BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002D06

Length=565
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009790737.1|  PREDICTED: transmembrane 9 superfamily member 4    216   2e-62   Nicotiana sylvestris
ref|XP_009602688.1|  PREDICTED: transmembrane 9 superfamily member 4    216   2e-62   Nicotiana tomentosiformis
ref|XP_006366766.1|  PREDICTED: transmembrane 9 superfamily membe...    214   9e-62   Solanum tuberosum [potatoes]
ref|XP_004243223.1|  PREDICTED: transmembrane 9 superfamily member 4    213   2e-61   Solanum lycopersicum
gb|KJB10804.1|  hypothetical protein B456_001G225600                    206   1e-58   Gossypium raimondii
gb|KHG12627.1|  Transmembrane 9 superfamily member 4                    204   2e-58   Gossypium arboreum [tree cotton]
ref|XP_010112888.1|  Transmembrane 9 superfamily member 4               203   8e-58   Morus notabilis
ref|XP_007049474.1|  Endomembrane protein 70 protein family             203   9e-58   Theobroma cacao [chocolate]
emb|CDP06133.1|  unnamed protein product                                200   3e-57   Coffea canephora [robusta coffee]
ref|XP_002321216.2|  hypothetical protein POPTR_0014s17050g             200   8e-57   
gb|KJB42668.1|  hypothetical protein B456_007G163300                    200   1e-56   Gossypium raimondii
emb|CBI28494.3|  unnamed protein product                                192   1e-56   Vitis vinifera
ref|XP_010252919.1|  PREDICTED: transmembrane 9 superfamily member 4    199   2e-56   Nelumbo nucifera [Indian lotus]
ref|XP_011014696.1|  PREDICTED: transmembrane 9 superfamily membe...    199   2e-56   Populus euphratica
ref|XP_011008192.1|  PREDICTED: transmembrane 9 superfamily membe...    199   3e-56   Populus euphratica
ref|XP_011007018.1|  PREDICTED: transmembrane 9 superfamily membe...    197   9e-56   Populus euphratica
ref|XP_002302834.2|  hypothetical protein POPTR_0002s22290g             197   1e-55   Populus trichocarpa [western balsam poplar]
ref|XP_010542054.1|  PREDICTED: transmembrane 9 superfamily member 4    196   2e-55   Tarenaya hassleriana [spider flower]
ref|XP_011069823.1|  PREDICTED: transmembrane 9 superfamily membe...    196   4e-55   Sesamum indicum [beniseed]
ref|XP_002262879.3|  PREDICTED: transmembrane 9 superfamily membe...    195   8e-55   Vitis vinifera
gb|KDP45164.1|  hypothetical protein JCGZ_15029                         194   1e-54   Jatropha curcas
ref|XP_004502094.1|  PREDICTED: transmembrane 9 superfamily membe...    193   4e-54   Cicer arietinum [garbanzo]
gb|KJB08736.1|  hypothetical protein B456_001G100100                    193   4e-54   Gossypium raimondii
emb|CAB40983.1|  putative protein (fragment)                            183   4e-54   Arabidopsis thaliana [mouse-ear cress]
gb|EYU37128.1|  hypothetical protein MIMGU_mgv1a002562mg                191   1e-53   Erythranthe guttata [common monkey flower]
ref|XP_003555670.1|  PREDICTED: transmembrane 9 superfamily membe...    191   2e-53   Glycine max [soybeans]
gb|KHG00223.1|  Tm9sf4                                                  194   3e-53   Gossypium arboreum [tree cotton]
emb|CDY39705.1|  BnaA04g07300D                                          191   3e-53   Brassica napus [oilseed rape]
gb|EAZ07484.1|  hypothetical protein OsI_29743                          190   3e-53   Oryza sativa Indica Group [Indian rice]
ref|XP_011079350.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...    190   4e-53   
ref|XP_002524564.1|  Endosomal P24A protein precursor, putative         189   7e-53   
ref|XP_004303912.1|  PREDICTED: transmembrane 9 superfamily membe...    189   7e-53   Fragaria vesca subsp. vesca
ref|XP_010551982.1|  PREDICTED: transmembrane 9 superfamily membe...    189   8e-53   Tarenaya hassleriana [spider flower]
ref|XP_008229754.1|  PREDICTED: transmembrane 9 superfamily member 4    189   1e-52   Prunus mume [ume]
ref|XP_009124132.1|  PREDICTED: transmembrane 9 superfamily member 4    189   1e-52   Brassica rapa
gb|EAZ43207.1|  hypothetical protein OsJ_27806                          190   1e-52   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010450327.1|  PREDICTED: transmembrane 9 superfamily member 4    188   2e-52   Camelina sativa [gold-of-pleasure]
ref|XP_007217167.1|  hypothetical protein PRUPE_ppa002553mg             188   2e-52   Prunus persica
gb|AES71730.2|  transmembrane 9 family protein                          188   2e-52   Medicago truncatula
ref|NP_193002.4|  endomembrane family protein 70                        188   3e-52   
ref|XP_006415014.1|  hypothetical protein EUTSA_v10024639mg             187   3e-52   Eutrema salsugineum [saltwater cress]
ref|XP_008794697.1|  PREDICTED: transmembrane 9 superfamily member 4    187   3e-52   Phoenix dactylifera
ref|XP_003601479.1|  Transmembrane 9 superfamily protein member         188   3e-52   
ref|XP_004139983.1|  PREDICTED: transmembrane 9 superfamily membe...    187   4e-52   Cucumis sativus [cucumbers]
ref|XP_004154518.1|  PREDICTED: transmembrane 9 superfamily membe...    187   4e-52   
emb|CDY33697.1|  BnaC04g29540D                                          187   5e-52   Brassica napus [oilseed rape]
gb|KHN20168.1|  Transmembrane 9 superfamily member 4                    187   6e-52   Glycine soja [wild soybean]
ref|XP_009390609.1|  PREDICTED: transmembrane 9 superfamily membe...    186   1e-51   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMS64413.1|  Transmembrane 9 superfamily member 4                    185   4e-51   Triticum urartu
ref|XP_006857592.1|  hypothetical protein AMTR_s00061p00090590          184   5e-51   
gb|EMT19888.1|  Transmembrane 9 superfamily member 4                    184   5e-51   
ref|XP_006283293.1|  hypothetical protein CARUB_v10004331mg             184   5e-51   Capsella rubella
ref|XP_010689494.1|  PREDICTED: transmembrane 9 superfamily membe...    184   6e-51   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010496356.1|  PREDICTED: transmembrane 9 superfamily membe...    184   8e-51   Camelina sativa [gold-of-pleasure]
ref|NP_001047965.1|  Os02g0722300                                       184   9e-51   
ref|XP_010496353.1|  PREDICTED: transmembrane 9 superfamily membe...    184   9e-51   Camelina sativa [gold-of-pleasure]
ref|XP_010036099.1|  PREDICTED: transmembrane 9 superfamily member 4    183   1e-50   Eucalyptus grandis [rose gum]
gb|KDO51059.1|  hypothetical protein CISIN_1g006214mg                   182   2e-50   Citrus sinensis [apfelsine]
ref|XP_008448144.1|  PREDICTED: transmembrane 9 superfamily member 4    182   2e-50   Cucumis melo [Oriental melon]
gb|EAY87338.1|  hypothetical protein OsI_08741                          180   2e-50   Oryza sativa Indica Group [Indian rice]
ref|XP_006447881.1|  hypothetical protein CICLE_v10014540mg             182   4e-50   Citrus clementina [clementine]
ref|XP_007146096.1|  hypothetical protein PHAVU_006G012200g             181   7e-50   Phaseolus vulgaris [French bean]
ref|XP_006647811.1|  PREDICTED: transmembrane 9 superfamily membe...    181   8e-50   Oryza brachyantha
ref|XP_008380040.1|  PREDICTED: putative phagocytic receptor 1a         180   2e-49   
ref|XP_004953733.1|  PREDICTED: transmembrane 9 superfamily membe...    179   3e-49   Setaria italica
ref|NP_001062138.1|  Os08g0496900                                       179   5e-49   
ref|NP_001151523.1|  transmembrane 9 superfamily protein member 4...    178   6e-49   Zea mays [maize]
gb|AET01036.2|  transmembrane 9 family protein                          178   7e-49   Medicago truncatula
ref|XP_003618077.1|  Transmembrane 9 superfamily protein member         178   7e-49   
gb|AFW73187.1|  transmembrane 9 family protein member 4                 178   7e-49   
gb|KHN34478.1|  Transmembrane 9 superfamily member 4                    178   9e-49   Glycine soja [wild soybean]
gb|EMS48782.1|  Transmembrane 9 superfamily member 4                    177   9e-49   Triticum urartu
gb|EEE62472.1|  hypothetical protein OsJ_17269                          178   1e-48   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001054755.1|  Os05g0168500                                       178   1e-48   
gb|EMT07832.1|  Transmembrane 9 superfamily member 4                    178   1e-48   
ref|XP_003541265.1|  PREDICTED: transmembrane 9 superfamily membe...    177   1e-48   Glycine max [soybeans]
gb|EEE57708.1|  hypothetical protein OsJ_08189                          180   2e-48   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004953734.1|  PREDICTED: transmembrane 9 superfamily membe...    177   2e-48   Setaria italica
ref|XP_006659537.1|  PREDICTED: transmembrane 9 superfamily membe...    177   2e-48   Oryza brachyantha
gb|EEC78593.1|  hypothetical protein OsI_18611                          176   4e-48   Oryza sativa Indica Group [Indian rice]
ref|XP_004491628.1|  PREDICTED: transmembrane 9 superfamily membe...    175   1e-47   Cicer arietinum [garbanzo]
ref|XP_002444820.1|  hypothetical protein SORBIDRAFT_07g028570          173   5e-47   
ref|XP_008368541.1|  PREDICTED: transmembrane 9 superfamily membe...    172   7e-47   
ref|XP_008353620.1|  PREDICTED: putative phagocytic receptor 1a         172   7e-47   
ref|XP_006647311.1|  PREDICTED: transmembrane 9 superfamily membe...    170   5e-46   Oryza brachyantha
gb|EPS61503.1|  hypothetical protein M569_13294                         169   1e-45   Genlisea aurea
ref|XP_008663085.1|  PREDICTED: transmembrane 9 superfamily member 4    169   1e-45   
ref|XP_007142543.1|  hypothetical protein PHAVU_008G289600g             169   1e-45   Phaseolus vulgaris [French bean]
ref|XP_004973801.1|  PREDICTED: transmembrane 9 superfamily membe...    169   2e-45   Setaria italica
ref|NP_001167934.1|  hypothetical protein precursor                     168   3e-45   Zea mays [maize]
ref|XP_010236014.1|  PREDICTED: transmembrane 9 superfamily membe...    167   4e-45   Brachypodium distachyon [annual false brome]
gb|KHN29868.1|  Transmembrane 9 superfamily member 4                    166   1e-44   Glycine soja [wild soybean]
ref|XP_003519687.1|  PREDICTED: transmembrane 9 superfamily membe...    166   1e-44   Glycine max [soybeans]
gb|EYU34313.1|  hypothetical protein MIMGU_mgv1a002925mg                166   2e-44   Erythranthe guttata [common monkey flower]
gb|EMT19887.1|  Transmembrane 9 superfamily member 4                    166   3e-44   
gb|AFW71976.1|  hypothetical protein ZEAMMB73_889343                    164   5e-44   
gb|KHN46885.1|  Transmembrane 9 superfamily member 4                    165   5e-44   Glycine soja [wild soybean]
gb|AGV54167.1|  transmembrane 9 superfamily protein member              164   1e-43   Phaseolus vulgaris [French bean]
tpg|DAA54117.1|  TPA: hypothetical protein ZEAMMB73_902167              160   1e-43   
tpg|DAA47985.1|  TPA: hypothetical protein ZEAMMB73_709250              161   2e-43   
ref|XP_003545348.1|  PREDICTED: transmembrane 9 superfamily membe...    162   3e-43   Glycine max [soybeans]
tpg|DAA47986.1|  TPA: hypothetical protein ZEAMMB73_709250              162   4e-43   
gb|EMS64414.1|  Transmembrane 9 superfamily member 4                    162   5e-43   Triticum urartu
ref|XP_010910092.1|  PREDICTED: transmembrane 9 superfamily membe...    161   8e-43   Elaeis guineensis
dbj|BAK03451.1|  predicted protein                                      160   2e-42   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004287227.1|  PREDICTED: transmembrane 9 superfamily membe...    154   3e-40   Fragaria vesca subsp. vesca
ref|XP_011078586.1|  PREDICTED: transmembrane 9 superfamily membe...    147   1e-37   Sesamum indicum [beniseed]
ref|XP_010687755.1|  PREDICTED: transmembrane 9 superfamily membe...    146   2e-37   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002523542.1|  Endosomal P24A protein precursor, putative         145   4e-37   Ricinus communis
ref|XP_010520555.1|  PREDICTED: transmembrane 9 superfamily membe...    145   4e-37   
ref|XP_010244791.1|  PREDICTED: transmembrane 9 superfamily member 4    145   5e-37   Nelumbo nucifera [Indian lotus]
ref|XP_002308380.2|  hypothetical protein POPTR_0006s20360g             145   7e-37   Populus trichocarpa [western balsam poplar]
gb|KJB83257.1|  hypothetical protein B456_013G237900                    144   9e-37   Gossypium raimondii
gb|KDP38623.1|  hypothetical protein JCGZ_03976                         144   1e-36   Jatropha curcas
emb|CDP18796.1|  unnamed protein product                                144   2e-36   Coffea canephora [robusta coffee]
ref|XP_009775737.1|  PREDICTED: transmembrane 9 superfamily member 4    144   2e-36   Nicotiana sylvestris
ref|XP_003542622.2|  PREDICTED: transmembrane 9 superfamily membe...    144   2e-36   Glycine max [soybeans]
gb|KHN47554.1|  Transmembrane 9 superfamily member 4                    143   2e-36   Glycine soja [wild soybean]
ref|XP_006597958.1|  PREDICTED: transmembrane 9 superfamily membe...    143   2e-36   Glycine max [soybeans]
gb|EYU31807.1|  hypothetical protein MIMGU_mgv1a021916mg                143   2e-36   Erythranthe guttata [common monkey flower]
ref|XP_011033481.1|  PREDICTED: transmembrane 9 superfamily membe...    143   2e-36   Populus euphratica
ref|XP_003533883.1|  PREDICTED: transmembrane 9 superfamily membe...    143   3e-36   Glycine max [soybeans]
ref|XP_006827113.1|  hypothetical protein AMTR_s00010p00245470          134   3e-36   
gb|KHN18590.1|  Transmembrane 9 superfamily member 4                    143   3e-36   Glycine soja [wild soybean]
ref|XP_003549702.2|  PREDICTED: transmembrane 9 superfamily membe...    143   3e-36   Glycine max [soybeans]
emb|CDP10518.1|  unnamed protein product                                142   4e-36   Coffea canephora [robusta coffee]
ref|XP_006845794.1|  hypothetical protein AMTR_s00019p00254960          142   4e-36   Amborella trichopoda
gb|EYU25293.1|  hypothetical protein MIMGU_mgv1a002545mg                142   7e-36   Erythranthe guttata [common monkey flower]
ref|NP_001190420.1|  endomembrane family protein 70                     142   7e-36   Arabidopsis thaliana [mouse-ear cress]
gb|ACJ85528.1|  unknown                                                 138   8e-36   Medicago truncatula
ref|XP_002264906.1|  PREDICTED: transmembrane 9 superfamily membe...    142   9e-36   Vitis vinifera
emb|CAN62778.1|  hypothetical protein VITISV_031212                     142   9e-36   Vitis vinifera
gb|AES91726.2|  hexose transporter, putative                            142   1e-35   Medicago truncatula
ref|XP_003570309.1|  PREDICTED: transmembrane 9 superfamily membe...    141   1e-35   Brachypodium distachyon [annual false brome]
gb|EPS67195.1|  hypothetical protein M569_07580                         137   1e-35   Genlisea aurea
ref|XP_006350070.1|  PREDICTED: transmembrane 9 superfamily membe...    141   1e-35   Solanum tuberosum [potatoes]
ref|XP_003609518.1|  Transmembrane 9 superfamily protein member         138   1e-35   
ref|XP_004508395.1|  PREDICTED: transmembrane 9 superfamily membe...    141   1e-35   Cicer arietinum [garbanzo]
ref|XP_010913386.1|  PREDICTED: transmembrane 9 superfamily membe...    141   2e-35   Elaeis guineensis
ref|XP_010929109.1|  PREDICTED: transmembrane 9 superfamily membe...    140   2e-35   
gb|KDO59354.1|  hypothetical protein CISIN_1g035744mg                   140   2e-35   Citrus sinensis [apfelsine]
ref|XP_006453695.1|  hypothetical protein CICLE_v10007695mg             140   2e-35   Citrus clementina [clementine]
dbj|BAJ87923.1|  predicted protein                                      140   2e-35   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006359540.1|  PREDICTED: transmembrane 9 superfamily membe...    140   3e-35   Solanum tuberosum [potatoes]
ref|XP_009399549.1|  PREDICTED: transmembrane 9 superfamily membe...    140   3e-35   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001048399.1|  Os02g0797700                                       140   4e-35   
ref|XP_011084037.1|  PREDICTED: transmembrane 9 superfamily membe...    140   5e-35   Sesamum indicum [beniseed]
ref|XP_001763301.1|  predicted protein                                  139   5e-35   
ref|XP_007155122.1|  hypothetical protein PHAVU_003G175400g             140   5e-35   Phaseolus vulgaris [French bean]
ref|XP_004954235.1|  PREDICTED: transmembrane 9 superfamily membe...    139   7e-35   Setaria italica
emb|CBI25602.3|  unnamed protein product                                138   8e-35   Vitis vinifera
ref|XP_002977007.1|  hypothetical protein SELMODRAFT_175941             139   9e-35   
ref|XP_011017952.1|  PREDICTED: transmembrane 9 superfamily membe...    139   1e-34   Populus euphratica
ref|XP_007204607.1|  hypothetical protein PRUPE_ppa002569mg             138   1e-34   Prunus persica
emb|CDY48716.1|  BnaA09g09910D                                          138   2e-34   Brassica napus [oilseed rape]
ref|XP_002980747.1|  hypothetical protein SELMODRAFT_444612             138   2e-34   
ref|XP_007013708.1|  Endomembrane protein 70 protein family             138   2e-34   
ref|XP_004159402.1|  PREDICTED: transmembrane 9 superfamily membe...    138   2e-34   
ref|XP_004139399.1|  PREDICTED: transmembrane 9 superfamily membe...    136   2e-34   
ref|XP_006353713.1|  PREDICTED: transmembrane 9 superfamily membe...    138   2e-34   Solanum tuberosum [potatoes]
ref|XP_008242892.1|  PREDICTED: transmembrane 9 superfamily member 4    138   2e-34   Prunus mume [ume]
ref|XP_006283250.1|  hypothetical protein CARUB_v10004286mg             138   2e-34   
ref|XP_002325161.2|  hypothetical protein POPTR_0018s12150g             137   3e-34   
ref|XP_001752772.1|  predicted protein                                  137   3e-34   
ref|XP_007138440.1|  hypothetical protein PHAVU_009G209100g             137   4e-34   Phaseolus vulgaris [French bean]
ref|XP_008456741.1|  PREDICTED: transmembrane 9 superfamily member 4    137   4e-34   Cucumis melo [Oriental melon]
gb|KFK30763.1|  hypothetical protein AALP_AA6G023200                    137   6e-34   Arabis alpina [alpine rockcress]
ref|NP_001147598.1|  LOC100281207 precursor                             136   8e-34   
gb|AFW73877.1|  transmembrane 9 family protein member 2                 136   8e-34   
gb|KJB07803.1|  hypothetical protein B456_001G045300                    135   1e-33   Gossypium raimondii
ref|XP_004146702.1|  PREDICTED: transmembrane 9 superfamily membe...    135   2e-33   Cucumis sativus [cucumbers]
emb|CDY03353.1|  BnaC09g09950D                                          135   2e-33   
ref|XP_009112619.1|  PREDICTED: transmembrane 9 superfamily member 4    135   2e-33   Brassica rapa
ref|XP_001752770.1|  predicted protein                                  135   3e-33   
ref|XP_010088424.1|  Transmembrane 9 superfamily member 4               134   5e-33   
ref|XP_010045163.1|  PREDICTED: transmembrane 9 superfamily membe...    134   7e-33   Eucalyptus grandis [rose gum]
ref|XP_006473949.1|  PREDICTED: transmembrane 9 superfamily membe...    134   8e-33   Citrus sinensis [apfelsine]
ref|XP_010047177.1|  PREDICTED: transmembrane 9 superfamily member 4    134   8e-33   Eucalyptus grandis [rose gum]
gb|KHG19964.1|  Transmembrane 9 superfamily member 4                    133   9e-33   Gossypium arboreum [tree cotton]
gb|ABK25111.1|  unknown                                                 133   1e-32   Picea sitchensis
gb|KCW88580.1|  hypothetical protein EUGRSUZ_A00958                     132   1e-32   Eucalyptus grandis [rose gum]
gb|KDO47051.1|  hypothetical protein CISIN_1g032114mg                   124   2e-32   Citrus sinensis [apfelsine]
ref|XP_010942153.1|  PREDICTED: transmembrane 9 superfamily membe...    132   3e-32   Elaeis guineensis
ref|XP_010067662.1|  PREDICTED: transmembrane 9 superfamily membe...    132   3e-32   Eucalyptus grandis [rose gum]
gb|KJB64580.1|  hypothetical protein B456_010G054800                    130   1e-31   Gossypium raimondii
ref|XP_010652098.1|  PREDICTED: transmembrane 9 superfamily membe...    130   2e-31   Vitis vinifera
ref|XP_006478582.1|  PREDICTED: transmembrane 9 superfamily membe...    124   3e-31   Citrus sinensis [apfelsine]
gb|EPS67343.1|  hypothetical protein M569_07431                         128   5e-31   Genlisea aurea
ref|XP_006478581.1|  PREDICTED: transmembrane 9 superfamily membe...    124   6e-31   Citrus sinensis [apfelsine]
gb|KJB64579.1|  hypothetical protein B456_010G054800                    127   6e-31   Gossypium raimondii
ref|XP_006478580.1|  PREDICTED: transmembrane 9 superfamily membe...    124   6e-31   Citrus sinensis [apfelsine]
gb|KCW88575.1|  hypothetical protein EUGRSUZ_A00955                     126   4e-30   Eucalyptus grandis [rose gum]
ref|XP_010928520.1|  PREDICTED: transmembrane 9 superfamily membe...    122   1e-28   Elaeis guineensis
gb|EEE68403.1|  hypothetical protein OsJ_26757                          119   6e-28   Oryza sativa Japonica Group [Japonica rice]
dbj|BAD01346.1|  endosomal protein-like                                 119   1e-27   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001061455.1|  Os08g0288400                                       118   2e-27   
gb|EAZ06398.1|  hypothetical protein OsI_28628                          117   8e-27   Oryza sativa Indica Group [Indian rice]
ref|XP_004973181.1|  PREDICTED: transmembrane 9 superfamily membe...    117   9e-27   Setaria italica
gb|EMT03801.1|  Transmembrane 9 superfamily member 2                    113   2e-26   
ref|XP_008650370.1|  PREDICTED: transmembrane 9 superfamily membe...    114   7e-26   Zea mays [maize]
ref|XP_002465960.1|  hypothetical protein SORBIDRAFT_01g049000          114   1e-25   Sorghum bicolor [broomcorn]
ref|XP_003571616.1|  PREDICTED: transmembrane 9 superfamily member 4    113   2e-25   Brachypodium distachyon [annual false brome]
ref|XP_002308473.2|  hypothetical protein POPTR_0006s22900g           99.8    6e-23   
gb|KFK32680.1|  hypothetical protein AALP_AA6G274800                    105   1e-22   Arabis alpina [alpine rockcress]
gb|KDP33510.1|  hypothetical protein JCGZ_07081                         103   5e-22   Jatropha curcas
gb|KJB68422.1|  hypothetical protein B456_010G2446002                 98.2    1e-21   Gossypium raimondii
gb|AAW79375.1|  putative endomembrane protein                         97.8    1e-21   Heterocapsa triquetra
ref|XP_009117241.1|  PREDICTED: transmembrane 9 superfamily member 4    101   2e-21   Brassica rapa
ref|XP_006474609.1|  PREDICTED: transmembrane 9 superfamily membe...    101   2e-21   
ref|XP_006293373.1|  hypothetical protein CARUB_v10022803mg             101   2e-21   
gb|KJB68423.1|  hypothetical protein B456_010G2446002                 98.2    3e-21   Gossypium raimondii
ref|XP_007136939.1|  hypothetical protein PHAVU_009G086800g             101   3e-21   Phaseolus vulgaris [French bean]
ref|XP_009616553.1|  PREDICTED: transmembrane 9 superfamily membe...    100   4e-21   Nicotiana tomentosiformis
emb|CDY34792.1|  BnaA09g41590D                                          100   5e-21   Brassica napus [oilseed rape]
ref|NP_196645.2|  endomembrane family protein 70                        100   7e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010552093.1|  PREDICTED: transmembrane 9 superfamily membe...    100   7e-21   Tarenaya hassleriana [spider flower]
gb|KJB63264.1|  hypothetical protein B456_010G2446001                 99.8    9e-21   Gossypium raimondii
ref|XP_006287242.1|  hypothetical protein CARUB_v10000429mg           99.8    9e-21   Capsella rubella
gb|KJB68421.1|  hypothetical protein B456_010G2446002                 92.8    1e-20   Gossypium raimondii
ref|XP_007011925.1|  Endomembrane protein 70 protein family           99.8    1e-20   Theobroma cacao [chocolate]
ref|XP_010493756.1|  PREDICTED: transmembrane 9 superfamily membe...  99.4    1e-20   Camelina sativa [gold-of-pleasure]
ref|XP_006404919.1|  hypothetical protein EUTSA_v10000079mg           99.4    1e-20   Eutrema salsugineum [saltwater cress]
gb|ETO25316.1|  hypothetical protein RFI_11824                        95.5    1e-20   Reticulomyxa filosa
ref|XP_010525804.1|  PREDICTED: transmembrane 9 superfamily member 4  99.4    1e-20   Tarenaya hassleriana [spider flower]
ref|XP_010454833.1|  PREDICTED: transmembrane 9 superfamily membe...  99.4    2e-20   Camelina sativa [gold-of-pleasure]
ref|XP_010101024.1|  Transmembrane 9 superfamily member 4             99.4    2e-20   Morus notabilis
ref|XP_002880556.1|  hypothetical protein ARALYDRAFT_481272           99.0    2e-20   Arabidopsis lyrata subsp. lyrata
ref|XP_002285526.1|  PREDICTED: transmembrane 9 superfamily member 9  99.0    2e-20   Vitis vinifera
emb|CDY40124.1|  BnaC02g00060D                                        98.6    2e-20   Brassica napus [oilseed rape]
