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 112/171 (65%), Positives = 141/171 (82%), Gaps = 1/171 (1%)
 Frame = +1

Query  76   EERK*LEMDAAA-AVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLS  252
            E++   ++D+A   V ELR +F AGKTK YEWR +QLKA+LK+ + +E  I+ AL  DLS
Sbjct  6    EKKAVFDIDSAKEVVQELRASFVAGKTKDYEWRRTQLKAMLKMMDENEPQIVAALRDDLS  65

Query  253  KPELESFVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISA  432
            KPELES ++EIA +K SCKLALK++K WM PE  K++ AT+PSSA+IVSEPLGVVLVISA
Sbjct  66   KPELESSIYEIAMLKNSCKLALKKMKHWMMPEKAKTSLATFPSSAEIVSEPLGVVLVISA  125

Query  433  WNYPFMLSLDPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            WNYP +LSLDPVIGAIAAGNA+VLKPSEI+PAT+SLLAKL  +YMD++ +K
Sbjct  126  WNYPLLLSLDPVIGAIAAGNAIVLKPSEISPATASLLAKLVANYMDSSCIK  176



>ref|XP_010447116.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic-like 
[Camelina sativa]
Length=549

 Score =   202 bits (515),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 135/162 (83%), Gaps = 0/162 (0%)
 Frame = +1

Query  100  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  279
            +AA  V ELR  F  G+TKSYEWR+SQL+ + ++ +  EK I +AL+ DLSKPELE+F+ 
Sbjct  72   EAALLVDELRNNFNTGRTKSYEWRISQLQNISRMLDEKEKCITEALYQDLSKPELEAFLA  131

Query  280  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  459
            EI+  K SC LA+KELK WM PE V+++  T+PSSA+IVSEPLGVVLVISAWN+PF+LS+
Sbjct  132  EISNTKTSCTLAIKELKNWMTPETVETSVTTFPSSAQIVSEPLGVVLVISAWNFPFLLSV  191

Query  460  DPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            +PVIGAI+AGNAVVLKPSEIAPATS+LLAKLF++Y+D T ++
Sbjct  192  EPVIGAISAGNAVVLKPSEIAPATSALLAKLFSEYLDKTTIR  233



>ref|XP_008781593.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Phoenix 
dactylifera]
Length=495

 Score =   201 bits (512),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 102/161 (63%), Positives = 137/161 (85%), Gaps = 0/161 (0%)
 Frame = +1

Query  103  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  282
            AA  V+ELRETF +G+T+S EWR +QLKA++++ E  E  IM AL++DL+KP+LES++HE
Sbjct  20   AAEMVAELRETFRSGRTRSLEWRAAQLKALVRMIEEKESDIMGALYADLAKPQLESYLHE  79

Query  283  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  462
            I+ VK++C  ALK+LKRWMKPE V ++  T+PS+A+IVSEPLGVVL+ISAWNYP +LS+D
Sbjct  80   ISLVKSACSFALKQLKRWMKPEKVPASITTFPSTAEIVSEPLGVVLIISAWNYPVLLSID  139

Query  463  PvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            PVIGAIAAGNAVVLKPS++APATSSL A++  DY+D + ++
Sbjct  140  PVIGAIAAGNAVVLKPSDLAPATSSLFARILPDYIDNSCIR  180



>gb|KCW62441.1| hypothetical protein EUGRSUZ_H05081 [Eucalyptus grandis]
Length=395

 Score =   199 bits (506),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 106/161 (66%), Positives = 133/161 (83%), Gaps = 0/161 (0%)
 Frame = +1

Query  103  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  282
            AA  V ELR++F +GKTKSYEWR +QL+++ K+ +  EK I+ AL  DLSKPELE+FV E
Sbjct  71   AALLVQELRKSFNSGKTKSYEWRAAQLQSISKMIDEREKEIIQALQLDLSKPELEAFVSE  130

Query  283  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  462
            I+  ++SC+ ALK+LKRWM PE V ++  TYPSSA+IVSEP GVVL+IS WNYPF+LSLD
Sbjct  131  ISMTQSSCQKALKDLKRWMAPEKVSTSITTYPSSAEIVSEPFGVVLIISTWNYPFLLSLD  190

Query  463  PvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            PVIGAIAAGNA+VLKPSEIAPATSSLLA L ++Y+D + +K
Sbjct  191  PVIGAIAAGNAIVLKPSEIAPATSSLLAGLLSEYVDRSTIK  231



>ref|XP_004502484.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X3 [Cicer arietinum]
Length=422

 Score =   199 bits (507),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 106/161 (66%), Positives = 134/161 (83%), Gaps = 0/161 (0%)
 Frame = +1

Query  103  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  282
            A++ V ELR +F++GKT+SYEWR+SQ+KA+LK+    +  I+ AL SDL+KP LE+ V+E
Sbjct  16   ASSLVKELRGSFSSGKTQSYEWRISQVKALLKMVVEQQDQIIHALRSDLAKPPLETVVYE  75

Query  283  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  462
            I   K SC++ LKELK+WM PE VKS+  T+PSSA+IV EPLGVVLVISAWNYPF+LSLD
Sbjct  76   IGMFKNSCEVTLKELKQWMAPEKVKSSITTFPSSAEIVPEPLGVVLVISAWNYPFLLSLD  135

Query  463  PvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            PV+GAIAAGNAVVLKPSEIAPA+SSLLAKL   YMD ++++
Sbjct  136  PVVGAIAAGNAVVLKPSEIAPASSSLLAKLLGKYMDNSSIR  176



>gb|KJB75338.1| hypothetical protein B456_012G037500 [Gossypium raimondii]
Length=544

 Score =   202 bits (513),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 109/160 (68%), Positives = 137/160 (86%), Gaps = 0/160 (0%)
 Frame = +1

Query  103  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  282
            AA  V+ELR+TF +GKTKSYEWR+SQL+++ K+ +  EK I++AL  DLSKPELE+F+ E
Sbjct  70   AAVLVNELRKTFNSGKTKSYEWRISQLESISKMIDEKEKEIVEALRKDLSKPELEAFLSE  129

Query  283  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  462
            I   ++SCKLALKELK+WM P+ V+++ ATYPSSA+IV+EPLGVVLVIS WN+PF LSLD
Sbjct  130  ILMARSSCKLALKELKQWMMPQKVETSLATYPSSAEIVAEPLGVVLVISTWNFPFSLSLD  189

Query  463  PvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAV  582
            PVIGAIAAGNAVVLKPSEIA ATSSLL++L  +YMD +A+
Sbjct  190  PVIGAIAAGNAVVLKPSEIASATSSLLSRLVGEYMDKSAI  229



>ref|XP_008444183.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 isoform 
X2 [Cucumis melo]
Length=484

 Score =   201 bits (510),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 109/170 (64%), Positives = 135/170 (79%), Gaps = 1/170 (1%)
 Frame = +1

Query  79   ERK*LEMDAA-AAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSK  255
            ER   + +AA   V+ELRE++ +GKT+SYEWR +QLK +LK+   +E  ++  + SDL K
Sbjct  3    ERTVFDGEAAERVVTELRESYNSGKTRSYEWRENQLKNMLKLVCENEDVMVQTVNSDLHK  62

Query  256  PELESFVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAW  435
            PE E+F HEIA +K SCKLALKEL+RWM PE VKS+   +PSSA IV EP GVVL+ISAW
Sbjct  63   PEFEAFAHEIALLKGSCKLALKELRRWMAPEKVKSSITVFPSSAAIVPEPFGVVLIISAW  122

Query  436  NYPFMLSLDPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            NYPF+LSLDPV+GAIAAGNAVVLKPSEI+P TSSL+AKL   Y+DT+AVK
Sbjct  123  NYPFLLSLDPVVGAIAAGNAVVLKPSEISPRTSSLMAKLLEKYLDTSAVK  172



>gb|KJB75340.1| hypothetical protein B456_012G037500 [Gossypium raimondii]
Length=547

 Score =   202 bits (513),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 109/160 (68%), Positives = 137/160 (86%), Gaps = 0/160 (0%)
 Frame = +1

Query  103  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  282
            AA  V+ELR+TF +GKTKSYEWR+SQL+++ K+ +  EK I++AL  DLSKPELE+F+ E
Sbjct  73   AAVLVNELRKTFNSGKTKSYEWRISQLESISKMIDEKEKEIVEALRKDLSKPELEAFLSE  132

Query  283  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  462
            I   ++SCKLALKELK+WM P+ V+++ ATYPSSA+IV+EPLGVVLVIS WN+PF LSLD
Sbjct  133  ILMARSSCKLALKELKQWMMPQKVETSLATYPSSAEIVAEPLGVVLVISTWNFPFSLSLD  192

Query  463  PvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAV  582
            PVIGAIAAGNAVVLKPSEIA ATSSLL++L  +YMD +A+
Sbjct  193  PVIGAIAAGNAVVLKPSEIASATSSLLSRLVGEYMDKSAI  232



>gb|KJB75339.1| hypothetical protein B456_012G037500 [Gossypium raimondii]
Length=547

 Score =   202 bits (513),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 109/160 (68%), Positives = 137/160 (86%), Gaps = 0/160 (0%)
 Frame = +1

Query  103  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  282
            AA  V+ELR+TF +GKTKSYEWR+SQL+++ K+ +  EK I++AL  DLSKPELE+F+ E
Sbjct  70   AAVLVNELRKTFNSGKTKSYEWRISQLESISKMIDEKEKEIVEALRKDLSKPELEAFLSE  129

Query  283  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  462
            I   ++SCKLALKELK+WM P+ V+++ ATYPSSA+IV+EPLGVVLVIS WN+PF LSLD
Sbjct  130  ILMARSSCKLALKELKQWMMPQKVETSLATYPSSAEIVAEPLGVVLVISTWNFPFSLSLD  189

Query  463  PvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAV  582
            PVIGAIAAGNAVVLKPSEIA ATSSLL++L  +YMD +A+
Sbjct  190  PVIGAIAAGNAVVLKPSEIASATSSLLSRLVGEYMDKSAI  229



>ref|XP_010432443.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic 
[Camelina sativa]
Length=547

 Score =   201 bits (512),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = +1

Query  100  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  279
            +AA  V ELR  F  G+TKSYEWR+SQL+ + ++ +  EK I +AL+ DLSKPELE+F+ 
Sbjct  70   EAALLVDELRNNFNTGRTKSYEWRISQLQNISRMLDEKEKCITEALYQDLSKPELEAFLA  129

Query  280  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  459
            EI+  K+SC LA+KELK WM P+ V+++  T+PSSA+IVSEPLGVVLVISAWN+PF+LS+
Sbjct  130  EISNTKSSCTLAIKELKNWMAPDTVETSVTTFPSSAQIVSEPLGVVLVISAWNFPFLLSV  189

Query  460  DPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            +PVIGAI+AGNAVVLKPSEIAPATS+LLAKLF++Y+D T ++
Sbjct  190  EPVIGAISAGNAVVLKPSEIAPATSTLLAKLFSEYLDKTTIR  231



>emb|CDX69039.1| BnaC01g04140D [Brassica napus]
Length=549

 Score =   201 bits (512),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 135/162 (83%), Gaps = 0/162 (0%)
 Frame = +1

Query  100  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  279
            +AA  V ELR  F  G+T+SYEWR+SQL+ + K+ +  EK I +AL  DLSKPELE+F+ 
Sbjct  73   EAALLVDELRTNFNTGRTRSYEWRISQLQNIAKMIDEKEKCITEALHQDLSKPELEAFLA  132

Query  280  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  459
            E++  K+SC LA+KELK WM PE VK++  T+PSSA+IVSEPLGVVL+ISAWN+PF+LS+
Sbjct  133  ELSNTKSSCMLAIKELKNWMAPETVKTSVTTFPSSAQIVSEPLGVVLIISAWNFPFLLSV  192

Query  460  DPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            +PVIGAI+AGNAVVLKPSEIAPATSSLLAKLF++Y+D T ++
Sbjct  193  EPVIGAISAGNAVVLKPSEIAPATSSLLAKLFSEYLDETTIR  234



>ref|XP_011002476.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Populus 
euphratica]
Length=756

 Score =   204 bits (519),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 111/162 (69%), Positives = 133/162 (82%), Gaps = 0/162 (0%)
 Frame = +1

Query  100  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  279
            +AA  V EL E F AGKTKSYEWRVSQLK + K+    EK I +AL+ DLSKPE E+FV 
Sbjct  76   EAAFLVKELNENFRAGKTKSYEWRVSQLKGIEKMVVEREKDICEALYKDLSKPEYEAFVS  135

Query  280  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  459
            EI+ V++SC+ ALKELK+WMKPE  K++ ATYPSSA+IVSEPLG VLVIS WNYPF LS+
Sbjct  136  EISMVRSSCEEALKELKQWMKPEKAKTSMATYPSSAEIVSEPLGAVLVISTWNYPFSLSV  195

Query  460  DPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
             PV+GAI AGNAVVLKPSEIAPATS+LL+KLF +Y+D +AV+
Sbjct  196  KPVVGAITAGNAVVLKPSEIAPATSALLSKLFEEYLDRSAVR  237


 Score =   133 bits (334),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 74/105 (70%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = +1

Query  271  FVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFM  450
             V +I+ V++SC+ ALKELK+WMKPE  K++ ATYPSSA+IVSEPLG VLVIS WNYPF 
Sbjct  338  LVIQISMVRSSCEEALKELKQWMKPEKAKTSMATYPSSAEIVSEPLGAVLVISTWNYPFS  397

Query  451  LSLDPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            LS+ PV+GAI AGNAVVLKPSEIAPATS+LL+KLF +Y+D +AV+
Sbjct  398  LSVKPVVGAITAGNAVVLKPSEIAPATSALLSKLFEEYLDRSAVR  442



>gb|AES72293.2| NAD-dependent aldehyde dehydrogenase family protein [Medicago 
truncatula]
Length=490

 Score =   200 bits (508),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 105/161 (65%), Positives = 134/161 (83%), Gaps = 0/161 (0%)
 Frame = +1

Query  103  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  282
            A++ V ELR +F++GKT+SYEWR+SQ+KA+LK+ +  +  I+DAL SDL+KP LE+ V+E
Sbjct  18   ASSLVKELRVSFSSGKTRSYEWRISQVKALLKMVDEQQDQIIDALRSDLAKPPLETVVYE  77

Query  283  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  462
            I   K SC++ LKELK+WM PE  K++  T+PSSA+IV EPLGVVLVISAWNYPF+LSLD
Sbjct  78   IGMFKNSCEVTLKELKQWMAPEKAKTSVTTFPSSAEIVPEPLGVVLVISAWNYPFLLSLD  137

Query  463  PvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            PV+GAIAAGNAVVLKPSEIAPA+SSLLA L   YMD ++V+
Sbjct  138  PVVGAIAAGNAVVLKPSEIAPASSSLLANLLGRYMDNSSVR  178



>ref|XP_004142628.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Cucumis 
sativus]
 ref|XP_004161167.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Cucumis 
sativus]
Length=484

 Score =   199 bits (507),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 105/161 (65%), Positives = 131/161 (81%), Gaps = 0/161 (0%)
 Frame = +1

Query  103  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  282
            A   V+ELRE++ +GKT+SYEWR +QLK +LK+   +E+ ++  + SDL KPE E+F HE
Sbjct  12   AERVVTELRESYNSGKTRSYEWRENQLKNLLKLVCENEEVMVQTVNSDLHKPEFEAFAHE  71

Query  283  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  462
            IA +K SCKLA+KEL+RWM PE VKS+   +PSSA IV EP GVVL+ISAWNYPF+LSLD
Sbjct  72   IALLKGSCKLAIKELRRWMAPEKVKSSITVFPSSAAIVPEPFGVVLIISAWNYPFLLSLD  131

Query  463  PvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            PV+GAIAAGNAVVLKPSEI+P TSSL+AKL   Y+DT+AVK
Sbjct  132  PVVGAIAAGNAVVLKPSEISPRTSSLMAKLLEKYLDTSAVK  172



>gb|KHN47009.1| Aldehyde dehydrogenase family 3 member H1 [Glycine soja]
Length=491

 Score =   199 bits (507),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 108/161 (67%), Positives = 132/161 (82%), Gaps = 0/161 (0%)
 Frame = +1

Query  103  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  282
            A++ V ELR+ F +G+T+SYEWRVSQLKA+LK    +E+ I+DAL SDL+KP LE+ V+E
Sbjct  19   ASSLVKELRDNFGSGRTRSYEWRVSQLKALLKAVVDNEEQIVDALRSDLAKPPLETVVYE  78

Query  283  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  462
            I   K SC++ LKELK WM PE VK++  T+PSSA+IV EPLGVVLVISAWNYP +LSLD
Sbjct  79   IGMFKNSCEVILKELKHWMTPEKVKTSIRTFPSSAEIVPEPLGVVLVISAWNYPILLSLD  138

Query  463  PvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            PV+GAIAAGNAVVLKPSEIAPATSS+LAKL   YMD + V+
Sbjct  139  PVVGAIAAGNAVVLKPSEIAPATSSVLAKLIEKYMDNSFVR  179



>ref|XP_004502482.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Cicer arietinum]
Length=488

 Score =   199 bits (507),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 106/161 (66%), Positives = 134/161 (83%), Gaps = 0/161 (0%)
 Frame = +1

Query  103  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  282
            A++ V ELR +F++GKT+SYEWR+SQ+KA+LK+    +  I+ AL SDL+KP LE+ V+E
Sbjct  16   ASSLVKELRGSFSSGKTQSYEWRISQVKALLKMVVEQQDQIIHALRSDLAKPPLETVVYE  75

Query  283  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  462
            I   K SC++ LKELK+WM PE VKS+  T+PSSA+IV EPLGVVLVISAWNYPF+LSLD
Sbjct  76   IGMFKNSCEVTLKELKQWMAPEKVKSSITTFPSSAEIVPEPLGVVLVISAWNYPFLLSLD  135

Query  463  PvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            PV+GAIAAGNAVVLKPSEIAPA+SSLLAKL   YMD ++++
Sbjct  136  PVVGAIAAGNAVVLKPSEIAPASSSLLAKLLGKYMDNSSIR  176



>ref|XP_008227591.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic 
isoform X2 [Prunus mume]
Length=479

 Score =   199 bits (506),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 137/171 (80%), Gaps = 1/171 (1%)
 Frame = +1

Query  76   EERK*LEMDAAAA-VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLS  252
            EE++    D A   V ELR +F +G+TKSYEWR+SQL+ + K+ E  EK I +AL+ DLS
Sbjct  66   EEKQTFNPDKAGELVKELRNSFNSGRTKSYEWRMSQLENIAKMLEEKEKEITEALYKDLS  125

Query  253  KPELESFVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISA  432
            KPE+E+F+ EI   K+SC  ALKEL++WM P+ V ++  T+PSSA+IVSEPLGVVLVIS 
Sbjct  126  KPEVEAFISEIVTAKSSCNEALKELRQWMIPQKVNTSITTFPSSAEIVSEPLGVVLVIST  185

Query  433  WNYPFMLSLDPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            WN+PF+LSLDPVIGAI+AGNAVVLKPSEIAPATSS+LAKL  +Y+D +AVK
Sbjct  186  WNFPFLLSLDPVIGAISAGNAVVLKPSEIAPATSSILAKLVEEYLDNSAVK  236



>gb|KJB29204.1| hypothetical protein B456_005G089100 [Gossypium raimondii]
Length=415

 Score =   197 bits (501),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 104/157 (66%), Positives = 131/157 (83%), Gaps = 0/157 (0%)
 Frame = +1

Query  115  VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFV  294
            V ELR +FA GKTKSYEWR++QL A++K+ E  E  I+ AL  DLSKPELES ++EIA +
Sbjct  20   VKELRASFATGKTKSYEWRLTQLNAMVKMMEEKEPQIVAALHDDLSKPELESSIYEIAML  79

Query  295  KASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLDPvig  474
            K SC+LA+K +K WM PE  K++  T+PSSA+IVSEPLGVVLVISAWNYPF+LSLDP++G
Sbjct  80   KNSCRLAVKNMKHWMMPEKAKTSLVTFPSSAEIVSEPLGVVLVISAWNYPFLLSLDPIVG  139

Query  475  aiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            AIAAGNA+VLKPSEIAPATS LLA+L  +Y+D++ +K
Sbjct  140  AIAAGNAIVLKPSEIAPATSLLLARLVAEYLDSSCIK  176



>ref|XP_009420563.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Musa 
acuminata subsp. malaccensis]
Length=484

 Score =   199 bits (505),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 101/161 (63%), Positives = 132/161 (82%), Gaps = 0/161 (0%)
 Frame = +1

Query  103  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  282
            AA  V+ELRE+F +G+T+S+EWRV+QLK + ++    E  I  AL  DL+KP++ESF+ E
Sbjct  10   AAEVVAELRESFESGRTRSFEWRVAQLKGIARLIVEKEAEITAALDDDLAKPQIESFIGE  69

Query  283  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  462
            I+ V+ SC+ ALKELKRWMKPE V ++  T+PSSAK+VSEPLGVVL+ISAWNYPF+LS+D
Sbjct  70   ISMVRESCRFALKELKRWMKPEKVATSVTTFPSSAKVVSEPLGVVLIISAWNYPFLLSID  129

Query  463  PvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            PVIGAIAAGNAVVLKPSE+APATSS  A++  DY+D + ++
Sbjct  130  PVIGAIAAGNAVVLKPSEVAPATSSFFARILPDYVDNSCIR  170



>ref|NP_001065921.1| Os11g0186200 [Oryza sativa Japonica Group]
 gb|AAY23278.1| aldehyde dehydrogenase, putative [Oryza sativa Japonica Group]
 gb|ABA91775.2| aldehyde dehydrogenase family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF27766.1| Os11g0186200 [Oryza sativa Japonica Group]
 dbj|BAG96824.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96923.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC67818.1| hypothetical protein OsI_35395 [Oryza sativa Indica Group]
 gb|EEE51777.1| hypothetical protein OsJ_33226 [Oryza sativa Japonica Group]
Length=482

 Score =   198 bits (504),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 103/164 (63%), Positives = 133/164 (81%), Gaps = 0/164 (0%)
 Frame = +1

Query  94   EMDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESF  273
            E + AA V ELR +F +G+T++ EWR +QL+ ++++ E  E  I DAL SDL+KP +ES+
Sbjct  3    EEEVAAVVGELRGSFRSGRTRAAEWRAAQLRGIVRMVEEREGDISDALHSDLAKPRMESY  62

Query  274  VHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFML  453
            +HEI+  KA+C  ALK LK WMKPE V +A  T+PS+A+IVSEPLGVVLVISAWNYPF+L
Sbjct  63   LHEISLAKAACTFALKGLKNWMKPEKVPAALTTFPSTAQIVSEPLGVVLVISAWNYPFLL  122

Query  454  SLDPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            S+DPVIGAIAAGNAVVLKPSEIAPATS+L AKL  +Y+D++ +K
Sbjct  123  SIDPVIGAIAAGNAVVLKPSEIAPATSALFAKLLPEYVDSSCIK  166



>ref|XP_006412252.1| hypothetical protein EUTSA_v10024844mg [Eutrema salsugineum]
 dbj|BAJ33838.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ53705.1| hypothetical protein EUTSA_v10024844mg [Eutrema salsugineum]
Length=547

 Score =   199 bits (507),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 106/162 (65%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = +1

Query  100  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  279
            +AA  V ELR  F  G+TKSYEWR+SQL+ + ++ +  E++I +AL  DLSKPELE+F+ 
Sbjct  71   EAALLVEELRINFNTGRTKSYEWRISQLQNISRMIDEKERSIAEALHQDLSKPELEAFLA  130