ref|XP_009125272.1|  PREDICTED: transmembrane 9 superfamily membe...  98.6    2e-20   Brassica rapa
emb|CDX85741.1|  BnaA02g00720D                                        98.6    2e-20   
emb|CDX78401.1|  BnaA03g03130D                                        98.2    3e-20   
ref|XP_009359115.1|  PREDICTED: transmembrane 9 superfamily membe...  98.2    3e-20   Pyrus x bretschneideri [bai li]
ref|XP_009363609.1|  PREDICTED: transmembrane 9 superfamily member 4  98.2    4e-20   Pyrus x bretschneideri [bai li]
ref|XP_010472420.1|  PREDICTED: transmembrane 9 superfamily membe...  98.2    4e-20   Camelina sativa [gold-of-pleasure]
gb|KFK25366.1|  hypothetical protein AALP_AA8G104100                  98.2    4e-20   Arabis alpina [alpine rockcress]
gb|EYU34345.1|  hypothetical protein MIMGU_mgv1a002794mg              97.8    4e-20   Erythranthe guttata [common monkey flower]
ref|XP_009131183.1|  PREDICTED: transmembrane 9 superfamily membe...  97.8    4e-20   Brassica rapa
gb|ACL53042.1|  unknown                                               97.4    4e-20   Zea mays [maize]
ref|XP_010519622.1|  PREDICTED: transmembrane 9 superfamily membe...  97.8    5e-20   Tarenaya hassleriana [spider flower]
ref|XP_006343648.1|  PREDICTED: transmembrane 9 superfamily membe...  97.8    5e-20   Solanum tuberosum [potatoes]
ref|XP_002963189.1|  hypothetical protein SELMODRAFT_165859           97.8    5e-20   Selaginella moellendorffii
ref|XP_006483483.1|  PREDICTED: transmembrane 9 superfamily membe...  97.4    5e-20   Citrus sinensis [apfelsine]
ref|XP_006450278.1|  hypothetical protein CICLE_v10007716mg           97.4    5e-20   Citrus clementina [clementine]
ref|XP_001766313.1|  predicted protein                                97.4    6e-20   
gb|KFK27770.1|  hypothetical protein AALP_AA8G426700                  97.4    7e-20   Arabis alpina [alpine rockcress]
ref|XP_003526158.1|  PREDICTED: transmembrane 9 superfamily membe...  97.4    7e-20   Glycine max [soybeans]
ref|XP_008220671.1|  PREDICTED: transmembrane 9 superfamily membe...  97.4    7e-20   Prunus mume [ume]
ref|XP_007221970.1|  hypothetical protein PRUPE_ppa002736mg           97.1    8e-20   Prunus persica
ref|NP_568465.1|  endomembrane family protein 70                      97.1    8e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008813078.1|  PREDICTED: transmembrane 9 superfamily membe...  97.1    9e-20   Phoenix dactylifera
ref|XP_010106795.1|  Transmembrane 9 superfamily member 4             97.1    9e-20   
ref|XP_010421358.1|  PREDICTED: transmembrane 9 superfamily membe...  97.1    1e-19   Camelina sativa [gold-of-pleasure]
ref|XP_006453610.1|  hypothetical protein CICLE_v10007727mg           96.7    1e-19   Citrus clementina [clementine]
ref|NP_001130383.1|  putative Transmembrane 9 family protein memb...  96.7    1e-19   Zea mays [maize]
emb|CAN74279.1|  hypothetical protein VITISV_040146                   96.7    1e-19   Vitis vinifera
ref|XP_001771623.1|  predicted protein                                96.7    1e-19   
gb|KDO59460.1|  hypothetical protein CISIN_1g006643mg                 96.7    1e-19   Citrus sinensis [apfelsine]
ref|XP_002289623.1|  membrane spanning protein of the nonaspanin ...  96.7    1e-19   Thalassiosira pseudonana CCMP1335
ref|XP_004242593.1|  PREDICTED: transmembrane 9 superfamily member 4  96.7    1e-19   Solanum lycopersicum
ref|XP_002515423.1|  Endosomal P24A protein precursor, putative       96.7    1e-19   Ricinus communis
ref|XP_002981604.1|  hypothetical protein SELMODRAFT_178926           96.7    1e-19   Selaginella moellendorffii
ref|XP_002445411.1|  hypothetical protein SORBIDRAFT_07g016310        96.3    1e-19   Sorghum bicolor [broomcorn]
emb|CAB96839.1|  putative protein                                     96.3    2e-19   Arabidopsis thaliana [mouse-ear cress]
gb|EAZ24951.1|  hypothetical protein OsJ_08732                        96.3    2e-19   Oryza sativa Japonica Group [Japonica rice]
ref|NP_179994.2|  Endomembrane protein 70 family protein              96.3    2e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008379055.1|  PREDICTED: transmembrane 9 superfamily member 4  96.3    2e-19   Malus domestica [apple tree]
ref|XP_009347293.1|  PREDICTED: transmembrane 9 superfamily membe...  96.3    2e-19   
ref|XP_006394756.1|  hypothetical protein EUTSA_v10003800mg           96.3    2e-19   Eutrema salsugineum [saltwater cress]
ref|XP_003522366.1|  PREDICTED: transmembrane 9 superfamily membe...  95.9    2e-19   Glycine max [soybeans]
ref|XP_004973141.1|  PREDICTED: transmembrane 9 superfamily membe...  95.9    2e-19   Setaria italica
ref|XP_006399581.1|  hypothetical protein EUTSA_v10012938mg           95.9    2e-19   Eutrema salsugineum [saltwater cress]
ref|XP_002874240.1|  hypothetical protein ARALYDRAFT_910552           95.9    2e-19   Arabidopsis lyrata subsp. lyrata
ref|XP_003518221.1|  PREDICTED: transmembrane 9 superfamily membe...  95.9    2e-19   Glycine max [soybeans]
gb|EYU35328.1|  hypothetical protein MIMGU_mgv1a002750mg              95.5    3e-19   Erythranthe guttata [common monkey flower]
ref|XP_004145497.1|  PREDICTED: transmembrane 9 superfamily membe...  95.5    3e-19   Cucumis sativus [cucumbers]
gb|EMT27688.1|  Transmembrane 9 superfamily member 4                  95.5    3e-19   
gb|KJB55089.1|  hypothetical protein B456_009G063000                  95.5    3e-19   Gossypium raimondii
ref|XP_002873480.1|  hypothetical protein ARALYDRAFT_909044           95.5    3e-19   Arabidopsis lyrata subsp. lyrata
ref|XP_008452846.1|  PREDICTED: transmembrane 9 superfamily membe...  95.5    3e-19   
emb|CDX78402.1|  BnaA03g03140D                                        94.7    4e-19   
ref|XP_009396776.1|  PREDICTED: transmembrane 9 superfamily membe...  95.1    4e-19   
gb|KJB65911.1|  hypothetical protein B456_010G119000                  95.1    4e-19   
ref|XP_006659999.1|  PREDICTED: transmembrane 9 superfamily membe...  95.1    4e-19   
emb|CDX70370.1|  BnaC03g04540D                                        94.4    5e-19   
gb|EMS67921.1|  Transmembrane 9 superfamily member 4                  95.1    5e-19   
ref|XP_003563325.1|  PREDICTED: transmembrane 9 superfamily member 4  94.7    5e-19   
ref|XP_010429380.1|  PREDICTED: transmembrane 9 superfamily membe...  94.7    5e-19   
gb|KHN29632.1|  Transmembrane 9 superfamily member 4                  94.7    5e-19   
gb|KHN17494.1|  Transmembrane 9 superfamily member 4                  94.7    5e-19   
ref|XP_009420385.1|  PREDICTED: transmembrane 9 superfamily membe...  94.7    5e-19   
ref|XP_003550684.1|  PREDICTED: transmembrane 9 superfamily membe...  94.7    5e-19   
gb|EEC83245.1|  hypothetical protein OsI_28561                        94.0    5e-19   
dbj|BAK06589.1|  predicted protein                                    94.7    6e-19   
gb|KHG17647.1|  Transmembrane 9 superfamily member 4                  94.7    6e-19   
ref|XP_006659678.1|  PREDICTED: transmembrane 9 superfamily membe...  94.4    7e-19   
gb|ACN27981.1|  unknown                                               94.4    7e-19   
ref|XP_010912180.1|  PREDICTED: transmembrane 9 superfamily member 8  94.4    8e-19   
gb|KDO67441.1|  hypothetical protein CISIN_1g006525mg                 94.0    9e-19   
ref|XP_009359116.1|  PREDICTED: transmembrane 9 superfamily membe...  94.0    1e-18   
gb|KHG12899.1|  Transmembrane 9 superfamily member 4                  93.6    1e-18   
ref|XP_010419638.1|  PREDICTED: transmembrane 9 superfamily membe...  93.6    1e-18   
ref|XP_010541558.1|  PREDICTED: transmembrane 9 superfamily membe...  93.6    1e-18   
tpg|DAA62590.1|  TPA: hypothetical protein ZEAMMB73_059339            88.2    1e-18   
ref|XP_010453116.1|  PREDICTED: transmembrane 9 superfamily membe...  93.6    1e-18   
ref|XP_002278700.1|  PREDICTED: transmembrane 9 superfamily membe...  93.6    1e-18   
ref|XP_002529382.1|  Endosomal P24A protein precursor, putative       93.6    1e-18   
emb|CBI36530.3|  unnamed protein product                              91.7    2e-18   
ref|XP_006290073.1|  hypothetical protein CARUB_v10003711mg           93.6    2e-18   
ref|XP_010491765.1|  PREDICTED: transmembrane 9 superfamily membe...  93.2    2e-18   
ref|XP_011036690.1|  PREDICTED: transmembrane 9 superfamily member 8  93.2    2e-18   
ref|XP_003573643.1|  PREDICTED: transmembrane 9 superfamily membe...  93.2    2e-18   
gb|EPS68838.1|  hypothetical protein M569_05931                       87.8    2e-18   
ref|XP_002324334.1|  endomembrane protein 70                          92.8    2e-18   
ref|XP_002308404.1|  hypothetical protein POPTR_0006s19780g           92.8    3e-18   
ref|XP_011033402.1|  PREDICTED: transmembrane 9 superfamily member 9  92.8    3e-18   
ref|XP_005651859.1|  EMP/nonaspanin domain family protein             92.8    3e-18   
ref|XP_004974172.1|  PREDICTED: transmembrane 9 superfamily membe...  92.4    3e-18   
ref|XP_006660013.1|  PREDICTED: transmembrane 9 superfamily membe...  92.8    3e-18   
ref|XP_011079404.1|  PREDICTED: transmembrane 9 superfamily membe...  92.4    3e-18   
ref|XP_001765116.1|  predicted protein                                92.4    3e-18   
ref|XP_004291962.1|  PREDICTED: transmembrane 9 superfamily member 8  92.4    3e-18   
ref|XP_008793236.1|  PREDICTED: transmembrane 9 superfamily membe...  92.4    4e-18   
ref|XP_002308707.1|  endomembrane protein 70                          92.4    4e-18   
ref|XP_002445709.1|  hypothetical protein SORBIDRAFT_07g024530        92.4    4e-18   
ref|XP_006656307.1|  PREDICTED: transmembrane 9 superfamily membe...  92.0    4e-18   
gb|KDP38681.1|  hypothetical protein JCGZ_04034                       92.0    4e-18   
ref|XP_002293459.1|  multispanning membrane protein                   92.0    4e-18   
ref|XP_006656173.1|  PREDICTED: transmembrane 9 superfamily membe...  92.0    4e-18   
ref|XP_011031447.1|  PREDICTED: transmembrane 9 superfamily membe...  92.0    5e-18   
ref|XP_009784355.1|  PREDICTED: transmembrane 9 superfamily membe...  92.0    5e-18   
gb|EEC81091.1|  hypothetical protein OsI_23922                        92.0    5e-18   
ref|NP_001130740.1|  hypothetical protein precursor                   92.0    5e-18   
ref|XP_008664577.1|  PREDICTED: transmembrane 9 superfamily membe...  92.0    5e-18   
ref|XP_008443860.1|  PREDICTED: transmembrane 9 superfamily membe...  92.0    5e-18   
ref|NP_001058222.1|  Os06g0650600                                     91.7    5e-18   
gb|EAZ07957.1|  hypothetical protein OsI_30211                        87.4    6e-18   
ref|XP_003578627.1|  PREDICTED: transmembrane 9 superfamily member 4  91.7    6e-18   
ref|XP_009042262.1|  hypothetical protein AURANDRAFT_34561            91.7    6e-18   
ref|XP_011083969.1|  PREDICTED: transmembrane 9 superfamily member 8  91.7    6e-18   
ref|XP_009627535.1|  PREDICTED: transmembrane 9 superfamily membe...  91.7    7e-18   
ref|XP_002325132.2|  hypothetical protein POPTR_0018s11580g           91.3    8e-18   
ref|XP_006478583.1|  PREDICTED: transmembrane 9 superfamily membe...  87.8    8e-18   
ref|XP_001771389.1|  predicted protein                                91.3    8e-18   
ref|XP_009615225.1|  PREDICTED: transmembrane 9 superfamily membe...  91.3    8e-18   
gb|KJB54983.1|  hypothetical protein B456_009G056900                  90.9    1e-17   
ref|XP_010047104.1|  PREDICTED: transmembrane 9 superfamily membe...  90.9    1e-17   
ref|XP_007154881.1|  hypothetical protein PHAVU_003G155900g           90.9    1e-17   
emb|CDO97915.1|  unnamed protein product                              90.9    1e-17   
dbj|BAJ94991.1|  predicted protein                                    90.9    1e-17   
ref|XP_008377639.1|  PREDICTED: transmembrane 9 superfamily membe...  90.9    1e-17   
ref|XP_011018035.1|  PREDICTED: transmembrane 9 superfamily membe...  90.9    1e-17   
ref|XP_002946579.1|  hypothetical protein VOLCADRAFT_109575           90.9    1e-17   
gb|KJB65796.1|  hypothetical protein B456_010G113300                  90.9    1e-17   
gb|ACG29725.1|  transmembrane 9 superfamily protein member 4          90.5    1e-17   
ref|XP_004146675.1|  PREDICTED: transmembrane 9 superfamily membe...  90.5    1e-17   
ref|XP_010265569.1|  PREDICTED: transmembrane 9 superfamily membe...  90.5    1e-17   
ref|XP_003061038.1|  predicted protein                                90.5    2e-17   
emb|CAP58026.1|  hypothetical protein                                 90.5    2e-17   
ref|XP_003527177.1|  PREDICTED: transmembrane 9 superfamily membe...  90.5    2e-17   
ref|XP_004965719.1|  PREDICTED: transmembrane 9 superfamily membe...  90.5    2e-17   
ref|NP_001146016.1|  transmembrane 9 family protein member 4 prec...  90.5    2e-17   
gb|KDD74081.1|  endomembrane protein 70                               90.5    2e-17   
ref|XP_011082042.1|  PREDICTED: transmembrane 9 superfamily membe...  90.5    2e-17   
ref|NP_001151787.1|  transmembrane 9 superfamily protein member 4...  90.1    2e-17   
ref|XP_010048839.1|  PREDICTED: transmembrane 9 superfamily member 4  90.1    2e-17   
ref|NP_001190392.1|  endomembrane family protein 70                   90.1    2e-17   
gb|EWM27009.1|  endosomal p24a protein                                90.1    2e-17   
ref|XP_008795202.1|  PREDICTED: transmembrane 9 superfamily membe...  90.1    2e-17   
ref|XP_011081972.1|  PREDICTED: transmembrane 9 superfamily member 8  90.1    2e-17   
gb|KHG23886.1|  Transmembrane 9 superfamily member 4                  90.1    2e-17   
gb|KHG02438.1|  Transmembrane 9 superfamily member 4                  90.1    2e-17   
gb|ACN26001.1|  unknown                                               90.1    2e-17   
emb|CAL69922.1|  hypothetical protein                                 90.1    2e-17   
ref|XP_003550248.1|  PREDICTED: transmembrane 9 superfamily membe...  89.7    2e-17   
ref|XP_010275836.1|  PREDICTED: transmembrane 9 superfamily membe...  89.7    2e-17   
ref|XP_002186115.1|  predicted protein                                89.7    3e-17   
ref|XP_001756770.1|  predicted protein                                89.7    3e-17   
ref|XP_007011709.1|  Endomembrane protein 70 protein family           89.7    3e-17   
ref|XP_009036611.1|  hypothetical protein AURANDRAFT_70168            89.7    3e-17   
ref|XP_003563731.1|  PREDICTED: transmembrane 9 superfamily membe...  89.7    3e-17   
ref|XP_002460650.1|  hypothetical protein SORBIDRAFT_02g032530        89.7    3e-17   
emb|CDP07847.1|  unnamed protein product                              89.7    3e-17   
gb|EWM29136.1|  Nonaspanin (TM9SF)                                    89.4    3e-17   
ref|XP_004514671.1|  PREDICTED: transmembrane 9 superfamily membe...  89.4    4e-17   
ref|XP_010242215.1|  PREDICTED: transmembrane 9 superfamily membe...  89.0    4e-17   
ref|XP_004957614.1|  PREDICTED: transmembrane 9 superfamily membe...  89.0    5e-17   
gb|EEC85043.1|  hypothetical protein OsI_32361                        89.0    5e-17   
gb|EAZ45641.1|  hypothetical protein OsJ_30309                        89.0    5e-17   
gb|EAZ43615.1|  hypothetical protein OsJ_28236                        89.0    5e-17   
ref|NP_001063906.1|  Os09g0557800                                     89.0    5e-17   
ref|XP_009766072.1|  PREDICTED: putative phagocytic receptor 1a       89.4    5e-17   
ref|XP_008377638.1|  PREDICTED: transmembrane 9 superfamily membe...  89.0    5e-17   
ref|XP_006338203.1|  PREDICTED: transmembrane 9 superfamily membe...  89.7    5e-17   
gb|EEE69126.1|  hypothetical protein OsJ_28237                        89.0    5e-17   
ref|XP_005645674.1|  EMP/nonaspanin domain family protein             89.0    5e-17   
ref|XP_002438595.1|  hypothetical protein SORBIDRAFT_10g022490        89.0    6e-17   
ref|XP_004966052.1|  PREDICTED: transmembrane 9 superfamily membe...  89.0    6e-17   
dbj|BAD10383.1|  putative PHG1A protein                               89.0    6e-17   
ref|XP_001690544.1|  EMP/nonaspanin domain family protein             88.6    6e-17   
ref|XP_002437370.1|  hypothetical protein SORBIDRAFT_10g025700        88.6    6e-17   
ref|NP_001062467.1|  Os08g0554900                                     88.6    6e-17   
ref|XP_010906873.1|  PREDICTED: transmembrane 9 superfamily membe...  88.6    7e-17   
gb|EJK45111.1|  hypothetical protein THAOC_36290                      88.6    7e-17   
dbj|BAH01633.1|  unnamed protein product                              88.6    7e-17   
gb|EEC84005.1|  hypothetical protein OsI_30212                        88.6    8e-17   
ref|XP_004244526.1|  PREDICTED: transmembrane 9 superfamily membe...  88.2    8e-17   
gb|EAZ01381.1|  hypothetical protein OsI_23414                        87.4    8e-17   
ref|XP_004965720.1|  PREDICTED: transmembrane 9 superfamily membe...  88.2    8e-17   
ref|NP_001169745.1|  hypothetical protein precursor                   88.2    9e-17   
ref|XP_006660966.1|  PREDICTED: transmembrane 9 superfamily membe...  88.2    9e-17   
emb|CDX97063.1|  BnaC09g45620D                                        88.2    1e-16   
ref|XP_006357090.1|  PREDICTED: transmembrane 9 superfamily membe...  88.2    1e-16   
ref|XP_010062626.1|  PREDICTED: transmembrane 9 superfamily member 4  88.2    1e-16   
ref|XP_004297557.1|  PREDICTED: transmembrane 9 superfamily member 7  87.8    1e-16   
emb|CDP10238.1|  unnamed protein product                              87.8    1e-16   
ref|XP_009603949.1|  PREDICTED: transmembrane 9 superfamily membe...  87.8    1e-16   
ref|XP_003544560.1|  PREDICTED: transmembrane 9 superfamily membe...  87.8    1e-16   
gb|KHN15300.1|  Transmembrane 9 superfamily member 4                  87.8    1e-16   
ref|XP_002437369.1|  hypothetical protein SORBIDRAFT_10g025690        87.8    1e-16   
ref|XP_009341063.1|  PREDICTED: transmembrane 9 superfamily membe...  87.4    1e-16   
dbj|BAD54580.1|  putative PHG1A protein                               87.8    1e-16   
ref|XP_010915247.1|  PREDICTED: transmembrane 9 superfamily membe...  87.8    1e-16   
ref|XP_008667168.1|  PREDICTED: uncharacterized protein LOC100193...  87.8    1e-16   
emb|CDX69803.1|  BnaA10g21520D                                        87.8    2e-16   
tpg|DAA40745.1|  TPA: hypothetical protein ZEAMMB73_973334            87.4    2e-16   
gb|KJB82833.1|  hypothetical protein B456_013G215900                  87.4    2e-16   
gb|EYU21993.1|  hypothetical protein MIMGU_mgv1a002734mg              87.4    2e-16   
ref|XP_009402928.1|  PREDICTED: transmembrane 9 superfamily membe...  87.4    2e-16   
ref|XP_010942081.1|  PREDICTED: transmembrane 9 superfamily membe...  87.4    2e-16   
ref|XP_009367553.1|  PREDICTED: transmembrane 9 superfamily membe...  87.4    2e-16   
gb|EJK47199.1|  hypothetical protein THAOC_34102                      87.4    2e-16   
ref|XP_007204227.1|  hypothetical protein PRUPE_ppa002742mg           87.4    2e-16   
ref|XP_004235601.1|  PREDICTED: transmembrane 9 superfamily member 4  87.0    2e-16   
ref|XP_010925439.1|  PREDICTED: transmembrane 9 superfamily membe...  87.0    2e-16   
ref|XP_007161084.1|  hypothetical protein PHAVU_001G041600g           87.0    2e-16   
gb|KCW69756.1|  hypothetical protein EUGRSUZ_F03131                   86.7    2e-16   
ref|XP_008242992.1|  PREDICTED: transmembrane 9 superfamily member 4  87.0    2e-16   
ref|XP_007138392.1|  hypothetical protein PHAVU_009G204800g           87.0    2e-16   
ref|XP_006342987.1|  PREDICTED: transmembrane 9 superfamily membe...  87.0    2e-16   
gb|EYU45852.1|  hypothetical protein MIMGU_mgv1a002772mg              86.7    3e-16   
tpg|DAA48707.1|  TPA: hypothetical protein ZEAMMB73_133092            81.3    3e-16   
ref|XP_004337978.1|  EMP/nonaspanin domain family protein             86.7    3e-16   
gb|EAZ37401.1|  hypothetical protein OsJ_21738                        86.7    4e-16   
dbj|BAJ96092.1|  predicted protein                                    86.3    4e-16   
ref|XP_002279431.1|  PREDICTED: transmembrane 9 superfamily member 7  86.3    4e-16   
gb|EPS73699.1|  hypothetical protein M569_01058                       80.5    4e-16   
gb|EEC84006.1|  hypothetical protein OsI_30213                        86.3    5e-16   
gb|KIY96917.1|  Transmembrane 9 superfamily member 4 Flags:Precursor  81.3    6e-16   
ref|XP_002956918.1|  hypothetical protein VOLCADRAFT_77298            85.9    6e-16   
ref|XP_009762751.1|  PREDICTED: transmembrane 9 superfamily membe...  85.9    7e-16   
ref|XP_009783992.1|  PREDICTED: transmembrane 9 superfamily membe...  85.5    7e-16   
ref|XP_007216982.1|  hypothetical protein PRUPE_ppa002713mg           85.5    7e-16   
ref|XP_009366179.1|  PREDICTED: transmembrane 9 superfamily membe...  85.5    7e-16   
gb|KHG12352.1|  Putative phagocytic receptor 1a                       85.5    7e-16   
ref|XP_008367749.1|  PREDICTED: transmembrane 9 superfamily membe...  85.5    8e-16   
ref|XP_009408857.1|  PREDICTED: transmembrane 9 superfamily membe...  85.5    8e-16   
ref|XP_008228298.1|  PREDICTED: transmembrane 9 superfamily membe...  85.5    9e-16   
ref|XP_009358436.1|  PREDICTED: transmembrane 9 superfamily member 4  85.1    9e-16   
ref|XP_009622116.1|  PREDICTED: transmembrane 9 superfamily membe...  85.1    1e-15   
ref|XP_006366153.1|  PREDICTED: transmembrane 9 superfamily membe...  85.1    1e-15   
ref|XP_008378710.1|  PREDICTED: transmembrane 9 superfamily membe...  84.7    1e-15   
ref|XP_004287134.1|  PREDICTED: transmembrane 9 superfamily membe...  84.7    1e-15   
ref|XP_001415876.1|  predicted protein                                84.7    1e-15   
ref|XP_006857241.1|  hypothetical protein AMTR_s00065p00212630        84.7    1e-15   
gb|EMT10602.1|  Transmembrane 9 superfamily member 4                  84.3    2e-15   
ref|XP_008808504.1|  PREDICTED: transmembrane 9 superfamily membe...  84.3    2e-15   
ref|XP_008808506.1|  PREDICTED: transmembrane 9 superfamily membe...  84.3    2e-15   
ref|XP_004341866.1|  transmembrane 9 superfamily protein member 4...  84.3    2e-15   
ref|XP_003112112.1|  hypothetical protein CRE_29803                   84.3    2e-15   
ref|XP_011072512.1|  PREDICTED: transmembrane 9 superfamily member 7  84.3    2e-15   
ref|XP_008391325.1|  PREDICTED: transmembrane 9 superfamily member 4  84.3    2e-15   
ref|XP_005756298.1|  hypothetical protein EMIHUDRAFT_46235            80.5    3e-15   
ref|XP_010904843.1|  PREDICTED: transmembrane 9 superfamily membe...  82.8    3e-15   
gb|EGT54666.1|  hypothetical protein CAEBREN_07251                    84.0    3e-15   
gb|EGT51047.1|  hypothetical protein CAEBREN_15269                    84.0    3e-15   
gb|AAD03378.1|  putative multispanning membrane protein               84.0    3e-15   
gb|KJB70244.1|  hypothetical protein B456_011G065000                  83.6    3e-15   
ref|XP_010925004.1|  PREDICTED: transmembrane 9 superfamily membe...  83.6    4e-15   
ref|XP_009381229.1|  PREDICTED: transmembrane 9 superfamily membe...  83.6    4e-15   
ref|XP_006385363.1|  endomembrane protein 70                          83.6    4e-15   
emb|CEF96692.1|  Nonaspanin (TM9SF)                                   83.2    4e-15   
ref|XP_011000794.1|  PREDICTED: transmembrane 9 superfamily member 7  83.2    4e-15   
ref|XP_010904706.1|  PREDICTED: transmembrane 9 superfamily membe...  83.2    5e-15   
gb|KHG26194.1|  Transmembrane 9 superfamily member 4                  83.2    5e-15   
ref|XP_010904776.1|  PREDICTED: transmembrane 9 superfamily membe...  83.2    5e-15   
ref|XP_004510372.1|  PREDICTED: transmembrane 9 superfamily membe...  83.2    5e-15   
gb|KEH18347.1|  endomembrane protein 70 family protein                83.2    5e-15   
ref|XP_002965995.1|  hypothetical protein SELMODRAFT_167843           83.2    5e-15   
ref|XP_011400587.1|  Transmembrane 9 superfamily member 4             83.6    5e-15   
ref|XP_004501387.1|  PREDICTED: transmembrane 9 superfamily membe...  82.8    6e-15   
ref|XP_010262126.1|  PREDICTED: transmembrane 9 superfamily membe...  82.8    6e-15   
ref|XP_011093732.1|  PREDICTED: transmembrane 9 superfamily membe...  82.8    7e-15   
ref|XP_002989231.1|  hypothetical protein SELMODRAFT_184443           82.8    7e-15   
ref|XP_004498808.1|  PREDICTED: transmembrane 9 superfamily membe...  82.4    8e-15   
ref|XP_010667161.1|  PREDICTED: transmembrane 9 superfamily membe...  82.4    8e-15   
ref|XP_007510015.1|  predicted protein                                82.4    8e-15   
gb|KJB56899.1|  hypothetical protein B456_009G140900                  82.4    9e-15   
gb|KHG25625.1|  Transmembrane 9 superfamily member 4                  82.4    9e-15   
ref|XP_010501142.1|  PREDICTED: transmembrane 9 superfamily membe...  82.4    9e-15   