Query  280  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  459
            EI+  K+SC LA+KELK WM PE VK++  T+PSSA+IVSEPLGVVLVISAWN+PF+LS+
Sbjct  131  EISNTKSSCMLAIKELKNWMAPETVKTSVTTFPSSAQIVSEPLGVVLVISAWNFPFLLSV  190

Query  460  DPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            +PVIGAIAAGNAVVLKPSEIAPATSSLLAKLF++Y+D + ++
Sbjct  191  EPVIGAIAAGNAVVLKPSEIAPATSSLLAKLFSEYLDESTIR  232



>ref|XP_010437650.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic-like 
[Camelina sativa]
Length=549

 Score =   199 bits (507),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 135/162 (83%), Gaps = 0/162 (0%)
 Frame = +1

Query  100  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  279
            +AA  V ELR  F  G+TKSY+WR+SQL+ + ++ +  EK I +AL  DLSKPELE+F+ 
Sbjct  72   EAALLVDELRNNFNTGRTKSYQWRISQLQNISRMLDEKEKCITEALNQDLSKPELEAFLA  131

Query  280  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  459
            EI+  K+SC LA+KELK WM PE V+++  T+PSSA+IVSEPLGVVLVISAWN+PF+LS+
Sbjct  132  EISNTKSSCTLAIKELKNWMAPETVETSVTTFPSSAQIVSEPLGVVLVISAWNFPFLLSV  191

Query  460  DPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            +PVIGAI+AGNAVVLKPSEIAPATS+LLAKLF++Y+D T ++
Sbjct  192  EPVIGAISAGNAVVLKPSEIAPATSALLAKLFSEYLDKTTIR  233



>gb|KDO80593.1| hypothetical protein CISIN_1g011107mg [Citrus sinensis]
Length=300

 Score =   193 bits (491),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 107/165 (65%), Positives = 132/165 (80%), Gaps = 3/165 (2%)
 Frame = +1

Query  100  DAAAA---VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELES  270
            DA AA   V ELR TFA+GKTKSY WRVSQLK+++K+    E  I+DAL  DL KPELES
Sbjct  15   DAEAASLFVKELRGTFASGKTKSYGWRVSQLKSLMKMLNEREPDIVDALRQDLDKPELES  74

Query  271  FVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFM  450
             ++E+A +K S K ALKELK WM PE  K++  T+PSSA+IV EP GVVL+IS WNYPF+
Sbjct  75   SIYEVALLKTSIKSALKELKHWMTPEKAKTSITTFPSSAEIVPEPFGVVLIISPWNYPFL  134

Query  451  LSLDPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            LSLDPV+GAIAAGNA+VLKPSE+APA+SSLLAKL  +YMD ++++
Sbjct  135  LSLDPVVGAIAAGNALVLKPSEVAPASSSLLAKLVGEYMDLSSIR  179



>ref|XP_009414877.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009414878.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Musa 
acuminata subsp. malaccensis]
Length=493

 Score =   198 bits (503),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 103/175 (59%), Positives = 136/175 (78%), Gaps = 3/175 (2%)
 Frame = +1

Query  70   GREERK*LEMDAAAA---VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALF  240
            G E  K    D A A   V+ LR +FA+G+T+S+EWR +QLK ++++ +  E AIM AL 
Sbjct  5    GEERGKGAGFDGAMAAELVAGLRRSFASGRTRSHEWRAAQLKGIVRMIDEKESAIMAALH  64

Query  241  SDLSKPELESFVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVL  420
             DL+KP++ES++HEI+  KA+C  ALKE+KRWMKPE V ++  T+PSSA+I+SEPLGVVL
Sbjct  65   EDLAKPQMESYLHEISLAKAACTFALKEMKRWMKPEKVPTSLTTFPSSAEIISEPLGVVL  124

Query  421  VISAWNYPFMLSLDPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            VISAWNYPF+LS+DPVIGA+ AGNAVVLKPSE+APATS   AK+  +Y+D + VK
Sbjct  125  VISAWNYPFLLSIDPVIGALVAGNAVVLKPSEVAPATSYFFAKVLPEYIDNSCVK  179



>ref|XP_006393739.1| hypothetical protein EUTSA_v10011438mg [Eutrema salsugineum]
 gb|ESQ31025.1| hypothetical protein EUTSA_v10011438mg [Eutrema salsugineum]
Length=483

 Score =   197 bits (502),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 106/162 (65%), Positives = 133/162 (82%), Gaps = 0/162 (0%)
 Frame = +1

Query  100  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  279
            DA+  V+ELR +F AG T  YEWRV+QLK +L I ++HE  I+ AL  DL KPELES V+
Sbjct  10   DASNLVTELRRSFDAGVTCGYEWRVTQLKKLLVICDNHEPEIVSALHDDLGKPELESSVY  69

Query  280  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  459
            E+A ++ S KLALK+LK WM P+  K++  T+P+SA+IVSEPLGVVLVISAWNYPF+LS+
Sbjct  70   EVALLRNSIKLALKQLKNWMAPDKAKTSLTTFPASAEIVSEPLGVVLVISAWNYPFLLSI  129

Query  460  DPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            DPVIGAI+AGNAVVLKPSE+APA+SSLLAKL   Y+DT+AV+
Sbjct  130  DPVIGAISAGNAVVLKPSELAPASSSLLAKLLEQYLDTSAVR  171



>ref|XP_010025726.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Eucalyptus grandis]
 gb|KCW62439.1| hypothetical protein EUGRSUZ_H05081 [Eucalyptus grandis]
Length=550

 Score =   198 bits (504),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 106/161 (66%), Positives = 133/161 (83%), Gaps = 0/161 (0%)
 Frame = +1

Query  103  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  282
            AA  V ELR++F +GKTKSYEWR +QL+++ K+ +  EK I+ AL  DLSKPELE+FV E
Sbjct  76   AALLVQELRKSFNSGKTKSYEWRAAQLQSISKMIDEREKEIIQALQLDLSKPELEAFVSE  135

Query  283  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  462
            I+  ++SC+ ALK+LKRWM PE V ++  TYPSSA+IVSEP GVVL+IS WNYPF+LSLD
Sbjct  136  ISMTQSSCQKALKDLKRWMAPEKVSTSITTYPSSAEIVSEPFGVVLIISTWNYPFLLSLD  195

Query  463  PvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            PVIGAIAAGNA+VLKPSEIAPATSSLLA L ++Y+D + +K
Sbjct  196  PVIGAIAAGNAIVLKPSEIAPATSSLLAGLLSEYVDRSTIK  236



>ref|XP_010025727.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X2 [Eucalyptus grandis]
 gb|KCW62440.1| hypothetical protein EUGRSUZ_H05081 [Eucalyptus grandis]
Length=545

 Score =   198 bits (504),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 106/161 (66%), Positives = 133/161 (83%), Gaps = 0/161 (0%)
 Frame = +1

Query  103  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  282
            AA  V ELR++F +GKTKSYEWR +QL+++ K+ +  EK I+ AL  DLSKPELE+FV E
Sbjct  71   AALLVQELRKSFNSGKTKSYEWRAAQLQSISKMIDEREKEIIQALQLDLSKPELEAFVSE  130

Query  283  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  462
            I+  ++SC+ ALK+LKRWM PE V ++  TYPSSA+IVSEP GVVL+IS WNYPF+LSLD
Sbjct  131  ISMTQSSCQKALKDLKRWMAPEKVSTSITTYPSSAEIVSEPFGVVLIISTWNYPFLLSLD  190

Query  463  PvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            PVIGAIAAGNA+VLKPSEIAPATSSLLA L ++Y+D + +K
Sbjct  191  PVIGAIAAGNAIVLKPSEIAPATSSLLAGLLSEYVDRSTIK  231



>ref|XP_010539000.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Tarenaya 
hassleriana]
Length=482

 Score =   197 bits (500),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 130/162 (80%), Gaps = 0/162 (0%)
 Frame = +1

Query  100  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  279
            DA   V+ LR  F AG T+ YEWRVSQLK +LK+ +HHE  I+ AL  DL KPELES ++
Sbjct  9    DATELVTGLRRGFDAGVTRGYEWRVSQLKNLLKVCDHHEPEIVAALRDDLGKPELESSIY  68

Query  280  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  459
            E+A ++ S KLALK LK WM PE  K++  T+P+SA+IVSEPLGV+LVISAWN+PF+LSL
Sbjct  69   EVALLRNSIKLALKHLKDWMTPEKAKTSLTTFPASAEIVSEPLGVILVISAWNFPFLLSL  128

Query  460  DPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            DPV+GAIAAGNAVVLKPSEIAPAT+SLL+KL   Y+D +A+K
Sbjct  129  DPVVGAIAAGNAVVLKPSEIAPATASLLSKLMEQYLDCSAIK  170



>ref|XP_008227590.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 isoform 
X1 [Prunus mume]
Length=549

 Score =   198 bits (504),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 137/171 (80%), Gaps = 1/171 (1%)
 Frame = +1

Query  76   EERK*LEMDAAAA-VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLS  252
            EE++    D A   V ELR +F +G+TKSYEWR+SQL+ + K+ E  EK I +AL+ DLS
Sbjct  66   EEKQTFNPDKAGELVKELRNSFNSGRTKSYEWRMSQLENIAKMLEEKEKEITEALYKDLS  125

Query  253  KPELESFVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISA  432
            KPE+E+F+ EI   K+SC  ALKEL++WM P+ V ++  T+PSSA+IVSEPLGVVLVIS 
Sbjct  126  KPEVEAFISEIVTAKSSCNEALKELRQWMIPQKVNTSITTFPSSAEIVSEPLGVVLVIST  185

Query  433  WNYPFMLSLDPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            WN+PF+LSLDPVIGAI+AGNAVVLKPSEIAPATSS+LAKL  +Y+D +AVK
Sbjct  186  WNFPFLLSLDPVIGAISAGNAVVLKPSEIAPATSSILAKLVEEYLDNSAVK  236



>gb|ACU23701.1| unknown [Glycine max]
Length=329

 Score =   193 bits (490),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 105/161 (65%), Positives = 128/161 (80%), Gaps = 0/161 (0%)
 Frame = +1

Query  103  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  282
            A++ V ELR+ F  G T+SYEWRVSQ+KA+LK    +E  I+ AL SDL+KP LE+ V+E
Sbjct  16   ASSLVKELRDNFGKGTTRSYEWRVSQVKALLKAVVENEDQIVGALCSDLAKPPLETVVYE  75

Query  283  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  462
            I   + SC++ LKELK WM PE VK++  T+PSSA+IV EPLGVVLVISAWNYP +LSLD
Sbjct  76   IGMFQNSCEVILKELKHWMTPEKVKTSIRTFPSSAEIVPEPLGVVLVISAWNYPILLSLD  135

Query  463  PvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            PV+GAIAAGNAVVLKPSEIAPATSS+LAKL   YMD + V+
Sbjct  136  PVVGAIAAGNAVVLKPSEIAPATSSVLAKLIEKYMDNSFVR  176



>gb|KDO80592.1| hypothetical protein CISIN_1g011107mg [Citrus sinensis]
Length=372

 Score =   194 bits (493),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 107/165 (65%), Positives = 132/165 (80%), Gaps = 3/165 (2%)
 Frame = +1

Query  100  DAAAA---VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELES  270
            DA AA   V ELR TFA+GKTKSY WRVSQLK+++K+    E  I+DAL  DL KPELES
Sbjct  15   DAEAASLFVKELRGTFASGKTKSYGWRVSQLKSLMKMLNEREPDIVDALRQDLDKPELES  74

Query  271  FVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFM  450
             ++E+A +K S K ALKELK WM PE  K++  T+PSSA+IV EP GVVL+IS WNYPF+
Sbjct  75   SIYEVALLKTSIKSALKELKHWMTPEKAKTSITTFPSSAEIVPEPFGVVLIISPWNYPFL  134

Query  451  LSLDPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            LSLDPV+GAIAAGNA+VLKPSE+APA+SSLLAKL  +YMD ++++
Sbjct  135  LSLDPVVGAIAAGNALVLKPSEVAPASSSLLAKLVGEYMDLSSIR  179



>ref|XP_006434228.1| hypothetical protein CICLE_v10000949mg [Citrus clementina]
 gb|ESR47468.1| hypothetical protein CICLE_v10000949mg [Citrus clementina]
Length=372

 Score =   194 bits (493),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 107/165 (65%), Positives = 132/165 (80%), Gaps = 3/165 (2%)
 Frame = +1

Query  100  DAAAA---VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELES  270
            DA AA   V ELR TFA+GKTKSY WRVSQLK+++K+    E  I+DAL  DL KPELES
Sbjct  15   DAEAASLFVKELRGTFASGKTKSYGWRVSQLKSLMKMLNEREPDIVDALRQDLDKPELES  74

Query  271  FVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFM  450
             ++E+A +K S K ALKELK WM PE  K++  T+PSSA+IV EP GVVL+IS WNYPF+
Sbjct  75   SIYEVALLKTSIKSALKELKHWMTPEKAKTSITTFPSSAEIVPEPFGVVLIISPWNYPFL  134

Query  451  LSLDPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            LSLDPV+GAIAAGNA+VLKPSE+APA+SSLLAKL  +YMD ++++
Sbjct  135  LSLDPVVGAIAAGNALVLKPSEVAPASSSLLAKLVGEYMDLSSIR  179



>gb|KJB29202.1| hypothetical protein B456_005G089100 [Gossypium raimondii]
Length=490

 Score =   197 bits (500),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 104/157 (66%), Positives = 131/157 (83%), Gaps = 0/157 (0%)
 Frame = +1

Query  115  VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFV  294
            V ELR +FA GKTKSYEWR++QL A++K+ E  E  I+ AL  DLSKPELES ++EIA +
Sbjct  20   VKELRASFATGKTKSYEWRLTQLNAMVKMMEEKEPQIVAALHDDLSKPELESSIYEIAML  79

Query  295  KASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLDPvig  474
            K SC+LA+K +K WM PE  K++  T+PSSA+IVSEPLGVVLVISAWNYPF+LSLDP++G
Sbjct  80   KNSCRLAVKNMKHWMMPEKAKTSLVTFPSSAEIVSEPLGVVLVISAWNYPFLLSLDPIVG  139

Query  475  aiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            AIAAGNA+VLKPSEIAPATS LLA+L  +Y+D++ +K
Sbjct  140  AIAAGNAIVLKPSEIAPATSLLLARLVAEYLDSSCIK  176



>gb|KHG28299.1| Aldehyde dehydrogenase family 3 member H1 [Gossypium arboreum]
Length=493

 Score =   197 bits (500),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 104/161 (65%), Positives = 131/161 (81%), Gaps = 0/161 (0%)
 Frame = +1

Query  103  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  282
            A   V ELR++F  GKTKSY WRV+QLKA+LK+ + +E  I+ AL  DLSKPE ES ++E
Sbjct  18   ANEVVKELRDSFVTGKTKSYRWRVTQLKAMLKMLDENEPQIVAALRDDLSKPEFESSLYE  77

Query  283  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  462
            I  V  SC+LALKE+  WM PE  K++  T+PSSA+IVSEPLGVVLVISAWNYPF++SLD
Sbjct  78   IQMVNNSCRLALKEMNHWMMPEKAKTSLTTFPSSAEIVSEPLGVVLVISAWNYPFLVSLD  137

Query  463  PvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            PV+GAI+AGNA+VLKPSE+APA+SSLLAKL  DY+D++ +K
Sbjct  138  PVVGAISAGNAIVLKPSEMAPASSSLLAKLVADYLDSSCIK  178



>emb|CDY36336.1| BnaC08g05150D [Brassica napus]
Length=482

 Score =   196 bits (497),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 133/162 (82%), Gaps = 0/162 (0%)
 Frame = +1

Query  100  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  279
            DA+  ++ELR +F AG T+ YEWRVSQLK +L I ++HE  I+ AL  DL KPELES V+
Sbjct  9    DASNLMTELRMSFDAGVTRGYEWRVSQLKKLLVICDNHEPEIVSALHDDLGKPELESSVY  68

Query  280  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  459
            E+A ++ S KLALK+LK WM P+  K++  T+P+SA+IVSEPLGVVLVISAWNYPF+LS+
Sbjct  69   EVALLRNSIKLALKQLKNWMAPDKAKTSLTTFPASAEIVSEPLGVVLVISAWNYPFLLSI  128

Query  460  DPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            DPVIGAI+AGNAVVLKPSE+APA+SSLLAKL   Y+D +AV+
Sbjct  129  DPVIGAISAGNAVVLKPSELAPASSSLLAKLLEQYLDPSAVR  170



>gb|ACJ85715.1| unknown [Medicago truncatula]
Length=313

 Score =   191 bits (485),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 101/157 (64%), Positives = 127/157 (81%), Gaps = 0/157 (0%)
 Frame = +1

Query  115  VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFV  294
            V ELR+ F  GKTKSYEWR+SQL+A++K+ E  EK I+DAL +DLSKP LE+++ EI   
Sbjct  73   VRELRKNFDTGKTKSYEWRISQLEAIVKMLEEKEKEIIDALHTDLSKPRLEAYITEIVQA  132

Query  295  KASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLDPvig  474
            K+SC  AL+ELK WMKPE V ++   +PSSA+I SEPLGVVL+IS WN+P +LSLDPVIG
Sbjct  133  KSSCDEALQELKHWMKPEKVSTSITAFPSSAEIASEPLGVVLIISTWNFPMLLSLDPVIG  192

Query  475  aiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            AI+AGNAVVLKPSE++PATSSLLA L   Y+D +AV+
Sbjct  193  AISAGNAVVLKPSEVSPATSSLLANLLESYLDNSAVR  229



>ref|XP_004503900.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic-like 
isoform X2 [Cicer arietinum]
Length=534

 Score =   196 bits (498),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 107/161 (66%), Positives = 126/161 (78%), Gaps = 0/161 (0%)
 Frame = +1

Query  103  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  282
            AA  V ELR  F  GKTKSYEWR+SQLKA+ K+ E  EK I+DAL  D+SKP LE+F+ E
Sbjct  61   AALLVRELRNNFDTGKTKSYEWRISQLKAIAKMLEEKEKEIVDALNKDISKPPLEAFITE  120

Query  283  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  462
            I   K+SC  AL+ELK WMKPE V ++   YPSSA+IVSEPLGVVLVIS WN+P +LSLD
Sbjct  121  IFQAKSSCNEALQELKHWMKPEKVSTSITAYPSSAEIVSEPLGVVLVISTWNFPMLLSLD  180

Query  463  PvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            PVIGAI+AGN VVLKPSE+APATSSLLA L   Y+D +AV+
Sbjct  181  PVIGAISAGNTVVLKPSEVAPATSSLLANLLESYLDNSAVR  221



>gb|KDO80591.1| hypothetical protein CISIN_1g011107mg [Citrus sinensis]
Length=434

 Score =   194 bits (493),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 107/165 (65%), Positives = 132/165 (80%), Gaps = 3/165 (2%)
 Frame = +1

Query  100  DAAAA---VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELES  270
            DA AA   V ELR TFA+GKTKSY WRVSQLK+++K+    E  I+DAL  DL KPELES
Sbjct  15   DAEAASLFVKELRGTFASGKTKSYGWRVSQLKSLMKMLNEREPDIVDALRQDLDKPELES  74

Query  271  FVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFM  450
             ++E+A +K S K ALKELK WM PE  K++  T+PSSA+IV EP GVVL+IS WNYPF+
Sbjct  75   SIYEVALLKTSIKSALKELKHWMTPEKAKTSITTFPSSAEIVPEPFGVVLIISPWNYPFL  134

Query  451  LSLDPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            LSLDPV+GAIAAGNA+VLKPSE+APA+SSLLAKL  +YMD ++++
Sbjct  135  LSLDPVVGAIAAGNALVLKPSEVAPASSSLLAKLVGEYMDLSSIR  179



>gb|KJB59280.1| hypothetical protein B456_009G247000 [Gossypium raimondii]
Length=493

 Score =   195 bits (496),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 103/161 (64%), Positives = 132/161 (82%), Gaps = 0/161 (0%)
 Frame = +1

Query  103  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  282
            A   V ELR++F  GKTKS+ WRV+QLKA+LK+ + +E  I+ AL  DLSKPE ES ++E
Sbjct  18   AKEVVKELRDSFVTGKTKSHRWRVTQLKAMLKMLDENEPQIVAALRDDLSKPEFESSLYE  77

Query  283  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  462
            I  +K SC+LALKE+  WM PE  K++  T+PSSA+IVSEPLGVVLVISAWNYPF+LSLD
Sbjct  78   IQILKNSCRLALKEMNHWMMPEKAKTSLTTFPSSAEIVSEPLGVVLVISAWNYPFLLSLD  137

Query  463  PvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            PV+GAI+AGNA+VLKPSE+APA+SSL+AKL  DY+D++ +K
Sbjct  138  PVVGAISAGNAIVLKPSEMAPASSSLIAKLVADYLDSSCIK  178



>ref|XP_003526638.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Glycine 
max]
Length=491

 Score =   195 bits (496),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 104/161 (65%), Positives = 132/161 (82%), Gaps = 0/161 (0%)
 Frame = +1

Query  103  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  282
            A++ V ELR+ F +G+T+SYEWRVSQ+KA+LK    +E+ I+DAL SDL+KP LE+ V+E
Sbjct  19   ASSLVKELRDNFGSGRTRSYEWRVSQVKALLKAVVDNEEQIVDALRSDLAKPPLETIVYE  78

Query  283  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  462
            +   K SC++ LKELK+WMKPE VK++  T+PSSA+IV EPLGVVLVISAWNYP +LSLD
Sbjct  79   VGMFKNSCEVILKELKQWMKPEKVKTSIRTFPSSAEIVPEPLGVVLVISAWNYPILLSLD  138

Query  463  PvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            PV+GAIAAGNAVVLKPSEIAPA+SSLL KL   Y D + ++
Sbjct  139  PVVGAIAAGNAVVLKPSEIAPASSSLLLKLIEKYCDNSFIR  179



>ref|XP_008444182.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 isoform 
X1 [Cucumis melo]
Length=488

 Score =   195 bits (495),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 114/165 (69%), Positives = 136/165 (82%), Gaps = 3/165 (2%)
 Frame = +1

Query  100  DAAAA---VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELES  270
            DAAAA   V +LR +F  G T+SYEWRVSQL+++LK++  HE+ + +AL SDLSKP LES
Sbjct  12   DAAAATELVKKLRRSFTTGTTRSYEWRVSQLQSLLKLSLEHEEDLCNALHSDLSKPVLES  71

Query  271  FVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFM  450
             VHEIA +K SCKLALKEL+RWM PE VKS+   +PSSA IV EP GVVL+ISAWNYPF+
Sbjct  72   IVHEIALLKGSCKLALKELRRWMAPEKVKSSITVFPSSAAIVPEPFGVVLIISAWNYPFL  131

Query  451  LSLDPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            LSLDPV+GAIAAGNAVVLKPSEI+P TSSL+AKL   Y+DT+AVK
Sbjct  132  LSLDPVVGAIAAGNAVVLKPSEISPRTSSLMAKLLEKYLDTSAVK  176



>ref|XP_006662789.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Oryza brachyantha]
Length=482

 Score =   195 bits (495),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 101/162 (62%), Positives = 130/162 (80%), Gaps = 0/162 (0%)
 Frame = +1

Query  100  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  279
            + AA   ELR +F AG+T+  EWR +QL+A++++ E  E  I DAL SDL+KP +ES++H
Sbjct  4    EVAAVAGELRASFRAGRTRPAEWRAAQLRAIVRMVEEREGDISDALHSDLAKPRMESYLH  63