>ref|XP_009790737.1| PREDICTED: transmembrane 9 superfamily member 4 [Nicotiana sylvestris]
Length=659

 Score =   216 bits (549),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 97/117 (83%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = +1

Query  214  RRYLAAFSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYC  393
            RRY A F Y IL+SHAC+GFYLPG+YMHTYS  ++IIVKVNSLTSIETELPFSYY LPYC
Sbjct  9    RRYWAVFLYVILVSHACNGFYLPGSYMHTYSTGEEIIVKVNSLTSIETELPFSYYSLPYC  68

Query  394  RPPGGIKKSAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQRT  564
            +PPGG+KKSAEN+GELLMGDQIDNSPYRF+MNVNE++YLCTT PLNEH VKLLKQRT
Sbjct  69   KPPGGVKKSAENLGELLMGDQIDNSPYRFKMNVNESIYLCTTPPLNEHEVKLLKQRT  125



>ref|XP_009602688.1| PREDICTED: transmembrane 9 superfamily member 4 [Nicotiana tomentosiformis]
Length=659

 Score =   216 bits (549),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 97/117 (83%), Positives = 107/117 (91%), Gaps = 0/117 (0%)
 Frame = +1

Query  214  RRYLAAFSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYC  393
            RRY A F Y IL+SHAC+GFYLPG+YMHTYS  ++IIVKVNSLTSIETELPFSYY LPYC
Sbjct  9    RRYWAVFLYVILVSHACNGFYLPGSYMHTYSTGEEIIVKVNSLTSIETELPFSYYSLPYC  68

Query  394  RPPGGIKKSAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQRT  564
             PPGG+KKSAEN+GELLMGDQIDNSPYRF+MNVNE++YLCTT PLNEH VKLLKQRT
Sbjct  69   NPPGGVKKSAENLGELLMGDQIDNSPYRFKMNVNESIYLCTTSPLNEHEVKLLKQRT  125



>ref|XP_006366766.1| PREDICTED: transmembrane 9 superfamily member 4-like [Solanum 
tuberosum]
Length=659

 Score =   214 bits (544),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 95/117 (81%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = +1

Query  214  RRYLAAFSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYC  393
            RRY A F Y +L+SHA +GFYLPG+YMHTYSP+++I+VKVNSLTSIETELPFSYY LPYC
Sbjct  9    RRYWALFVYVVLVSHASNGFYLPGSYMHTYSPNEEIVVKVNSLTSIETELPFSYYSLPYC  68

Query  394  RPPGGIKKSAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQRT  564
            +PPGG+KKSAEN+GELLMGDQIDNSPY+FRMNVNE++YLCTT PLNEH VKLLKQRT
Sbjct  69   KPPGGVKKSAENLGELLMGDQIDNSPYKFRMNVNESIYLCTTPPLNEHEVKLLKQRT  125



>ref|XP_004243223.1| PREDICTED: transmembrane 9 superfamily member 4 [Solanum lycopersicum]
Length=659

 Score =   213 bits (541),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 95/117 (81%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = +1

Query  214  RRYLAAFSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYC  393
            RRY A F Y +L+SHA +GFYLPG+YMHTYSP+++I+VKVNSLTSIETELPFSYY LPYC
Sbjct  9    RRYWAVFIYVVLVSHASNGFYLPGSYMHTYSPNEEILVKVNSLTSIETELPFSYYSLPYC  68

Query  394  RPPGGIKKSAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQRT  564
            +PPGG+K SAEN+GELLMGDQIDNSPYRFRMNVNE++YLCTT PLNEH VKLLKQRT
Sbjct  69   KPPGGVKNSAENLGELLMGDQIDNSPYRFRMNVNESIYLCTTPPLNEHEVKLLKQRT  125



>gb|KJB10804.1| hypothetical protein B456_001G225600 [Gossypium raimondii]
Length=659

 Score =   206 bits (523),  Expect = 1e-58, Method: Composition-based stats.
 Identities = 90/113 (80%), Positives = 101/113 (89%), Gaps = 0/113 (0%)
 Frame = +1

Query  226  AAFSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPG  405
            + F   +L +H+CHGFYLPG+YMHTYS SD I+ KVNSLTSIETELPFSYY LPYC+P G
Sbjct  13   SVFLLVVLFAHSCHGFYLPGSYMHTYSTSDTIVAKVNSLTSIETELPFSYYSLPYCKPLG  72

Query  406  GIKKSAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQRT  564
            GIKKSAEN+GELLMGDQIDNSPYRF+MNVNE+LY+CTT PLNEH VKLLKQRT
Sbjct  73   GIKKSAENLGELLMGDQIDNSPYRFKMNVNESLYVCTTSPLNEHEVKLLKQRT  125



>gb|KHG12627.1| Transmembrane 9 superfamily member 4 [Gossypium arboreum]
Length=659

 Score =   204 bits (520),  Expect = 2e-58, Method: Composition-based stats.
 Identities = 90/113 (80%), Positives = 100/113 (88%), Gaps = 0/113 (0%)
 Frame = +1

Query  226  AAFSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPG  405
            + F   +L +H+CHGFYLPG+YMHTYS SD I+ KVNSLTSIETELPFSYY LPYC P G
Sbjct  13   SVFLLVVLFAHSCHGFYLPGSYMHTYSTSDTIVAKVNSLTSIETELPFSYYSLPYCEPLG  72

Query  406  GIKKSAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQRT  564
            GIKKSAEN+GELLMGDQIDNSPYRF+MNVNE+LY+CTT PLNEH VKLLKQRT
Sbjct  73   GIKKSAENLGELLMGDQIDNSPYRFKMNVNESLYVCTTSPLNEHEVKLLKQRT  125



>ref|XP_010112888.1| Transmembrane 9 superfamily member 4 [Morus notabilis]
 gb|EXC35023.1| Transmembrane 9 superfamily member 4 [Morus notabilis]
Length=659

 Score =   203 bits (516),  Expect = 8e-58, Method: Composition-based stats.
 Identities = 90/112 (80%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +1

Query  229  AFSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGG  408
            AF + +L +HACHGFYLPG+YMHTYS  D I  KVNSLTSIETELPFSYY LPYC+P GG
Sbjct  14   AFVFLVLFAHACHGFYLPGSYMHTYSKGDAIFAKVNSLTSIETELPFSYYSLPYCKPSGG  73

Query  409  IKKSAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQRT  564
            IKKSAEN+GELLMGDQIDNSPYRFRMN+NET+YLCTT  LNE+ VKLLKQRT
Sbjct  74   IKKSAENLGELLMGDQIDNSPYRFRMNMNETVYLCTTSRLNENEVKLLKQRT  125



>ref|XP_007049474.1| Endomembrane protein 70 protein family [Theobroma cacao]
 gb|EOX93631.1| Endomembrane protein 70 protein family [Theobroma cacao]
Length=659

 Score =   203 bits (516),  Expect = 9e-58, Method: Composition-based stats.
 Identities = 91/111 (82%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = +1

Query  232  FSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGI  411
            F   IL  H+CHGFYLPG+YMHTYS SD I+ KVNSLTSIETELPFSYY LPYC+P GGI
Sbjct  15   FVLVILFVHSCHGFYLPGSYMHTYSTSDTIVAKVNSLTSIETELPFSYYSLPYCKPLGGI  74

Query  412  KKSAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQRT  564
            KKSAEN+GELLMGDQIDN+PYRFRMNVNE+LYLCTT  LNEH VKLLKQRT
Sbjct  75   KKSAENLGELLMGDQIDNTPYRFRMNVNESLYLCTTNALNEHEVKLLKQRT  125



>emb|CDP06133.1| unnamed protein product [Coffea canephora]
Length=572

 Score =   200 bits (509),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 91/118 (77%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = +1

Query  211  RRRYLAAFSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPY  390
            +R+Y AAF Y +L+S+ C+GFYLPGTYMHTY+  + + VKVNSLTSIETELPFSYY LPY
Sbjct  8    KRKYWAAFVYLVLVSNICNGFYLPGTYMHTYTTGEVLYVKVNSLTSIETELPFSYYSLPY  67

Query  391  CRPPGGIKKSAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQRT  564
            C P GGIKKSAEN+GELL+GDQIDNSPYRF+MNVNE+LYLCTT PL+EH VKLLKQRT
Sbjct  68   CHPQGGIKKSAENLGELLLGDQIDNSPYRFKMNVNESLYLCTTPPLSEHEVKLLKQRT  125



>ref|XP_002321216.2| hypothetical protein POPTR_0014s17050g [Populus trichocarpa]
 gb|EEE99531.2| hypothetical protein POPTR_0014s17050g [Populus trichocarpa]
Length=650

 Score =   200 bits (509),  Expect = 8e-57, Method: Composition-based stats.
 Identities = 89/112 (79%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +1

Query  229  AFSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGG  408
            AF   +L   AC+GFYLPG+YMHTYS  D+I+ KVNSLTSIETELPFSYY LPYC+P GG
Sbjct  5    AFLLLVLFGKACNGFYLPGSYMHTYSTGDEIVAKVNSLTSIETELPFSYYSLPYCQPHGG  64

Query  409  IKKSAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQRT  564
            IKKSAEN+GELLMGDQIDNSPYRFRMNVNE++YLCTT PL+EH VKLLKQRT
Sbjct  65   IKKSAENLGELLMGDQIDNSPYRFRMNVNESVYLCTTKPLSEHEVKLLKQRT  116



>gb|KJB42668.1| hypothetical protein B456_007G163300 [Gossypium raimondii]
 gb|KJB42669.1| hypothetical protein B456_007G163300 [Gossypium raimondii]
 gb|KJB42670.1| hypothetical protein B456_007G163300 [Gossypium raimondii]
Length=659

 Score =   200 bits (508),  Expect = 1e-56, Method: Composition-based stats.
 Identities = 89/111 (80%), Positives = 96/111 (86%), Gaps = 0/111 (0%)
 Frame = +1

Query  232  FSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGI  411
            F   +L +H C GFYLPG+YMHTYS  D I  KVNSLTSIETELPFSYY LPYC+P GG+
Sbjct  15   FLLLLLFAHICDGFYLPGSYMHTYSTKDTIFAKVNSLTSIETELPFSYYSLPYCKPLGGV  74

Query  412  KKSAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQRT  564
            KKSAEN+GELLMGDQIDNSPYRFRMNVNE+LYLCTT PLNEH VKLLKQRT
Sbjct  75   KKSAENLGELLMGDQIDNSPYRFRMNVNESLYLCTTSPLNEHEVKLLKQRT  125



>emb|CBI28494.3| unnamed protein product [Vitis vinifera]
Length=321

 Score =   192 bits (489),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 94/106 (89%), Gaps = 0/106 (0%)
 Frame = +1

Query  247  LISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKSAE  426
            L +H C GFYLPG+YMHTYS  + I+ KVNSLTSIETELPFSYY LPYC+P  GIKKSAE
Sbjct  29   LFAHECRGFYLPGSYMHTYSTGEPILAKVNSLTSIETELPFSYYSLPYCKPVAGIKKSAE  88

Query  427  NVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQRT  564
            N+GELLMGDQIDNSPYRFRMNVNET+YLCTT PLNEH VKLLKQRT
Sbjct  89   NLGELLMGDQIDNSPYRFRMNVNETIYLCTTSPLNEHDVKLLKQRT  134



>ref|XP_010252919.1| PREDICTED: transmembrane 9 superfamily member 4 [Nelumbo nucifera]
Length=661

 Score =   199 bits (507),  Expect = 2e-56, Method: Composition-based stats.
 Identities = 88/113 (78%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = +1

Query  226  AAFSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPG  405
            +A  Y IL +  C+GFYLPG+YMHTYS  ++I  KVNSLTSIETELPFSYY LPYC+PPG
Sbjct  15   SALVYVILFTGICNGFYLPGSYMHTYSTGEKIFAKVNSLTSIETELPFSYYSLPYCKPPG  74

Query  406  GIKKSAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQRT  564
            GIKKSAEN+GELLMGDQIDNSPYRFRMN+NE++YLCTT PLNE  VKLLKQRT
Sbjct  75   GIKKSAENLGELLMGDQIDNSPYRFRMNINESIYLCTTSPLNEQEVKLLKQRT  127



>ref|XP_011014696.1| PREDICTED: transmembrane 9 superfamily member 12-like [Populus 
euphratica]
Length=654

 Score =   199 bits (505),  Expect = 2e-56, Method: Composition-based stats.
 Identities = 89/112 (79%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = +1

Query  229  AFSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGG  408
            AF   +L   AC+GFYLPG+YMHTYS  D+I  KVNSLTSIETELPFSYY LPYC+P GG
Sbjct  9    AFLLLVLFGKACNGFYLPGSYMHTYSTGDEIFAKVNSLTSIETELPFSYYSLPYCQPHGG  68