Query  280  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  459
            EI+  KA+CK ALK LK WMKPE V +   T+PS+A+IVSEPLGVVLVISAWNYPF+LS+
Sbjct  64   EISLAKAACKFALKGLKNWMKPEKVPAGLTTFPSTAQIVSEPLGVVLVISAWNYPFLLSI  123

Query  460  DPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            +PVIGAIAAGNAV+LKPSEIAPATS+L AKL  +Y+D + +K
Sbjct  124  EPVIGAIAAGNAVLLKPSEIAPATSALFAKLLPEYVDKSCIK  165



>ref|XP_004503899.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic-like 
isoform X1 [Cicer arietinum]
Length=542

 Score =   196 bits (498),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 107/161 (66%), Positives = 126/161 (78%), Gaps = 0/161 (0%)
 Frame = +1

Query  103  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  282
            AA  V ELR  F  GKTKSYEWR+SQLKA+ K+ E  EK I+DAL  D+SKP LE+F+ E
Sbjct  69   AALLVRELRNNFDTGKTKSYEWRISQLKAIAKMLEEKEKEIVDALNKDISKPPLEAFITE  128

Query  283  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  462
            I   K+SC  AL+ELK WMKPE V ++   YPSSA+IVSEPLGVVLVIS WN+P +LSLD
Sbjct  129  IFQAKSSCNEALQELKHWMKPEKVSTSITAYPSSAEIVSEPLGVVLVISTWNFPMLLSLD  188

Query  463  PvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            PVIGAI+AGN VVLKPSE+APATSSLLA L   Y+D +AV+
Sbjct  189  PVIGAISAGNTVVLKPSEVAPATSSLLANLLESYLDNSAVR  229



>ref|XP_011468213.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Fragaria 
vesca subsp. vesca]
Length=545

 Score =   196 bits (498),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 104/161 (65%), Positives = 136/161 (84%), Gaps = 0/161 (0%)
 Frame = +1

Query  103  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  282
            A   V ELR++F +G+TKSYEWR+ QL  + ++ +  EK I++AL+ DLSKPELE+F+ E
Sbjct  74   AGLLVKELRKSFNSGRTKSYEWRMLQLSNIARMLDEKEKDIVEALYKDLSKPELETFISE  133

Query  283  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  462
            I+  K+SCK AL+ LK+WM P+ VK++ AT+PSSA+IVSEPLGVVLVIS WN+PF+LS+D
Sbjct  134  ISTAKSSCKEALEGLKQWMIPQKVKTSIATFPSSAEIVSEPLGVVLVISTWNFPFLLSID  193

Query  463  PvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            PVIGAI+AGNAVVLKPSEIAPATSSLLA+L  +Y+D++AVK
Sbjct  194  PVIGAISAGNAVVLKPSEIAPATSSLLAQLVEEYLDSSAVK  234



>ref|XP_009383529.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Musa 
acuminata subsp. malaccensis]
Length=493

 Score =   195 bits (495),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 101/161 (63%), Positives = 128/161 (80%), Gaps = 0/161 (0%)
 Frame = +1

Query  103  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  282
            AA  V+ LR  FA+G+T+SYEWR +QLK ++++ +  E  IM AL  DL+KP +ES++HE
Sbjct  19   AAVLVAGLRRGFASGRTRSYEWRAAQLKGIVRMIDDKEAEIMAALHDDLAKPHMESYLHE  78

Query  283  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  462
            I+  KA+C  ALKE+KRWMKPE V ++  T+PSSA+IVSEP+GVVLVISAWNYPF+LS+D
Sbjct  79   ISLAKAACTFALKEMKRWMKPEKVPTSITTFPSSAEIVSEPVGVVLVISAWNYPFLLSID  138

Query  463  PvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            PVIGAIAAGNAV LKPSE+APATSSL A +   Y D + VK
Sbjct  139  PVIGAIAAGNAVALKPSEVAPATSSLFATILPKYTDNSCVK  179



>emb|CDY36018.1| BnaA08g04430D [Brassica napus]
Length=482

 Score =   194 bits (494),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 133/162 (82%), Gaps = 0/162 (0%)
 Frame = +1

Query  100  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  279
            DA+  ++ELR +F AG T+SYEWRVSQLK +  I ++HE  I+ AL  DL KPELES V+
Sbjct  9    DASNLMTELRMSFDAGVTRSYEWRVSQLKKLQVICDNHEPEIVSALHDDLGKPELESSVY  68

Query  280  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  459
            E+A ++ S KLALK+LK WM P+  K++  T+P+SA+IVSEPLGVVLVISAWNYPF+LS+
Sbjct  69   EVALLRNSIKLALKQLKNWMAPDKAKTSLTTFPASAEIVSEPLGVVLVISAWNYPFLLSI  128

Query  460  DPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            DPVIGAI+AGNAVVLKPSE+APA+SSLLAKL   Y+D +AV+
Sbjct  129  DPVIGAISAGNAVVLKPSELAPASSSLLAKLLEQYLDPSAVR  170



>ref|XP_006472804.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Citrus 
sinensis]
 gb|KDO80585.1| hypothetical protein CISIN_1g011107mg [Citrus sinensis]
Length=493

 Score =   194 bits (493),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 107/165 (65%), Positives = 132/165 (80%), Gaps = 3/165 (2%)
 Frame = +1

Query  100  DAAAA---VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELES  270
            DA AA   V ELR TFA+GKTKSY WRVSQLK+++K+    E  I+DAL  DL KPELES
Sbjct  15   DAEAASLFVKELRGTFASGKTKSYGWRVSQLKSLMKMLNEREPDIVDALRQDLDKPELES  74

Query  271  FVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFM  450
             ++E+A +K S K ALKELK WM PE  K++  T+PSSA+IV EP GVVL+IS WNYPF+
Sbjct  75   SIYEVALLKTSIKSALKELKHWMTPEKAKTSITTFPSSAEIVPEPFGVVLIISPWNYPFL  134

Query  451  LSLDPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            LSLDPV+GAIAAGNA+VLKPSE+APA+SSLLAKL  +YMD ++++
Sbjct  135  LSLDPVVGAIAAGNALVLKPSEVAPASSSLLAKLVGEYMDLSSIR  179



>ref|XP_006434229.1| hypothetical protein CICLE_v10000949mg [Citrus clementina]
 gb|ESR47469.1| hypothetical protein CICLE_v10000949mg [Citrus clementina]
Length=493

 Score =   194 bits (493),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 107/165 (65%), Positives = 132/165 (80%), Gaps = 3/165 (2%)
 Frame = +1

Query  100  DAAAA---VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELES  270
            DA AA   V ELR TFA+GKTKSY WRVSQLK+++K+    E  I+DAL  DL KPELES
Sbjct  15   DAEAASLFVKELRGTFASGKTKSYGWRVSQLKSLMKMLNEREPDIVDALRQDLDKPELES  74

Query  271  FVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFM  450
             ++E+A +K S K ALKELK WM PE  K++  T+PSSA+IV EP GVVL+IS WNYPF+
Sbjct  75   SIYEVALLKTSIKSALKELKHWMTPEKAKTSITTFPSSAEIVPEPFGVVLIISPWNYPFL  134

Query  451  LSLDPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            LSLDPV+GAIAAGNA+VLKPSE+APA+SSLLAKL  +YMD ++++
Sbjct  135  LSLDPVVGAIAAGNALVLKPSEVAPASSSLLAKLVGEYMDLSSIR  179



>ref|XP_008387507.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Malus domestica]
Length=550

 Score =   194 bits (494),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 104/161 (65%), Positives = 129/161 (80%), Gaps = 0/161 (0%)
 Frame = +1

Query  103  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  282
            A   V ELR++F +G+TKSYEWR  QL+ + K+ E  EK I +AL+ DLSKPE+E+F+ E
Sbjct  77   AGLLVKELRKSFNSGRTKSYEWRRXQLENIAKMLEEKEKEITEALYKDLSKPEIEAFISE  136

Query  283  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  462
            I   ++SC  ALKELK WM P+ V ++  TYPSSA+IVSEPLGVVLVIS WN+PF+LSLD
Sbjct  137  IVQXRSSCNEALKELKHWMVPQKVXTSITTYPSSAEIVSEPLGVVLVISTWNFPFLLSLD  196

Query  463  PvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            PVIGAI+AGNAVVLKPSEIAPATSSLLA L  +Y+D +A+K
Sbjct  197  PVIGAISAGNAVVLKPSEIAPATSSLLANLVEEYLDNSAIK  237



>ref|XP_003602042.1| Aldehyde dehydrogenase family 3 member H1 [Medicago truncatula]
Length=495

 Score =   193 bits (491),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 105/166 (63%), Positives = 134/166 (81%), Gaps = 5/166 (3%)
 Frame = +1

Query  103  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  282
            A++ V ELR +F++GKT+SYEWR+SQ+KA+LK+ +  +  I+DAL SDL+KP LE+ V+E
Sbjct  18   ASSLVKELRVSFSSGKTRSYEWRISQVKALLKMVDEQQDQIIDALRSDLAKPPLETVVYE  77

Query  283  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYP-----F  447
            I   K SC++ LKELK+WM PE  K++  T+PSSA+IV EPLGVVLVISAWNYP     F
Sbjct  78   IGMFKNSCEVTLKELKQWMAPEKAKTSVTTFPSSAEIVPEPLGVVLVISAWNYPFRKSTF  137

Query  448  MLSLDPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            +LSLDPV+GAIAAGNAVVLKPSEIAPA+SSLLA L   YMD ++V+
Sbjct  138  VLSLDPVVGAIAAGNAVVLKPSEIAPASSSLLANLLGRYMDNSSVR  183



>ref|XP_008367720.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Malus 
domestica]
Length=560

 Score =   194 bits (494),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 104/161 (65%), Positives = 129/161 (80%), Gaps = 0/161 (0%)
 Frame = +1

Query  103  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  282
            A   V ELR++F +G+TKSYEWR  QL+ + K+ E  EK I +AL+ DLSKPE+E+F+ E
Sbjct  87   AGLLVKELRKSFNSGRTKSYEWRRXQLENIAKMLEEKEKEITEALYKDLSKPEIEAFISE  146

Query  283  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  462
            I   ++SC  ALKELK WM P+ V ++  TYPSSA+IVSEPLGVVLVIS WN+PF+LSLD
Sbjct  147  IVQXRSSCNEALKELKHWMVPQKVXTSITTYPSSAEIVSEPLGVVLVISTWNFPFLLSLD  206

Query  463  PvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            PVIGAI+AGNAVVLKPSEIAPATSSLLA L  +Y+D +A+K
Sbjct  207  PVIGAISAGNAVVLKPSEIAPATSSLLANLVEEYLDNSAIK  247



>ref|XP_010461437.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Camelina 
sativa]
Length=485

 Score =   193 bits (490),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 101/162 (62%), Positives = 133/162 (82%), Gaps = 0/162 (0%)
 Frame = +1

Query  100  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  279
            +A+  V+ELR +F  G T+ Y+WR++QLK +L I ++HE  I++AL  DL KPELES V 
Sbjct  12   EASDLVNELRRSFDDGVTRGYDWRITQLKKLLVICDNHEHEIVEALRDDLGKPELESSVF  71

Query  280  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  459
            E+A ++ SCKLALK+LK WM P+  K++  T+P+SA+IVSEPLGVVLVISAWNYPF+LS+
Sbjct  72   EVALLRNSCKLALKQLKNWMAPDKAKTSLTTFPASAEIVSEPLGVVLVISAWNYPFLLSI  131

Query  460  DPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            DPVIGAI+AGNAVVLKPSE+APA+S+LLAKL   Y+D +AV+
Sbjct  132  DPVIGAISAGNAVVLKPSELAPASSALLAKLLEQYLDPSAVR  173



>gb|ACG29168.1| aldehyde dehydrogenase, dimeric NADP-preferring [Zea mays]
Length=478

 Score =   192 bits (489),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 104/161 (65%), Positives = 128/161 (80%), Gaps = 0/161 (0%)
 Frame = +1

Query  103  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  282
            A   V ELR +FAAG+T+  EWR +QLK ++++ +  E  I  AL  DL+KP +ESF+HE
Sbjct  2    AEETVRELRASFAAGRTRPAEWRAAQLKGLIRMIDEKEAEISAALHEDLAKPHMESFLHE  61

Query  283  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  462
            I+  K+SCK ALK LK WMKPE V +A  T+PSSA+IV EPLGVVL+ISAWNYPF+LS+D
Sbjct  62   ISLTKSSCKFALKGLKNWMKPEKVPAAITTFPSSAQIVPEPLGVVLIISAWNYPFILSID  121

Query  463  PvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            PVIGAIAAGNAVVLKPSEIAPATSSLLAKL  +Y+D + +K
Sbjct  122  PVIGAIAAGNAVVLKPSEIAPATSSLLAKLLPEYVDNSCIK  162



>ref|XP_004502483.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X2 [Cicer arietinum]
Length=493

 Score =   193 bits (490),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 134/166 (81%), Gaps = 5/166 (3%)
 Frame = +1

Query  103  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  282
            A++ V ELR +F++GKT+SYEWR+SQ+KA+LK+    +  I+ AL SDL+KP LE+ V+E
Sbjct  16   ASSLVKELRGSFSSGKTQSYEWRISQVKALLKMVVEQQDQIIHALRSDLAKPPLETVVYE  75

Query  283  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYP-----F  447
            I   K SC++ LKELK+WM PE VKS+  T+PSSA+IV EPLGVVLVISAWNYP     F
Sbjct  76   IGMFKNSCEVTLKELKQWMAPEKVKSSITTFPSSAEIVPEPLGVVLVISAWNYPFCKLTF  135

Query  448  MLSLDPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            +LSLDPV+GAIAAGNAVVLKPSEIAPA+SSLLAKL   YMD ++++
Sbjct  136  VLSLDPVVGAIAAGNAVVLKPSEIAPASSSLLAKLLGKYMDNSSIR  181



>ref|XP_003523436.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 isoform 
X1 [Glycine max]
 ref|XP_006578967.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 isoform 
X2 [Glycine max]
 ref|XP_006578968.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 isoform 
X3 [Glycine max]
Length=488

 Score =   192 bits (489),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 105/161 (65%), Positives = 128/161 (80%), Gaps = 0/161 (0%)
 Frame = +1

Query  103  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  282
            A++ V ELR+ F  G T+SYEWRVSQ+KA+LK    +E  I+ AL SDL+KP LE+ V+E
Sbjct  16   ASSLVKELRDNFGKGTTRSYEWRVSQVKALLKAVVENEDQIVGALCSDLAKPPLETVVYE  75

Query  283  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  462
            I   + SC++ LKELK WM PE VK++  T+PSSA+IV EPLGVVLVISAWNYP +LSLD
Sbjct  76   IGMFQNSCEVILKELKHWMTPEKVKTSIRTFPSSAEIVPEPLGVVLVISAWNYPILLSLD  135

Query  463  PvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            PV+GAIAAGNAVVLKPSEIAPATSS+LAKL   YMD + V+
Sbjct  136  PVVGAIAAGNAVVLKPSEIAPATSSVLAKLIEKYMDNSFVR  176



>ref|NP_001148092.1| aldehyde dehydrogenase, dimeric NADP-preferring [Zea mays]
 gb|ACG29697.1| aldehyde dehydrogenase, dimeric NADP-preferring [Zea mays]
Length=481

 Score =   192 bits (489),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 104/161 (65%), Positives = 128/161 (80%), Gaps = 0/161 (0%)
 Frame = +1

Query  103  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  282
            A   V ELR +FAAG+T+  EWR +QLK ++++ +  E  I  AL  DL+KP +ESF+HE
Sbjct  5    AEETVRELRASFAAGRTRPAEWRAAQLKGLIRMIDEKEAEISAALHEDLAKPHMESFLHE  64

Query  283  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  462
            I+  K+SCK ALK LK WMKPE V +A  T+PSSA+IV EPLGVVL+ISAWNYPF+LS+D
Sbjct  65   ISLTKSSCKFALKGLKNWMKPEKVPAAITTFPSSAQIVPEPLGVVLIISAWNYPFILSID  124

Query  463  PvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            PVIGAIAAGNAVVLKPSEIAPATSSLLAKL  +Y+D + +K
Sbjct  125  PVIGAIAAGNAVVLKPSEIAPATSSLLAKLLPEYVDNSCIK  165



>ref|XP_010500136.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Camelina 
sativa]
Length=486

 Score =   192 bits (489),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 101/162 (62%), Positives = 133/162 (82%), Gaps = 0/162 (0%)
 Frame = +1

Query  100  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  279
            +A+  V+ELR +F  G T+ Y+WR++QLK +L I ++HE  I++AL  DL KPELES V 
Sbjct  13   EASDLVNELRRSFDDGVTRGYDWRITQLKKLLVICDNHEHDIVEALRDDLGKPELESSVF  72

Query  280  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  459
            E+A ++ SCKLALK+LK WM P+  K++  T+P+SA+IVSEPLGVVLVISAWNYPF+LS+
Sbjct  73   EVALLRNSCKLALKQLKNWMAPDKAKTSLTTFPASAEIVSEPLGVVLVISAWNYPFLLSI  132

Query  460  DPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            DPVIGAI+AGNAVVLKPSE+APA+S+LLAKL   Y+D +AV+
Sbjct  133  DPVIGAISAGNAVVLKPSELAPASSALLAKLLEQYLDPSAVR  174



>ref|XP_010479042.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Camelina 
sativa]
Length=485

 Score =   192 bits (489),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 101/162 (62%), Positives = 133/162 (82%), Gaps = 0/162 (0%)
 Frame = +1

Query  100  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  279
            +A+  V+ELR +F  G T+ Y+WR++QLK +L I ++HE  I++AL  DL KPELES V 
Sbjct  12   EASDLVNELRRSFDDGVTRGYDWRITQLKKLLVICDNHEHDIVEALRHDLGKPELESSVF  71

Query  280  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  459
            E+A ++ SCKLALK+LK WM P+  K++  T+P+SA+IVSEPLGVVLVISAWNYPF+LS+
Sbjct  72   EVALLRNSCKLALKQLKNWMAPDKAKTSLTTFPASAEIVSEPLGVVLVISAWNYPFLLSI  131

Query  460  DPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            DPVIGAI+AGNAVVLKPSE+APA+S+LLAKL   Y+D +AV+
Sbjct  132  DPVIGAISAGNAVVLKPSELAPASSALLAKLLEQYLDPSAVR  173



>ref|XP_009107480.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Brassica 
rapa]
Length=482

 Score =   192 bits (489),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 132/162 (81%), Gaps = 0/162 (0%)
 Frame = +1

Query  100  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  279
            DA+  ++ELR +F AG T+SYEWRVSQLK +  I ++HE  I+ AL  DL  PELES V+
Sbjct  9    DASNLMTELRMSFDAGVTRSYEWRVSQLKKLQVICDNHEPEIVSALHDDLGTPELESSVY  68

Query  280  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  459
            E+A ++ S KLALK+LK WM P+  K++  T+P+SA+IVSEPLGVVLVISAWNYPF+LS+
Sbjct  69   EVALLRNSIKLALKQLKNWMAPDKAKTSLTTFPASAEIVSEPLGVVLVISAWNYPFLLSI  128

Query  460  DPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            DPVIGAI+AGNAVVLKPSE+APA+SSLLAKL   Y+D +AV+
Sbjct  129  DPVIGAISAGNAVVLKPSELAPASSSLLAKLLEQYLDPSAVR  170



>gb|ACF85700.1| unknown [Zea mays]
 gb|AFW65462.1| aldehyde dehydrogenase, dimeric NADP-preferring [Zea mays]
Length=478

 Score =   192 bits (488),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 104/161 (65%), Positives = 128/161 (80%), Gaps = 0/161 (0%)
 Frame = +1

Query  103  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  282
            A   V ELR +FAAG+T+  EWR +QLK ++++ +  E  I  AL  DL+KP +ESF+HE
Sbjct  2    AEETVRELRASFAAGQTRPAEWRAAQLKGLIRMIDEKEAEISAALHEDLAKPHMESFLHE  61

Query  283  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  462
            I+  K+SCK ALK LK WMKPE V +A  T+PSSA+IV EPLGVVL+ISAWNYPF+LS+D
Sbjct  62   ISLTKSSCKFALKGLKNWMKPEKVPAAITTFPSSAQIVPEPLGVVLIISAWNYPFILSID  121

Query  463  PvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            PVIGAIAAGNAVVLKPSEIAPATSSLLAKL  +Y+D + +K
Sbjct  122  PVIGAIAAGNAVVLKPSEIAPATSSLLAKLLPEYVDNSCIK  162



>ref|XP_002888606.1| ALDH3H1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64865.1| ALDH3H1 [Arabidopsis lyrata subsp. lyrata]
Length=484

 Score =   192 bits (487),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 102/162 (63%), Positives = 133/162 (82%), Gaps = 0/162 (0%)
 Frame = +1

Query  100  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  279
            DA+  V++LR +F  G T+ YEWRV+QLK +L I ++HE  I+ AL  DL KPELES V+
Sbjct  11   DASILVTDLRRSFDDGVTRGYEWRVTQLKKLLIICDNHEPEIVAALRDDLGKPELESSVY  70

Query  280  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  459
            E++ ++ S KLALK+LK WM PE  K++  T+P+SA+IVSEPLGVVLVISAWNYPF+LS+
Sbjct  71   EVSLLRNSIKLALKQLKNWMAPEKAKTSLTTFPASAEIVSEPLGVVLVISAWNYPFLLSI  130

Query  460  DPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            DPVIGAI+AGNAVVLKPSE+APA+S+LLAKL   Y+D++AV+
Sbjct  131  DPVIGAISAGNAVVLKPSELAPASSALLAKLMEQYLDSSAVR  172



>ref|XP_003630349.1| Aldehyde dehydrogenase family 3 member H1 [Medicago truncatula]
Length=550

 Score =   193 bits (490),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 102/157 (65%), Positives = 128/157 (82%), Gaps = 0/157 (0%)
 Frame = +1

Query  115  VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFV  294
            V ELR+ F  GKTKSYEWR+SQL+A++K+ E  EK I+DAL +DLSKP LE+++ EI   
Sbjct  73   VRELRKNFDTGKTKSYEWRISQLEAIVKMLEEKEKEIIDALHTDLSKPRLEAYITEIVQA  132

Query  295  KASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLDPvig  474
            K+SC  AL+ELK WMKPE V ++   +PSSA+IVSEPLGVVL+IS WN+P +LSLDPVIG
Sbjct  133  KSSCDEALQELKHWMKPEKVSTSITAFPSSAEIVSEPLGVVLIISTWNFPMLLSLDPVIG  192

Query  475  aiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            AI+AGNAVVLKPSE++PATSSLLA L   Y+D +AV+
Sbjct  193  AISAGNAVVLKPSEVSPATSSLLANLLESYLDNSAVR  229



>gb|AET04825.2| NAD-dependent aldehyde dehydrogenase family protein [Medicago 
truncatula]
Length=543

 Score =   193 bits (490),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 102/157 (65%), Positives = 128/157 (82%), Gaps = 0/157 (0%)
 Frame = +1

Query  115  VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFV  294
            V ELR+ F  GKTKSYEWR+SQL+A++K+ E  EK I+DAL +DLSKP LE+++ EI   
Sbjct  73   VRELRKNFDTGKTKSYEWRISQLEAIVKMLEEKEKEIIDALHTDLSKPRLEAYITEIVQA  132