Query  409  IKKSAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQRT  564
            IKKSAEN+GELLMGDQIDNSPYRFRMNVNE++YLCTT PL+EH VKLLKQRT
Sbjct  69   IKKSAENLGELLMGDQIDNSPYRFRMNVNESVYLCTTKPLSEHEVKLLKQRT  120



>ref|XP_011008192.1| PREDICTED: transmembrane 9 superfamily member 12 [Populus euphratica]
Length=654

 Score =   199 bits (505),  Expect = 3e-56, Method: Composition-based stats.
 Identities = 89/112 (79%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = +1

Query  229  AFSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGG  408
            AF   +L   AC+GFYLPG+YMHTYS  D+I  KVNSLTSIETELPFSYY LPYC+P GG
Sbjct  9    AFLLLVLFGKACNGFYLPGSYMHTYSTGDEIFAKVNSLTSIETELPFSYYSLPYCQPHGG  68

Query  409  IKKSAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQRT  564
            IKKSAEN+GELLMGDQIDNSPYRFRMNVNE++YLCTT PL+EH VKLLKQRT
Sbjct  69   IKKSAENLGELLMGDQIDNSPYRFRMNVNESVYLCTTKPLSEHEVKLLKQRT  120



>ref|XP_011007018.1| PREDICTED: transmembrane 9 superfamily member 12 [Populus euphratica]
Length=654

 Score =   197 bits (502),  Expect = 9e-56, Method: Composition-based stats.
 Identities = 88/112 (79%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = +1

Query  229  AFSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGG  408
            AF    L  +AC+GFYLPG+YMHTYSP D I  KVNSLTSIETELPFSYY LPYC+P  G
Sbjct  9    AFLVLALFGNACNGFYLPGSYMHTYSPGDAIFAKVNSLTSIETELPFSYYSLPYCQPKEG  68

Query  409  IKKSAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQRT  564
            +KKSAEN+GELLMGDQIDNSPYRFRMNVNE++YLCTT PL+EH VKLLKQRT
Sbjct  69   VKKSAENLGELLMGDQIDNSPYRFRMNVNESVYLCTTKPLSEHEVKLLKQRT  120



>ref|XP_002302834.2| hypothetical protein POPTR_0002s22290g [Populus trichocarpa]
 gb|EEE82107.2| hypothetical protein POPTR_0002s22290g [Populus trichocarpa]
Length=654

 Score =   197 bits (501),  Expect = 1e-55, Method: Composition-based stats.
 Identities = 88/112 (79%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = +1

Query  229  AFSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGG  408
            AF    L  +AC+GFYLPG+YMHTYSP D I  KVNSLTSIETELPFSYY LPYC+P  G
Sbjct  9    AFLLLALFGNACNGFYLPGSYMHTYSPGDAIFAKVNSLTSIETELPFSYYSLPYCQPKEG  68

Query  409  IKKSAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQRT  564
            +KKSAEN+GELLMGDQIDNSPYRFRMNVNE++YLCTT PL+EH VKLLKQRT
Sbjct  69   VKKSAENLGELLMGDQIDNSPYRFRMNVNESVYLCTTKPLSEHEVKLLKQRT  120



>ref|XP_010542054.1| PREDICTED: transmembrane 9 superfamily member 4 [Tarenaya hassleriana]
 ref|XP_010542055.1| PREDICTED: transmembrane 9 superfamily member 4 [Tarenaya hassleriana]
 ref|XP_010542056.1| PREDICTED: transmembrane 9 superfamily member 4 [Tarenaya hassleriana]
 ref|XP_010542057.1| PREDICTED: transmembrane 9 superfamily member 4 [Tarenaya hassleriana]
Length=652

 Score =   196 bits (498),  Expect = 2e-55, Method: Composition-based stats.
 Identities = 88/111 (79%), Positives = 95/111 (86%), Gaps = 0/111 (0%)
 Frame = +1

Query  232  FSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGI  411
            F   + +   CHGFYLPG+YMHTYS  D I  KVNSLTSIETELPFSYY LPYC+P GGI
Sbjct  8    FLLLVFVGQLCHGFYLPGSYMHTYSNGDPIFGKVNSLTSIETELPFSYYSLPYCKPLGGI  67

Query  412  KKSAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQRT  564
            KKSAEN+GELLMGDQIDNSPYRFRMN+NE+LYLCTT PLNEH VKLLKQRT
Sbjct  68   KKSAENLGELLMGDQIDNSPYRFRMNMNESLYLCTTSPLNEHEVKLLKQRT  118



>ref|XP_011069823.1| PREDICTED: transmembrane 9 superfamily member 12-like [Sesamum 
indicum]
Length=657

 Score =   196 bits (497),  Expect = 4e-55, Method: Composition-based stats.
 Identities = 86/117 (74%), Positives = 98/117 (84%), Gaps = 0/117 (0%)
 Frame = +1

Query  214  RRYLAAFSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYC  393
            R+    F + +LI   C+GFYLPG+YMHTYS  D+I  KVNSLTSIETELPFSYY LPYC
Sbjct  7    RKLCTGFVFLVLILQGCNGFYLPGSYMHTYSTGDEIYAKVNSLTSIETELPFSYYSLPYC  66

Query  394  RPPGGIKKSAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQRT  564
            +P GGIKKSAEN+GELLMGDQIDNSPYRFRMNVNE++YLCTT PL++  VKL KQRT
Sbjct  67   KPKGGIKKSAENLGELLMGDQIDNSPYRFRMNVNESVYLCTTAPLSDQEVKLFKQRT  123



>ref|XP_002262879.3| PREDICTED: transmembrane 9 superfamily member 12 [Vitis vinifera]
Length=668

 Score =   195 bits (495),  Expect = 8e-55, Method: Composition-based stats.
 Identities = 87/106 (82%), Positives = 94/106 (89%), Gaps = 0/106 (0%)
 Frame = +1

Query  247  LISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKSAE  426
            L +H C GFYLPG+YMHTYS  + I+ KVNSLTSIETELPFSYY LPYC+P  GIKKSAE
Sbjct  29   LFAHECRGFYLPGSYMHTYSTGEPILAKVNSLTSIETELPFSYYSLPYCKPVAGIKKSAE  88

Query  427  NVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQRT  564
            N+GELLMGDQIDNSPYRFRMNVNET+YLCTT PLNEH VKLLKQRT
Sbjct  89   NLGELLMGDQIDNSPYRFRMNVNETIYLCTTSPLNEHDVKLLKQRT  134



>gb|KDP45164.1| hypothetical protein JCGZ_15029 [Jatropha curcas]
Length=650

 Score =   194 bits (494),  Expect = 1e-54, Method: Composition-based stats.
 Identities = 84/107 (79%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = +1

Query  244  ILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKSA  423
            +L  H C+ FYLPG+YMHTYS  ++I+ KVNSLTSIETELPFSYY LPYC+PPGGIKKSA
Sbjct  10   VLFLHTCNAFYLPGSYMHTYSTGEKILAKVNSLTSIETELPFSYYSLPYCKPPGGIKKSA  69

Query  424  ENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQRT  564
            EN+GELLMGDQIDNSPYRFRMN+NE+++LCTT PL+EH VKLLKQRT
Sbjct  70   ENLGELLMGDQIDNSPYRFRMNINESVFLCTTPPLSEHEVKLLKQRT  116



>ref|XP_004502094.1| PREDICTED: transmembrane 9 superfamily member 4-like [Cicer arietinum]
Length=659

 Score =   193 bits (490),  Expect = 4e-54, Method: Composition-based stats.
 Identities = 89/117 (76%), Positives = 100/117 (85%), Gaps = 5/117 (4%)
 Frame = +1

Query  229  AFSYFILIS-----HACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYC  393
            +F+Y++ +S        +GFYLPG+YMHTYS  + I  KVNSLTSIETELPFSYY LPYC
Sbjct  9    SFTYWVFLSVIVFAQVSNGFYLPGSYMHTYSNGEFINAKVNSLTSIETELPFSYYSLPYC  68

Query  394  RPPGGIKKSAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQRT  564
            +PPGGIKKSAEN+GELLMGDQIDNSPYRFRMNVNET+YLCTT PLNEH VKLLKQRT
Sbjct  69   QPPGGIKKSAENLGELLMGDQIDNSPYRFRMNVNETVYLCTTSPLNEHEVKLLKQRT  125



>gb|KJB08736.1| hypothetical protein B456_001G100100 [Gossypium raimondii]
Length=655

 Score =   193 bits (490),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 89/112 (79%), Positives = 95/112 (85%), Gaps = 0/112 (0%)
 Frame = +1

Query  229  AFSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGG  408
             F   IL  H C+GFYLPG+YMHTYS  D I  K+NSLTSIETELPFSYY LPYC+P GG
Sbjct  10   GFQLLILFVHHCYGFYLPGSYMHTYSTKDAIYAKINSLTSIETELPFSYYSLPYCKPMGG  69

Query  409  IKKSAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQRT  564
            IKKSAEN+GELLMGDQIDNSPYRFRMNVNE+LYLCTT PLNE  VKLLKQRT
Sbjct  70   IKKSAENLGELLMGDQIDNSPYRFRMNVNESLYLCTTSPLNEREVKLLKQRT  121



>emb|CAB40983.1| putative protein (fragment) [Arabidopsis thaliana]
Length=227

 Score =   183 bits (464),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 85/112 (76%), Positives = 92/112 (82%), Gaps = 0/112 (0%)
 Frame = +1

Query  229  AFSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGG  408
             F   + +S  C+GFYLPG+YMHTYS  D I  KVNSLTSIETELPFSYY LPYC+P  G
Sbjct  7    VFVLLVFVSQLCNGFYLPGSYMHTYSDGDSIFAKVNSLTSIETELPFSYYSLPYCQPLEG  66

Query  409  IKKSAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQRT  564
            IKKSAEN+GELLMGDQIDNS YRFRM  NE+LYLCTT PLNEH VKLLKQRT
Sbjct  67   IKKSAENLGELLMGDQIDNSAYRFRMRTNESLYLCTTSPLNEHEVKLLKQRT  118



>gb|EYU37128.1| hypothetical protein MIMGU_mgv1a002562mg [Erythranthe guttata]
Length=659

 Score =   191 bits (486),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/118 (75%), Positives = 99/118 (84%), Gaps = 0/118 (0%)
 Frame = +1

Query  211  RRRYLAAFSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPY  390
            +R+  AA    + I   C+GFYLPG+YMHTYS  D+I  KVNSLTSIETELPFSYY LPY
Sbjct  8    KRKLHAALILLVQILQVCNGFYLPGSYMHTYSTGDEIYAKVNSLTSIETELPFSYYSLPY  67

Query  391  CRPPGGIKKSAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQRT  564
            C+P GGIKKSAEN+GELLMGDQIDNSPYRFRMNVNET++LCTT PLNE  VKLLKQRT
Sbjct  68   CQPMGGIKKSAENLGELLMGDQIDNSPYRFRMNVNETVFLCTTPPLNEEQVKLLKQRT  125



>ref|XP_003555670.1| PREDICTED: transmembrane 9 superfamily member 4-like isoform 
X1 [Glycine max]
 ref|XP_006605661.1| PREDICTED: transmembrane 9 superfamily member 4-like isoform 
X2 [Glycine max]
Length=657

 Score =   191 bits (486),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/112 (79%), Positives = 96/112 (86%), Gaps = 0/112 (0%)
 Frame = +1

Query  229  AFSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGG  408
             F + I+     +GFYLPG+YMHTYS  D I  KVNSLTSIETELP+SYYDLPYC+P GG
Sbjct  12   VFLFVIVFVQVVNGFYLPGSYMHTYSNKDLIYAKVNSLTSIETELPYSYYDLPYCQPDGG  71

Query  409  IKKSAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQRT  564
            IKKSAEN+GELLMGDQIDNSPYRFRMNVNETLYLCTT PLNEH VKLLKQRT
Sbjct  72   IKKSAENLGELLMGDQIDNSPYRFRMNVNETLYLCTTSPLNEHEVKLLKQRT  123



>gb|KHG00223.1| Tm9sf4 [Gossypium arboreum]
Length=1139

 Score =   194 bits (492),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 90/112 (80%), Positives = 95/112 (85%), Gaps = 0/112 (0%)
 Frame = +1

Query  229  AFSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGG  408
             F   IL  H C+GFYLPG+YMHTYS  D I  KVNSLTSIETELPFSYY LPYC+P GG
Sbjct  494  GFQLLILFVHHCYGFYLPGSYMHTYSTKDAIYAKVNSLTSIETELPFSYYGLPYCKPMGG  553

Query  409  IKKSAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQRT  564
            IKKSAEN+GELLMGDQIDNSPYRFRMNVNE+LYLCTT PLNE  VKLLKQRT
Sbjct  554  IKKSAENLGELLMGDQIDNSPYRFRMNVNESLYLCTTSPLNEREVKLLKQRT  605



>emb|CDY39705.1| BnaA04g07300D [Brassica napus]
Length=689

 Score =   191 bits (484),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 86/118 (73%), Positives = 96/118 (81%), Gaps = 0/118 (0%)
 Frame = +1

Query  211  RRRYLAAFSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPY  390
            RR+    F   + ++  C GFYLPG+YMHTYS  D I+ KVNSLTSIETELPFS+Y LPY
Sbjct  38   RRKMYGVFVLLVFVAQVCDGFYLPGSYMHTYSNGDSILAKVNSLTSIETELPFSFYSLPY  97

Query  391  CRPPGGIKKSAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQRT  564
            C+P  GIKKSAEN+GELLMGDQIDNS YRFRMN NE+LYLCTT PLNEH VKLLKQRT
Sbjct  98   CKPLEGIKKSAENLGELLMGDQIDNSAYRFRMNTNESLYLCTTSPLNEHEVKLLKQRT  155



>gb|EAZ07484.1| hypothetical protein OsI_29743 [Oryza sativa Indica Group]
Length=594

 Score =   190 bits (482),  Expect = 3e-53, Method: Composition-based stats.
 Identities = 85/116 (73%), Positives = 97/116 (84%), Gaps = 0/116 (0%)
 Frame = +1

Query  217  RYLAAFSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCR  396
            R+L    + +L  H C+ FYLPG+YMHTYS  ++I  KVNSLTSIETE+PFSYY LPYCR
Sbjct  184  RWLGLCIFLVLRLHYCNAFYLPGSYMHTYSQGEEIWAKVNSLTSIETEMPFSYYSLPYCR  243

Query  397  PPGGIKKSAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQRT  564
            P GGIKKSAEN+GELLMGDQIDNSPYRFR+NVNE+LYLCTT  LNE+  KLLKQRT
Sbjct  244  PQGGIKKSAENLGELLMGDQIDNSPYRFRVNVNESLYLCTTKGLNENDAKLLKQRT  299



>ref|XP_011079350.1| PREDICTED: LOW QUALITY PROTEIN: transmembrane 9 superfamily member 
12-like [Sesamum indicum]
Length=653

 Score =   190 bits (482),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 87/118 (74%), Positives = 99/118 (84%), Gaps = 0/118 (0%)
 Frame = +1

Query  211  RRRYLAAFSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPY  390
            RR+   AF   + +    +GFYLPG+YMHTYS  D+I  KVNSLTSIETELPFSYY LPY
Sbjct  8    RRKLCTAFVCLVFVFQTAYGFYLPGSYMHTYSTGDEIYAKVNSLTSIETELPFSYYSLPY  67

Query  391  CRPPGGIKKSAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQRT  564
            C+P GGIKKSAEN+GELLMGDQIDNSPYRFRMNVNE+LY+CTT PL+E+ VKLLKQRT
Sbjct  68   CKPQGGIKKSAENLGELLMGDQIDNSPYRFRMNVNESLYICTTLPLSEYEVKLLKQRT  125



>ref|XP_002524564.1| Endosomal P24A protein precursor, putative [Ricinus communis]
 gb|EEF37772.1| Endosomal P24A protein precursor, putative [Ricinus communis]
Length=654

 Score =   189 bits (481),  Expect = 7e-53, Method: Composition-based stats.
 Identities = 81/107 (76%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = +1

Query  244  ILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKSA  423
            +L +H C  FYLPG+YMHTYS  ++I+ KVNSLTSIETELPFSYY LPYC+PPG I+KSA
Sbjct  14   VLFAHTCSAFYLPGSYMHTYSTGEKIVAKVNSLTSIETELPFSYYSLPYCKPPGRIRKSA  73

Query  424  ENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQRT  564
            EN+GELLMGDQIDNSPY+FRMN+NE+++LCTT PL+EH VKLLKQRT
Sbjct  74   ENLGELLMGDQIDNSPYQFRMNINESVFLCTTPPLSEHEVKLLKQRT  120



>ref|XP_004303912.1| PREDICTED: transmembrane 9 superfamily member 12 [Fragaria vesca 
subsp. vesca]
Length=660

 Score =   189 bits (481),  Expect = 7e-53, Method: Composition-based stats.
 Identities = 83/115 (72%), Positives = 97/115 (84%), Gaps = 0/115 (0%)
 Frame = +1

Query  220  YLAAFSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRP  399
            +L A    ++ +H C+GFYLPG+YMHTYS   +I  KVNSLTSIETELPFSYY LPYC+P
Sbjct  12   FLWALLVLVMFAHVCNGFYLPGSYMHTYSKGQEIFTKVNSLTSIETELPFSYYSLPYCKP  71

Query  400  PGGIKKSAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQRT  564
             GGIKK AEN+GELLMGD+I++SPYRFRMN+NET+YLCTT PL EH VKLLKQRT
Sbjct  72   QGGIKKMAENLGELLMGDEIESSPYRFRMNMNETVYLCTTNPLKEHEVKLLKQRT  126



>ref|XP_010551982.1| PREDICTED: transmembrane 9 superfamily member 4-like [Tarenaya 
hassleriana]
 ref|XP_010551983.1| PREDICTED: transmembrane 9 superfamily member 4-like [Tarenaya 
hassleriana]
 ref|XP_010551985.1| PREDICTED: transmembrane 9 superfamily member 4-like [Tarenaya 
hassleriana]
Length=662

 Score =   189 bits (481),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 88/121 (73%), Positives = 101/121 (83%), Gaps = 3/121 (2%)
 Frame = +1

Query  211  RRRYLAA---FSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYD  381
            RRR +     F   +L +  C+GFYLPG+YMH+YS  + I  KVNSLTSIETELPFSYY 
Sbjct  8    RRRTMGLCHLFLSMVLFAQLCNGFYLPGSYMHSYSKGEHIFAKVNSLTSIETELPFSYYS  67

Query  382  LPYCRPPGGIKKSAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQR  561
            LPYC+PPGGIKKSAEN+GELLMGDQIDNSPYRF+MNVNE++YLCTT PLNE+ VKLLKQR
Sbjct  68   LPYCQPPGGIKKSAENLGELLMGDQIDNSPYRFQMNVNESVYLCTTSPLNENEVKLLKQR  127

Query  562  T  564
            T
Sbjct  128  T  128



>ref|XP_008229754.1| PREDICTED: transmembrane 9 superfamily member 4 [Prunus mume]
Length=659

 Score =   189 bits (480),  Expect = 1e-52, Method: Composition-based stats.
 Identities = 84/106 (79%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = +1

Query  247  LISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKSAE  426
            L +H C+GFYLPG+YMHTYS + +II KVNSLTSIETELPFSYY LPYC+PP GIKKSAE
Sbjct  20   LFAHTCNGFYLPGSYMHTYSKAQEIITKVNSLTSIETELPFSYYSLPYCKPPKGIKKSAE  79

Query  427  NVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQRT  564
            N+GELLMGD+I+NS YRF+MNVNET+YLCTT PL EH VKLLKQRT
Sbjct  80   NLGELLMGDEIENSAYRFKMNVNETVYLCTTHPLTEHDVKLLKQRT  125



>ref|XP_009124132.1| PREDICTED: transmembrane 9 superfamily member 4 [Brassica rapa]
Length=649

 Score =   189 bits (479),  Expect = 1e-52, Method: Composition-based stats.
 Identities = 84/111 (76%), Positives = 93/111 (84%), Gaps = 0/111 (0%)
 Frame = +1

Query  232  FSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGI  411
            F   + ++  C GFYLPG+YMHTYS  D I+ KVNSLTSIETELPFS+Y LPYC+P  GI
Sbjct  5    FVLLVFVAQVCDGFYLPGSYMHTYSNGDSILAKVNSLTSIETELPFSFYSLPYCKPLEGI  64

Query  412  KKSAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQRT  564
            KKSAEN+GELLMGDQIDNS YRFRMN NE+LYLCTT PLNEH VKLLKQRT
Sbjct  65   KKSAENLGELLMGDQIDNSAYRFRMNTNESLYLCTTSPLNEHEVKLLKQRT  115



>gb|EAZ43207.1| hypothetical protein OsJ_27806 [Oryza sativa Japonica Group]
Length=834

 Score =   190 bits (482),  Expect = 1e-52, Method: Composition-based stats.
 Identities = 85/116 (73%), Positives = 97/116 (84%), Gaps = 0/116 (0%)
 Frame = +1

Query  217  RYLAAFSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCR  396
            R+L    + +L  H C+ FYLPG+YMHTYS  ++I  KVNSLTSIETE+PFSYY LPYCR
Sbjct  184  RWLGLCIFLVLRLHYCNAFYLPGSYMHTYSQGEEIWAKVNSLTSIETEMPFSYYSLPYCR  243

Query  397  PPGGIKKSAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQRT  564
            P GGIKKSAEN+GELLMGDQIDNSPYRFR+NVNE+LYLCTT  LNE+  KLLKQRT
Sbjct  244  PQGGIKKSAENLGELLMGDQIDNSPYRFRVNVNESLYLCTTKGLNENDAKLLKQRT  299



>ref|XP_010450327.1| PREDICTED: transmembrane 9 superfamily member 4 [Camelina sativa]
Length=652

 Score =   188 bits (478),  Expect = 2e-52, Method: Composition-based stats.
 Identities = 85/112 (76%), Positives = 93/112 (83%), Gaps = 0/112 (0%)
 Frame = +1

Query  229  AFSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGG  408
            AF   + ++  C+GFYLPG+YMHTYS  D I  KVNSLTSIETELPFSYY LPYC+P  G
Sbjct  7    AFVLLVFVTQLCNGFYLPGSYMHTYSDGDSIFAKVNSLTSIETELPFSYYSLPYCQPLEG  66

Query  409  IKKSAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQRT  564
            IKKSAEN+GELLMGDQIDNS YRFRM  NE+LYLCTT PLNEH VKLLKQRT
Sbjct  67   IKKSAENLGELLMGDQIDNSAYRFRMRTNESLYLCTTSPLNEHEVKLLKQRT  118