Query  295  KASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLDPvig  474
            K+SC  AL+ELK WMKPE V ++   +PSSA+IVSEPLGVVL+IS WN+P +LSLDPVIG
Sbjct  133  KSSCDEALQELKHWMKPEKVSTSITAFPSSAEIVSEPLGVVLIISTWNFPMLLSLDPVIG  192

Query  475  aiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            AI+AGNAVVLKPSE++PATSSLLA L   Y+D +AV+
Sbjct  193  AISAGNAVVLKPSEVSPATSSLLANLLESYLDNSAVR  229



>gb|KHG30273.1| Aldehyde dehydrogenase family 3 member H1 [Gossypium arboreum]
Length=490

 Score =   192 bits (487),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 103/157 (66%), Positives = 130/157 (83%), Gaps = 0/157 (0%)
 Frame = +1

Query  115  VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFV  294
            V ELR +FA GKTKSYEWR++QL A++K+ E  E  I+ AL  DLSKPELES ++EIA +
Sbjct  20   VKELRASFATGKTKSYEWRLTQLNAMVKMMEEKEPQIVAALHDDLSKPELESSIYEIAML  79

Query  295  KASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLDPvig  474
            K S +LA+K +K WM PE  K++  T+PSSA+IVSEPLGVVLVISAWNYPF+LSLDP++G
Sbjct  80   KNSFRLAVKNMKHWMMPEKAKTSLVTFPSSAEIVSEPLGVVLVISAWNYPFLLSLDPIVG  139

Query  475  aiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            AIAAGNA+VLKPSEIAPATS LLA+L  +Y+D++ +K
Sbjct  140  AIAAGNAIVLKPSEIAPATSLLLARLVAEYLDSSCIK  176



>gb|KFK24209.1| hypothetical protein AALP_AAs42301U000200 [Arabis alpina]
Length=483

 Score =   191 bits (486),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 102/162 (63%), Positives = 131/162 (81%), Gaps = 0/162 (0%)
 Frame = +1

Query  100  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  279
            DA   ++ELR +F +G T+ YEWRVSQLK +L I ++HE  I+ AL  DL KPELES V+
Sbjct  10   DATNLMTELRRSFDSGVTRGYEWRVSQLKKLLIICDNHEPEIVSALHDDLGKPELESSVY  69

Query  280  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  459
            E+A ++ S KLAL +LK WM P+  K++  T+P+SA+I+S+PLGVVLVISAWNYPF+LSL
Sbjct  70   EVALLRNSIKLALSQLKYWMAPDKAKTSLTTFPASAEIISDPLGVVLVISAWNYPFLLSL  129

Query  460  DPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            DPVIGAI+AGNAVVLKPSE+APA+SSLLAKL   Y+D +AV+
Sbjct  130  DPVIGAISAGNAVVLKPSELAPASSSLLAKLMEQYLDPSAVR  171



>emb|CDY25655.1| BnaC05g25340D [Brassica napus]
Length=389

 Score =   189 bits (480),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 130/162 (80%), Gaps = 0/162 (0%)
 Frame = +1

Query  100  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  279
            DA   V+ELR +F  G T+ YEWRV+QLK +L I ++HE  I+ AL  DL KPELES V+
Sbjct  9    DATDLVTELRRSFDDGVTRGYEWRVTQLKKLLLICDNHEPEIVSALHDDLGKPELESSVY  68

Query  280  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  459
            E+A ++ S  LA+++LK WM P+  K++  T+P+SA+IV EPLGVVLVISAWNYPF+LS+
Sbjct  69   EVALLRNSINLAVQQLKDWMAPDKAKTSLTTFPASAEIVYEPLGVVLVISAWNYPFLLSI  128

Query  460  DPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            DPVIGAI+AGNAVVLKPSE+APA+SSLLAKL   Y+D++AV+
Sbjct  129  DPVIGAISAGNAVVLKPSELAPASSSLLAKLLEQYLDSSAVR  170



>tpg|DAA38940.1| TPA: hypothetical protein ZEAMMB73_547503 [Zea mays]
Length=317

 Score =   187 bits (474),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 99/161 (61%), Positives = 126/161 (78%), Gaps = 0/161 (0%)
 Frame = +1

Query  103  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  282
            A   V ELR +FA+G+T+  EWR  QLK ++++ +  E  I  AL  DL+KP +ES++HE
Sbjct  2    AEETVQELRASFASGRTRRAEWRAEQLKGLIRMIDEKEAEISAALHEDLAKPHMESYLHE  61

Query  283  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  462
            I+  ++SCK AL  LK WMKPE + +A  T+PSSA+IV EPLGVVL+ISAWNYPF+LS+D
Sbjct  62   ISITRSSCKFALDGLKSWMKPEKIPAALTTFPSSAQIVPEPLGVVLIISAWNYPFILSID  121

Query  463  PvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            PVIGAIAAGNAVVLKPSEIAPATSSLLAKL  +Y+D + +K
Sbjct  122  PVIGAIAAGNAVVLKPSEIAPATSSLLAKLLPEYVDNSCIK  162



>ref|XP_007137428.1| hypothetical protein PHAVU_009G126400g [Phaseolus vulgaris]
 gb|ESW09422.1| hypothetical protein PHAVU_009G126400g [Phaseolus vulgaris]
Length=490

 Score =   191 bits (484),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 104/161 (65%), Positives = 131/161 (81%), Gaps = 0/161 (0%)
 Frame = +1

Query  103  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  282
            A++ V ELR+ F +G+T+SYEWRVSQ+KA+LK    +E  I+DAL SDL+KP LE+ V+E
Sbjct  18   ASSLVKELRKNFGSGRTRSYEWRVSQVKALLKAMVDNEDQIVDALRSDLAKPSLETLVYE  77

Query  283  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  462
            I  +K+S ++ LKELK WM PE VK++  T+PSSA+IV EPLGVVLVIS WNYP +L+L+
Sbjct  78   IGLLKSSSEVILKELKHWMTPEKVKTSIKTFPSSAEIVPEPLGVVLVISPWNYPILLTLE  137

Query  463  PvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            PV+GAIAAGNAVVLKPSEIAPATSSLLAKL   YMD + V+
Sbjct  138  PVVGAIAAGNAVVLKPSEIAPATSSLLAKLIEKYMDHSFVR  178



>gb|AAX96338.1| aldehyde dehydrogenase, putative [Oryza sativa Japonica Group]
Length=494

 Score =   190 bits (482),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 103/176 (59%), Positives = 133/176 (76%), Gaps = 12/176 (7%)
 Frame = +1

Query  94   EMDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESF  273
            E + AA V ELR +F +G+T++ EWR +QL+ ++++ E  E  I DAL SDL+KP +ES+
Sbjct  3    EEEVAAVVGELRGSFRSGRTRAAEWRAAQLRGIVRMVEEREGDISDALHSDLAKPRMESY  62

Query  274  VHEIAFVKASCKLALKELKRWMKPE------------NVKSAFATYPSSAKIVSEPLGVV  417
            +HEI+  KA+C  ALK LK WMKPE             V +A  T+PS+A+IVSEPLGVV
Sbjct  63   LHEISLAKAACTFALKGLKNWMKPEKMLIMLTLINDDQVPAALTTFPSTAQIVSEPLGVV  122

Query  418  LVISAWNYPFMLSLDPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            LVISAWNYPF+LS+DPVIGAIAAGNAVVLKPSEIAPATS+L AKL  +Y+D++ +K
Sbjct  123  LVISAWNYPFLLSIDPVIGAIAAGNAVVLKPSEIAPATSALFAKLLPEYVDSSCIK  178



>ref|XP_009145048.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Brassica 
rapa]
Length=482

 Score =   190 bits (482),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 101/162 (62%), Positives = 130/162 (80%), Gaps = 0/162 (0%)
 Frame = +1

Query  100  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  279
            DA   V+ELR +F  G T+ YEWRV+QLK +L I ++HE  I+ AL  DL KPELES V+
Sbjct  9    DATDLVTELRRSFDDGVTRGYEWRVTQLKKLLLICDNHEPEIVSALHDDLGKPELESSVY  68

Query  280  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  459
            E+A ++ S  LA+K+LK WM P+  K++  T+P+SA+IV EPLGVVLVISAWNYPF+LS+
Sbjct  69   EVALLRNSINLAVKQLKDWMAPDKAKTSLTTFPASAEIVYEPLGVVLVISAWNYPFLLSI  128

Query  460  DPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            DPVIGAI+AGNAVVLKPSE+APA+SSLLAKL   Y+D++AV+
Sbjct  129  DPVIGAISAGNAVVLKPSELAPASSSLLAKLLEQYLDSSAVR  170



>ref|XP_010930724.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Elaeis 
guineensis]
Length=495

 Score =   190 bits (482),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 100/161 (62%), Positives = 130/161 (81%), Gaps = 0/161 (0%)
 Frame = +1

Query  103  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  282
            AA   +E+RE F +GKT+S EWR +QLK ++++ E  E  IM AL +DL+KP  ES++HE
Sbjct  20   AAEMEAEMREIFRSGKTRSLEWRAAQLKGLVRMIEEKEADIMAALDADLAKPPFESYLHE  79

Query  283  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  462
            ++ VK+SC  ALKELK WMKPE V ++  T+PS+A+IVSEPLGVVL+ISAWNYPF+LSL 
Sbjct  80   VSLVKSSCTFALKELKHWMKPEKVPASITTFPSTAEIVSEPLGVVLIISAWNYPFLLSLS  139

Query  463  PvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            PVIGAIAAGNAVVLKPSE+APATSSL A++  DY+D + ++
Sbjct  140  PVIGAIAAGNAVVLKPSEVAPATSSLFARILPDYIDNSCIR  180



>gb|ABR16899.1| unknown [Picea sitchensis]
Length=556

 Score =   190 bits (483),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 99/165 (60%), Positives = 129/165 (78%), Gaps = 1/165 (1%)
 Frame = +1

Query  94   EMDAAAAV-SELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELES  270
            EM  A A+ ++LRETF  G T+SYEWR+SQL+ +LK+ + ++  I +AL  D+ KP  ES
Sbjct  79   EMPIADAIATQLRETFTCGSTRSYEWRMSQLEQILKLTDENQTQITEALHQDMGKPVFES  138

Query  271  FVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFM  450
            F+ EI+  K+SCK+A+KELK WM P+ V +    +PSSA+IV EPLG VL+ISAWNYPF+
Sbjct  139  FISEISLTKSSCKVAIKELKSWMTPQKVSTTITVFPSSAEIVPEPLGAVLIISAWNYPFL  198

Query  451  LSLDPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            LS+DPVIGAIAAGN VVLKPSE+APATSSLLA+L   Y+D +AV+
Sbjct  199  LSMDPVIGAIAAGNVVVLKPSEVAPATSSLLARLIPRYLDNSAVR  243



>ref|XP_006663868.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like, partial 
[Oryza brachyantha]
Length=479

 Score =   189 bits (479),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 97/157 (62%), Positives = 128/157 (82%), Gaps = 0/157 (0%)
 Frame = +1

Query  115  VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFV  294
            V+ LR  FAAG+T+  EWR +QL+ +L++A   E  +  AL +DL+KP  ES+VHEIA V
Sbjct  8    VAALRGRFAAGRTRGAEWRAAQLRGLLRMAAEAEAEVCRALHADLAKPSTESYVHEIALV  67

Query  295  KASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLDPvig  474
            K+SC+ ALK LK+WMKP+ V ++  T+PS+A++ +EPLGVVLVISAWNYPF+LS+DP+IG
Sbjct  68   KSSCEFALKNLKKWMKPQKVHASLMTFPSTARVTAEPLGVVLVISAWNYPFLLSIDPIIG  127

Query  475  aiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            AIAAGNAVVLKPSE+APATSSLLA+L   Y+D+T +K
Sbjct  128  AIAAGNAVVLKPSEVAPATSSLLAELLPRYVDSTCIK  164



>ref|XP_003532071.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic-like 
[Glycine max]
 gb|KHN16935.1| Aldehyde dehydrogenase family 3 member I1, chloroplastic [Glycine 
soja]
Length=541

 Score =   189 bits (481),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 101/157 (64%), Positives = 126/157 (80%), Gaps = 0/157 (0%)
 Frame = +1

Query  115  VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFV  294
            V +LR++F +G TKSY WRVSQL+A+ K+ E  EK I +AL+ DL KP LE+F+ EI+  
Sbjct  73   VKDLRKSFDSGMTKSYGWRVSQLEAIAKMLEEKEKEITEALYKDLGKPRLEAFITEISQA  132

Query  295  KASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLDPvig  474
            K+SC  ALKELK WMKPE V ++  TYPSSA+IV EPLGVVLVIS WN+PF+LS+DPVIG
Sbjct  133  KSSCSEALKELKEWMKPEKVNTSITTYPSSAEIVPEPLGVVLVISTWNFPFLLSMDPVIG  192

Query  475  aiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            AI+AGNAVVLKPSEI+PATSSLLA L   Y+D + ++
Sbjct  193  AISAGNAVVLKPSEISPATSSLLANLIEQYLDNSTIR  229



>emb|CAE51203.1| putative aldehyde dehydrogenase [Arabidopsis thaliana]
Length=480

 Score =   188 bits (477),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 131/162 (81%), Gaps = 0/162 (0%)
 Frame = +1

Query  100  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  279
            +A+  V+ELR +F  G T+ YEWRV+QLK ++ I ++HE  I+ AL  DL KPELES V+
Sbjct  7    EASNLVTELRRSFDDGVTRGYEWRVTQLKKLMIICDNHEPEIVAALRDDLGKPELESSVY  66

Query  280  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  459
            E++ ++ S KLALK+LK WM PE  K++  T+P+SA+IVSEPLGVVLVISAWNYPF+LS+
Sbjct  67   EVSLLRNSIKLALKQLKNWMAPEKAKTSLTTFPASAEIVSEPLGVVLVISAWNYPFLLSI  126

Query  460  DPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            DPVIGAI+AGNAVVLKPSE+APA+S+LL KL   Y+D +AV+
Sbjct  127  DPVIGAISAGNAVVLKPSELAPASSALLTKLLEQYLDPSAVR  168



>gb|AAM61211.1| aldehyde dehydrogenase, putative [Arabidopsis thaliana]
Length=484

 Score =   188 bits (477),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 131/162 (81%), Gaps = 0/162 (0%)
 Frame = +1

Query  100  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  279
            +A+  V+ELR +F  G T+ YEWRV+QLK ++ I ++HE  I+ AL  DL KPELES V+
Sbjct  11   EASNLVTELRRSFDDGVTRGYEWRVTQLKKLMIICDNHEPEIVAALRDDLGKPELESSVY  70

Query  280  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  459
            E++ ++ S KLALK+LK WM PE  K++  T+P+SA+IVSEPLGVVLVISAWNYPF+LS+
Sbjct  71   EVSLLRNSIKLALKQLKNWMAPEKAKTSLTTFPASAEIVSEPLGVVLVISAWNYPFLLSI  130

Query  460  DPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            DPVIGAI+AGNAVVLKPSE+APA+S+LL KL   Y+D +AV+
Sbjct  131  DPVIGAISAGNAVVLKPSELAPASSALLTKLLEQYLDPSAVR  172



>ref|NP_175081.1| aldehyde dehydrogenase 3H1 [Arabidopsis thaliana]
 ref|NP_849770.1| aldehyde dehydrogenase 3H1 [Arabidopsis thaliana]
 sp|Q70DU8.2|AL3H1_ARATH RecName: Full=Aldehyde dehydrogenase family 3 member H1; Short=AtALDH4; 
Short=Ath-ALDH4 [Arabidopsis thaliana]
 gb|AAG50550.1|AC074228_5 aldehyde dehydrogenase, putative [Arabidopsis thaliana]
 gb|AAL59944.1| putative aldehyde dehydrogenase [Arabidopsis thaliana]
 gb|AEE32025.1| aldehyde dehydrogenase 3H1 [Arabidopsis thaliana]
 gb|AEE32026.1| aldehyde dehydrogenase 3H1 [Arabidopsis thaliana]
Length=484

 Score =   188 bits (477),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 131/162 (81%), Gaps = 0/162 (0%)
 Frame = +1

Query  100  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  279
            +A+  V+ELR +F  G T+ YEWRV+QLK ++ I ++HE  I+ AL  DL KPELES V+
Sbjct  11   EASNLVTELRRSFDDGVTRGYEWRVTQLKKLMIICDNHEPEIVAALRDDLGKPELESSVY  70

Query  280  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  459
            E++ ++ S KLALK+LK WM PE  K++  T+P+SA+IVSEPLGVVLVISAWNYPF+LS+
Sbjct  71   EVSLLRNSIKLALKQLKNWMAPEKAKTSLTTFPASAEIVSEPLGVVLVISAWNYPFLLSI  130

Query  460  DPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            DPVIGAI+AGNAVVLKPSE+APA+S+LL KL   Y+D +AV+
Sbjct  131  DPVIGAISAGNAVVLKPSELAPASSALLTKLLEQYLDPSAVR  172



>ref|XP_006304446.1| hypothetical protein CARUB_v10011079mg [Capsella rubella]
 gb|EOA37344.1| hypothetical protein CARUB_v10011079mg [Capsella rubella]
Length=484

 Score =   187 bits (476),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 101/163 (62%), Positives = 132/163 (81%), Gaps = 0/163 (0%)
 Frame = +1

Query  97   MDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFV  276
            ++A+  V ELR +F  G T+ YEWRV+QLK +L + ++HE  I+ AL  DL KPELES V
Sbjct  10   VEASDLVKELRRSFDDGVTRGYEWRVTQLKKLLVVFDNHEPEIVAALRDDLGKPELESSV  69

Query  277  HEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLS  456
            +E++ ++ S KLALK+LK WM P+  K +  T+P+SA+IVSEPLGVVLVISAWNYPF+LS
Sbjct  70   YEVSLLRNSVKLALKQLKNWMAPDKAKISLTTFPASAEIVSEPLGVVLVISAWNYPFLLS  129

Query  457  LDPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            +DPVIGAI+AGNAVVLKPSE+APA+S+LLAKLF  Y+D +AV+
Sbjct  130  IDPVIGAISAGNAVVLKPSELAPASSALLAKLFEQYLDPSAVR  172



>gb|KDO52217.1| hypothetical protein CISIN_1g009109mg [Citrus sinensis]
 gb|KDO52218.1| hypothetical protein CISIN_1g009109mg [Citrus sinensis]
 gb|KDO52219.1| hypothetical protein CISIN_1g009109mg [Citrus sinensis]
 gb|KDO52220.1| hypothetical protein CISIN_1g009109mg [Citrus sinensis]
Length=429

 Score =   186 bits (472),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 109/173 (63%), Positives = 137/173 (79%), Gaps = 3/173 (2%)
 Frame = +1

Query  76   EERK*LEMD---AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSD  246
            EE++    D   AA+ + ELR  + + KTKSYEWR+SQ++++  + E  E+ I++A+  D
Sbjct  57   EEKQMQRFDVEKAASLMKELRNNYNSRKTKSYEWRMSQIQSIANMIEEKEEEIIEAIHKD  116

Query  247  LSKPELESFVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVI  426
            LSKP  E+F+ EI+  K+SCKLALKELK W KPE  K++  TYPSSA+I+SEPLGVVLVI
Sbjct  117  LSKPPFETFISEISMTKSSCKLALKELKYWTKPEKAKTSLTTYPSSAEIISEPLGVVLVI  176

Query  427  SAWNYPFMLSLDPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            S WNYPF+LSLDPVIGAIAAGNAVVLKPSEIAPATSSLLAKL  DY+D +AV+
Sbjct  177  STWNYPFLLSLDPVIGAIAAGNAVVLKPSEIAPATSSLLAKLLEDYVDNSAVR  229



>ref|XP_006432085.1| hypothetical protein CICLE_v10000776mg [Citrus clementina]
 ref|XP_006432087.1| hypothetical protein CICLE_v10000776mg [Citrus clementina]
 ref|XP_006464931.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic-like 
isoform X2 [Citrus sinensis]
 gb|ESR45325.1| hypothetical protein CICLE_v10000776mg [Citrus clementina]
 gb|ESR45327.1| hypothetical protein CICLE_v10000776mg [Citrus clementina]
Length=429

 Score =   186 bits (472),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 109/173 (63%), Positives = 137/173 (79%), Gaps = 3/173 (2%)
 Frame = +1

Query  76   EERK*LEMD---AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSD  246
            EE++    D   AA+ + ELR  + + KTKSYEWR+SQ++++  + E  E+ I++A+  D
Sbjct  57   EEKQMQRFDVEKAASLMKELRNNYNSRKTKSYEWRMSQIQSIANMIEEKEEEIIEAIHKD  116

Query  247  LSKPELESFVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVI  426
            LSKP  E+F+ EI+  K+SCKLALKELK W KPE  K++  TYPSSA+I+SEPLGVVLVI
Sbjct  117  LSKPPFETFISEISMTKSSCKLALKELKYWTKPEKAKTSLTTYPSSAEIISEPLGVVLVI  176

Query  427  SAWNYPFMLSLDPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            S WNYPF+LSLDPVIGAIAAGNAVVLKPSEIAPATSSLLAKL  DY+D +AV+
Sbjct  177  STWNYPFLLSLDPVIGAIAAGNAVVLKPSEIAPATSSLLAKLLEDYVDNSAVR  229



>ref|NP_001168661.1| hypothetical protein [Zea mays]
 gb|ACN29088.1| unknown [Zea mays]
 tpg|DAA38941.1| TPA: hypothetical protein ZEAMMB73_547503 [Zea mays]
Length=478

 Score =   187 bits (474),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 99/161 (61%), Positives = 126/161 (78%), Gaps = 0/161 (0%)
 Frame = +1

Query  103  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  282
            A   V ELR +FA+G+T+  EWR  QLK ++++ +  E  I  AL  DL+KP +ES++HE
Sbjct  2    AEETVQELRASFASGRTRRAEWRAEQLKGLIRMIDEKEAEISAALHEDLAKPHMESYLHE  61

Query  283  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  462
            I+  ++SCK AL  LK WMKPE + +A  T+PSSA+IV EPLGVVL+ISAWNYPF+LS+D
Sbjct  62   ISITRSSCKFALDGLKSWMKPEKIPAALTTFPSSAQIVPEPLGVVLIISAWNYPFILSID  121

Query  463  PvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            PVIGAIAAGNAVVLKPSEIAPATSSLLAKL  +Y+D + +K
Sbjct  122  PVIGAIAAGNAVVLKPSEIAPATSSLLAKLLPEYVDNSCIK  162



>gb|EPS67391.1| aldehyde dehydrogenase, partial [Genlisea aurea]
Length=432

 Score =   186 bits (471),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 107/157 (68%), Positives = 135/157 (86%), Gaps = 0/157 (0%)
 Frame = +1

Query  115  VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFV  294
            V ELR  + +G+T+S EWR SQLKA+LKIA HHE+ I++AL SDL+KP+ E+++ EIA V
Sbjct  1    VEELRSAYHSGRTRSLEWRASQLKALLKIATHHEEEILEALMSDLNKPKHEAYLFEIASV  60

Query  295  KASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLDPvig  474
             ++CKLA+KEL  WM PE VK+  AT+PSSA+IVSEPLGVVLVIS WNYPF+LS++PVIG
Sbjct  61   SSACKLAMKELPGWMMPEKVKTTMATFPSSAEIVSEPLGVVLVISTWNYPFLLSMEPVIG  120

Query  475  aiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            AIAAGNAVVLKPSE+AP+TSSLL+KL  +YMD+TAV+
Sbjct  121  AIAAGNAVVLKPSEVAPSTSSLLSKLLGEYMDSTAVR  157