>ref|XP_007217167.1| hypothetical protein PRUPE_ppa002553mg [Prunus persica]
 gb|EMJ18366.1| hypothetical protein PRUPE_ppa002553mg [Prunus persica]
Length=659

 Score =   188 bits (478),  Expect = 2e-52, Method: Composition-based stats.
 Identities = 83/106 (78%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = +1

Query  247  LISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKSAE  426
            L +H+C+GFYLPG+YMHTYS + +I+ KVNSLTSIETELPFSYY LPYC+PP GIKKSAE
Sbjct  20   LFAHSCNGFYLPGSYMHTYSKAQEIVTKVNSLTSIETELPFSYYSLPYCKPPEGIKKSAE  79

Query  427  NVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQRT  564
            N+GELLMGD+I+NS YRF+MNVN+TLYLCTT PL EH VKLLKQRT
Sbjct  80   NLGELLMGDEIENSAYRFKMNVNKTLYLCTTHPLTEHDVKLLKQRT  125



>gb|AES71730.2| transmembrane 9 family protein [Medicago truncatula]
Length=659

 Score =   188 bits (477),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 90/115 (78%), Positives = 97/115 (84%), Gaps = 1/115 (1%)
 Frame = +1

Query  220  YLAAFSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRP  399
            Y   FS F + +   +GFYLPG+YMHTYS  + I  KVNSLTSIETELPFSYY LPYC+P
Sbjct  12   YWVFFS-FTVFAQVSNGFYLPGSYMHTYSNGEYINAKVNSLTSIETELPFSYYSLPYCQP  70

Query  400  PGGIKKSAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQRT  564
            PGGIKKSAEN+GELLMGDQIDNSPYRFRMN NETLYLCTT PLNEH VKLLKQRT
Sbjct  71   PGGIKKSAENLGELLMGDQIDNSPYRFRMNKNETLYLCTTAPLNEHEVKLLKQRT  125



>ref|NP_193002.4| endomembrane family protein 70 [Arabidopsis thaliana]
 sp|F4JRE0.1|TMN12_ARATH RecName: Full=Transmembrane 9 superfamily member 12; AltName: 
Full=Endomembrane protein 7; AltName: Full=Transmembrane nine 
protein 12; Short=AtTMN12; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AEE83160.1| endomembrane family protein 70 [Arabidopsis thaliana]
Length=652

 Score =   188 bits (477),  Expect = 3e-52, Method: Composition-based stats.
 Identities = 85/111 (77%), Positives = 92/111 (83%), Gaps = 0/111 (0%)
 Frame = +1

Query  232  FSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGI  411
            F   + +S  C+GFYLPG+YMHTYS  D I  KVNSLTSIETELPFSYY LPYC+P  GI
Sbjct  8    FVLLVFVSQLCNGFYLPGSYMHTYSDGDSIFAKVNSLTSIETELPFSYYSLPYCQPLEGI  67

Query  412  KKSAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQRT  564
            KKSAEN+GELLMGDQIDNS YRFRM  NE+LYLCTT PLNEH VKLLKQRT
Sbjct  68   KKSAENLGELLMGDQIDNSAYRFRMRTNESLYLCTTSPLNEHEVKLLKQRT  118



>ref|XP_006415014.1| hypothetical protein EUTSA_v10024639mg [Eutrema salsugineum]
 gb|ESQ56467.1| hypothetical protein EUTSA_v10024639mg [Eutrema salsugineum]
Length=652

 Score =   187 bits (476),  Expect = 3e-52, Method: Composition-based stats.
 Identities = 84/111 (76%), Positives = 93/111 (84%), Gaps = 0/111 (0%)
 Frame = +1

Query  232  FSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGI  411
            F   + +   C+GFYLPG+YMHTYS  D I+ KVNSLTSIETELPFS+Y LPYC+P  GI
Sbjct  8    FVLLVFVCQLCNGFYLPGSYMHTYSNGDSILAKVNSLTSIETELPFSFYSLPYCKPLEGI  67

Query  412  KKSAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQRT  564
            KKSAEN+GELLMGDQIDNS YRFRMN NE+LYLCTT PLNEH VKLLKQRT
Sbjct  68   KKSAENLGELLMGDQIDNSAYRFRMNTNESLYLCTTSPLNEHEVKLLKQRT  118



>ref|XP_008794697.1| PREDICTED: transmembrane 9 superfamily member 4 [Phoenix dactylifera]
Length=659

 Score =   187 bits (476),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 88/109 (81%), Positives = 97/109 (89%), Gaps = 0/109 (0%)
 Frame = +1

Query  238  YFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKK  417
            +F+LI+   +GFYLPG+YMHTYS  + I VKVNSLTSIETELPFSYY LPYC P GGIKK
Sbjct  17   FFLLITCPSNGFYLPGSYMHTYSQGETIPVKVNSLTSIETELPFSYYSLPYCHPQGGIKK  76

Query  418  SAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQRT  564
            SAEN+GELLMGDQIDNSPY+FRMNVNE+LYLCTT PLNEH VKLLKQRT
Sbjct  77   SAENLGELLMGDQIDNSPYKFRMNVNESLYLCTTKPLNEHEVKLLKQRT  125



>ref|XP_003601479.1| Transmembrane 9 superfamily protein member [Medicago truncatula]
Length=744

 Score =   188 bits (477),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 90/115 (78%), Positives = 97/115 (84%), Gaps = 1/115 (1%)
 Frame = +1

Query  220  YLAAFSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRP  399
            Y   FS F + +   +GFYLPG+YMHTYS  + I  KVNSLTSIETELPFSYY LPYC+P
Sbjct  97   YWVFFS-FTVFAQVSNGFYLPGSYMHTYSNGEYINAKVNSLTSIETELPFSYYSLPYCQP  155

Query  400  PGGIKKSAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQRT  564
            PGGIKKSAEN+GELLMGDQIDNSPYRFRMN NETLYLCTT PLNEH VKLLKQRT
Sbjct  156  PGGIKKSAENLGELLMGDQIDNSPYRFRMNKNETLYLCTTAPLNEHEVKLLKQRT  210



>ref|XP_004139983.1| PREDICTED: transmembrane 9 superfamily member 4-like [Cucumis 
sativus]
 gb|KGN46627.1| hypothetical protein Csa_6G115620 [Cucumis sativus]
Length=659

 Score =   187 bits (476),  Expect = 4e-52, Method: Composition-based stats.
 Identities = 82/108 (76%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = +1

Query  241  FILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKS  420
            F+++++ C  FYLPG+YM+ YS  D I  KVNSLTSIETELPF+YY LPYC+PPGG+KKS
Sbjct  18   FLVLAYHCDAFYLPGSYMNVYSSEDPIFAKVNSLTSIETELPFNYYSLPYCKPPGGVKKS  77

Query  421  AENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQRT  564
            AEN+GELLMGDQIDNSPYRFRMNVNET+YLCTT PLNE  VKLLK RT
Sbjct  78   AENLGELLMGDQIDNSPYRFRMNVNETVYLCTTEPLNEDQVKLLKHRT  125



>ref|XP_004154518.1| PREDICTED: transmembrane 9 superfamily member 4-like [Cucumis 
sativus]
Length=659

 Score =   187 bits (476),  Expect = 4e-52, Method: Composition-based stats.
 Identities = 82/108 (76%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = +1

Query  241  FILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKS  420
            F+++++ C  FYLPG+YM+ YS  D I  KVNSLTSIETELPF+YY LPYC+PPGG+KKS
Sbjct  18   FLVLAYHCDAFYLPGSYMNVYSSEDPIFAKVNSLTSIETELPFNYYSLPYCKPPGGVKKS  77

Query  421  AENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQRT  564
            AEN+GELLMGDQIDNSPYRFRMNVNET+YLCTT PLNE  VKLLK RT
Sbjct  78   AENLGELLMGDQIDNSPYRFRMNVNETVYLCTTEPLNEDQVKLLKHRT  125



>emb|CDY33697.1| BnaC04g29540D [Brassica napus]
Length=667

 Score =   187 bits (475),  Expect = 5e-52, Method: Composition-based stats.
 Identities = 84/117 (72%), Positives = 94/117 (80%), Gaps = 0/117 (0%)
 Frame = +1

Query  214  RRYLAAFSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYC  393
            R+        + ++  C+GFYLPG+YMHTYS  D I  KVNSLTSIETELPFS+Y LPYC
Sbjct  17   RKMYRVIVLLVFVAQLCNGFYLPGSYMHTYSNGDSIFAKVNSLTSIETELPFSFYSLPYC  76

Query  394  RPPGGIKKSAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQRT  564
            +P  GIKKSAEN+GELLMGDQIDNS YRFRMN NE+LYLCTT PLNEH VKLLKQRT
Sbjct  77   KPLEGIKKSAENLGELLMGDQIDNSAYRFRMNTNESLYLCTTSPLNEHEVKLLKQRT  133



>gb|KHN20168.1| Transmembrane 9 superfamily member 4 [Glycine soja]
Length=657

 Score =   187 bits (474),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = +1

Query  265  HGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKSAENVGELL  444
            +GFYLPG+YMHTYS  D I  KVNSLTSIETELP+SYYDLPYC+P GGIKKSAEN+GELL
Sbjct  24   NGFYLPGSYMHTYSNKDLIYAKVNSLTSIETELPYSYYDLPYCQPDGGIKKSAENLGELL  83

Query  445  MGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQRT  564
            MGDQIDNSPYRFRMNVNETLYLCTT PLNEH VKLLKQRT
Sbjct  84   MGDQIDNSPYRFRMNVNETLYLCTTSPLNEHEVKLLKQRT  123



>ref|XP_009390609.1| PREDICTED: transmembrane 9 superfamily member 4-like [Musa acuminata 
subsp. malaccensis]
Length=661

 Score =   186 bits (472),  Expect = 1e-51, Method: Composition-based stats.
 Identities = 85/111 (77%), Positives = 95/111 (86%), Gaps = 0/111 (0%)
 Frame = +1

Query  232  FSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGI  411
            FS  +L+  + + FYLPG+YMHTYS  + I VKVNSLTSIETELPF YY LPYC+P  GI
Sbjct  18   FSIVLLLCGSGNAFYLPGSYMHTYSEGENIWVKVNSLTSIETELPFGYYTLPYCQPQSGI  77

Query  412  KKSAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQRT  564
            KKSAEN+GELLMGDQIDNSPYRFR+NVNE+LYLCTT PLNEH VKLLKQRT
Sbjct  78   KKSAENLGELLMGDQIDNSPYRFRVNVNESLYLCTTKPLNEHEVKLLKQRT  128



>gb|EMS64413.1| Transmembrane 9 superfamily member 4 [Triticum urartu]
Length=655

 Score =   185 bits (469),  Expect = 4e-51, Method: Composition-based stats.
 Identities = 83/115 (72%), Positives = 96/115 (83%), Gaps = 0/115 (0%)
 Frame = +1

Query  220  YLAAFSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRP  399
            + A    F++++ AC  FYLPG+YMHTY   ++I  KVNSLTSIETELPFSYY LPYCRP
Sbjct  7    FSALLVLFLVMAPACEAFYLPGSYMHTYRQGEEIGAKVNSLTSIETELPFSYYSLPYCRP  66

Query  400  PGGIKKSAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQRT  564
             GGIKKSAEN+GELLMGDQIDNSPYRF +NVNE+LYLCTT PL+E  VKLLKQR+
Sbjct  67   KGGIKKSAENLGELLMGDQIDNSPYRFHVNVNESLYLCTTSPLDEDDVKLLKQRS  121



>ref|XP_006857592.1| hypothetical protein AMTR_s00061p00090590 [Amborella trichopoda]
 gb|ERN19059.1| hypothetical protein AMTR_s00061p00090590 [Amborella trichopoda]
Length=653

 Score =   184 bits (468),  Expect = 5e-51, Method: Composition-based stats.
 Identities = 87/115 (76%), Positives = 99/115 (86%), Gaps = 3/115 (3%)
 Frame = +1

Query  229  AFSYFIL-ISHAC--HGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRP  399
            A S FIL IS+AC  +GFYLPG+YMHTYS  D ++VKVNSLTSIETELPFSYY LPYC P
Sbjct  7    AHSVFILFISYACLCNGFYLPGSYMHTYSKGDDLLVKVNSLTSIETELPFSYYSLPYCTP  66

Query  400  PGGIKKSAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQRT  564
              G+KKSAEN+GELLMGDQIDNSPYRFRM+ NE+++LCTT PL EH VK+LKQRT
Sbjct  67   QKGVKKSAENLGELLMGDQIDNSPYRFRMSKNESIFLCTTKPLTEHEVKVLKQRT  121



>gb|EMT19888.1| Transmembrane 9 superfamily member 4 [Aegilops tauschii]
Length=657

 Score =   184 bits (468),  Expect = 5e-51, Method: Composition-based stats.
 Identities = 82/107 (77%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = +1

Query  244  ILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKSA  423
            ++++ AC  FYLPG+YMHTY   ++I  KVNSLTSIETELPFSYY LPYCRP GGIKKSA
Sbjct  15   LVMAPACEAFYLPGSYMHTYRQGEEIGAKVNSLTSIETELPFSYYSLPYCRPKGGIKKSA  74

Query  424  ENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQRT  564
            EN+GELLMGDQIDNSPYRFR+NVNE+LYLCTT PL+E  VKLLKQR+
Sbjct  75   ENLGELLMGDQIDNSPYRFRVNVNESLYLCTTSPLDEDDVKLLKQRS  121



>ref|XP_006283293.1| hypothetical protein CARUB_v10004331mg [Capsella rubella]
 gb|EOA16191.1| hypothetical protein CARUB_v10004331mg [Capsella rubella]
Length=652

 Score =   184 bits (468),  Expect = 5e-51, Method: Composition-based stats.
 Identities = 83/111 (75%), Positives = 90/111 (81%), Gaps = 0/111 (0%)
 Frame = +1

Query  232  FSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGI  411
            F   + +S  C+GFYLPG+YMHTYS  D I  KVNSLTSIETELPF YY LPYC P  GI
Sbjct  8    FVLLVFVSQLCNGFYLPGSYMHTYSDGDSIFAKVNSLTSIETELPFGYYSLPYCEPLEGI  67

Query  412  KKSAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQRT  564
            KKSAEN+GELLMGDQIDNS YRFRM  NE+L+LCTT PLNEH VKLLKQRT
Sbjct  68   KKSAENLGELLMGDQIDNSAYRFRMRTNESLFLCTTSPLNEHEVKLLKQRT  118



>ref|XP_010689494.1| PREDICTED: transmembrane 9 superfamily member 12 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010689495.1| PREDICTED: transmembrane 9 superfamily member 12 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010689496.1| PREDICTED: transmembrane 9 superfamily member 12 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010689497.1| PREDICTED: transmembrane 9 superfamily member 12 [Beta vulgaris 
subsp. vulgaris]
Length=659

 Score =   184 bits (467),  Expect = 6e-51, Method: Composition-based stats.
 Identities = 84/111 (76%), Positives = 92/111 (83%), Gaps = 1/111 (1%)
 Frame = +1

Query  232  FSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGI  411
             S F+ +   C GFYLPGTYMHTYS  D+I  KVNSLTSIETELPFSYY LPYCRP  G+
Sbjct  16   LSLFVFLC-VCDGFYLPGTYMHTYSNGDEIYAKVNSLTSIETELPFSYYSLPYCRPHDGV  74

Query  412  KKSAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQRT  564
            KKSAEN+GELLMGDQIDNSPYRF+MNVNET++LC T PL E  VKLLKQRT
Sbjct  75   KKSAENLGELLMGDQIDNSPYRFQMNVNETVFLCITSPLTEQEVKLLKQRT  125



>ref|XP_010496356.1| PREDICTED: transmembrane 9 superfamily member 4-like isoform 
X2 [Camelina sativa]
Length=664

 Score =   184 bits (466),  Expect = 8e-51, Method: Composition-based stats.
 Identities = 83/112 (74%), Positives = 92/112 (82%), Gaps = 0/112 (0%)
 Frame = +1

Query  229  AFSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGG  408
            AF   + ++  C+GFYLPG+YMHTYS  D I  KVNSLTSIETELPFS+Y LPYC P  G
Sbjct  7    AFVLLVFVTQLCNGFYLPGSYMHTYSDGDSIFAKVNSLTSIETELPFSFYSLPYCPPLEG  66

Query  409  IKKSAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQRT  564
            IKKSAEN+GELLMGDQID+S YRFRM  NE+LYLCTT PLNEH VKLLKQRT
Sbjct  67   IKKSAENLGELLMGDQIDSSAYRFRMRTNESLYLCTTSPLNEHEVKLLKQRT  118



>ref|NP_001047965.1| Os02g0722300 [Oryza sativa Japonica Group]
 dbj|BAD13014.1| putative endomembrane protein [Oryza sativa Japonica Group]
 dbj|BAF09879.1| Os02g0722300 [Oryza sativa Japonica Group]
 dbj|BAG89294.1| unnamed protein product [Oryza sativa Japonica Group]
Length=653

 Score =   184 bits (466),  Expect = 9e-51, Method: Composition-based stats.
 Identities = 83/117 (71%), Positives = 96/117 (82%), Gaps = 0/117 (0%)
 Frame = +1

Query  214  RRYLAAFSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYC  393
            R + A    F++++  C  FYLPG+YMHTY   ++I  KVNSLTSIETELPFSYY LPYC
Sbjct  5    RIFSALLMVFLVLAPHCEAFYLPGSYMHTYRQGEEIWAKVNSLTSIETELPFSYYSLPYC  64

Query  394  RPPGGIKKSAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQRT  564
             P GGIKKSAEN+GELLMGDQIDNSPYRFR+NVNE+LYLCTT PL+E  VKLLKQR+
Sbjct  65   HPQGGIKKSAENLGELLMGDQIDNSPYRFRVNVNESLYLCTTNPLDEADVKLLKQRS  121



>ref|XP_010496353.1| PREDICTED: transmembrane 9 superfamily member 4-like isoform 
X1 [Camelina sativa]
Length=652

 Score =   184 bits (466),  Expect = 9e-51, Method: Composition-based stats.
 Identities = 83/112 (74%), Positives = 92/112 (82%), Gaps = 0/112 (0%)
 Frame = +1

Query  229  AFSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGG  408
            AF   + ++  C+GFYLPG+YMHTYS  D I  KVNSLTSIETELPFS+Y LPYC P  G
Sbjct  7    AFVLLVFVTQLCNGFYLPGSYMHTYSDGDSIFAKVNSLTSIETELPFSFYSLPYCPPLEG  66

Query  409  IKKSAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQRT  564
            IKKSAEN+GELLMGDQID+S YRFRM  NE+LYLCTT PLNEH VKLLKQRT
Sbjct  67   IKKSAENLGELLMGDQIDSSAYRFRMRTNESLYLCTTSPLNEHEVKLLKQRT  118



>ref|XP_010036099.1| PREDICTED: transmembrane 9 superfamily member 4 [Eucalyptus grandis]
 ref|XP_010036100.1| PREDICTED: transmembrane 9 superfamily member 4 [Eucalyptus grandis]
 ref|XP_010036101.1| PREDICTED: transmembrane 9 superfamily member 4 [Eucalyptus grandis]
 gb|KCW47620.1| hypothetical protein EUGRSUZ_K01364 [Eucalyptus grandis]
Length=660

 Score =   183 bits (465),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 82/103 (80%), Positives = 91/103 (88%), Gaps = 0/103 (0%)
 Frame = +1

Query  256  HACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKSAENVG  435
            H C GFYLPG+YMHTYS  D+I  KVNSLTSIETELPFSYY LPYC+PP G+KKSAEN+G
Sbjct  23   HVCSGFYLPGSYMHTYSTHDKIFAKVNSLTSIETELPFSYYSLPYCQPPEGVKKSAENLG  82

Query  436  ELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQRT  564
            ELLMGDQIDNSPYRF+MN+NET+YLCTT  L +H VKLLKQRT
Sbjct  83   ELLMGDQIDNSPYRFQMNINETVYLCTTVALKDHQVKLLKQRT  125



>gb|KDO51059.1| hypothetical protein CISIN_1g006214mg [Citrus sinensis]
Length=656

 Score =   182 bits (463),  Expect = 2e-50, Method: Composition-based stats.
 Identities = 83/114 (73%), Positives = 95/114 (83%), Gaps = 0/114 (0%)
 Frame = +1

Query  223  LAAFSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPP  402
            L AF + +L    C+GFYLPG+YMHTYS  + I  KVNSLTSIETELPFSYY LPYC+P 
Sbjct  9    LWAFLFAVLFGQVCNGFYLPGSYMHTYSNGEAIYTKVNSLTSIETELPFSYYSLPYCKPL  68

Query  403  GGIKKSAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQRT  564
             G+KKSAEN+GELLMGDQIDNSPYRFR+N NETL+LC T PL+E+ VKLLKQRT
Sbjct  69   RGVKKSAENLGELLMGDQIDNSPYRFRINKNETLFLCITTPLSENEVKLLKQRT  122



>ref|XP_008448144.1| PREDICTED: transmembrane 9 superfamily member 4 [Cucumis melo]
Length=658

 Score =   182 bits (463),  Expect = 2e-50, Method: Composition-based stats.
 Identities = 81/111 (73%), Positives = 94/111 (85%), Gaps = 0/111 (0%)
 Frame = +1

Query  232  FSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGI  411
            F  F+++++ C  FYLPG+YM+ YS  D I  KVNSLTSIETELPF+YY LPYC+P GG+
Sbjct  14   FLVFLVLAYHCDAFYLPGSYMNVYSSEDPIFAKVNSLTSIETELPFNYYSLPYCKPRGGV  73

Query  412  KKSAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQRT  564
            KKSAEN+GELLMGDQIDNSPYRFRMNVNET+YLCTT PL+E  VKLLK RT
Sbjct  74   KKSAENLGELLMGDQIDNSPYRFRMNVNETVYLCTTEPLSEDQVKLLKHRT  124



>gb|EAY87338.1| hypothetical protein OsI_08741 [Oryza sativa Indica Group]
Length=489

 Score =   180 bits (457),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 96/117 (82%), Gaps = 0/117 (0%)
 Frame = +1

Query  214  RRYLAAFSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYC  393
            R + A    F++++  C  FYLPG+YMHTY   ++I  KVNSLTSIETELPFSYY LPYC
Sbjct  5    RIFSALLMVFLVLAPHCEAFYLPGSYMHTYRQGEEIWAKVNSLTSIETELPFSYYSLPYC  64

Query  394  RPPGGIKKSAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQRT  564
             P GGIKKSAEN+GELLMGDQIDNSPYRFR+NVNE+LYLCTT PL+E  VKLLKQR+
Sbjct  65   HPQGGIKKSAENLGELLMGDQIDNSPYRFRVNVNESLYLCTTNPLDEADVKLLKQRS  121