>gb|ABA96616.1| aldehyde dehydrogenase family protein, expressed [Oryza sativa 
Japonica Group]
Length=484

 Score =   187 bits (474),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 98/159 (62%), Positives = 126/159 (79%), Gaps = 0/159 (0%)
 Frame = +1

Query  109  AAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIA  288
            A V+ LR  FAAG T+  EWR +QL+ +L++A   E  +  AL +DL+KP  ES+VHEIA
Sbjct  11   AEVAALRGRFAAGGTRGAEWRAAQLRGILRMAAEAEAEVCRALHADLAKPYTESYVHEIA  70

Query  289  FVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLDPv  468
             VK+SCK ALK LK+WMKP+ V +   T+PS+A++ +EPLGVVLVISAWNYPF+LS+DP+
Sbjct  71   LVKSSCKFALKNLKKWMKPQKVTAPLMTFPSTARVAAEPLGVVLVISAWNYPFLLSIDPI  130

Query  469  igaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            IGAIAAGNAVVLKPSE+APATSSLLA+L   Y+D + +K
Sbjct  131  IGAIAAGNAVVLKPSEVAPATSSLLAELLPRYVDGSCIK  169



>ref|XP_008668343.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
Length=541

 Score =   187 bits (474),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 99/161 (61%), Positives = 126/161 (78%), Gaps = 0/161 (0%)
 Frame = +1

Query  103  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  282
            A   V ELR +FA+G+T+  EWR  QLK ++++ +  E  I  AL  DL+KP +ES++HE
Sbjct  2    AEETVQELRASFASGRTRRAEWRAEQLKGLIRMIDEKEAEISAALHEDLAKPHMESYLHE  61

Query  283  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  462
            I+  ++SCK AL  LK WMKPE + +A  T+PSSA+IV EPLGVVL+ISAWNYPF+LS+D
Sbjct  62   ISITRSSCKFALDGLKSWMKPEKIPAALTTFPSSAQIVPEPLGVVLIISAWNYPFILSID  121

Query  463  PvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            PVIGAIAAGNAVVLKPSEIAPATSSLLAKL  +Y+D + +K
Sbjct  122  PVIGAIAAGNAVVLKPSEIAPATSSLLAKLLPEYVDNSCIK  162



>ref|XP_007159875.1| hypothetical protein PHAVU_002G275200g [Phaseolus vulgaris]
 gb|ESW31869.1| hypothetical protein PHAVU_002G275200g [Phaseolus vulgaris]
Length=566

 Score =   187 bits (475),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 98/157 (62%), Positives = 125/157 (80%), Gaps = 0/157 (0%)
 Frame = +1

Query  115  VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFV  294
            V +LR+ F +G+TKSYEWRVSQL+A+ K+ E  EK I +AL+ DL+KP  E+F+ E+   
Sbjct  98   VRDLRKCFDSGRTKSYEWRVSQLEAISKMLEEKEKEITEALYKDLAKPPFEAFITEVTQA  157

Query  295  KASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLDPvig  474
            K+SC  AL ELK WMKPE V ++  T+PSSA+IV EPLGVVLVIS WN+PF+LS+DPVIG
Sbjct  158  KSSCNEALTELKHWMKPERVSTSITTFPSSAEIVPEPLGVVLVISTWNFPFLLSMDPVIG  217

Query  475  aiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            AI+AGN VVLKPSEI+PATSSLLA L   Y+D +A++
Sbjct  218  AISAGNTVVLKPSEISPATSSLLANLIEQYLDNSAIR  254



>gb|KDO52216.1| hypothetical protein CISIN_1g009109mg [Citrus sinensis]
Length=507

 Score =   186 bits (472),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 110/185 (59%), Positives = 140/185 (76%), Gaps = 3/185 (2%)
 Frame = +1

Query  40   FHIYKYIYCLGREERK*LEMD---AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEH  210
            F  +     +  EE++    D   AA+ + ELR  + + KTKSYEWR+SQ++++  + E 
Sbjct  9    FQDFSCSATMAAEEKQMQRFDVEKAASLMKELRNNYNSRKTKSYEWRMSQIQSIANMIEE  68

Query  211  HEKAIMDALFSDLSKPELESFVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAK  390
             E+ I++A+  DLSKP  E+F+ EI+  K+SCKLALKELK W KPE  K++  TYPSSA+
Sbjct  69   KEEEIIEAIHKDLSKPPFETFISEISMTKSSCKLALKELKYWTKPEKAKTSLTTYPSSAE  128

Query  391  IVSEPLGVVLVISAWNYPFMLSLDPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMD  570
            I+SEPLGVVLVIS WNYPF+LSLDPVIGAIAAGNAVVLKPSEIAPATSSLLAKL  DY+D
Sbjct  129  IISEPLGVVLVISTWNYPFLLSLDPVIGAIAAGNAVVLKPSEIAPATSSLLAKLLEDYVD  188

Query  571  TTAVK  585
             +AV+
Sbjct  189  NSAVR  193



>dbj|BAK01937.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=489

 Score =   185 bits (469),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 97/165 (59%), Positives = 131/165 (79%), Gaps = 0/165 (0%)
 Frame = +1

Query  91   LEMDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELES  270
            +E  AAA ++ELR +F  G+T+  EWR +QL++++++ E  E  I DAL +DL+KP +E+
Sbjct  9    MEPTAAALMAELRGSFREGRTRPAEWRTAQLRSLVRMIEEKEDDISDALHADLAKPRMEA  68

Query  271  FVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFM  450
            ++HEI+  K +C  ALK LK WMKP+ V SA  T+PS+A+IV EP+GVVLVISAWNYPF+
Sbjct  69   YLHEISLAKGACMFALKGLKNWMKPDKVPSAITTFPSTAQIVPEPMGVVLVISAWNYPFL  128

Query  451  LSLDPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            LS++PVIGAIAAGNAVVLKPSEI+PATSSL AKL  +Y+D + +K
Sbjct  129  LSIEPVIGAIAAGNAVVLKPSEISPATSSLFAKLLPEYLDRSCIK  173



>gb|KDO52215.1| hypothetical protein CISIN_1g009109mg [Citrus sinensis]
Length=543

 Score =   186 bits (472),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 109/173 (63%), Positives = 137/173 (79%), Gaps = 3/173 (2%)
 Frame = +1

Query  76   EERK*LEMD---AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSD  246
            EE++    D   AA+ + ELR  + + KTKSYEWR+SQ++++  + E  E+ I++A+  D
Sbjct  57   EEKQMQRFDVEKAASLMKELRNNYNSRKTKSYEWRMSQIQSIANMIEEKEEEIIEAIHKD  116

Query  247  LSKPELESFVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVI  426
            LSKP  E+F+ EI+  K+SCKLALKELK W KPE  K++  TYPSSA+I+SEPLGVVLVI
Sbjct  117  LSKPPFETFISEISMTKSSCKLALKELKYWTKPEKAKTSLTTYPSSAEIISEPLGVVLVI  176

Query  427  SAWNYPFMLSLDPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            S WNYPF+LSLDPVIGAIAAGNAVVLKPSEIAPATSSLLAKL  DY+D +AV+
Sbjct  177  STWNYPFLLSLDPVIGAIAAGNAVVLKPSEIAPATSSLLAKLLEDYVDNSAVR  229



>ref|XP_006432086.1| hypothetical protein CICLE_v10000776mg [Citrus clementina]
 ref|XP_006464930.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic-like 
isoform X1 [Citrus sinensis]
 gb|ESR45326.1| hypothetical protein CICLE_v10000776mg [Citrus clementina]
Length=543

 Score =   186 bits (471),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 109/173 (63%), Positives = 137/173 (79%), Gaps = 3/173 (2%)
 Frame = +1

Query  76   EERK*LEMD---AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSD  246
            EE++    D   AA+ + ELR  + + KTKSYEWR+SQ++++  + E  E+ I++A+  D
Sbjct  57   EEKQMQRFDVEKAASLMKELRNNYNSRKTKSYEWRMSQIQSIANMIEEKEEEIIEAIHKD  116

Query  247  LSKPELESFVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVI  426
            LSKP  E+F+ EI+  K+SCKLALKELK W KPE  K++  TYPSSA+I+SEPLGVVLVI
Sbjct  117  LSKPPFETFISEISMTKSSCKLALKELKYWTKPEKAKTSLTTYPSSAEIISEPLGVVLVI  176

Query  427  SAWNYPFMLSLDPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            S WNYPF+LSLDPVIGAIAAGNAVVLKPSEIAPATSSLLAKL  DY+D +AV+
Sbjct  177  STWNYPFLLSLDPVIGAIAAGNAVVLKPSEIAPATSSLLAKLLEDYVDNSAVR  229



>ref|XP_003577758.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Brachypodium 
distachyon]
Length=481

 Score =   184 bits (468),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 97/156 (62%), Positives = 124/156 (79%), Gaps = 0/156 (0%)
 Frame = +1

Query  118  SELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFVK  297
             ELR  F +G+T+  EWR +QLKA++++ E  E  I DAL +DL+KP +ES++HEI+  K
Sbjct  10   QELRGCFRSGRTRPAEWRAAQLKALVRMIEDKENDISDALHADLAKPRMESYLHEISLAK  69

Query  298  ASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLDPviga  477
             +C  ALK +K WMKPE V +A  T+PS+A IV EPLGVVL+ISAWNYPF+LS+DPVIGA
Sbjct  70   GACIFALKGMKNWMKPEKVPAAITTFPSTATIVPEPLGVVLIISAWNYPFLLSIDPVIGA  129

Query  478  iaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            IAAGNAVVLKPSEIAPATSSL AKL  +Y+D++ +K
Sbjct  130  IAAGNAVVLKPSEIAPATSSLFAKLLPEYVDSSCIK  165



>ref|XP_009355864.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic-like 
isoform X2 [Pyrus x bretschneideri]
Length=534

 Score =   183 bits (465),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 105/155 (68%), Positives = 127/155 (82%), Gaps = 0/155 (0%)
 Frame = +1

Query  121  ELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFVKA  300
            ELR++F +G+TKSYEWR SQL+ + K+ E  EK I +AL+ DLSKPE+E+F+ EI   K+
Sbjct  93   ELRKSFNSGRTKSYEWRRSQLENIAKMLEEKEKEIAEALYKDLSKPEIEAFISEIVQAKS  152

Query  301  SCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLDPvigai  480
            SC  ALKELK WM P+ V +   TYPSSA+IVSEPLGVVLVIS WN+PF+LSLDPVIGAI
Sbjct  153  SCNEALKELKHWMVPQKVSTPITTYPSSAEIVSEPLGVVLVISTWNFPFLLSLDPVIGAI  212

Query  481  aagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            +AGNAVVLKPSEIAPATSSLLA L  +Y+D +AVK
Sbjct  213  SAGNAVVLKPSEIAPATSSLLANLVEEYLDNSAVK  247



>ref|XP_009355863.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Pyrus x bretschneideri]
Length=560

 Score =   182 bits (463),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 105/155 (68%), Positives = 127/155 (82%), Gaps = 0/155 (0%)
 Frame = +1

Query  121  ELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFVKA  300
            ELR++F +G+TKSYEWR SQL+ + K+ E  EK I +AL+ DLSKPE+E+F+ EI   K+
Sbjct  93   ELRKSFNSGRTKSYEWRRSQLENIAKMLEEKEKEIAEALYKDLSKPEIEAFISEIVQAKS  152

Query  301  SCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLDPvigai  480
            SC  ALKELK WM P+ V +   TYPSSA+IVSEPLGVVLVIS WN+PF+LSLDPVIGAI
Sbjct  153  SCNEALKELKHWMVPQKVSTPITTYPSSAEIVSEPLGVVLVISTWNFPFLLSLDPVIGAI  212

Query  481  aagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            +AGNAVVLKPSEIAPATSSLLA L  +Y+D +AVK
Sbjct  213  SAGNAVVLKPSEIAPATSSLLANLVEEYLDNSAVK  247



>ref|XP_010547357.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic 
isoform X1 [Tarenaya hassleriana]
 ref|XP_010547358.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic 
isoform X1 [Tarenaya hassleriana]
Length=540

 Score =   181 bits (458),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 103/164 (63%), Positives = 131/164 (80%), Gaps = 0/164 (0%)
 Frame = +1

Query  94   EMDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESF  273
            E   A+ V ELR+ F  GKTKSYEWR++QL+ + ++ +   K I  AL  DL+KPELE+F
Sbjct  68   EETVASLVEELRDNFKTGKTKSYEWRITQLEGIARMIDEKSKYIAQALREDLNKPELEAF  127

Query  274  VHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFML  453
            + EI+  K+SC LA+KELK WM PE V ++  T PSSA+IVSEPLGVVL+ISAWN+PF+L
Sbjct  128  LAEISNTKSSCMLAIKELKNWMTPEPVTTSVTTSPSSAEIVSEPLGVVLIISAWNFPFLL  187

Query  454  SLDPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            ++DPVIGAIAAGNAVVLKPSEIAPATSSLLA+LF +Y+D T ++
Sbjct  188  AIDPVIGAIAAGNAVVLKPSEIAPATSSLLARLFREYLDGTTIR  231



>ref|XP_004977224.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X2 [Setaria italica]
Length=482

 Score =   179 bits (455),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 96/161 (60%), Positives = 126/161 (78%), Gaps = 0/161 (0%)
 Frame = +1

Query  103  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  282
            AA A   LR +FA+G+T+   WR +QL+ +L++A   E  I  AL +DL+KP  ES+VHE
Sbjct  7    AAQARERLRASFASGRTRPAAWRAAQLRGLLRMAVEMEAEICAALRADLAKPRTESYVHE  66

Query  283  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  462
            I+ V +SCK ALK L++WMKP+ V +   T+PS+A++ +EPLGVVLVISAWNYPF+L++D
Sbjct  67   ISLVTSSCKFALKNLQKWMKPKKVPAGLLTFPSTARVTAEPLGVVLVISAWNYPFLLAID  126

Query  463  PvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            PVIGAIAAGNAVVLKPSEIAPATSSLLA L   Y+D++ +K
Sbjct  127  PVIGAIAAGNAVVLKPSEIAPATSSLLADLLPQYVDSSCIK  167



>ref|XP_004977223.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Setaria italica]
Length=520

 Score =   179 bits (455),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 96/161 (60%), Positives = 126/161 (78%), Gaps = 0/161 (0%)
 Frame = +1

Query  103  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  282
            AA A   LR +FA+G+T+   WR +QL+ +L++A   E  I  AL +DL+KP  ES+VHE
Sbjct  7    AAQARERLRASFASGRTRPAAWRAAQLRGLLRMAVEMEAEICAALRADLAKPRTESYVHE  66

Query  283  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  462
            I+ V +SCK ALK L++WMKP+ V +   T+PS+A++ +EPLGVVLVISAWNYPF+L++D
Sbjct  67   ISLVTSSCKFALKNLQKWMKPKKVPAGLLTFPSTARVTAEPLGVVLVISAWNYPFLLAID  126

Query  463  PvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            PVIGAIAAGNAVVLKPSEIAPATSSLLA L   Y+D++ +K
Sbjct  127  PVIGAIAAGNAVVLKPSEIAPATSSLLADLLPQYVDSSCIK  167



>ref|XP_009404859.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Musa 
acuminata subsp. malaccensis]
Length=487

 Score =   179 bits (453),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 96/161 (60%), Positives = 123/161 (76%), Gaps = 0/161 (0%)
 Frame = +1

Query  103  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  282
            AA  V+ELRETF +G+T+S  WR +QLKA+ ++ + +E  I  AL+ DL+KP  ESF+HE
Sbjct  10   AAEVVAELRETFRSGRTRSLRWRAAQLKALARMIDENEADIAAALYHDLAKPPTESFLHE  69

Query  283  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  462
            I+  K +C  ALK+LKRWMKP  V ++  T+PSSAKIV EP GVVLVISAWN+PF+LS+D
Sbjct  70   ISLAKEACLFALKKLKRWMKPRKVPTSITTFPSSAKIVPEPFGVVLVISAWNFPFLLSID  129

Query  463  PvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            PVIGAIAAGN VVLKPSE+A  TSS LAK    Y+D + ++
Sbjct  130  PVIGAIAAGNTVVLKPSEVATVTSSFLAKNLPQYVDNSCIR  170



>gb|KDO80584.1| hypothetical protein CISIN_1g011107mg [Citrus sinensis]
Length=487

 Score =   178 bits (451),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 100/166 (60%), Positives = 124/166 (75%), Gaps = 9/166 (5%)
 Frame = +1

Query  97   MDAAAA---VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELE  267
             DA AA   V ELR TFA+GKTKSY WRVSQLK+++K+    E  I+DAL  DL KPELE
Sbjct  14   FDAEAASLFVKELRGTFASGKTKSYGWRVSQLKSLMKMLNEREPDIVDALRQDLDKPELE  73

Query  268  SFVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPF  447
            S ++E+A +K S K ALKELK WM PE  K++  T+PSSA+IV EP GVVL+IS WNYPF
Sbjct  74   SSIYEVALLKTSIKSALKELKHWMTPEKAKTSITTFPSSAEIVPEPFGVVLIISPWNYPF  133

Query  448  MLSLDPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
             +       AIAAGNA+VLKPSE+APA+SSLLAKL  +YMD ++++
Sbjct  134  FVG------AIAAGNALVLKPSEVAPASSSLLAKLVGEYMDLSSIR  173



>gb|ABK24239.1| unknown [Picea sitchensis]
Length=478

 Score =   177 bits (450),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 92/162 (57%), Positives = 121/162 (75%), Gaps = 0/162 (0%)
 Frame = +1

Query  100  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  279
            DA   V +LR TF++G+T+SYEWR++QLK V K+ + +E  I++AL  D+ KP  ESF  
Sbjct  3    DAVRVVRKLRYTFSSGRTRSYEWRIAQLKQVWKLVDENEDQIIEALSEDIGKPPFESFFA  62

Query  280  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  459
            EI+  K SCK+A+K+LK WM PE V +    +PS A+I+ EPLG  L+ISAWNYP +LS+
Sbjct  63   EISLTKDSCKVAIKQLKSWMAPEKVSTTLTVFPSKAEILPEPLGAALIISAWNYPLLLSM  122

Query  460  DPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            DPVIGAIAAGN +VLKPSE+APATSSLLA L   Y+D  A++
Sbjct  123  DPVIGAIAAGNVIVLKPSEVAPATSSLLATLIPQYLDDDAIR  164



>ref|XP_010238657.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Brachypodium 
distachyon]
Length=479

 Score =   175 bits (443),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 93/162 (57%), Positives = 125/162 (77%), Gaps = 0/162 (0%)
 Frame = +1

Query  100  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  279
            DA +  +ELR  F  G T++ EWR +QL+ +L++A   E  + DAL +DL+KP  E+ +H
Sbjct  3    DARSWAAELRGRFEEGLTRAAEWRAAQLRGLLRMATEMEAEMCDALHADLAKPRTEACLH  62

Query  280  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  459
            EI+ +K+SC  ALK LK+WMKP+ V++   T+PS+A+I +EPLGVVL+ISAWNYP +LSL
Sbjct  63   EISLIKSSCLFALKNLKKWMKPQKVQAKLMTFPSAARITAEPLGVVLIISAWNYPLLLSL  122

Query  460  DPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            DPVIGA+AAGNAVVLKPSE+APATSSLLA+L   ++D   VK
Sbjct  123  DPVIGALAAGNAVVLKPSEVAPATSSLLAELLPRFVDGRCVK  164



>ref|XP_002449124.1| hypothetical protein SORBIDRAFT_05g005470 [Sorghum bicolor]
 gb|EES08112.1| hypothetical protein SORBIDRAFT_05g005470 [Sorghum bicolor]
Length=478

 Score =   175 bits (443),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 93/157 (59%), Positives = 120/157 (76%), Gaps = 0/157 (0%)
 Frame = +1

Query  115  VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFV  294
            V EL   F AG+ +S +WR  QL+ ++++ +  E  I  AL  DL+KP +ES++HEI+  
Sbjct  6    VRELPPNFPAGRKRSPQWRAEQLRGLIRMIDEKEAEISAALHEDLAKPHMESYLHEISLT  65

Query  295  KASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLDPvig  474
            K+SCK A+  LK WMKPE V ++  T+PSSA+IV EPLGVVL+ISAWNYPF+LS+DPVIG
Sbjct  66   KSSCKFAINGLKNWMKPEKVPASITTFPSSAQIVPEPLGVVLIISAWNYPFILSIDPVIG  125

Query  475  aiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            AIAAGNAVVLKPSEIAPATSS+LA L   Y+D + +K
Sbjct  126  AIAAGNAVVLKPSEIAPATSSVLANLLPKYVDNSCIK  162



>ref|XP_002441918.1| hypothetical protein SORBIDRAFT_08g004840 [Sorghum bicolor]
 gb|EES15756.1| hypothetical protein SORBIDRAFT_08g004840 [Sorghum bicolor]
Length=487

 Score =   174 bits (440),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 89/151 (59%), Positives = 120/151 (79%), Gaps = 0/151 (0%)
 Frame = +1

Query  133  TFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFVKASCKL  312
            +FA G+T++  WR +QL+ +L++A   E  +  AL +DL+KP+ ES+VHEI+ V  SCK 
Sbjct  18   SFATGRTRAAAWREAQLRGLLRMAAEMEDDVCAALRADLAKPQTESYVHEISLVTTSCKF  77

Query  313  ALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLDPvigaiaagn  492
            ALK LK+WMKP+ V     T+PS+A++ +EPLGVVLVISAWNYPF+L++DPV+GAIAAGN
Sbjct  78   ALKNLKKWMKPQKVPGGVLTFPSAARVTAEPLGVVLVISAWNYPFLLAIDPVVGAIAAGN  137

Query  493  avvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            AVVLKPSE+APATSSLLA+L   Y+D + V+
Sbjct  138  AVVLKPSEVAPATSSLLAELLPRYVDASCVR  168



>gb|EMT33845.1| Aldehyde dehydrogenase family 3 member H1 [Aegilops tauschii]
Length=517

 Score =   174 bits (441),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 99/186 (53%), Positives = 129/186 (69%), Gaps = 25/186 (13%)
 Frame = +1

Query  103  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  282
            AAA + ELR +F  G+T+  EWR +QL+A++++ E  E  I DAL +DL+KP +E+++HE
Sbjct  5    AAAVMEELRGSFREGRTRPAEWRTAQLRALVRMIEEKEDDISDALHADLAKPRMEAYLHE  64

Query  283  -------------------------IAFVKASCKLALKELKRWMKPENVKSAFATYPSSA  387
                                     I+  K +C  ALK LK WMKP+ V SA  T+PS+A
Sbjct  65   VCSTSISISNLQVDSNRIYRRILGLISLAKGACMFALKGLKNWMKPDKVPSAITTFPSTA  124

Query  388  KIVSEPLGVVLVISAWNYPFMLSLDPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYM  567
            +IV EPLGVVLVISAWNYPF+LS++PVIGAIAAGNAVVLKPSEIAPATSSL AKL  +Y+
Sbjct  125  QIVPEPLGVVLVISAWNYPFLLSIEPVIGAIAAGNAVVLKPSEIAPATSSLFAKLLPEYV  184

Query  568  DTTAVK  585
            D++ +K
Sbjct  185  DSSCIK  190



>ref|XP_008368060.1| PREDICTED: aldehyde dehydrogenase-like [Malus domestica]
Length=139

 Score =   161 bits (407),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/120 (63%), Positives = 96/120 (80%), Gaps = 0/120 (0%)
 Frame = +1

Query  94   EMDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESF  273
            E  A+A V ELR +F +GKT+SY+WRVSQLK + K+    E+ I+DAL SDLSKPELES 
Sbjct  19   EEAASAVVKELRASFVSGKTRSYQWRVSQLKGIXKLITKKEREIVDALRSDLSKPELESQ  78

Query  274  VHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFML  453
            V+ I+ +  SCKLA+KELK+WMKPE VK++ A +P+SA+IVSEPLG +LVISAWNYPF L
Sbjct  79   VYVISMLSNSCKLAIKELKKWMKPEKVKTSIAVFPASAEIVSEPLGAILVISAWNYPFSL  138



>gb|ACL53721.1| unknown [Zea mays]
 gb|AFW56224.1| aldehyde dehydrogenase, dimeric NADP-preferring [Zea mays]
Length=491

 Score =   170 bits (431),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 88/155 (57%), Positives = 115/155 (74%), Gaps = 0/155 (0%)
 Frame = +1

Query  121  ELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFVKA  300
             LR +FA+G+T+   WR +QL+ +L++A   E  I  AL +DL+KP  E +VHEI+ V +
Sbjct  19   RLRRSFASGRTRPAAWREAQLRGLLRMATEREDDICAALHADLAKPLTECYVHEISLVIS  78

Query  301  SCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLDPvigai  480
            SCK ALK LK+WMKP  V     T+PS+A + +EPLGVVLVISAWNYPF+L++DPV+GA 
Sbjct  79   SCKFALKNLKKWMKPRKVPGGLLTFPSAASVAAEPLGVVLVISAWNYPFLLAIDPVVGAF  138

Query  481  aagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            AAGNAV LKPSE+APATS LLA L   Y+D + V+
Sbjct  139  AAGNAVALKPSEVAPATSLLLADLLPRYVDPSCVR  173



>ref|NP_001152171.1| aldehyde dehydrogenase, dimeric NADP-preferring [Zea mays]
 gb|ACG46203.1| aldehyde dehydrogenase, dimeric NADP-preferring [Zea mays]
Length=491

 Score =   170 bits (430),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 88/155 (57%), Positives = 115/155 (74%), Gaps = 0/155 (0%)
 Frame = +1

Query  121  ELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFVKA  300
             LR +FA+G+T+   WR +QL+ +L++A   E  I  AL +DL+KP  E +VHEI+ V +
Sbjct  19   RLRRSFASGRTRPAAWREAQLRGLLRMAAEREDDICAALHADLAKPLTECYVHEISLVIS  78

Query  301  SCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLDPvigai  480
            SCK ALK LK+WMKP  V     T+PS+A + +EPLGVVLVISAWNYPF+L++DPV+GA 
Sbjct  79   SCKFALKNLKKWMKPRKVPGGLLTFPSAASVAAEPLGVVLVISAWNYPFLLAIDPVVGAF  138

Query  481  aagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            AAGNAV LKPSE+APATS LLA L   Y+D + V+
Sbjct  139  AAGNAVALKPSEVAPATSLLLADLLPRYVDPSCVR  173



>ref|XP_007213817.1| hypothetical protein PRUPE_ppa005609mg [Prunus persica]
 gb|EMJ15016.1| hypothetical protein PRUPE_ppa005609mg [Prunus persica]
Length=451

 Score =   164 bits (416),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 90/138 (65%), Positives = 115/138 (83%), Gaps = 0/138 (0%)
 Frame = +1

Query  172  VSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFVKASCKLALKELKRWMKPEN  351
            +SQL+ + K+ E  EK I +AL+ DLSKPE+E+F+ EI   K+SC  ALKEL++WM P+ 
Sbjct  1    MSQLENIAKMLEEKEKEITEALYKDLSKPEVEAFISEIVTAKSSCNEALKELRQWMIPQK  60

Query  352  VKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLDPvigaiaagnavvLKPSEIAPAT  531
            V ++  T+PSSA+IVSEPLGVVLVI+ WN+PF+LS+DPVIGAI+AGNAVVLKPSEIAPAT
Sbjct  61   VNTSITTFPSSAEIVSEPLGVVLVIATWNFPFLLSVDPVIGAISAGNAVVLKPSEIAPAT  120

Query  532  SSLLAKLFNDYMDTTAVK  585
            SSLLAKL  +Y+D +AVK
Sbjct  121  SSLLAKLVEEYLDNSAVK  138



>ref|XP_001764841.1| variable substrate [Physcomitrella patens]
 gb|EDQ70283.1| variable substrate [Physcomitrella patens]
Length=492

 Score =   164 bits (414),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 79/157 (50%), Positives = 119/157 (76%), Gaps = 0/157 (0%)
 Frame = +1

Query  115  VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFV  294
            V+E+RE +  G+T+   WRV QL  ++++    E  I+  L++DL KP  ES+V E++ V
Sbjct  23   VTEVREAYRNGRTRPAAWRVQQLNGIIRMISERESEIVQTLYTDLGKPSHESYVTEVSLV  82

Query  295  KASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLDPvig  474
            +++CKLA+KELK+WM P  V  +  T+PS   IV+EPLGV LVISAWN+PF+LS++P++G
Sbjct  83   RSACKLAIKELKKWMAPLKVSGSITTFPSWGAIVAEPLGVALVISAWNFPFLLSVEPLVG  142

Query  475  aiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            AI+AG A+VLKPSE+APAT++LL+KL   Y+D++ ++
Sbjct  143  AISAGCAMVLKPSEVAPATAALLSKLVPLYLDSSVIR  179



>gb|EEC67815.1| hypothetical protein OsI_35392 [Oryza sativa Indica Group]
Length=140

 Score =   154 bits (390),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 69/118 (58%), Positives = 91/118 (77%), Gaps = 0/118 (0%)
 Frame = +1

Query  94   EMDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESF  273
            E + AA V ELR +F +G+T++ EWR +QL+ ++++ E  E  I DAL SDL+KP +ES+
Sbjct  3    EEEVAAVVGELRGSFRSGRTRAAEWRAAQLRGIVRMVEEREGDISDALHSDLAKPRMESY  62

Query  274  VHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPF  447
            +HEI+  KA+C  ALK LK WMKPE V +A  T+PS+A+IVSEPLGVVLVISAWNYPF
Sbjct  63   LHEISLAKAACTFALKGLKNWMKPEKVPAALTTFPSTAQIVSEPLGVVLVISAWNYPF  120



>ref|XP_001780129.1| variable substrate [Physcomitrella patens]
 gb|EDQ55048.1| variable substrate [Physcomitrella patens]
Length=500

 Score =   162 bits (410),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 90/169 (53%), Positives = 121/169 (72%), Gaps = 12/169 (7%)
 Frame = +1

Query  115  VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFV  294
            V+E+RE +   +TK  EWRV QLK +L++    E  I++AL++DL KP  ES++ EI+ V
Sbjct  19   VAEVREAYMTMRTKPAEWRVQQLKGLLRMVIESESEIVEALYADLGKPAHESYMSEISLV  78

Query  295  KASCKLALKELKRWMKPEN------------VKSAFATYPSSAKIVSEPLGVVLVISAWN  438
            K+SCKLA+KELK+WM P+             V  +  T+PSSA IV+EPLGV LVISAWN
Sbjct  79   KSSCKLAIKELKKWMAPQRLCIMHVMFGALMVSGSMITFPSSASIVAEPLGVTLVISAWN  138

Query  439  YPFMLSLDPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            +PF+LS+DP+IGAI+AG AVVLKPSE+  AT +LLAKL   YMD + ++
Sbjct  139  FPFLLSVDPLIGAISAGCAVVLKPSEVVYATPALLAKLIPLYMDNSVIR  187



>gb|KJB75337.1| hypothetical protein B456_012G037500 [Gossypium raimondii]
Length=443

 Score =   158 bits (399),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 88/126 (70%), Positives = 108/126 (86%), Gaps = 0/126 (0%)
 Frame = +1

Query  205  EHHEKAIMDALFSDLSKPELESFVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSS  384
            +  EK I++AL  DLSKPELE+F+ EI   ++SCKLALKELK+WM P+ V+++ ATYPSS
Sbjct  3    DEKEKEIVEALRKDLSKPELEAFLSEILMARSSCKLALKELKQWMMPQKVETSLATYPSS  62

Query  385  AKIVSEPLGVVLVISAWNYPFMLSLDPvigaiaagnavvLKPSEIAPATSSLLAKLFNDY  564
            A+IV+EPLGVVLVIS WN+PF LSLDPVIGAIAAGNAVVLKPSEIA ATSSLL++L  +Y
Sbjct  63   AEIVAEPLGVVLVISTWNFPFSLSLDPVIGAIAAGNAVVLKPSEIASATSSLLSRLVGEY  122

Query  565  MDTTAV  582
            MD +A+
Sbjct  123  MDKSAI  128



>ref|XP_002978104.1| hypothetical protein SELMODRAFT_271300 [Selaginella moellendorffii]
 gb|EFJ20761.1| hypothetical protein SELMODRAFT_271300 [Selaginella moellendorffii]
Length=479

 Score =   157 bits (397),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 84/160 (53%), Positives = 119/160 (74%), Gaps = 0/160 (0%)
 Frame = +1

Query  106  AAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEI  285
            AA   E+R  F +G+T+S +WR++QLK+++ + + HE+ I +A+  D+ KP  E F  EI
Sbjct  7    AAVCGEVRGDFKSGRTRSLDWRLAQLKSIVDLIKKHEEDITEAVAVDMGKPSYECFASEI  66

Query  286  AFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLDP  465
              VK++C+LA+K LK W    NV    AT P+SA +  EP GVVL+ISAWN+PF+LSLDP
Sbjct  67   FPVKSACQLAIKNLKNWTAAVNVPPLLATLPASASMKPEPFGVVLIISAWNFPFLLSLDP  126

Query  466  vigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            ++GAIAAGNAVVLKPSE+APATS+L+A+L   Y+D +A++
Sbjct  127  MVGAIAAGNAVVLKPSEMAPATSALIARLLPLYLDKSAIR  166



>ref|XP_002966639.1| hypothetical protein SELMODRAFT_227647 [Selaginella moellendorffii]
 gb|EFJ32666.1| hypothetical protein SELMODRAFT_227647 [Selaginella moellendorffii]
Length=479

 Score =   157 bits (397),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 84/160 (53%), Positives = 119/160 (74%), Gaps = 0/160 (0%)
 Frame = +1

Query  106  AAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEI  285
            AA   E+R  F +G+T+S +WR++QLK+++ + + HE+ I +A+  D+ KP  E F  EI
Sbjct  7    AAVCGEVRGDFKSGRTRSLDWRLAQLKSIVDLIKKHEEDITEAVAVDMGKPSYECFASEI  66

Query  286  AFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLDP  465
              VK++C+LA+K LK W    NV    AT P+SA +  EP GVVL+ISAWN+PF+LSLDP
Sbjct  67   FPVKSACQLAIKNLKNWTAAVNVPPLLATLPASASMKPEPFGVVLIISAWNFPFLLSLDP  126

Query  466  vigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            ++GAIAAGNAVVLKPSE+APATS+L+A+L   Y+D +A++
Sbjct  127  MVGAIAAGNAVVLKPSEMAPATSALIARLLPLYLDKSAIR  166



>ref|XP_001757163.1| variable substrate [Physcomitrella patens]
 gb|EDQ78022.1| variable substrate [Physcomitrella patens]
Length=479

 Score =   153 bits (387),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 83/163 (51%), Positives = 113/163 (69%), Gaps = 0/163 (0%)
 Frame = +1

Query  97   MDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFV  276
            +DA   VSELR T    +T+  +WR+ Q++AVLK+   +E  I  AL SDL K   ESF+
Sbjct  4    IDAPQIVSELRATLRTARTRPAQWRLDQIRAVLKLVNENEDDIYAALHSDLHKSNYESFL  63

Query  277  HEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLS  456
             E+  + ++CK  +K L +WM PE      A +P++A ++SEPLGV LVIS WN+P +L+
Sbjct  64   TEVNVLVSACKSTMKNLHKWMAPEKKPIPLAVWPANASVISEPLGVALVISPWNFPLLLA  123

Query  457  LDPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            LDPV+GAIAAG  V LK SEIAPATS+LLA+L  +Y+DT A+K
Sbjct  124  LDPVVGAIAAGCTVCLKTSEIAPATSALLARLLPEYVDTEAIK  166



>gb|EMS62407.1| Aldehyde dehydrogenase family 3 member H1 [Triticum urartu]
Length=450

 Score =   152 bits (384),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 104/127 (82%), Gaps = 0/127 (0%)
 Frame = +1

Query  205  EHHEKAIMDALFSDLSKPELESFVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSS  384
            E  E  I DAL +DL+KP +E+++HEI+  K +C  ALK LK WMKP+ V SA  T+PS+
Sbjct  3    EEKEDDISDALHADLAKPRMEAYLHEISLAKGACMFALKGLKNWMKPDKVPSAITTFPST  62

Query  385  AKIVSEPLGVVLVISAWNYPFMLSLDPvigaiaagnavvLKPSEIAPATSSLLAKLFNDY  564
            A+IV EPLGVVLVISAWNYPF+LS++PVIGAIAAGNAVVLKPSE+APATSSL AKL  +Y
Sbjct  63   AQIVPEPLGVVLVISAWNYPFLLSIEPVIGAIAAGNAVVLKPSELAPATSSLFAKLLPEY  122

Query  565  MDTTAVK  585
            +D++ +K
Sbjct  123  VDSSCIK  129



>gb|EMS67814.1| Aldehyde dehydrogenase family 3 member I1, chloroplastic [Triticum 
urartu]
Length=160

 Score =   143 bits (361),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 85/114 (75%), Gaps = 0/114 (0%)
 Frame = +1

Query  106  AAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEI  285
            AAAV ELRE FAAG+T+  EWR +QL+ VL++A   E  I DAL +DL KP+ E+ VHE+
Sbjct  6    AAAVQELRERFAAGQTRPAEWRAAQLRGVLRMATEMEAEICDALHADLGKPKTEAHVHEL  65

Query  286  AFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPF  447
            + +K+SC  ALK LK+WMKP+ V +    +PS+A+I  EPLG+VLVISAWNYP 
Sbjct  66   SLIKSSCLFALKNLKKWMKPQKVPAKLMNFPSTARITPEPLGLVLVISAWNYPL  119



>ref|XP_010679827.1| PREDICTED: aldehyde dehydrogenase family 3 member F1-like [Beta 
vulgaris subsp. vulgaris]
Length=487

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 82/162 (51%), Positives = 113/162 (70%), Gaps = 0/162 (0%)
 Frame = +1

Query  100  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  279
            D  + +SELRETF +GKTKS EWR +QL+A+  + EH EK    ALF D+ K +LE++  
Sbjct  5    DTMSLLSELRETFKSGKTKSLEWRKTQLQALSNMVEHQEKLCFQALFDDVGKGKLEAYKD  64

Query  280  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  459
            E+   K + + AL  LK+WM P+    +    PS A+I+ EP G+VL++++WNYPF L+L
Sbjct  65   EVGPTKKTIEYALSNLKKWMAPKKAGMSLLLLPSKAEIIPEPYGLVLILTSWNYPFDLAL  124

Query  460  DPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            +P+IGAIAAGN VV+KPSE+APATSS LA     Y+D  A+K
Sbjct  125  EPLIGAIAAGNVVVIKPSELAPATSSFLANTIPQYLDNAAIK  166



>ref|XP_001197038.2| PREDICTED: aldehyde dehydrogenase-like [Strongylocentrotus purpuratus]
Length=218

 Score =   144 bits (364),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 77/161 (48%), Positives = 103/161 (64%), Gaps = 0/161 (0%)
 Frame = +1

Query  97   MDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFV  276
             DA   V   R  F A +T+SYE R++ L  + ++   +++A +DAL+ DL KPE E+  
Sbjct  5    FDAGMVVESCRSAFDASQTRSYEARITHLHNLRRMISENKQAFVDALYKDLRKPEFEAVT  64

Query  277  HEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLS  456
             E+ F    C LA+ ELK+WMKPE V   FA       I  +PLGVVL+I AWNYPF L 
Sbjct  65   FEVDFCHNDCVLAINELKQWMKPEKVAIPFAGVGKQCYIQRDPLGVVLIIGAWNYPFQLP  124

Query  457  LDPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTA  579
            + P+IGAIAAGN  V+KPSEI+PAT+ L  +LF  YMD++ 
Sbjct  125  IHPLIGAIAAGNTAVIKPSEISPATAKLFEELFPKYMDSSC  165



>ref|XP_004142629.1| PREDICTED: LOW QUALITY PROTEIN: aldehyde dehydrogenase family 
3 member H1-like [Cucumis sativus]
Length=462

 Score =   146 bits (369),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 86/166 (52%), Positives = 107/166 (64%), Gaps = 25/166 (15%)
 Frame = +1

Query  97   MDAAAA---VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELE  267
             DAAAA   V+ELR  F +G T+SYEWRVSQL+++LK+   HE+ I DAL SDLSKP LE
Sbjct  7    FDAAAATDLVNELRAIFNSGNTRSYEWRVSQLESLLKLCVDHEEDICDALRSDLSKPALE  66

Query  268  SFVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPF  447
            S +HEI  VK SCKLA+KE+  WMKPE V      + +S  I +  L + + I+A N   
Sbjct  67   SIIHEIGMVKGSCKLAIKEIGNWMKPEKVFG----FANSLWIXASILYINIYIAAGN---  119

Query  448  MLSLDPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
                            VVLKPSEI+PATSSL+AKLF  Y+DT+AVK
Sbjct  120  ---------------TVVLKPSEISPATSSLIAKLFEKYLDTSAVK  150



>gb|EAZ19830.1| hypothetical protein OsJ_35414 [Oryza sativa Japonica Group]
Length=464

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 87/159 (55%), Positives = 111/159 (70%), Gaps = 20/159 (13%)
 Frame = +1

Query  109  AAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIA  288
            A V+ LR  FAAG T+  EWR +QL+ +L++A   E  I                    A
Sbjct  11   AEVAALRGRFAAGGTRGAEWRAAQLRGILRMAAEAEAEI--------------------A  50

Query  289  FVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLDPv  468
             VK+SCK ALK LK+WMKP+ V +   T+PS+A++ +EPLGVVLVISAWNYPF+LS+DP+
Sbjct  51   LVKSSCKFALKNLKKWMKPQKVTAPLMTFPSTARVAAEPLGVVLVISAWNYPFLLSIDPI  110

Query  469  igaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            IGAIAAGNAVVLKPSE+APATSSLLA+L   Y+D + +K
Sbjct  111  IGAIAAGNAVVLKPSEVAPATSSLLAELLPRYVDGSCIK  149



>ref|WP_006011635.1| aldehyde dehydrogenase [Glaciecola pallidula]
 dbj|GAC29092.1| aldehyde dehydrogenase [Glaciecola pallidula DSM 14239 = ACAM 
615]
Length=468

 Score =   144 bits (364),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 105/157 (67%), Gaps = 0/157 (0%)
 Frame = +1

Query  115  VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFV  294
            + EL+ TFA G+TK Y+WRV QL A+ ++ + +  AI+ AL +DL K E ES++ EI + 
Sbjct  21   IDELKRTFATGRTKPYQWRVEQLTALKQLIQENSNAIILALHTDLGKSETESWLTEIGYS  80

Query  295  KASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLDPvig  474
             A  K  LK LK WMKP  + +   T P  +  +SEPLGV L+I AWNYPF L + P++ 
Sbjct  81   IADIKGNLKRLKSWMKPTKISTPMITQPGKSYTISEPLGVALIIGAWNYPFQLVITPLVA  140

Query  475  aiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            A+AAGN  V+KPSE++ ATS+LLAKL   Y+D  A K
Sbjct  141  AMAAGNCAVIKPSELSEATSALLAKLVPKYLDNAAFK  177



>gb|EAY82454.1| hypothetical protein OsI_37671 [Oryza sativa Indica Group]
Length=464

 Score =   144 bits (364),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 86/159 (54%), Positives = 111/159 (70%), Gaps = 20/159 (13%)
 Frame = +1

Query  109  AAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIA  288
            A V+ LR  FAAG T+  EWR +QL+ +L++A   E  I                    A
Sbjct  11   AEVAALRGRFAAGGTRGAEWRAAQLRGILRMAAEAEAEI--------------------A  50

Query  289  FVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLDPv  468
             VK+SCK ALK LK+WMKP+ V +   T+PS+A++ +EPLGVVL+ISAWNYPF+LS+DP+
Sbjct  51   LVKSSCKFALKNLKKWMKPQKVTAPLMTFPSTARVAAEPLGVVLIISAWNYPFLLSIDPI  110

Query  469  igaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            IGAIAAGNAVVLKPSE+APATSSLLA+L   Y+D + +K
Sbjct  111  IGAIAAGNAVVLKPSEVAPATSSLLAELLPRYVDGSCIK  149



>ref|XP_010651247.1| PREDICTED: aldehyde dehydrogenase family 3 member F1 isoform 
X4 [Vitis vinifera]
Length=409

 Score =   143 bits (361),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 86/157 (55%), Positives = 109/157 (69%), Gaps = 0/157 (0%)
 Frame = +1

Query  115  VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFV  294
            + ELRE++ +GKTK   WR SQLK +L + +  EK I  AL  DL K   ES+  E+  +
Sbjct  11   LEELRESYRSGKTKEASWRKSQLKGLLTLLKEQEKDIFKALEQDLGKHYAESYRDEVGTL  70

Query  295  KASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLDPvig  474
              S  LAL  LK WM     K   AT+PS+A++  EPLG+VL+IS+WN+PF LSL+PVIG
Sbjct  71   TKSVNLALSSLKDWMSSRKAKLPIATFPSTAEVFPEPLGLVLIISSWNFPFGLSLEPVIG  130

Query  475  aiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            AIAAGN+VVLKPSE+APA+SSLLAK    Y+D  AVK
Sbjct  131  AIAAGNSVVLKPSELAPASSSLLAKTIPTYLDKKAVK  167



>ref|XP_010651245.1| PREDICTED: aldehyde dehydrogenase family 3 member F1 isoform 
X2 [Vitis vinifera]
Length=425

 Score =   143 bits (361),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 86/157 (55%), Positives = 109/157 (69%), Gaps = 0/157 (0%)
 Frame = +1

Query  115  VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFV  294
            + ELRE++ +GKTK   WR SQLK +L + +  EK I  AL  DL K   ES+  E+  +
Sbjct  11   LEELRESYRSGKTKEASWRKSQLKGLLTLLKEQEKDIFKALEQDLGKHYAESYRDEVGTL  70

Query  295  KASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLDPvig  474
              S  LAL  LK WM     K   AT+PS+A++  EPLG+VL+IS+WN+PF LSL+PVIG
Sbjct  71   TKSVNLALSSLKDWMSSRKAKLPIATFPSTAEVFPEPLGLVLIISSWNFPFGLSLEPVIG  130

Query  475  aiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            AIAAGN+VVLKPSE+APA+SSLLAK    Y+D  AVK
Sbjct  131  AIAAGNSVVLKPSELAPASSSLLAKTIPTYLDKKAVK  167



>ref|XP_010651246.1| PREDICTED: aldehyde dehydrogenase family 3 member F1 isoform 
X3 [Vitis vinifera]
Length=417

 Score =   143 bits (360),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 86/157 (55%), Positives = 109/157 (69%), Gaps = 0/157 (0%)
 Frame = +1

Query  115  VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFV  294
            + ELRE++ +GKTK   WR SQLK +L + +  EK I  AL  DL K   ES+  E+  +
Sbjct  11   LEELRESYRSGKTKEASWRKSQLKGLLTLLKEQEKDIFKALEQDLGKHYAESYRDEVGTL  70