>ref|XP_006447881.1| hypothetical protein CICLE_v10014540mg [Citrus clementina]
 ref|XP_006469390.1| PREDICTED: transmembrane 9 superfamily member 4-like [Citrus 
sinensis]
 gb|ESR61121.1| hypothetical protein CICLE_v10014540mg [Citrus clementina]
Length=656

 Score =   182 bits (461),  Expect = 4e-50, Method: Composition-based stats.
 Identities = 83/114 (73%), Positives = 95/114 (83%), Gaps = 0/114 (0%)
 Frame = +1

Query  223  LAAFSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPP  402
            L AF + +L    C+GFYLPG+YMHTYS  + I  KVNSLTSIETELPFSYY LPYC+P 
Sbjct  9    LWAFLFAVLFGQVCNGFYLPGSYMHTYSNGEPIDTKVNSLTSIETELPFSYYSLPYCKPL  68

Query  403  GGIKKSAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQRT  564
             G+KKSAEN+GELLMGDQIDNSPYRFR+N NETL+LC T PL+E+ VKLLKQRT
Sbjct  69   RGVKKSAENLGELLMGDQIDNSPYRFRINKNETLFLCITTPLSENEVKLLKQRT  122



>ref|XP_007146096.1| hypothetical protein PHAVU_006G012200g [Phaseolus vulgaris]
 gb|ESW18090.1| hypothetical protein PHAVU_006G012200g [Phaseolus vulgaris]
Length=657

 Score =   181 bits (459),  Expect = 7e-50, Method: Composition-based stats.
 Identities = 84/111 (76%), Positives = 92/111 (83%), Gaps = 0/111 (0%)
 Frame = +1

Query  232  FSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGI  411
            F   ++ +   +GFYLPG+YM TYS    I  KVNSLTSIETELPFSYY LPYC P GGI
Sbjct  13   FLSVMVFAQVANGFYLPGSYMITYSNKSPIFAKVNSLTSIETELPFSYYSLPYCPPVGGI  72

Query  412  KKSAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQRT  564
            KKSAEN+GELLMGDQIDNSPYRF+MNVNET+YLCTT PLNEH VKLLKQRT
Sbjct  73   KKSAENLGELLMGDQIDNSPYRFQMNVNETVYLCTTSPLNEHEVKLLKQRT  123



>ref|XP_006647811.1| PREDICTED: transmembrane 9 superfamily member 4-like [Oryza brachyantha]
Length=653

 Score =   181 bits (459),  Expect = 8e-50, Method: Composition-based stats.
 Identities = 82/115 (71%), Positives = 95/115 (83%), Gaps = 0/115 (0%)
 Frame = +1

Query  220  YLAAFSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRP  399
            + A    F+++S  C  FYLPG+YMHTY   ++I  KVNSLTSIETELPFSYY LPYC+P
Sbjct  7    FSALLVVFLVLSPHCKAFYLPGSYMHTYRQGEEIWAKVNSLTSIETELPFSYYSLPYCQP  66

Query  400  PGGIKKSAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQRT  564
              GIKKSAEN+GELLMGDQIDNSPYRFR+NVNE+LYLCTT PL+E  VKLLKQR+
Sbjct  67   QDGIKKSAENLGELLMGDQIDNSPYRFRVNVNESLYLCTTNPLDEGDVKLLKQRS  121



>ref|XP_008380040.1| PREDICTED: putative phagocytic receptor 1a [Malus domestica]
Length=659

 Score =   180 bits (456),  Expect = 2e-49, Method: Composition-based stats.
 Identities = 81/112 (72%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +1

Query  229  AFSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGG  408
            A    ++  H C+GFYLPG+YMHTY+   +I  KVNSLTSIETELPFSYY LPYC+PP G
Sbjct  14   ALLVLVVFVHTCNGFYLPGSYMHTYAKGQEITTKVNSLTSIETELPFSYYSLPYCKPPEG  73

Query  409  IKKSAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQRT  564
            IKKSAEN+GELLMGD+I+NS YRF MNVNET YLCTT  L EH VKLLKQRT
Sbjct  74   IKKSAENLGELLMGDEIENSAYRFNMNVNETRYLCTTDXLTEHDVKLLKQRT  125



>ref|XP_004953733.1| PREDICTED: transmembrane 9 superfamily member 4-like [Setaria 
italica]
Length=669

 Score =   179 bits (455),  Expect = 3e-49, Method: Composition-based stats.
 Identities = 81/108 (75%), Positives = 91/108 (84%), Gaps = 0/108 (0%)
 Frame = +1

Query  241  FILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKS  420
            F++ +  C  FYLPG+YMHTY   ++I  KVNSLTSIETELPFSYY LPYCRP  GIKKS
Sbjct  30   FLVFAPPCGAFYLPGSYMHTYRQGEEIGAKVNSLTSIETELPFSYYSLPYCRPKDGIKKS  89

Query  421  AENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQRT  564
            AEN+GELLMGDQIDNSPYRFR+NVNE+LYLCTT PL E  VKLLKQR+
Sbjct  90   AENLGELLMGDQIDNSPYRFRVNVNESLYLCTTNPLGEADVKLLKQRS  137



>ref|NP_001062138.1| Os08g0496900 [Oryza sativa Japonica Group]
 dbj|BAA81763.1| putative transmembrane 9 superfamily protein member 2 precursor 
[Oryza sativa Japonica Group]
 dbj|BAD10135.1| putative transmembrane 9 superfamily protein member 2 precursor 
[Oryza sativa Japonica Group]
 dbj|BAF24052.1| Os08g0496900 [Oryza sativa Japonica Group]
Length=661

 Score =   179 bits (453),  Expect = 5e-49, Method: Composition-based stats.
 Identities = 80/100 (80%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +1

Query  265  HGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKSAENVGELL  444
            + FYLPG+YMHTYS  ++I  KVNSLTSIETE+PFSYY LPYCRP GGIKKSAEN+GELL
Sbjct  27   NAFYLPGSYMHTYSQGEEIWAKVNSLTSIETEMPFSYYSLPYCRPQGGIKKSAENLGELL  86

Query  445  MGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQRT  564
            MGDQIDNSPYRFR+NVNE+LYLCTT  LNE+  KLLKQRT
Sbjct  87   MGDQIDNSPYRFRVNVNESLYLCTTKGLNENDAKLLKQRT  126



>ref|NP_001151523.1| transmembrane 9 superfamily protein member 4 precursor [Zea mays]
 gb|ACG43169.1| transmembrane 9 superfamily protein member 4 [Zea mays]
Length=653

 Score =   178 bits (452),  Expect = 6e-49, Method: Composition-based stats.
 Identities = 81/115 (70%), Positives = 93/115 (81%), Gaps = 0/115 (0%)
 Frame = +1

Query  220  YLAAFSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRP  399
            + A    F+  +  C  FYLPG+YMHTY   + I  KVNSLTSIETELPFSYY LPYCRP
Sbjct  7    FSALLVVFLAFTTPCESFYLPGSYMHTYQQGEVIRAKVNSLTSIETELPFSYYSLPYCRP  66

Query  400  PGGIKKSAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQRT  564
              G+KKSAEN+GELLMGDQIDNSPYRFR+NVNE+LYLCTT PL+E +VKLLKQR+
Sbjct  67   RDGVKKSAENLGELLMGDQIDNSPYRFRVNVNESLYLCTTTPLDEANVKLLKQRS  121



>gb|AET01036.2| transmembrane 9 family protein [Medicago truncatula]
Length=665

 Score =   178 bits (452),  Expect = 7e-49, Method: Composition-based stats.
 Identities = 82/108 (76%), Positives = 92/108 (85%), Gaps = 1/108 (1%)
 Frame = +1

Query  241  FILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKS  420
            F+ IS + +GFYLPG+YMHTY+  D I  KVNSLTSIETELPF YY LPYC+P GGIKKS
Sbjct  25   FVQISKS-NGFYLPGSYMHTYANGDPIYAKVNSLTSIETELPFGYYSLPYCQPLGGIKKS  83

Query  421  AENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQRT  564
            AEN+GELLMGDQIDNSPY F+MNVN++ YLCTT PLNEH VKL KQRT
Sbjct  84   AENLGELLMGDQIDNSPYLFKMNVNQSSYLCTTAPLNEHEVKLFKQRT  131



>ref|XP_003618077.1| Transmembrane 9 superfamily protein member [Medicago truncatula]
Length=663

 Score =   178 bits (452),  Expect = 7e-49, Method: Composition-based stats.
 Identities = 82/108 (76%), Positives = 92/108 (85%), Gaps = 1/108 (1%)
 Frame = +1

Query  241  FILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKS  420
            F+ IS + +GFYLPG+YMHTY+  D I  KVNSLTSIETELPF YY LPYC+P GGIKKS
Sbjct  23   FVQISKS-NGFYLPGSYMHTYANGDPIYAKVNSLTSIETELPFGYYSLPYCQPLGGIKKS  81

Query  421  AENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQRT  564
            AEN+GELLMGDQIDNSPY F+MNVN++ YLCTT PLNEH VKL KQRT
Sbjct  82   AENLGELLMGDQIDNSPYLFKMNVNQSSYLCTTAPLNEHEVKLFKQRT  129



>gb|AFW73187.1| transmembrane 9 family protein member 4 [Zea mays]
Length=653

 Score =   178 bits (452),  Expect = 7e-49, Method: Composition-based stats.
 Identities = 81/115 (70%), Positives = 93/115 (81%), Gaps = 0/115 (0%)
 Frame = +1

Query  220  YLAAFSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRP  399
            + A    F+  +  C  FYLPG+YMHTY   + I  KVNSLTSIETELPFSYY LPYCRP
Sbjct  7    FSALLVVFLAFTTPCESFYLPGSYMHTYQQGEVIRAKVNSLTSIETELPFSYYSLPYCRP  66

Query  400  PGGIKKSAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQRT  564
              G+KKSAEN+GELLMGDQIDNSPYRFR+NVNE+LYLCTT PL+E +VKLLKQR+
Sbjct  67   RDGVKKSAENLGELLMGDQIDNSPYRFRVNVNESLYLCTTTPLDEANVKLLKQRS  121



>gb|KHN34478.1| Transmembrane 9 superfamily member 4 [Glycine soja]
Length=657

 Score =   178 bits (451),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 83/112 (74%), Positives = 93/112 (83%), Gaps = 0/112 (0%)
 Frame = +1

Query  229  AFSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGG  408
             F + I+ +   + FYLPG+YMHTYS  D I  KVNSLTSIETELP++YY LPYC+P GG
Sbjct  12   VFLFVIVFAQVVNAFYLPGSYMHTYSNKDLIYAKVNSLTSIETELPYNYYSLPYCQPDGG  71

Query  409  IKKSAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQRT  564
            IKKSAEN+GELLMGDQIDNSPYRF+MNVNETLYLCTT  LNEH VKLLKQR 
Sbjct  72   IKKSAENLGELLMGDQIDNSPYRFQMNVNETLYLCTTPLLNEHEVKLLKQRA  123



>gb|EMS48782.1| Transmembrane 9 superfamily member 4 [Triticum urartu]
Length=612

 Score =   177 bits (450),  Expect = 9e-49, Method: Composition-based stats.
 Identities = 79/99 (80%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = +1

Query  265  HGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKSAENVGELL  444
            + FYLPG+YMHTYS  + I  KVNSLTSIETE+PFSYY LPYCRPPGGIKKSAEN+GELL
Sbjct  26   NAFYLPGSYMHTYSQGENIWAKVNSLTSIETEMPFSYYSLPYCRPPGGIKKSAENLGELL  85

Query  445  MGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQR  561
            MGDQIDNSPYRFR+NVNE+L+LCTT  LNE+  KLLKQR
Sbjct  86   MGDQIDNSPYRFRVNVNESLFLCTTKGLNENDAKLLKQR  124



>gb|EEE62472.1| hypothetical protein OsJ_17269 [Oryza sativa Japonica Group]
Length=652

 Score =   178 bits (451),  Expect = 1e-48, Method: Composition-based stats.
 Identities = 78/117 (67%), Positives = 98/117 (84%), Gaps = 2/117 (2%)
 Frame = +1

Query  217  RYLAAFSYFILIS--HACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPY  390
            R++ A+   +L+S     +GFYLPGT+MHTY+P++ I  KVNSLTSIETELPFSYY LPY
Sbjct  5    RWILAYLLVVLVSLHGGANGFYLPGTFMHTYTPNEVISAKVNSLTSIETELPFSYYSLPY  64

Query  391  CRPPGGIKKSAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQR  561
            C+PP G+KKSAEN+GE+LMGDQIDNSPYRFR+NVNE++YLCTT PL +   +LLK+R
Sbjct  65   CKPPEGVKKSAENLGEILMGDQIDNSPYRFRVNVNESVYLCTTDPLTKEQAELLKKR  121



>ref|NP_001054755.1| Os05g0168500 [Oryza sativa Japonica Group]
 gb|AAV25243.1| putative transmembrane protein [Oryza sativa Japonica Group]
 dbj|BAF16669.1| Os05g0168500 [Oryza sativa Japonica Group]
 dbj|BAG94733.1| unnamed protein product [Oryza sativa Japonica Group]
Length=656

 Score =   178 bits (451),  Expect = 1e-48, Method: Composition-based stats.
 Identities = 78/117 (67%), Positives = 98/117 (84%), Gaps = 2/117 (2%)
 Frame = +1

Query  217  RYLAAFSYFILIS--HACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPY  390
            R++ A+   +L+S     +GFYLPGT+MHTY+P++ I  KVNSLTSIETELPFSYY LPY
Sbjct  9    RWILAYLLVVLVSLHGGANGFYLPGTFMHTYTPNEVISAKVNSLTSIETELPFSYYSLPY  68

Query  391  CRPPGGIKKSAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQR  561
            C+PP G+KKSAEN+GE+LMGDQIDNSPYRFR+NVNE++YLCTT PL +   +LLK+R
Sbjct  69   CKPPEGVKKSAENLGEILMGDQIDNSPYRFRVNVNESVYLCTTDPLTKEQAELLKKR  125



>gb|EMT07832.1| Transmembrane 9 superfamily member 4 [Aegilops tauschii]
Length=661

 Score =   178 bits (451),  Expect = 1e-48, Method: Composition-based stats.
 Identities = 79/99 (80%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = +1

Query  265  HGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKSAENVGELL  444
            + FYLPG+YMHTYS  + I  KVNSLTSIETE+PFSYY LPYCRPPGGIKKSAEN+GELL
Sbjct  27   NAFYLPGSYMHTYSQGEDIWAKVNSLTSIETEMPFSYYSLPYCRPPGGIKKSAENLGELL  86

Query  445  MGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQR  561
            MGDQIDNSPYRFR+NVNE+L+LCTT  LNE+  KLLKQR
Sbjct  87   MGDQIDNSPYRFRVNVNESLFLCTTKGLNENDAKLLKQR  125



>ref|XP_003541265.1| PREDICTED: transmembrane 9 superfamily member 4-like [Glycine 
max]
Length=657

 Score =   177 bits (450),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 82/112 (73%), Positives = 93/112 (83%), Gaps = 0/112 (0%)
 Frame = +1

Query  229  AFSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGG  408
             F + ++ +   + FYLPG+YMHTYS  D I  KVNSLTSIETELP++YY LPYC+P GG
Sbjct  12   VFLFVVVFAQVVNAFYLPGSYMHTYSNKDLIYAKVNSLTSIETELPYNYYSLPYCQPDGG  71

Query  409  IKKSAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQRT  564
            IKKSAEN+GELLMGDQIDNSPYRF+MNVNETLYLCTT  LNEH VKLLKQR 
Sbjct  72   IKKSAENLGELLMGDQIDNSPYRFQMNVNETLYLCTTPLLNEHEVKLLKQRA  123



>gb|EEE57708.1| hypothetical protein OsJ_08189 [Oryza sativa Japonica Group]
Length=1010

 Score =   180 bits (456),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 96/117 (82%), Gaps = 0/117 (0%)
 Frame = +1

Query  214  RRYLAAFSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYC  393
            R + A    F++++  C  FYLPG+YMHTY   ++I  KVNSLTSIETELPFSYY LPYC
Sbjct  428  RIFSALLMVFLVLAPHCEAFYLPGSYMHTYRQGEEIWAKVNSLTSIETELPFSYYSLPYC  487

Query  394  RPPGGIKKSAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQRT  564
             P GGIKKSAEN+GELLMGDQIDNSPYRFR+NVNE+LYLCTT PL+E  VKLLKQR+
Sbjct  488  HPQGGIKKSAENLGELLMGDQIDNSPYRFRVNVNESLYLCTTNPLDEADVKLLKQRS  544



>ref|XP_004953734.1| PREDICTED: transmembrane 9 superfamily member 4-like [Setaria 
italica]
Length=656

 Score =   177 bits (450),  Expect = 2e-48, Method: Composition-based stats.
 Identities = 76/101 (75%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = +1

Query  259  ACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKSAENVGE  438
            A H FYLPGT+MHTYSP + I  KVNSLTSIETELPFSYY LPYC+PP G+KKSAEN+GE
Sbjct  25   AVHAFYLPGTFMHTYSPGEAISAKVNSLTSIETELPFSYYSLPYCKPPEGVKKSAENLGE  84

Query  439  LLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQR  561
            +LMGDQIDNSPYRFR+NVNE++YLCTT PL +   +LLK+R
Sbjct  85   ILMGDQIDNSPYRFRVNVNESVYLCTTDPLTKEQAELLKKR  125



>ref|XP_006659537.1| PREDICTED: transmembrane 9 superfamily member 4-like [Oryza brachyantha]
Length=661

 Score =   177 bits (449),  Expect = 2e-48, Method: Composition-based stats.
 Identities = 79/100 (79%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +1

Query  265  HGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKSAENVGELL  444
            + FYLPG+YMHTYS  ++I  KVNSLTSIETE+PFSYY LPYCRP GGIKKSAEN+GELL
Sbjct  27   NAFYLPGSYMHTYSQGEEIWAKVNSLTSIETEMPFSYYSLPYCRPQGGIKKSAENLGELL  86

Query  445  MGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQRT  564
            MGDQIDNSPY+FR+NVNE+LYLCTT  LNE+  KLLKQRT
Sbjct  87   MGDQIDNSPYKFRVNVNESLYLCTTKGLNENDTKLLKQRT  126



>gb|EEC78593.1| hypothetical protein OsI_18611 [Oryza sativa Indica Group]
Length=656

 Score =   176 bits (447),  Expect = 4e-48, Method: Composition-based stats.
 Identities = 78/118 (66%), Positives = 98/118 (83%), Gaps = 2/118 (2%)
 Frame = +1

Query  214  RRYLAAFSYFILIS--HACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLP  387
            RR++ A+   +L+S     +GFYLPGT+MHTY+P++ I  KVNSLTSIETELPFSYY LP
Sbjct  8    RRWILAYLLVVLVSLHGGANGFYLPGTFMHTYTPNEVISAKVNSLTSIETELPFSYYSLP  67

Query  388  YCRPPGGIKKSAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQR  561
            YC+P  G+KKSAEN+GE+LMGDQIDNSPYRFR+NVNE++YLCTT PL +   +LLK+R
Sbjct  68   YCKPLEGVKKSAENLGEILMGDQIDNSPYRFRVNVNESVYLCTTDPLTKEQAELLKKR  125



>ref|XP_004491628.1| PREDICTED: transmembrane 9 superfamily member 4-like [Cicer arietinum]
Length=664

 Score =   175 bits (443),  Expect = 1e-47, Method: Composition-based stats.
 Identities = 83/111 (75%), Positives = 91/111 (82%), Gaps = 1/111 (1%)
 Frame = +1

Query  232  FSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGI  411
            F  F+ I    + FYLPG+YMHTYS  D I  KVNSLTSIETELPFSYY LPYC+P GGI
Sbjct  21   FVAFVQI-QITNAFYLPGSYMHTYSNGDPIYAKVNSLTSIETELPFSYYSLPYCQPLGGI  79

Query  412  KKSAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQRT  564
            KKSAEN+GELLMGDQIDNSPY FRMNVN+++YLCTT  L EH VKLLKQRT
Sbjct  80   KKSAENLGELLMGDQIDNSPYLFRMNVNQSIYLCTTTSLKEHEVKLLKQRT  130



>ref|XP_002444820.1| hypothetical protein SORBIDRAFT_07g028570 [Sorghum bicolor]
 gb|EES14315.1| hypothetical protein SORBIDRAFT_07g028570 [Sorghum bicolor]
Length=719

 Score =   173 bits (439),  Expect = 5e-47, Method: Composition-based stats.
 Identities = 77/99 (78%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = +1

Query  268  GFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKSAENVGELLM  447
             FYLPG+YMHTYS  + I  KVNSLTSIETE+PF+YY LPYCRP GGIKKSAEN+GELLM
Sbjct  86   AFYLPGSYMHTYSQGELIFAKVNSLTSIETEMPFNYYSLPYCRPQGGIKKSAENLGELLM  145

Query  448  GDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQRT  564
            GDQIDNSPYRFR+NVNE+++LCTT  LNE+  KLLKQRT
Sbjct  146  GDQIDNSPYRFRVNVNESVFLCTTKGLNENDAKLLKQRT  184



>ref|XP_008368541.1| PREDICTED: transmembrane 9 superfamily member 4-like [Malus domestica]
Length=659

 Score =   172 bits (437),  Expect = 7e-47, Method: Composition-based stats.
 Identities = 77/112 (69%), Positives = 90/112 (80%), Gaps = 0/112 (0%)
 Frame = +1

Query  229  AFSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGG  408
            A    ++  H C+GFYLPG+YMH YS   +II  VNSLTSI T LPFSYY LPYC+PPGG
Sbjct  14   ALLVLVVFVHTCNGFYLPGSYMHXYSTGQEIITXVNSLTSIGTGLPFSYYSLPYCKPPGG  73

Query  409  IKKSAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQRT  564
            IKKSAEN+GELLMGD+I+ S Y F+MN+NETLY+CTT PL +H VKLLKQRT
Sbjct  74   IKKSAENLGELLMGDEIETSAYLFKMNMNETLYVCTTPPLTKHDVKLLKQRT  125



>ref|XP_008353620.1| PREDICTED: putative phagocytic receptor 1a [Malus domestica]
Length=664

 Score =   172 bits (437),  Expect = 7e-47, Method: Composition-based stats.
 Identities = 77/112 (69%), Positives = 90/112 (80%), Gaps = 0/112 (0%)
 Frame = +1

Query  229  AFSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGG  408
            A    ++  H C+GFYLPG+YMH YS   +II  VNSLTSI T LPFSYY LPYC+PPGG
Sbjct  14   ALLVLVVFVHTCNGFYLPGSYMHXYSTGQEIITXVNSLTSIGTGLPFSYYSLPYCKPPGG  73