Query  295  KASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLDPvig  474
              S  LAL  LK WM     K   AT+PS+A++  EPLG+VL+IS+WN+PF LSL+PVIG
Sbjct  71   TKSVNLALSSLKDWMSSRKAKLPIATFPSTAEVFPEPLGLVLIISSWNFPFGLSLEPVIG  130

Query  475  aiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            AIAAGN+VVLKPSE+APA+SSLLAK    Y+D  AVK
Sbjct  131  AIAAGNSVVLKPSELAPASSSLLAKTIPTYLDKKAVK  167



>ref|XP_004170348.1| PREDICTED: aldehyde dehydrogenase family 3 member F1-like, partial 
[Cucumis sativus]
Length=321

 Score =   140 bits (354),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 81/157 (52%), Positives = 105/157 (67%), Gaps = 0/157 (0%)
 Frame = +1

Query  115  VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFV  294
            + E RE F +GKTK   WR SQLK + K    +++ I +ALF DL K  +E+F  EI  +
Sbjct  8    LEETREYFKSGKTKEASWRFSQLKGLHKFLNQNQQQIYNALFQDLGKHHVEAFRDEIGNL  67

Query  295  KASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLDPvig  474
            + S   AL+ LK WM P   K       +SA++V EPLGVVLVIS+WN+PF LSL+P+IG
Sbjct  68   QMSLNFALENLKHWMSPRKAKLPAIAVLNSAEVVPEPLGVVLVISSWNFPFGLSLEPLIG  127

Query  475  aiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            AIAAGN V LK SE APA+S+ LAK+  DY+D  AV+
Sbjct  128  AIAAGNCVFLKTSEFAPASSAFLAKVIGDYVDDKAVR  164



>ref|XP_006596209.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X3 [Glycine max]
Length=422

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 91/102 (89%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  459
             IA +K SC++ALKELK WM PE VK++ AT+PSSA+IVSEPLGVVLVISAWNYPF+LSL
Sbjct  10   RIAMLKNSCRIALKELKHWMTPEKVKTSIATFPSSAEIVSEPLGVVLVISAWNYPFLLSL  69

Query  460  DPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            DPVIGAIAAGNAVVLKPSEIAPATSSLLAKL  DY+D + +K
Sbjct  70   DPVIGAIAAGNAVVLKPSEIAPATSSLLAKLLGDYLDNSCIK  111



>ref|XP_002285466.1| PREDICTED: aldehyde dehydrogenase family 3 member F1 isoform 
X1 [Vitis vinifera]
 emb|CBI16385.3| unnamed protein product [Vitis vinifera]
Length=485

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 86/157 (55%), Positives = 109/157 (69%), Gaps = 0/157 (0%)
 Frame = +1

Query  115  VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFV  294
            + ELRE++ +GKTK   WR SQLK +L + +  EK I  AL  DL K   ES+  E+  +
Sbjct  11   LEELRESYRSGKTKEASWRKSQLKGLLTLLKEQEKDIFKALEQDLGKHYAESYRDEVGTL  70

Query  295  KASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLDPvig  474
              S  LAL  LK WM     K   AT+PS+A++  EPLG+VL+IS+WN+PF LSL+PVIG
Sbjct  71   TKSVNLALSSLKDWMSSRKAKLPIATFPSTAEVFPEPLGLVLIISSWNFPFGLSLEPVIG  130

Query  475  aiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            AIAAGN+VVLKPSE+APA+SSLLAK    Y+D  AVK
Sbjct  131  AIAAGNSVVLKPSELAPASSSLLAKTIPTYLDKKAVK  167



>ref|WP_009627619.1| Aldehyde Dehydrogenase [Pseudanabaena biceps]
 gb|ELS32285.1| Aldehyde Dehydrogenase [Pseudanabaena biceps PCC 7429]
Length=463

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 110/159 (69%), Gaps = 0/159 (0%)
 Frame = +1

Query  94   EMDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESF  273
             +D  A +++ R  F   KTK YE+RVSQLK + ++ + +EK I+DA+++DL KP +E F
Sbjct  8    NLDIPATIAKQRIFFDGNKTKDYEFRVSQLKKLAQLIKENEKLILDAVYADLRKPTIEIF  67

Query  274  VHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFML  453
              EI    +  +  +K LK WMKP+ V +    +PSS+ I +EPLGVVL+++ WNYPF L
Sbjct  68   GSEILIALSEIRYVIKHLKAWMKPQKVGTPLNLFPSSSYIYTEPLGVVLIVAPWNYPFSL  127

Query  454  SLDPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMD  570
            ++ P+IGAIAAGN  +LKPSE AP TS+ +AK+ N++ D
Sbjct  128  NIQPLIGAIAAGNCAILKPSEYAPHTSNAIAKIINEHFD  166



>emb|CDP01945.1| unnamed protein product [Coffea canephora]
Length=488

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/160 (48%), Positives = 116/160 (73%), Gaps = 0/160 (0%)
 Frame = +1

Query  106  AAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEI  285
            A  ++ELR+TF +GKT+  EWR +QL+A+LK+ + +E +I DAL  DL K  +ES+  E+
Sbjct  8    ARNLAELRQTFRSGKTRGLEWRKAQLRAILKLLDENEDSIFDALQQDLGKHPVESYRDEV  67

Query  286  AFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLDP  465
              +K S K AL  +++WM P+  +     +P+ A+++ EPLG+VLV+++WN+P  L+LDP
Sbjct  68   GVLKKSAKYALASVEKWMAPKKGQMPLLFFPARAEVLPEPLGLVLVLASWNFPISLALDP  127

Query  466  vigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            VIGAI+AGN VVLKPSE++PA+SS LA     Y+D+ A+K
Sbjct  128  VIGAISAGNTVVLKPSELSPASSSFLANTIPRYLDSAALK  167



>ref|XP_009109317.1| PREDICTED: aldehyde dehydrogenase family 3 member F1-like [Brassica 
rapa]
Length=494

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 111/158 (70%), Gaps = 0/158 (0%)
 Frame = +1

Query  112  AVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAF  291
            ++ E+R+TFA+G+T+S +WR +QL A++++ + +E+ + D LF DL K   E+F  E+ F
Sbjct  17   SLREMRDTFASGRTRSVKWRKAQLGAIIEMVKDNEEKMSDVLFQDLGKHSTEAFRDELGF  76

Query  292  VKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLDPvi  471
            V  S   AL  L +W+ P N       YP++ K++SEP G VLV+S+WN+P  LSLDP+I
Sbjct  77   VMRSATTALNCLDKWVVPRNSNLPLLFYPATGKVISEPYGTVLVLSSWNFPISLSLDPMI  136

Query  472  gaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            GAIAAGN V+LK SE++P  S+LLAKL   Y+DT A+K
Sbjct  137  GAIAAGNTVLLKASELSPNASALLAKLIPSYLDTKAIK  174



>ref|XP_002978037.1| hypothetical protein SELMODRAFT_268146 [Selaginella moellendorffii]
 gb|EFJ20694.1| hypothetical protein SELMODRAFT_268146 [Selaginella moellendorffii]
Length=480

 Score =   142 bits (358),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 86/157 (55%), Positives = 120/157 (76%), Gaps = 0/157 (0%)
 Frame = +1

Query  115  VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFV  294
            V+ELR+ F +G+T+  EWR +QL+A+L++ +  E  I++AL  D+ KP  E++V E++ +
Sbjct  10   VAELRDAFRSGRTRPMEWRAAQLRAMLRMIDEREGEIIEALDRDIGKPAYETYVAELSTI  69

Query  295  KASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLDPvig  474
              SC  ALK L+ WM P+ V ++  ++PSS +IV EPLGV LVISAWN+PF+LSLDPVIG
Sbjct  70   ANSCTNALKHLRSWMAPDKVSTSMISFPSSGEIVPEPLGVALVISAWNFPFLLSLDPVIG  129

Query  475  aiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            AI AGNAVVLKPSE+APAT++LLAKL   Y+D  A++
Sbjct  130  AICAGNAVVLKPSELAPATAALLAKLVPLYLDKKAIR  166



>ref|XP_002966702.1| hypothetical protein SELMODRAFT_168397 [Selaginella moellendorffii]
 gb|EFJ32729.1| hypothetical protein SELMODRAFT_168397 [Selaginella moellendorffii]
Length=480

 Score =   141 bits (356),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 86/157 (55%), Positives = 120/157 (76%), Gaps = 0/157 (0%)
 Frame = +1

Query  115  VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFV  294
            V+ELR+ F +G+T+  +WR +QL+A+L++ +  E  I++AL  D+ KP  E++V E++ +
Sbjct  10   VAELRDEFRSGRTRPMDWRAAQLRAMLRMIDEREGEIIEALDRDIGKPAYETYVAELSTI  69

Query  295  KASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLDPvig  474
              SC  ALK L+ WM PE V ++  ++PSS +IV EPLGV LVISAWN+PF+LSLDPVIG
Sbjct  70   ANSCTNALKHLRSWMAPEKVSTSMISFPSSGEIVPEPLGVALVISAWNFPFLLSLDPVIG  129

Query  475  aiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            AI AGNAVVLKPSE+APAT++LLAKL   Y+D  A++
Sbjct  130  AICAGNAVVLKPSELAPATAALLAKLVPLYLDKKAIR  166



>ref|XP_001767194.1| variable substrate [Physcomitrella patens]
 gb|EDQ68115.1| variable substrate [Physcomitrella patens]
Length=485

 Score =   141 bits (356),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 80/163 (49%), Positives = 107/163 (66%), Gaps = 0/163 (0%)
 Frame = +1

Query  97   MDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFV  276
            +DAA   S LRETF  G+T+   WR+ QL A++K+ E +E  I  ALF+DL KP  E+  
Sbjct  10   LDAAKVASCLRETFRTGRTRPSNWRLEQLHAIVKLIEENEDEICRALFADLHKPRHEALT  69

Query  277  HEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLS  456
             E   V AS K A+K L +W  P   ++ +  +P+SA I+ EPLGV  VI+ WN+PF+L+
Sbjct  70   MESLVVTASAKHAIKNLNKWRAPVKKETPYIVWPASAFILPEPLGVAFVIAPWNFPFLLA  129

Query  457  LDPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            +DPVIGAIAAG  V LK SE+ PATS LL+ L   Y+D  A+K
Sbjct  130  VDPVIGAIAAGCTVCLKTSEVTPATSELLSTLVPKYLDNDAIK  172



>emb|CDY35463.1| BnaC03g61970D [Brassica napus]
Length=488

 Score =   141 bits (355),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 111/158 (70%), Gaps = 0/158 (0%)
 Frame = +1

Query  112  AVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAF  291
            ++ E+RETFA+G+T+S +WR +QL A++++ + +E+ + D LF DL K   E+F  E+ F
Sbjct  11   SLREMRETFASGRTRSVKWRKAQLGAIIEMVKDNEEKMSDVLFQDLGKHSTEAFRDELGF  70

Query  292  VKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLDPvi  471
            V  S   AL  L +W+ P+        YP++ K++SEP G VLV+S+WN+P  LSLDP+I
Sbjct  71   VMRSATTALNCLDKWVVPKKSNLPLLFYPATGKVISEPYGTVLVLSSWNFPISLSLDPMI  130

Query  472  gaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            GAIAAGN V+LK SE++P  S+LLAKL   Y+DT A+K
Sbjct  131  GAIAAGNTVLLKASELSPNASALLAKLIPSYLDTKAIK  168



>emb|CDY24790.1| BnaA08g15200D [Brassica napus]
Length=488

 Score =   141 bits (355),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 110/158 (70%), Gaps = 0/158 (0%)
 Frame = +1

Query  112  AVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAF  291
            ++ E+RETFA+G+T+S +WR +QL A++++ + +E+ + D LF DL K   E+F  E+ F
Sbjct  11   SLREMRETFASGRTRSVKWRKAQLGAIIEMVKDNEEKMSDVLFQDLGKHSTEAFRDELGF  70

Query  292  VKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLDPvi  471
            V  S   AL  L +W+ P         YP++ K++SEP G VLV+S+WN+P  LSLDP+I
Sbjct  71   VMRSATTALNCLDKWVVPRKSNLPLLFYPATGKVISEPYGTVLVLSSWNFPISLSLDPMI  130

Query  472  gaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            GAIAAGN V+LK SE++P  S+LLAKL   Y+DT A+K
Sbjct  131  GAIAAGNTVLLKASELSPNASALLAKLIPSYLDTKAIK  168



>ref|XP_009768441.1| PREDICTED: aldehyde dehydrogenase family 3 member F1-like [Nicotiana 
sylvestris]
Length=481

 Score =   140 bits (354),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 82/157 (52%), Positives = 110/157 (70%), Gaps = 0/157 (0%)
 Frame = +1

Query  115  VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFV  294
            + ELRETF +GKT+   WR +QLK +L++ E  E  I  AL  DL K  +E++  EI  +
Sbjct  8    LEELRETFKSGKTREESWRRTQLKNLLRLLEEKEDDIFKALKQDLGKHHVEAYRDEIGTL  67

Query  295  KASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLDPvig  474
              S   AL  LK+WM  +  K   A +PSSA++V EPLG+VL+IS+WN+PF +SL+P+IG
Sbjct  68   IKSVNYALDGLKKWMCGKKAKLPIAAFPSSAELVPEPLGLVLIISSWNFPFGISLEPLIG  127

Query  475  aiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            AIAAGN VVLKPSE APA+SS+LAK  + Y+D  A+K
Sbjct  128  AIAAGNVVVLKPSEQAPASSSVLAKTISTYLDNKAIK  164



>gb|KGN54173.1| hypothetical protein Csa_4G291370 [Cucumis sativus]
Length=481

 Score =   140 bits (354),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 81/157 (52%), Positives = 105/157 (67%), Gaps = 0/157 (0%)
 Frame = +1

Query  115  VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFV  294
            + E RE F +GKTK   WR SQLK + K    +++ I +ALF DL K  +E+F  EI  +
Sbjct  8    LEETREYFKSGKTKEASWRFSQLKGLHKFLNQNQQQIYNALFQDLGKHHVEAFRDEIGNL  67

Query  295  KASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLDPvig  474
            + S   AL+ LK WM P   K       +SA++V EPLGVVLVIS+WN+PF LSL+P+IG
Sbjct  68   QMSLNFALENLKHWMSPRKAKLPAIAVLNSAEVVPEPLGVVLVISSWNFPFGLSLEPLIG  127

Query  475  aiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            AIAAGN V LK SE APA+S+ LAK+  DY+D  AV+
Sbjct  128  AIAAGNCVFLKTSEFAPASSAFLAKVIGDYVDDKAVR  164



>ref|XP_004142118.1| PREDICTED: LOW QUALITY PROTEIN: aldehyde dehydrogenase family 
3 member F1-like [Cucumis sativus]
Length=479

 Score =   140 bits (354),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 81/157 (52%), Positives = 105/157 (67%), Gaps = 0/157 (0%)
 Frame = +1

Query  115  VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFV  294
            + E RE F +GKTK   WR SQLK + K    +++ I +ALF DL K  +E+F  EI  +
Sbjct  8    LEETREYFKSGKTKEASWRFSQLKGLHKFLNQNQQQIYNALFQDLGKHHVEAFRDEIGNL  67

Query  295  KASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLDPvig  474
            + S   AL+ LK WM P   K       +SA++V EPLGVVLVIS+WN+PF LSL+P+IG
Sbjct  68   QMSLNFALENLKHWMSPRKAKLPAIAVLNSAEVVPEPLGVVLVISSWNFPFGLSLEPLIG  127

Query  475  aiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            AIAAGN V LK SE APA+S+ LAK+  DY+D  AV+
Sbjct  128  AIAAGNCVFLKTSEFAPASSAFLAKVIGDYVDDKAVR  164



>ref|WP_041246595.1| aldehyde dehydrogenase [Glaciecola nitratireducens]
Length=457

 Score =   140 bits (352),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 105/157 (67%), Gaps = 0/157 (0%)
 Frame = +1

Query  115  VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFV  294
            + EL+ TFA+G+TKSYEWRV QL A+  + E +   I++AL +DL K + E+++ EI + 
Sbjct  9    IDELKRTFASGRTKSYEWRVEQLNALTLLIEENSSDIIEALHADLGKCKTEAWLTEIGYS  68

Query  295  KASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLDPvig  474
             AS    +K LK WMKP  + +     P  +  ++EPLGV L+I AWNYPF L + P+I 
Sbjct  69   TASITDTVKRLKSWMKPNKISTPMIAQPGKSYTINEPLGVALIIGAWNYPFQLVITPLIA  128

Query  475  aiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            AIAAGN  V+KPSE++  TS+LLAKL   Y+D  A+K
Sbjct  129  AIAAGNCAVIKPSELSLTTSALLAKLVPKYLDNAAIK  165



>gb|AEP28780.1| NAD-dependent aldehyde dehydrogenase [Glaciecola nitratireducens 
FR1064]
Length=469

 Score =   140 bits (352),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 105/157 (67%), Gaps = 0/157 (0%)
 Frame = +1

Query  115  VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFV  294
            + EL+ TFA+G+TKSYEWRV QL A+  + E +   I++AL +DL K + E+++ EI + 
Sbjct  21   IDELKRTFASGRTKSYEWRVEQLNALTLLIEENSSDIIEALHADLGKCKTEAWLTEIGYS  80

Query  295  KASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLDPvig  474
             AS    +K LK WMKP  + +     P  +  ++EPLGV L+I AWNYPF L + P+I 
Sbjct  81   TASITDTVKRLKSWMKPNKISTPMIAQPGKSYTINEPLGVALIIGAWNYPFQLVITPLIA  140

Query  475  aiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            AIAAGN  V+KPSE++  TS+LLAKL   Y+D  A+K
Sbjct  141  AIAAGNCAVIKPSELSLTTSALLAKLVPKYLDNAAIK  177



>ref|XP_010547359.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic 
isoform X2 [Tarenaya hassleriana]
Length=438

 Score =   139 bits (351),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = +1

Query  205  EHHEKAIMDALFSDLSKPELESFVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSS  384
            +   K I  AL  DL+KPELE+F+ EI+  K+SC LA+KELK WM PE V ++  T PSS
Sbjct  3    DEKSKYIAQALREDLNKPELEAFLAEISNTKSSCMLAIKELKNWMTPEPVTTSVTTSPSS  62

Query  385  AKIVSEPLGVVLVISAWNYPFMLSLDPvigaiaagnavvLKPSEIAPATSSLLAKLFNDY  564
            A+IVSEPLGVVL+ISAWN+PF+L++DPVIGAIAAGNAVVLKPSEIAPATSSLLA+LF +Y
Sbjct  63   AEIVSEPLGVVLIISAWNFPFLLAIDPVIGAIAAGNAVVLKPSEIAPATSSLLARLFREY  122

Query  565  MDTTAVK  585
            +D T ++
Sbjct  123  LDGTTIR  129



>ref|WP_005142534.1| aldehyde dehydrogenase [Mycobacterium rhodesiae]
 gb|EHB55306.1| Aldehyde Dehydrogenase [Mycobacterium rhodesiae JS60]
Length=466

 Score =   139 bits (350),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 72/162 (44%), Positives = 107/162 (66%), Gaps = 0/162 (0%)
 Frame = +1

Query  100  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  279
            DAA  ++++R  F +G+T+S  WR  QL+AV ++ E  E  I +AL SDL +   E+++ 
Sbjct  14   DAAGVLADVRRVFNSGRTRSLTWRTEQLRAVERMCEEREPEIAEALASDLGRSSFEAWLG  73

Query  280  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  459
            +I   KA    A K LK+W+KP+      A  P    +  +PLGV+LVI  WNYPF L +
Sbjct  74   DIGSTKAEAAFARKHLKKWVKPQRYALPLAQLPGKGWVQYDPLGVILVIGPWNYPFYLCM  133

Query  460  DPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
             PV+ AIAAGN +V+KPSE+APATS+L+A+L  +Y+D+ A++
Sbjct  134  APVVAAIAAGNGMVIKPSELAPATSALIARLVPEYLDSEAIR  175



>ref|XP_009138416.1| PREDICTED: aldehyde dehydrogenase family 3 member F1-like isoform 
X2 [Brassica rapa]
Length=472

 Score =   139 bits (350),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 72/158 (46%), Positives = 109/158 (69%), Gaps = 0/158 (0%)
 Frame = +1

Query  112  AVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAF  291
            ++ E+R+TFA+G+T+S +WR +QL+A++++ + +E  + D LF DL K  +E+F  E+ F
Sbjct  11   SLREMRDTFASGRTRSVKWRKTQLEAIIEMVKDNEDKMCDVLFQDLGKHSIEAFRDELGF  70

Query  292  VKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLDPvi  471
            V  S   AL  L +W+ P         YP++ K++SEP G VLV+S+WN+P  LSLDP+I
Sbjct  71   VMRSATTALNSLDKWVVPRKSNLPLLFYPATGKVISEPYGTVLVLSSWNFPISLSLDPMI  130

Query  472  gaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            GAI+AGN V+LK SE++P  S+LLAK    Y+D  A+K
Sbjct  131  GAISAGNTVLLKASELSPNASALLAKTIPSYLDNKAIK  168



>ref|XP_009138415.1| PREDICTED: aldehyde dehydrogenase family 3 member F1-like isoform 
X1 [Brassica rapa]
Length=484

 Score =   139 bits (350),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 72/158 (46%), Positives = 109/158 (69%), Gaps = 0/158 (0%)
 Frame = +1

Query  112  AVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAF  291
            ++ E+R+TFA+G+T+S +WR +QL+A++++ + +E  + D LF DL K  +E+F  E+ F
Sbjct  11   SLREMRDTFASGRTRSVKWRKTQLEAIIEMVKDNEDKMCDVLFQDLGKHSIEAFRDELGF  70

Query  292  VKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLDPvi  471
            V  S   AL  L +W+ P         YP++ K++SEP G VLV+S+WN+P  LSLDP+I
Sbjct  71   VMRSATTALNSLDKWVVPRKSNLPLLFYPATGKVISEPYGTVLVLSSWNFPISLSLDPMI  130

Query  472  gaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            GAI+AGN V+LK SE++P  S+LLAK    Y+D  A+K
Sbjct  131  GAISAGNTVLLKASELSPNASALLAKTIPSYLDNKAIK  168



>emb|CDX72584.1| BnaC07g46060D [Brassica napus]
Length=484

 Score =   139 bits (349),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 73/158 (46%), Positives = 108/158 (68%), Gaps = 0/158 (0%)
 Frame = +1

Query  112  AVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAF  291
            ++ E+RETFA+G+T+S +WR +QLKA++++ + +E+ + D LF DL K   E+F  E+ F
Sbjct  11   SLREMRETFASGRTRSVKWRKTQLKAIIEMVKDNEEKMCDVLFQDLGKHSTEAFRDELGF  70

Query  292  VKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLDPvi  471
            V  S   AL  L +W+ P         YP++ K++SEP G VLV+S+WN+P  LSLDP+I
Sbjct  71   VMRSAATALNSLDKWVVPRKSNLPLLFYPATGKVISEPYGTVLVLSSWNFPISLSLDPMI  130

Query  472  gaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            GAI+AGN V+LK SE++P  S+ LAK    Y+D  A+K
Sbjct  131  GAISAGNTVLLKASELSPNASAFLAKTIPSYLDNKAIK  168



>ref|WP_006946046.1| Aldehyde dehydrogenase [Rhodococcus sp. EsD8]
 emb|CCW14894.1| Aldehyde dehydrogenase [Rhodococcus sp. EsD8]
Length=469