Query  409  IKKSAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQRT  564
            IKKSAEN+GELLMGD+I+ S Y F+MN+NETLY+CTT PL +H VKLLKQRT
Sbjct  74   IKKSAENLGELLMGDEIETSAYLFKMNMNETLYVCTTPPLTKHDVKLLKQRT  125



>ref|XP_006647311.1| PREDICTED: transmembrane 9 superfamily member 4-like [Oryza brachyantha]
Length=656

 Score =   170 bits (431),  Expect = 5e-46, Method: Composition-based stats.
 Identities = 73/99 (74%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = +1

Query  265  HGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKSAENVGELL  444
            + FYLPGT+MHTYSP + I  KVNSLTSIETELPFSYY LPYC+PP G+KKSAEN+GE+L
Sbjct  27   NAFYLPGTFMHTYSPGEAISAKVNSLTSIETELPFSYYSLPYCKPPEGVKKSAENLGEIL  86

Query  445  MGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQR  561
            MGDQIDNSPYRFR+N NE++YLCTT PL +   +LLK+R
Sbjct  87   MGDQIDNSPYRFRVNENESVYLCTTDPLTKEQAELLKKR  125



>gb|EPS61503.1| hypothetical protein M569_13294 [Genlisea aurea]
Length=659

 Score =   169 bits (429),  Expect = 1e-45, Method: Composition-based stats.
 Identities = 78/117 (67%), Positives = 93/117 (79%), Gaps = 0/117 (0%)
 Frame = +1

Query  214  RRYLAAFSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYC  393
            R+  +A   +I +  AC GFYLPG+Y+HTYS  ++I  KVNSLTSIETELPFSYY LPYC
Sbjct  9    RKLSSALVCWIFLFQACSGFYLPGSYLHTYSTRNEIYAKVNSLTSIETELPFSYYSLPYC  68

Query  394  RPPGGIKKSAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQRT  564
             P   IKKS EN+GELLMGDQI NSPYRFRMN+NE+LYLCTT PL++   ++LKQRT
Sbjct  69   EPIDNIKKSVENLGELLMGDQIFNSPYRFRMNLNESLYLCTTHPLSKLQAEILKQRT  125



>ref|XP_008663085.1| PREDICTED: transmembrane 9 superfamily member 4 [Zea mays]
 tpg|DAA47831.1| TPA: hypothetical protein ZEAMMB73_339674 [Zea mays]
Length=662

 Score =   169 bits (429),  Expect = 1e-45, Method: Composition-based stats.
 Identities = 76/99 (77%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = +1

Query  268  GFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKSAENVGELLM  447
             FYLPG+YMHTYS  + I  KVNSLTSIETE+PF+YY LPYCRP GGIKKSAEN+GELLM
Sbjct  29   AFYLPGSYMHTYSQGEVIHAKVNSLTSIETEMPFNYYSLPYCRPQGGIKKSAENLGELLM  88

Query  448  GDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQRT  564
            GDQIDNSPYRF +NVNE+++LCTT  LNE+  KLLKQRT
Sbjct  89   GDQIDNSPYRFHVNVNESVFLCTTKGLNENDAKLLKQRT  127



>ref|XP_007142543.1| hypothetical protein PHAVU_008G289600g [Phaseolus vulgaris]
 gb|ESW14537.1| hypothetical protein PHAVU_008G289600g [Phaseolus vulgaris]
Length=661

 Score =   169 bits (428),  Expect = 1e-45, Method: Composition-based stats.
 Identities = 81/110 (74%), Positives = 90/110 (82%), Gaps = 3/110 (3%)
 Frame = +1

Query  235  SYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIK  414
            ++F+ IS A   FYLPG+YMHTYS  DQI  KVNSLTSIETELP+SYY LPYC+P GGIK
Sbjct  21   NFFLQISDA---FYLPGSYMHTYSNGDQIYAKVNSLTSIETELPYSYYSLPYCKPLGGIK  77

Query  415  KSAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQRT  564
            KSAEN+GELL GDQIDNS Y FRMNVN ++YLCTT PL E  V LLKQRT
Sbjct  78   KSAENLGELLRGDQIDNSAYLFRMNVNHSIYLCTTPPLTEVEVNLLKQRT  127



>ref|XP_004973801.1| PREDICTED: transmembrane 9 superfamily member 4-like [Setaria 
italica]
Length=661

 Score =   169 bits (428),  Expect = 2e-45, Method: Composition-based stats.
 Identities = 75/99 (76%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = +1

Query  265  HGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKSAENVGELL  444
            + FYLPG+YMHTYS  + I  KVNSLTSIETE+PF+YY LPYCRP GGIKKSAEN+GELL
Sbjct  27   NAFYLPGSYMHTYSQGELISAKVNSLTSIETEMPFNYYSLPYCRPQGGIKKSAENLGELL  86

Query  445  MGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQR  561
            MGDQIDNSPYRF +NVNE+++LCTT  LNE+  KLLKQR
Sbjct  87   MGDQIDNSPYRFHVNVNESIFLCTTKGLNENDAKLLKQR  125



>ref|NP_001167934.1| hypothetical protein precursor [Zea mays]
 gb|ACN26575.1| unknown [Zea mays]
 gb|ACN33319.1| unknown [Zea mays]
 gb|ACN33746.1| unknown [Zea mays]
 gb|AFW63670.1| hypothetical protein ZEAMMB73_348862 [Zea mays]
Length=656

 Score =   168 bits (425),  Expect = 3e-45, Method: Composition-based stats.
 Identities = 72/99 (73%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = +1

Query  265  HGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKSAENVGELL  444
            H FYLPGT+MHTYSP + I  KVNSLTSIETELPFSYY LPYC+P  G+KKSAEN+GE+L
Sbjct  27   HAFYLPGTFMHTYSPGEVISAKVNSLTSIETELPFSYYSLPYCKPLDGVKKSAENLGEIL  86

Query  445  MGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQR  561
            MGDQIDNSPYRF++NVNE+++LCTT PL +   +LLK+R
Sbjct  87   MGDQIDNSPYRFQVNVNESVFLCTTDPLTKEQAELLKRR  125



>ref|XP_010236014.1| PREDICTED: transmembrane 9 superfamily member 4-like [Brachypodium 
distachyon]
Length=656

 Score =   167 bits (424),  Expect = 4e-45, Method: Composition-based stats.
 Identities = 71/98 (72%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = +1

Query  268  GFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKSAENVGELLM  447
             FYLPGT+MHTY P + I  KVNSLTSIETELPFSYY LPYC+PP G+KKSAEN+GE+LM
Sbjct  28   AFYLPGTFMHTYDPGEAISAKVNSLTSIETELPFSYYSLPYCKPPEGVKKSAENLGEILM  87

Query  448  GDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQR  561
            GDQIDNSPYRFR+N++E++YLCTT PL +   +LLK R
Sbjct  88   GDQIDNSPYRFRVNIDESVYLCTTDPLTKEQAELLKNR  125



>gb|KHN29868.1| Transmembrane 9 superfamily member 4 [Glycine soja]
Length=661

 Score =   166 bits (421),  Expect = 1e-44, Method: Composition-based stats.
 Identities = 79/108 (73%), Positives = 90/108 (83%), Gaps = 3/108 (3%)
 Frame = +1

Query  241  FILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKS  420
            F+ IS+A   FYLPG+YMHTYS  D I  KVNSLTSIETELP+SYY LPYC+P G IKKS
Sbjct  23   FVQISNA---FYLPGSYMHTYSNGDNIYAKVNSLTSIETELPYSYYSLPYCKPLGDIKKS  79

Query  421  AENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQRT  564
            AEN+GELL GDQID+SPY FRMNVN+++YLCTT  L E+ VKLLKQRT
Sbjct  80   AENLGELLRGDQIDSSPYLFRMNVNQSIYLCTTTALKENEVKLLKQRT  127



>ref|XP_003519687.1| PREDICTED: transmembrane 9 superfamily member 4-like [Glycine 
max]
Length=661

 Score =   166 bits (421),  Expect = 1e-44, Method: Composition-based stats.
 Identities = 79/108 (73%), Positives = 90/108 (83%), Gaps = 3/108 (3%)
 Frame = +1

Query  241  FILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKS  420
            F+ IS+A   FYLPG+YMHTYS  D I  KVNSLTSIETELP+SYY LPYC+P G IKKS
Sbjct  23   FVQISNA---FYLPGSYMHTYSNGDNIYAKVNSLTSIETELPYSYYSLPYCKPLGDIKKS  79

Query  421  AENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQRT  564
            AEN+GELL GDQID+SPY FRMNVN+++YLCTT  L E+ VKLLKQRT
Sbjct  80   AENLGELLRGDQIDSSPYLFRMNVNQSIYLCTTTALKENEVKLLKQRT  127



>gb|EYU34313.1| hypothetical protein MIMGU_mgv1a002925mg [Erythranthe guttata]
Length=625

 Score =   166 bits (419),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/91 (82%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = +1

Query  292  MHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKSAENVGELLMGDQIDNSP  471
            MHTYS  D+I  KVNSLTSIETELPFSYY LPYC+PPGGIKKSAEN+GEL+MGDQIDNSP
Sbjct  1    MHTYSTGDEIYAKVNSLTSIETELPFSYYSLPYCQPPGGIKKSAENLGELIMGDQIDNSP  60

Query  472  YRFRMNVNETLYLCTTGPLNEHHVKLLKQRT  564
            YRFRMNVNE++Y+CT+ PL+EH VKLLKQRT
Sbjct  61   YRFRMNVNESVYICTSPPLSEHDVKLLKQRT  91



>gb|EMT19887.1| Transmembrane 9 superfamily member 4 [Aegilops tauschii]
Length=652

 Score =   166 bits (419),  Expect = 3e-44, Method: Composition-based stats.
 Identities = 77/117 (66%), Positives = 91/117 (78%), Gaps = 2/117 (2%)
 Frame = +1

Query  217  RYLAAFSYFILIS-HA-CHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPY  390
            R+++A    IL+S H     FYLPGT+MHTY   + I  KVNSLTSIETELPFSYY LPY
Sbjct  5    RWISASLLVILLSLHPIADAFYLPGTFMHTYEAGEDIAAKVNSLTSIETELPFSYYSLPY  64

Query  391  CRPPGGIKKSAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQR  561
            C+PP G+KKSAEN+GE+LMGDQIDNSPY F +NVNE+LYLCTT PL +   +LLK R
Sbjct  65   CKPPEGVKKSAENLGEVLMGDQIDNSPYHFHVNVNESLYLCTTDPLTKEQAELLKNR  121



>gb|AFW71976.1| hypothetical protein ZEAMMB73_889343 [Zea mays]
Length=597

 Score =   164 bits (416),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 95/119 (80%), Gaps = 2/119 (2%)
 Frame = +1

Query  214  RRYLAAFSYFILIS--HACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLP  387
            R +++A    +L+S     H FYLPGT+MHTYSP + I  KVNSLTSIETELPFSYY LP
Sbjct  8    RSWISACVLVLLLSLHPRVHAFYLPGTFMHTYSPGEVISAKVNSLTSIETELPFSYYSLP  67

Query  388  YCRPPGGIKKSAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQRT  564
            YC+P  G+KKSAEN+GE+LMGDQIDNSPYRF++NVNE+++LCTT PL +   +LLK+R 
Sbjct  68   YCKPLDGVKKSAENLGEILMGDQIDNSPYRFQVNVNESVFLCTTDPLTKEQAELLKRRA  126



>gb|KHN46885.1| Transmembrane 9 superfamily member 4 [Glycine soja]
Length=661

 Score =   165 bits (417),  Expect = 5e-44, Method: Composition-based stats.
 Identities = 79/108 (73%), Positives = 89/108 (82%), Gaps = 3/108 (3%)
 Frame = +1

Query  241  FILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKS  420
            F+ IS+A   FYLPG+YMHTYS  D I  KVNSLTSIETELP+SYY LPYC+P G IKKS
Sbjct  23   FVQISNA---FYLPGSYMHTYSNGDPIYAKVNSLTSIETELPYSYYSLPYCKPLGKIKKS  79

Query  421  AENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQRT  564
            AEN+GELL GDQI NSPY F MNVN+++YLCTT  LNE+ VKLLKQRT
Sbjct  80   AENLGELLRGDQIHNSPYLFHMNVNQSIYLCTTTALNENEVKLLKQRT  127



>gb|AGV54167.1| transmembrane 9 superfamily protein member [Phaseolus vulgaris]
Length=661

 Score =   164 bits (414),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 81/109 (74%), Positives = 89/109 (82%), Gaps = 3/109 (3%)
 Frame = +1

Query  238  YFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKK  417
            +F+ IS A   FYLPG+YMHTYS  DQI  KVNSLTSIETELP+SYY LPYC+P GGIKK
Sbjct  22   FFLQISDA---FYLPGSYMHTYSNGDQIYAKVNSLTSIETELPYSYYSLPYCKPLGGIKK  78

Query  418  SAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQRT  564
            SAEN+GELL GDQIDNS Y FRMNVN ++YLCTT PL E  V LLKQRT
Sbjct  79   SAENLGELLRGDQIDNSAYLFRMNVNHSIYLCTTPPLTEVEVNLLKQRT  127



>tpg|DAA54117.1| TPA: hypothetical protein ZEAMMB73_902167 [Zea mays]
Length=361

 Score =   160 bits (404),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 71/101 (70%), Positives = 85/101 (84%), Gaps = 0/101 (0%)
 Frame = +1

Query  262  CHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKSAENVGEL  441
             H FYLPGT+MHTYSP + I  K+NSLTSIETELPFSYY+LPYC+P  G+KKSAEN+GE+
Sbjct  26   VHAFYLPGTFMHTYSPGEVISAKINSLTSIETELPFSYYNLPYCKPLDGVKKSAENLGEI  85

Query  442  LMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQRT  564
            LMGDQIDNS YRF++NVNE++YLCTT PL     +LLK+R 
Sbjct  86   LMGDQIDNSSYRFQVNVNESVYLCTTDPLINEQAELLKRRA  126



>tpg|DAA47985.1| TPA: hypothetical protein ZEAMMB73_709250 [Zea mays]
Length=493

 Score =   161 bits (408),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/117 (64%), Positives = 94/117 (80%), Gaps = 2/117 (2%)
 Frame = +1

Query  220  YLAAFSYFILIS--HACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYC  393
            +++A    +L+S     H FYLPGT+MHTYSP + I  KVNSLTSIETELPFSYY LPYC
Sbjct  10   WISACVLVLLLSLHPRVHAFYLPGTFMHTYSPGEVISAKVNSLTSIETELPFSYYSLPYC  69

Query  394  RPPGGIKKSAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQRT  564
            +P  G+KKSAEN+GE+LMGDQIDNSPYRF++NVNE+++LCTT PL +   +LLK+R 
Sbjct  70   KPLDGVKKSAENLGEILMGDQIDNSPYRFQVNVNESVFLCTTDPLTKEQAELLKRRA  126



>ref|XP_003545348.1| PREDICTED: transmembrane 9 superfamily member 4-like [Glycine 
max]
Length=661

 Score =   162 bits (411),  Expect = 3e-43, Method: Composition-based stats.
 Identities = 78/108 (72%), Positives = 88/108 (81%), Gaps = 3/108 (3%)
 Frame = +1

Query  241  FILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKS  420
            F+ IS+A   FYLPG+YMHTYS  D I  KVNSLTSIETELP+SYY LPYC+P G IKKS
Sbjct  23   FVQISNA---FYLPGSYMHTYSNGDPIYAKVNSLTSIETELPYSYYSLPYCKPLGKIKKS  79

Query  421  AENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQRT  564
            AEN+GELL GDQI NSPY F MNVN+++YLC T  LNE+ VKLLKQRT
Sbjct  80   AENLGELLRGDQIHNSPYLFHMNVNQSIYLCITTALNENEVKLLKQRT  127



>tpg|DAA47986.1| TPA: hypothetical protein ZEAMMB73_709250 [Zea mays]
Length=561

 Score =   162 bits (409),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 75/117 (64%), Positives = 94/117 (80%), Gaps = 2/117 (2%)
 Frame = +1

Query  220  YLAAFSYFILIS--HACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYC  393
            +++A    +L+S     H FYLPGT+MHTYSP + I  KVNSLTSIETELPFSYY LPYC
Sbjct  10   WISACVLVLLLSLHPRVHAFYLPGTFMHTYSPGEVISAKVNSLTSIETELPFSYYSLPYC  69

Query  394  RPPGGIKKSAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQRT  564
            +P  G+KKSAEN+GE+LMGDQIDNSPYRF++NVNE+++LCTT PL +   +LLK+R 
Sbjct  70   KPLDGVKKSAENLGEILMGDQIDNSPYRFQVNVNESVFLCTTDPLTKEQAELLKRRA  126



>gb|EMS64414.1| Transmembrane 9 superfamily member 4 [Triticum urartu]
Length=652

 Score =   162 bits (409),  Expect = 5e-43, Method: Composition-based stats.
 Identities = 76/117 (65%), Positives = 90/117 (77%), Gaps = 2/117 (2%)
 Frame = +1

Query  217  RYLAAFSYFILIS-HA-CHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPY  390
            R+++A    IL+S H     FYLPGT+MHTY   + I  KVNSLTSIETELPFSYY LPY
Sbjct  5    RWISASLLVILLSLHPIADAFYLPGTFMHTYEAGETIAAKVNSLTSIETELPFSYYSLPY  64

Query  391  CRPPGGIKKSAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQR  561
            C+P  G+KKSAEN+GE+LMGDQIDNSPY F +NVNE+LYLCTT PL +   +LLK R
Sbjct  65   CKPQEGVKKSAENLGEVLMGDQIDNSPYHFHVNVNESLYLCTTDPLTKEQAELLKNR  121



>ref|XP_010910092.1| PREDICTED: transmembrane 9 superfamily member 12 [Elaeis guineensis]
Length=661

 Score =   161 bits (408),  Expect = 8e-43, Method: Composition-based stats.
 Identities = 77/112 (69%), Positives = 89/112 (79%), Gaps = 1/112 (1%)
 Frame = +1

Query  232  FSY-FILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGG  408
            FS+  +LI+    GFYLPG+Y+HTYS  + I VKVNSLTSIETELPF YY LPYC+   G
Sbjct  16   FSFSVLLITCPSKGFYLPGSYIHTYSEGEPISVKVNSLTSIETELPFGYYSLPYCQTKDG  75

Query  409  IKKSAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQRT  564
             KKSAENVGELLMGDQIDNSPY+F +N +E+ YLCTT PL E  VKLLKQR+
Sbjct  76   NKKSAENVGELLMGDQIDNSPYKFHVNADESRYLCTTKPLTELEVKLLKQRS  127



>dbj|BAK03451.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93419.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=656

 Score =   160 bits (406),  Expect = 2e-42, Method: Composition-based stats.
 Identities = 74/117 (63%), Positives = 88/117 (75%), Gaps = 2/117 (2%)
 Frame = +1

Query  217  RYLAAFSYFILIS--HACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPY  390
            R+++A    IL+S       FYLPGT+MHTY   + I  KVNSLTSIETELPFSYY LPY
Sbjct  9    RWISASLLVILLSLQPIADAFYLPGTFMHTYEAGETIAAKVNSLTSIETELPFSYYSLPY  68

Query  391  CRPPGGIKKSAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQR  561
            C+P  G+KKSAEN+GE+LMGDQIDNSPY F +N NE+LYLCTT PL +   +LLK R
Sbjct  69   CKPTEGVKKSAENLGEVLMGDQIDNSPYHFHVNTNESLYLCTTDPLTKEQAELLKNR  125



>ref|XP_004287227.1| PREDICTED: transmembrane 9 superfamily member 11 [Fragaria vesca 
subsp. vesca]
Length=657

 Score =   154 bits (389),  Expect = 3e-40, Method: Composition-based stats.
 Identities = 68/117 (58%), Positives = 93/117 (79%), Gaps = 2/117 (2%)
 Frame = +1

Query  214  RRYLAAFSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYC  393
            R  + AF+  +L+  + +GFYLPG+Y H Y+  D++ VKVNSLTSI+TE+PFSYY LP+C
Sbjct  6    RFSIWAFT-ILLVFQSVYGFYLPGSYPHKYAVGDELFVKVNSLTSIDTEIPFSYYSLPFC  64

Query  394  RPPGGIKKSAENVGELLMGDQIDNSPYRFRMNVNET-LYLCTTGPLNEHHVKLLKQR  561
             PP GIK SAEN+GELLMGD+I+NSPY+F+M+ NE+ +++C +GPLN    KLLK+R
Sbjct  65   EPPNGIKDSAENLGELLMGDRIENSPYKFKMHTNESEIFMCKSGPLNADQFKLLKKR  121



>ref|XP_011078586.1| PREDICTED: transmembrane 9 superfamily member 11 [Sesamum indicum]
Length=658

 Score =   147 bits (370),  Expect = 1e-37, Method: Composition-based stats.
 Identities = 69/112 (62%), Positives = 85/112 (76%), Gaps = 1/112 (1%)
 Frame = +1

Query  229  AFSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGG  408
            A   F+ I    HGFYLPG+Y H Y+  D + VKVNSLTSI+TE+PFSYY LP+C+P  G
Sbjct  11   ALLVFLAIFQLGHGFYLPGSYPHKYAVGDYLNVKVNSLTSIDTEMPFSYYSLPFCQPKEG  70

Query  409  IKKSAENVGELLMGDQIDNSPYRFRMNVNET-LYLCTTGPLNEHHVKLLKQR  561
            IK SAEN+GELLMGD+I+NSPYRF+M  NET ++LC T PL+    KLLK+R
Sbjct  71   IKDSAENLGELLMGDRIENSPYRFKMYTNETEVFLCQTKPLSGEEFKLLKKR  122



>ref|XP_010687755.1| PREDICTED: transmembrane 9 superfamily member 11 [Beta vulgaris 
subsp. vulgaris]
Length=656

 Score =   146 bits (369),  Expect = 2e-37, Method: Composition-based stats.
 Identities = 69/119 (58%), Positives = 88/119 (74%), Gaps = 5/119 (4%)
 Frame = +1

Query  220  YLAAFSYFI----LISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLP  387
            +L  F  FI    LI  + +GFYLPG+Y H Y   D + VKVNSLTSI+TE+PFSYY LP
Sbjct  3    FLGKFMIFIVVICLICESGNGFYLPGSYPHKYVVGDTLSVKVNSLTSIDTEMPFSYYSLP  62

Query  388  YCRPPGGIKKSAENVGELLMGDQIDNSPYRFRMNVNET-LYLCTTGPLNEHHVKLLKQR  561
            +C+P  G+K SAEN+GELLMGD+I+NSPYRF+M  NET ++LC T PL+    KL+K+R
Sbjct  63   FCKPQEGVKDSAENLGELLMGDRIENSPYRFKMYTNETEIFLCKTSPLSADEFKLMKKR  121