 Score =   138 bits (348),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 104/160 (65%), Gaps = 0/160 (0%)
 Frame = +1

Query  103  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  282
            AA  V +LR+TFA+G+T+SYEWR+SQL+ + ++ +  E  I  AL  DL +   E+++ +
Sbjct  18   AADTVGKLRQTFASGRTRSYEWRISQLRGIERLVDECESEIAAALSEDLGRVPSEAWLGD  77

Query  283  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  462
            IA  K     A K+L++WM+        A YP    +  EPLGVVLVI  WNYP  L+L 
Sbjct  78   IASTKGEAVFARKKLRKWMRRRRQSLPLAQYPGRGWVQHEPLGVVLVIGPWNYPVYLALA  137

Query  463  PvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAV  582
            P++ A++AGN  V+KPSE+APATS+LL +L   Y+D  A+
Sbjct  138  PLVAAVSAGNCAVVKPSELAPATSALLTRLIPKYLDNDAI  177



>ref|WP_043390663.1| aldehyde dehydrogenase [Mycobacterium sp. UNC280MFTsu5.1]
Length=461

 Score =   138 bits (347),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 72/159 (45%), Positives = 102/159 (64%), Gaps = 0/159 (0%)
 Frame = +1

Query  109  AAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIA  288
            A V  LR  FA G+T+   WR+ QL+ + ++ E  E+ I+DAL +DL +   E ++ +IA
Sbjct  12   AVVDTLRTVFATGRTRDLSWRIEQLRGIERLCEEREQEIVDALATDLGRSAFEGWLADIA  71

Query  289  FVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLDPv  468
              KA    A K LK+WM+   V    +  P+   +  +PLGVVLVI  WNYPF LS+ P+
Sbjct  72   STKAEAAYARKHLKKWMRRRPVGLPLSQLPAKGWVQYDPLGVVLVIGPWNYPFYLSVSPL  131

Query  469  igaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            + A+AAGN  V+KPSE+APATS+LLA+L   Y+D  A+K
Sbjct  132  VAAVAAGNCAVVKPSELAPATSALLARLLPQYLDPDAIK  170



>ref|XP_006370384.1| hypothetical protein POPTR_0001s421501g, partial [Populus trichocarpa]
 gb|ERP66953.1| hypothetical protein POPTR_0001s421501g, partial [Populus trichocarpa]
Length=338

 Score =   136 bits (342),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 78/104 (75%), Positives = 91/104 (88%), Gaps = 0/104 (0%)
 Frame = +1

Query  274  VHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFML  453
            V +IA VK+SC+ ALKELK+WMKPE  K++ ATYPSSA+IVSEPLG VLVIS WNYPF L
Sbjct  49   VIQIAMVKSSCEEALKELKQWMKPEKAKTSMATYPSSAEIVSEPLGAVLVISTWNYPFSL  108

Query  454  SLDPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            S+ PVIGAI AGNAVVLKPSEIAPATSSLL+KLF +Y+D +AV+
Sbjct  109  SVKPVIGAITAGNAVVLKPSEIAPATSSLLSKLFEEYLDRSAVR  152



>ref|WP_043983956.1| aldehyde dehydrogenase [Mycobacterium llatzerense]
 gb|KIU18761.1| aldehyde dehydrogenase [Mycobacterium llatzerense]
Length=461

 Score =   138 bits (347),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 72/159 (45%), Positives = 102/159 (64%), Gaps = 0/159 (0%)
 Frame = +1

Query  109  AAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIA  288
            A V  LR  FA G+T+   WR+ QL+ + ++ E  E+ I+DAL +DL +   E ++ +IA
Sbjct  12   AVVDTLRTVFATGRTRDLSWRIEQLRGIERLCEEREQQIVDALAADLGRSAFEGWLADIA  71

Query  289  FVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLDPv  468
              KA    A K LK+WM+   V    +  P+   +  +PLGVVLVI  WNYPF LS+ P+
Sbjct  72   STKAEAAYARKHLKKWMRRRPVGLPLSQLPAKGWVQYDPLGVVLVIGPWNYPFYLSVSPL  131

Query  469  igaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            + A+AAGN  V+KPSE+APATS+LLA+L   Y+D  A+K
Sbjct  132  VAAVAAGNCAVVKPSELAPATSALLARLLPQYLDPDAIK  170



>ref|XP_008449722.1| PREDICTED: aldehyde dehydrogenase family 3 member F1-like [Cucumis 
melo]
Length=481

 Score =   138 bits (347),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 79/157 (50%), Positives = 106/157 (68%), Gaps = 0/157 (0%)
 Frame = +1

Query  115  VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFV  294
            + E RE + +GKTK   WR SQLK + K    +++ I +ALF DL K  +E+F  EI  +
Sbjct  8    LEETREYYNSGKTKEASWRFSQLKGLHKFLNQNQQQIYNALFQDLGKHHVEAFRDEIGNL  67

Query  295  KASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLDPvig  474
            + S   AL+ LK WM P+  K       +SA++V EPLGVVLVIS+WN+PF LSL+P+IG
Sbjct  68   QMSLNFALENLKHWMSPKKAKLPAIAVLNSAEVVPEPLGVVLVISSWNFPFGLSLEPLIG  127

Query  475  aiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            AIAAGN V LK SE +PA+S+ LAK+  DY+D  AV+
Sbjct  128  AIAAGNCVFLKTSEFSPASSAFLAKVIGDYVDKKAVR  164



>ref|WP_015772232.1| aldehyde dehydrogenase [Jonesia denitrificans]
 gb|ACV09604.1| Aldehyde Dehydrogenase [Jonesia denitrificans DSM 20603]
Length=468

 Score =   137 bits (346),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 76/161 (47%), Positives = 105/161 (65%), Gaps = 0/161 (0%)
 Frame = +1

Query  100  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  279
            D A  V  LR+TF AG TK   WR+ QL A+ ++   HEK I +AL SDL KPE E+++ 
Sbjct  8    DIAGTVHGLRDTFRAGTTKPLAWRLRQLDALEQLVSSHEKEIAEALASDLGKPEAEAYLT  67

Query  280  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  459
            E +F+    +   + L+RW K  +V    A  P++  +++EPLGVVLV++ WNYP  L L
Sbjct  68   ETSFLLTEIRHTRRHLRRWAKARHVAPPAALLPATTSVIAEPLGVVLVMAPWNYPIQLLL  127

Query  460  DPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAV  582
             P +GA+AAGN VVL PSE+APA+S L+A+L   Y+D  AV
Sbjct  128  APAVGALAAGNCVVLSPSEVAPASSHLMARLIPRYLDPVAV  168



>ref|XP_002452841.1| hypothetical protein SORBIDRAFT_04g033420 [Sorghum bicolor]
 gb|EES05817.1| hypothetical protein SORBIDRAFT_04g033420 [Sorghum bicolor]
Length=486

 Score =   137 bits (346),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 107/157 (68%), Gaps = 0/157 (0%)
 Frame = +1

Query  115  VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFV  294
            VS+LRE + +G+T+  EWR SQL+ ++++ E  E+AI DAL  DL K  +E+F  E+  +
Sbjct  18   VSDLREVYESGRTQDMEWRQSQLRGLVRLLEDEEEAIFDALHEDLGKHRVEAFRDEVGVL  77

Query  295  KASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLDPvig  474
            K S    L+ LK+W  PE   +    +P++A +V EPLGVVL+ S WN P  L+L+P+ G
Sbjct  78   KKSVVDKLQNLKKWAAPEKAHTPLVAFPATALVVPEPLGVVLIFSCWNLPIGLALEPLSG  137

Query  475  aiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            A+AAGNA V+KPSE+AP+TS+ LA     Y+D+ AVK
Sbjct  138  ALAAGNAAVVKPSELAPSTSAFLAANIPKYLDSKAVK  174



>ref|XP_008219617.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 isoform 
X2 [Prunus mume]
Length=413

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 91/99 (92%), Gaps = 0/99 (0%)
 Frame = +1

Query  289  FVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLDPv  468
             +K+SCKLALKEL+ WMKPE  K++  T+PSSA+IVSEPLGV+L+ISAWNYPF+LSLDPV
Sbjct  1    MLKSSCKLALKELRNWMKPEKAKTSLTTFPSSAEIVSEPLGVILIISAWNYPFLLSLDPV  60

Query  469  igaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            +GAIAAGNAVVLKPSE+APATSSLLAKL  +YMD+++++
Sbjct  61   VGAIAAGNAVVLKPSELAPATSSLLAKLVGEYMDSSSIR  99



>emb|CDY59717.1| BnaA03g59170D [Brassica napus]
Length=484

 Score =   137 bits (346),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 72/158 (46%), Positives = 108/158 (68%), Gaps = 0/158 (0%)
 Frame = +1

Query  112  AVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAF  291
            ++ E+R+TFA+G+T+S +WR +QL+A++++ + +E  + D LF DL K   E+F  E+ F
Sbjct  11   SLREMRDTFASGRTRSVKWRKTQLEAIIEMVKDNEDKMCDVLFQDLGKHSTEAFRDELGF  70

Query  292  VKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLDPvi  471
            V  S   AL  L +W+ P         YP++ K++SEP G VLV+S+WN+P  LSLDP+I
Sbjct  71   VMRSATTALNSLDKWVVPRKSNLPLLFYPATGKVISEPYGTVLVLSSWNFPISLSLDPMI  130

Query  472  gaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            GAI+AGN V+LK SE++P  S+LLAK    Y+D  A+K
Sbjct  131  GAISAGNTVLLKASELSPNASALLAKTIPSYLDNKAIK  168



>emb|CDX77447.1| BnaA07g05850D [Brassica napus]
Length=481

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/158 (46%), Positives = 108/158 (68%), Gaps = 0/158 (0%)
 Frame = +1

Query  112  AVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAF  291
            ++ E+RETFA+G+T+S +WR +QL+A++++ + +E  + D LF DL K   E+F  E+ F
Sbjct  8    SLREMRETFASGRTRSVKWRKTQLEAIIEMVKDNEDKMCDVLFQDLGKHSTEAFRDELGF  67

Query  292  VKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLDPvi  471
            V  S   AL  L +W+ P+        YPS+ K++SEP G VLV+S+WN+P  LSLDP+I
Sbjct  68   VMRSATTALNCLDKWVVPKKSNLPLLFYPSTGKVISEPYGTVLVLSSWNFPISLSLDPLI  127

Query  472  gaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            GAI+AGN V+LK SE++P  S+ LAK    Y+D  A+K
Sbjct  128  GAISAGNTVLLKASELSPNASAFLAKTIPSYLDNKAIK  165



>emb|CDX69216.1| BnaC01g02370D [Brassica napus]
Length=481

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 73/158 (46%), Positives = 108/158 (68%), Gaps = 0/158 (0%)
 Frame = +1

Query  112  AVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAF  291
            ++ E+RETFA+G+T+S +WR +QL+A++++ + +E  + D LF DL K   E+F  E+ F
Sbjct  8    SLREMRETFASGRTRSVKWRKTQLEAIIEMVKDNEDKMCDVLFQDLGKHSTEAFRDELGF  67

Query  292  VKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLDPvi  471
            V  S   AL  L +W+ P+        YPS+ K++SEP G VLV+S+WN+P  LSLDP+I
Sbjct  68   VMRSATTALNCLDKWVVPKKSDLPLLFYPSTGKVISEPYGTVLVLSSWNFPISLSLDPMI  127

Query  472  gaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            GAI+AGN V+LK SE++P  S+ LAK    Y+D  A+K
Sbjct  128  GAISAGNTVLLKASELSPNASAFLAKTIPSYLDNKAIK  165



>ref|WP_026413602.1| aldehyde dehydrogenase [Actinomadura oligospora]
Length=460

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 77/156 (49%), Positives = 101/156 (65%), Gaps = 0/156 (0%)
 Frame = +1

Query  115  VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFV  294
            V  LR  F +G+TK   WR  QL+ +  +    E  + DAL +DL K  +ES+  E+ FV
Sbjct  10   VERLRGVFRSGRTKGLAWRREQLRGLRTLLTEREAELADALRADLGKGAVESYASELGFV  69

Query  295  KASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLDPvig  474
                  AL+ L+RW +PE V    +  P+ A+ V EPLGVVLVIS WNYP ML+L P++G
Sbjct  70   VNEIDHALRHLERWTRPERVAVPRSLMPARARTVREPLGVVLVISPWNYPVMLALAPMVG  129

Query  475  aiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAV  582
            A+AAGN VVLKPSE+APATSS LA+L   ++D  AV
Sbjct  130  ALAAGNCVVLKPSELAPATSSALARLLPSHLDDQAV  165



>ref|WP_020098975.1| hypothetical protein [Mycobacterium sp. 360MFTsu5.1]
Length=459

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 69/156 (44%), Positives = 105/156 (67%), Gaps = 0/156 (0%)
 Frame = +1

Query  115  VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFV  294
            V+ LRE FA G+T+   WR+ QL+ + ++ +  E+ I++AL +DL +P  + ++ +IA  
Sbjct  12   VTGLREVFATGRTRDIGWRLEQLRGIERMCDECEQEIVEALAADLGRPAFDGWLADIAST  71

Query  295  KASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLDPvig  474
            +A    A K LK+WM+  +V    + +P    +  +PLGVVLVI AWNYPF LS+ P++ 
Sbjct  72   RAEAAYARKHLKKWMRRLSVGLPLSQWPGKGWVQYDPLGVVLVIGAWNYPFYLSVGPLVA  131

Query  475  aiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAV  582
            A+AAGN  V+KPSE+APATS+LLA+L   Y+D  A+
Sbjct  132  AVAAGNCAVVKPSELAPATSALLARLLPKYLDREAI  167



>ref|XP_003580245.1| PREDICTED: aldehyde dehydrogenase family 3 member F1-like [Brachypodium 
distachyon]
Length=495

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 77/156 (49%), Positives = 102/156 (65%), Gaps = 0/156 (0%)
 Frame = +1

Query  118  SELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFVK  297
             ELR  + +G+T+S  WR SQL+ +L++    E+    AL  DL K   E++  E+  + 
Sbjct  28   GELRAAYESGRTRSLAWRQSQLRGLLRLLAEKEEDAFRALHDDLGKHRAEAYRDEVGVLV  87

Query  298  ASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLDPviga  477
             S   ALKE+ +WM PE V      YP+SA++V EPLGVVL+ S WN+P  LSL+P+IGA
Sbjct  88   KSANAALKEIGKWMAPEKVWVPLVAYPASAQVVPEPLGVVLIFSCWNFPLGLSLEPLIGA  147

Query  478  iaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            IAAGNAV LKPSE+APAT+  L     +YMD TAVK
Sbjct  148  IAAGNAVALKPSEMAPATAKFLEDNIGEYMDATAVK  183



>ref|WP_008182868.1| aldehyde dehydrogenase [Moorea producens]
 gb|EGJ33158.1| NAD-dependent aldehyde dehydrogenase [Moorea producens 3L]
Length=461

 Score =   136 bits (343),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 71/156 (46%), Positives = 101/156 (65%), Gaps = 0/156 (0%)
 Frame = +1

Query  115  VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFV  294
            VS LR T+A GKT+S +WR+ QL+ V K+   +E  I +AL +DL K +LE++  EI+++
Sbjct  13   VSRLRNTYATGKTRSLQWRIQQLQQVKKMTLDNEDKIREALLADLGKCQLEAWSAEISYI  72

Query  295  KASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLDPvig  474
                   +K LK+WMKP  VK+     P  + I  EPLGV L+I AWNYP+ L + P + 
Sbjct  73   ATEVDHTIKHLKKWMKPRKVKTPLVAMPGKSYIQPEPLGVALIIGAWNYPWQLVIAPYVA  132

Query  475  aiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAV  582
            A++AGN  +LKPSE+A  TS L+A+L   Y+D  AV
Sbjct  133  ALSAGNCAILKPSELAANTSRLMAELVPKYLDGDAV  168



>gb|KJB17707.1| hypothetical protein B456_003G011600 [Gossypium raimondii]
Length=327

 Score =   134 bits (338),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 73/158 (46%), Positives = 107/158 (68%), Gaps = 0/158 (0%)
 Frame = +1

Query  112  AVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAF  291
            +++ELRETF  G TKS  WR SQLKA+L++   +E +I  AL  DL K  +ES+  E+  
Sbjct  4    SIAELRETFKTGGTKSISWRKSQLKALLQLINQNEDSIFKALDQDLGKSPVESYRDEVGV  63

Query  292  VKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLDPvi  471
            +K S    L  L++W+ P+  +     +P+ A+++ +PLGVVL+ S+WN+PF L+LDP+I
Sbjct  64   LKKSVTYTLSCLEKWVAPKKAEVPLLFFPAKAEVMPQPLGVVLIFSSWNFPFTLALDPLI  123

Query  472  gaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            GAI+AGN V+LKPS++APA  S L +    Y+D  AVK
Sbjct  124  GAISAGNTVLLKPSDLAPACMSFLVETIPKYLDNKAVK  161



>ref|XP_009145598.1| PREDICTED: aldehyde dehydrogenase family 3 member F1 [Brassica 
rapa]
Length=481

 Score =   136 bits (342),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 72/158 (46%), Positives = 108/158 (68%), Gaps = 0/158 (0%)
 Frame = +1

Query  112  AVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAF  291
            ++ E+R+TFA+G+T+S +WR +QL+A++++ + +E  + D LF DL K   E+F  E+ F
Sbjct  8    SLREMRDTFASGRTRSVKWRKTQLEAIIEMVKDNEDKMCDVLFQDLGKHSTEAFRDELGF  67

Query  292  VKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLDPvi  471
            V  S   AL  L +W+ P+        YPS+ K++SEP G VLV+S+WN+P  LSLDP+I
Sbjct  68   VMRSATTALNCLDKWVVPKKSNLPLLFYPSTGKVISEPYGTVLVLSSWNFPISLSLDPLI  127

Query  472  gaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            GAI+AGN V+LK SE++P  S+ LAK    Y+D  A+K
Sbjct  128  GAISAGNTVLLKASELSPNASAFLAKTIPSYLDNKAIK  165



>ref|WP_044449982.1| aldehyde dehydrogenase [Mastigocladus laminosus]
 gb|KIY12939.1| aldehyde dehydrogenase [Mastigocladus laminosus UU774]
Length=462

 Score =   136 bits (342),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 107/165 (65%), Gaps = 0/165 (0%)
 Frame = +1

Query  91   LEMDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELES  270
            +E+     +++ R+ F  G+T+   +R+SQLK + ++ + +E  I  AL +DL+KPE E+
Sbjct  3    VEVSMIDIINQQRDFFQTGETQKLSFRISQLKLLQQLIKENETVICQALKADLNKPEFEA  62

Query  271  FVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFM  450
            F  EI  V    +  LK LK W+KP+  K  +   P+SAKI  EPLGVVL+I  WNYPF 
Sbjct  63   FSSEILLVFKEIEFCLKNLKNWIKPQKTKVPWQLLPASAKIYPEPLGVVLIIGTWNYPFQ  122

Query  451  LSLDPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            L + P+IGAIA+GN  ++KPSEIAP TSSL+AKL + Y     +K
Sbjct  123  LVITPLIGAIASGNCTIIKPSEIAPNTSSLIAKLISKYFQPEYIK  167



>ref|WP_019148953.1| hypothetical protein [Timonella senegalensis]
Length=462

 Score =   136 bits (342),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 77/162 (48%), Positives = 108/162 (67%), Gaps = 0/162 (0%)
 Frame = +1

Query  100  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  279
            D +  V+E+RE FA G TK  +WR SQLKA+ ++   +E+AI  AL  DL K   E++  
Sbjct  3    DISTCVTEVREAFAKGLTKPSKWRKSQLKALDRLLVENEQAITGALRDDLGKHPSEAYTT  62

Query  280  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  459
            EI+ V+      L  L RW+ P+ VK + A  P++A  + EPLGV L+I+ WNYP  L L
Sbjct  63   EISIVRGEISNTLSHLGRWLAPKPVKPSIAVLPANAYTILEPLGVALIIAPWNYPVQLLL  122

Query  460  DPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
             P++GAIAAGN+V+LKPSE+AP TS+L+A L   Y+DT A++
Sbjct  123  GPLVGAIAAGNSVILKPSELAPRTSTLIATLVPRYLDTRAIR  164



>ref|WP_036342552.1| aldehyde dehydrogenase [Mycobacterium aromaticivorans]
 gb|KDF00055.1| aldehyde dehydrogenase [Mycobacterium aromaticivorans JS19b1 
= JCM 16368]
Length=466

 Score =   136 bits (342),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 71/164 (43%), Positives = 109/164 (66%), Gaps = 0/164 (0%)
 Frame = +1

Query  94   EMDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESF  273
            E  AA  ++++R  F +G+T+S  WR  QL AV ++ +  E  I +AL SDL +   E++
Sbjct  12   EGAAAGVLADVRRVFTSGRTRSLSWRSEQLLAVERMCDEREPEIAEALASDLGRSSFEAW  71

Query  274  VHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFML  453
            + +I   KA    A K+LK+W+KP+  +   A  P  A +  +PLGV+LVI  WNYPF L
Sbjct  72   LADIGSTKAEAAFARKQLKKWVKPQKSRLPLAQLPGRAWVQYDPLGVILVIGPWNYPFYL  131

Query  454  SLDPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
             + P++ A+AAGN VV+KPSE+APATS+L+A+L  +Y+D+ A++
Sbjct  132  CMAPLVAAVAAGNGVVIKPSELAPATSALIARLVPEYLDSDAIR  175



>gb|KJB64495.1| hypothetical protein B456_010G051500 [Gossypium raimondii]
Length=442

 Score =   135 bits (341),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 76/106 (72%), Positives = 91/106 (86%), Gaps = 0/106 (0%)
 Frame = +1

Query  268  SFVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPF  447
            S    IA +K SCKLALK++K WM PE  K++ AT+PSSA+IVSEPLGVVLVISAWNYPF
Sbjct  23   SLTEMIAMLKNSCKLALKKMKHWMMPEKAKTSLATFPSSAEIVSEPLGVVLVISAWNYPF  82

Query  448  MLSLDPvigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            +LSLDP IGAIAAGNA+VLKPSEI+PAT+SLLAKL  +YMD++ +K
Sbjct  83   LLSLDPFIGAIAAGNAIVLKPSEISPATASLLAKLVANYMDSSCIK  128



>gb|AFW72558.1| hypothetical protein ZEAMMB73_265586 [Zea mays]
Length=327

 Score =   134 bits (336),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 74/160 (46%), Positives = 103/160 (64%), Gaps = 0/160 (0%)
 Frame = +1

Query  106  AAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEI  285
               V +LRE + +G+T+  EWR SQL+ ++++ E  E+ I D L  DL K   E+F  E+
Sbjct  14   GGLVGDLREVYESGRTQGLEWRQSQLRGLVRLLEEKEEEIFDVLHEDLGKHRGEAFRDEV  73

Query  286  AFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLDP  465
              +K S    L+ LK W  PE   +    +P++A +V EPLGVVLV S WN P  L+L+P
Sbjct  74   GVLKKSVVDKLQNLKNWAAPEKAHTPLVAFPATALVVPEPLGVVLVFSCWNLPIGLALEP  133

Query  466  vigaiaagnavvLKPSEIAPATSSLLAKLFNDYMDTTAVK  585
            + GA+AAGNAVV+KPSE+APATS+ LA     Y+D+ AVK
Sbjct  134  LSGALAAGNAVVVKPSELAPATSAFLAANIPKYLDSKAVK  173



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 737611932690