>ref|XP_002523542.1| Endosomal P24A protein precursor, putative [Ricinus communis]
 gb|EEF38881.1| Endosomal P24A protein precursor, putative [Ricinus communis]
Length=657

 Score =   145 bits (366),  Expect = 4e-37, Method: Composition-based stats.
 Identities = 65/106 (61%), Positives = 86/106 (81%), Gaps = 1/106 (1%)
 Frame = +1

Query  247  LISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKSAE  426
            LI  + +GFYLPG+Y H Y+  + + VKVNS+TSI+TE+PFSYY LP+C+P  G+K SAE
Sbjct  16   LIFQSGYGFYLPGSYPHKYNVGETLSVKVNSITSIDTEMPFSYYSLPFCKPAEGVKDSAE  75

Query  427  NVGELLMGDQIDNSPYRFRMNVNET-LYLCTTGPLNEHHVKLLKQR  561
            N+GELLMGD+I+NSPYRFRM+VNE+ ++LC T PL+    KLLK+R
Sbjct  76   NLGELLMGDRIENSPYRFRMHVNESEVFLCKTDPLSADSFKLLKKR  121



>ref|XP_010520555.1| PREDICTED: transmembrane 9 superfamily member 4-like [Tarenaya 
hassleriana]
Length=663

 Score =   145 bits (366),  Expect = 4e-37, Method: Composition-based stats.
 Identities = 64/107 (60%), Positives = 84/107 (79%), Gaps = 1/107 (1%)
 Frame = +1

Query  244  ILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKSA  423
            + I+ + +GFYLPG+Y H Y   D + VKVNSLTSIETE+PFSYY LP+C+PP G+K SA
Sbjct  21   VFIAQSAYGFYLPGSYPHKYKVGDPLNVKVNSLTSIETEMPFSYYSLPFCQPPDGVKDSA  80

Query  424  ENVGELLMGDQIDNSPYRFRMNVNET-LYLCTTGPLNEHHVKLLKQR  561
            EN+GELLMGD+I+NSPY+F+M  NE+ +++C T  LN    KLLK+R
Sbjct  81   ENLGELLMGDRIENSPYKFKMFTNESEIFMCQTEKLNADTFKLLKKR  127



>ref|XP_010244791.1| PREDICTED: transmembrane 9 superfamily member 4 [Nelumbo nucifera]
Length=657

 Score =   145 bits (366),  Expect = 5e-37, Method: Composition-based stats.
 Identities = 68/120 (57%), Positives = 91/120 (76%), Gaps = 5/120 (4%)
 Frame = +1

Query  217  RYLAAFSYFILIS----HACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDL  384
            R+   F+ ++L S     +  GFYLPG+Y H Y   DQ+ VKVNSLTSI+TE+PFSYY L
Sbjct  2    RFSHQFAIWVLFSLLLLQSGDGFYLPGSYPHKYQVGDQLSVKVNSLTSIDTEMPFSYYSL  61

Query  385  PYCRPPGGIKKSAENVGELLMGDQIDNSPYRFRMNVNET-LYLCTTGPLNEHHVKLLKQR  561
            P+C+P  G+K SAEN+GELLMGD+I+NSPYRF+M  NET ++LC T PL+ ++ K+LK+R
Sbjct  62   PFCKPLEGVKDSAENLGELLMGDRIENSPYRFKMYTNETDIFLCRTDPLSANNFKILKKR  121



>ref|XP_002308380.2| hypothetical protein POPTR_0006s20360g [Populus trichocarpa]
 gb|EEE91903.2| hypothetical protein POPTR_0006s20360g [Populus trichocarpa]
Length=657

 Score =   145 bits (365),  Expect = 7e-37, Method: Composition-based stats.
 Identities = 64/106 (60%), Positives = 85/106 (80%), Gaps = 1/106 (1%)
 Frame = +1

Query  247  LISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKSAE  426
            L+  + +GFYLPG+Y H Y   D + VKVNS+TSIETE+PFSYY LP+C+P  G+K SAE
Sbjct  16   LVFQSGYGFYLPGSYPHNYGIGDTLSVKVNSITSIETEIPFSYYSLPFCKPLEGVKDSAE  75

Query  427  NVGELLMGDQIDNSPYRFRMNVNET-LYLCTTGPLNEHHVKLLKQR  561
            N+GE+LMGD+I+NSPY+F+M+ NET ++LC T PL+  H KLLK+R
Sbjct  76   NLGEVLMGDRIENSPYKFKMHTNETDIFLCRTDPLSGDHFKLLKKR  121



>gb|KJB83257.1| hypothetical protein B456_013G237900 [Gossypium raimondii]
Length=654

 Score =   144 bits (364),  Expect = 9e-37, Method: Composition-based stats.
 Identities = 67/118 (57%), Positives = 89/118 (75%), Gaps = 5/118 (4%)
 Frame = +1

Query  223  LAAFSYFIL----ISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPY  390
            +A+F  ++L    +  + +GFYLPG+Y H Y   D + VKVNSLTSI+TE+PFSYY LP+
Sbjct  1    MASFGIWVLTIFLVFQSGYGFYLPGSYPHKYKVGDPLSVKVNSLTSIDTEMPFSYYSLPF  60

Query  391  CRPPGGIKKSAENVGELLMGDQIDNSPYRFRMNVNETL-YLCTTGPLNEHHVKLLKQR  561
            C+P  G+K SAEN+GELLMGD+I+NSPYRF+M  NETL +LC +G L+    KLLK+R
Sbjct  61   CKPAEGVKDSAENLGELLMGDRIENSPYRFKMYTNETLIFLCQSGKLSADEFKLLKER  118



>gb|KDP38623.1| hypothetical protein JCGZ_03976 [Jatropha curcas]
Length=663

 Score =   144 bits (363),  Expect = 1e-36, Method: Composition-based stats.
 Identities = 66/108 (61%), Positives = 86/108 (80%), Gaps = 1/108 (1%)
 Frame = +1

Query  241  FILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKS  420
            F LI  + +GFYLPG+Y H Y+  + + VKVNS+TSI+TE+PFSYY LP+C P  G+K S
Sbjct  20   FCLIFQSGYGFYLPGSYPHKYNVGETLSVKVNSITSIDTEMPFSYYSLPFCEPTEGVKDS  79

Query  421  AENVGELLMGDQIDNSPYRFRMNVNET-LYLCTTGPLNEHHVKLLKQR  561
            AEN+GELLMGD+I+NSPYRFRM+VNE+ ++LC T PL+    KLLK+R
Sbjct  80   AENLGELLMGDRIENSPYRFRMHVNESEIFLCRTEPLSADSFKLLKKR  127



>emb|CDP18796.1| unnamed protein product [Coffea canephora]
Length=663

 Score =   144 bits (362),  Expect = 2e-36, Method: Composition-based stats.
 Identities = 63/108 (58%), Positives = 82/108 (76%), Gaps = 1/108 (1%)
 Frame = +1

Query  241  FILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKS  420
            F+       GFYLPG++ H Y   DQ+ VKVNSLTSIETE+P+ YY LP+C+P  G+K S
Sbjct  19   FVAFLQCAAGFYLPGSFPHKYMVGDQLSVKVNSLTSIETEIPYGYYSLPFCKPKEGVKDS  78

Query  421  AENVGELLMGDQIDNSPYRFRMNVNET-LYLCTTGPLNEHHVKLLKQR  561
            AEN+GELLMGD+I+NSPYRF+M VNET ++LC +GPL+    K+L +R
Sbjct  79   AENLGELLMGDRIENSPYRFKMRVNETDVFLCQSGPLSADEFKILTER  126



>ref|XP_009775737.1| PREDICTED: transmembrane 9 superfamily member 4 [Nicotiana sylvestris]
Length=657

 Score =   144 bits (362),  Expect = 2e-36, Method: Composition-based stats.
 Identities = 66/109 (61%), Positives = 83/109 (76%), Gaps = 1/109 (1%)
 Frame = +1

Query  238  YFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKK  417
            +  L+    HGFYLPG+Y H Y   D + VKVNSLTSI+TELP+SYY LP+C+P  G+K 
Sbjct  13   FICLVCELGHGFYLPGSYPHKYVVGDFLNVKVNSLTSIDTELPYSYYSLPFCKPEEGVKD  72

Query  418  SAENVGELLMGDQIDNSPYRFRMNVNET-LYLCTTGPLNEHHVKLLKQR  561
            SAEN+GELLMGD+I+NSPYRF+M  NET ++LC T PL+    KLLK+R
Sbjct  73   SAENLGELLMGDRIENSPYRFKMYTNETEVFLCQTKPLSGEEFKLLKER  121



>ref|XP_003542622.2| PREDICTED: transmembrane 9 superfamily member 4-like [Glycine 
max]
 gb|KHN22104.1| Transmembrane 9 superfamily member 4 [Glycine soja]
Length=682

 Score =   144 bits (362),  Expect = 2e-36, Method: Composition-based stats.
 Identities = 65/117 (56%), Positives = 88/117 (75%), Gaps = 1/117 (1%)
 Frame = +1

Query  214  RRYLAAFSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYC  393
            R  L  F +  L+  + +GFYLPG+Y H Y   D++ VKVNSLTSIETE+PFSYY LP+C
Sbjct  30   RFRLWVFVFLCLMFQSGNGFYLPGSYPHKYGIGDELSVKVNSLTSIETEMPFSYYSLPFC  89

Query  394  RPPGGIKKSAENVGELLMGDQIDNSPYRFRMNVNET-LYLCTTGPLNEHHVKLLKQR  561
            +P GG+K SAEN+GELLMGD+I+NSPY+F+M  NE+ ++LC    L++   K+LK+R
Sbjct  90   KPEGGVKDSAENLGELLMGDRIENSPYKFKMYTNESEIFLCQVEKLSDDQFKILKKR  146



>gb|KHN47554.1| Transmembrane 9 superfamily member 4 [Glycine soja]
Length=660

 Score =   143 bits (361),  Expect = 2e-36, Method: Composition-based stats.
 Identities = 64/100 (64%), Positives = 81/100 (81%), Gaps = 1/100 (1%)
 Frame = +1

Query  265  HGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKSAENVGELL  444
            +GFYLPG+Y H Y  +D++ VKVNSLTSI+TE+PFSYY LP+C+P GGIK SAEN+GELL
Sbjct  25   YGFYLPGSYPHNYDVTDELWVKVNSLTSIDTEMPFSYYSLPFCKPEGGIKDSAENLGELL  84

Query  445  MGDQIDNSPYRFRMNVNET-LYLCTTGPLNEHHVKLLKQR  561
            MGD+I+NSPYRFRM  NE+ +YLC    L+    K+LK+R
Sbjct  85   MGDRIENSPYRFRMYTNESEIYLCQIQALSGDQFKILKER  124



>ref|XP_006597958.1| PREDICTED: transmembrane 9 superfamily member 4-like [Glycine 
max]
Length=660

 Score =   143 bits (361),  Expect = 2e-36, Method: Composition-based stats.
 Identities = 64/100 (64%), Positives = 81/100 (81%), Gaps = 1/100 (1%)
 Frame = +1

Query  265  HGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKSAENVGELL  444
            +GFYLPG+Y H Y  +D++ VKVNSLTSI+TE+PFSYY LP+C+P GGIK SAEN+GELL
Sbjct  25   YGFYLPGSYPHNYDVTDELWVKVNSLTSIDTEMPFSYYSLPFCKPEGGIKDSAENLGELL  84

Query  445  MGDQIDNSPYRFRMNVNET-LYLCTTGPLNEHHVKLLKQR  561
            MGD+I+NSPYRFRM  NE+ +YLC    L+    K+LK+R
Sbjct  85   MGDRIENSPYRFRMYTNESEIYLCQIQALSGDQFKILKER  124



>gb|EYU31807.1| hypothetical protein MIMGU_mgv1a021916mg [Erythranthe guttata]
Length=659

 Score =   143 bits (361),  Expect = 2e-36, Method: Composition-based stats.
 Identities = 67/100 (67%), Positives = 80/100 (80%), Gaps = 1/100 (1%)
 Frame = +1

Query  265  HGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKSAENVGELL  444
             GFYLPG+Y H +   D + VKVNSLTSI+TE+PFSYYDLPYCRP  GIK SAEN+GELL
Sbjct  23   QGFYLPGSYPHKHGIGDYLNVKVNSLTSIDTEIPFSYYDLPYCRPKEGIKDSAENLGELL  82

Query  445  MGDQIDNSPYRFRMNVNET-LYLCTTGPLNEHHVKLLKQR  561
            MGD+I+NSPYRF+M  NET ++LC T PL+    KLLK+R
Sbjct  83   MGDRIENSPYRFKMYTNETQIFLCQTKPLSTEEFKLLKKR  122



>ref|XP_011033481.1| PREDICTED: transmembrane 9 superfamily member 11-like [Populus 
euphratica]
Length=657

 Score =   143 bits (361),  Expect = 2e-36, Method: Composition-based stats.
 Identities = 64/106 (60%), Positives = 84/106 (79%), Gaps = 1/106 (1%)
 Frame = +1

Query  247  LISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKSAE  426
            L+  + +GFYLPG+Y H Y   D + VKVNS+TSIETE+PFSYY LP+C+P  G+K SAE
Sbjct  16   LVFQSGYGFYLPGSYPHNYGIGDTLSVKVNSITSIETEIPFSYYSLPFCKPLEGVKDSAE  75

Query  427  NVGELLMGDQIDNSPYRFRMNVNET-LYLCTTGPLNEHHVKLLKQR  561
            N+GE+LMGD+I+NSPY+F+M+ NET ++LC T PL   H KLLK+R
Sbjct  76   NLGEVLMGDRIENSPYKFKMHTNETDIFLCRTDPLLGDHFKLLKKR  121



>ref|XP_003533883.1| PREDICTED: transmembrane 9 superfamily member 4-like [Glycine 
max]
 gb|KHN42484.1| Transmembrane 9 superfamily member 4 [Glycine soja]
Length=660

 Score =   143 bits (361),  Expect = 3e-36, Method: Composition-based stats.
 Identities = 65/100 (65%), Positives = 81/100 (81%), Gaps = 1/100 (1%)
 Frame = +1

Query  265  HGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKSAENVGELL  444
            +GFYLPG+Y H Y  SD++ VKVNSLTSI+TE+PFSYY LP+C+P GGIK SAEN+GELL
Sbjct  25   YGFYLPGSYPHNYGVSDELWVKVNSLTSIDTEIPFSYYSLPFCKPEGGIKDSAENLGELL  84

Query  445  MGDQIDNSPYRFRMNVNET-LYLCTTGPLNEHHVKLLKQR  561
            MGD+I+NSPYRFRM  NE+ +YLC    L+    K+LK+R
Sbjct  85   MGDRIENSPYRFRMYSNESEIYLCRIEALSGDQFKILKER  124



>ref|XP_006827113.1| hypothetical protein AMTR_s00010p00245470 [Amborella trichopoda]
 gb|ERM94350.1| hypothetical protein AMTR_s00010p00245470 [Amborella trichopoda]
Length=119

 Score =   134 bits (336),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 62/98 (63%), Positives = 79/98 (81%), Gaps = 1/98 (1%)
 Frame = +1

Query  268  GFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKSAENVGELLM  447
             FYLPG+Y H Y   D++ VKV+SLTS+ETELP+ YY LP+C+P  GIK SAEN+GELLM
Sbjct  4    AFYLPGSYPHKYLKGDELWVKVHSLTSVETELPYRYYSLPFCKPLDGIKDSAENLGELLM  63

Query  448  GDQIDNSPYRFRMNVNET-LYLCTTGPLNEHHVKLLKQ  558
            GD I+NSPYRF+MN NE+ ++LC T PL++  VKLLK+
Sbjct  64   GDHIENSPYRFKMNTNESDIFLCATNPLSKDDVKLLKK  101



>gb|KHN18590.1| Transmembrane 9 superfamily member 4 [Glycine soja]
Length=682

 Score =   143 bits (361),  Expect = 3e-36, Method: Composition-based stats.
 Identities = 65/117 (56%), Positives = 88/117 (75%), Gaps = 1/117 (1%)
 Frame = +1

Query  214  RRYLAAFSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYC  393
            R  L  F +  L+  + +GFYLPG+Y H Y   D++ VKVNSLTSIETE+PFSYY LP+C
Sbjct  30   RFRLWVFVFLCLMFQSGNGFYLPGSYPHKYGIGDELSVKVNSLTSIETEMPFSYYSLPFC  89

Query  394  RPPGGIKKSAENVGELLMGDQIDNSPYRFRMNVNET-LYLCTTGPLNEHHVKLLKQR  561
            +P GG+K SAEN+GELLMGD+I+NSPY+F+M  NE+ ++LC    L++   K+LK+R
Sbjct  90   KPEGGVKDSAENLGELLMGDRIENSPYKFKMYTNESEIFLCQVEKLSDDEFKILKKR  146



>ref|XP_003549702.2| PREDICTED: transmembrane 9 superfamily member 4-like [Glycine 
max]
Length=682

 Score =   143 bits (361),  Expect = 3e-36, Method: Composition-based stats.
 Identities = 65/117 (56%), Positives = 88/117 (75%), Gaps = 1/117 (1%)
 Frame = +1

Query  214  RRYLAAFSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYC  393
            R  L  F +  L+  + +GFYLPG+Y H Y   D++ VKVNSLTSIETE+PFSYY LP+C
Sbjct  30   RFRLWVFVFLCLMFQSGNGFYLPGSYPHKYGIGDELSVKVNSLTSIETEMPFSYYSLPFC  89

Query  394  RPPGGIKKSAENVGELLMGDQIDNSPYRFRMNVNET-LYLCTTGPLNEHHVKLLKQR  561
            +P GG+K SAEN+GELLMGD+I+NSPY+F+M  NE+ ++LC    L++   K+LK+R
Sbjct  90   KPEGGVKDSAENLGELLMGDRIENSPYKFKMYTNESEIFLCQVEKLSDDEFKILKKR  146



>emb|CDP10518.1| unnamed protein product [Coffea canephora]
Length=656

 Score =   142 bits (359),  Expect = 4e-36, Method: Composition-based stats.
 Identities = 67/109 (61%), Positives = 82/109 (75%), Gaps = 1/109 (1%)
 Frame = +1

Query  238  YFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKK  417
            +  +IS   HGFYLPG+Y H Y     + VKVNSLTSIETE+PFSYY LP+C P  G+K 
Sbjct  13   FICMISQLGHGFYLPGSYPHKYGIGGFLNVKVNSLTSIETEMPFSYYSLPFCHPKEGVKD  72

Query  418  SAENVGELLMGDQIDNSPYRFRMNVNET-LYLCTTGPLNEHHVKLLKQR  561
            SAEN+GELLMGD+I+NSPYRF+M  NET ++LC T PL+    KLLK+R
Sbjct  73   SAENLGELLMGDRIENSPYRFKMYNNETEVFLCQTKPLSGEEFKLLKKR  121



>ref|XP_006845794.1| hypothetical protein AMTR_s00019p00254960 [Amborella trichopoda]
 gb|ERN07469.1| hypothetical protein AMTR_s00019p00254960 [Amborella trichopoda]
Length=657

 Score =   142 bits (359),  Expect = 4e-36, Method: Composition-based stats.
 Identities = 67/108 (62%), Positives = 85/108 (79%), Gaps = 4/108 (4%)
 Frame = +1

Query  241  FILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKS  420
             + IS A   FYLPG+Y H Y    ++ VKVNSLTS+ETELP+SYY LP+C+P  GIK S
Sbjct  17   LVCISEA---FYLPGSYPHKYLKGGELWVKVNSLTSVETELPYSYYSLPFCKPLDGIKDS  73

Query  421  AENVGELLMGDQIDNSPYRFRMNVNET-LYLCTTGPLNEHHVKLLKQR  561
            AEN+GELLMGD+I+NSPYRF+MN NE+ ++LC T PL++  VKLLK+R
Sbjct  74   AENLGELLMGDRIENSPYRFKMNTNESDIFLCATNPLSKDDVKLLKKR  121



>gb|EYU25293.1| hypothetical protein MIMGU_mgv1a002545mg [Erythranthe guttata]
Length=660

 Score =   142 bits (358),  Expect = 7e-36, Method: Composition-based stats.
 Identities = 65/100 (65%), Positives = 80/100 (80%), Gaps = 1/100 (1%)
 Frame = +1

Query  265  HGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKSAENVGELL  444
            +GFYLPG+Y H Y   D + +KVNSLTSI+TE+P+SYY LPYC P GGIK SAEN+GELL
Sbjct  24   NGFYLPGSYPHNYGIGDYLNMKVNSLTSIDTEIPYSYYSLPYCLPQGGIKDSAENLGELL  83

Query  445  MGDQIDNSPYRFRMNVNET-LYLCTTGPLNEHHVKLLKQR  561
            MGD+I+NSPYRF+M  NET ++LC T PL+    KLLK+R
Sbjct  84   MGDRIENSPYRFKMYTNETDIFLCQTKPLSADEFKLLKKR  123



>ref|NP_001190420.1| endomembrane family protein 70 [Arabidopsis thaliana]
 sp|Q9FYQ8.1|TMN11_ARATH RecName: Full=Transmembrane 9 superfamily member 11; AltName: 
Full=Endomembrane protein 6; AltName: Full=Transmembrane nine 
protein 11; Short=AtTMN11; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB10022.1| endosomal protein-like [Arabidopsis thaliana]
 gb|AED93935.1| endomembrane family protein 70 [Arabidopsis thaliana]
Length=658

 Score =   142 bits (358),  Expect = 7e-36, Method: Composition-based stats.
 Identities = 66/107 (62%), Positives = 83/107 (78%), Gaps = 1/107 (1%)
 Frame = +1

Query  244  ILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKSA  423
            +L+  +  GFYLPG+Y H Y   D + VKVNSLTSIETE+PFSYY LP+C+P  GIK SA
Sbjct  15   LLVIQSSFGFYLPGSYPHKYEVGDYLNVKVNSLTSIETEMPFSYYSLPFCKPSEGIKDSA  74

Query  424  ENVGELLMGDQIDNSPYRFRMNVNET-LYLCTTGPLNEHHVKLLKQR  561
            EN+GELLMGD+I+NSPYRFRM  NE+ ++LC T  L+   +KLLK+R
Sbjct  75   ENLGELLMGDRIENSPYRFRMFKNESEIFLCQTDKLSADSLKLLKKR  121



>gb|ACJ85528.1| unknown [Medicago truncatula]
 gb|AFK35465.1| unknown [Medicago truncatula]
Length=319

 Score =   138 bits (347),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 60/106 (57%), Positives = 84/106 (79%), Gaps = 1/106 (1%)
 Frame = +1

Query  247  LISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKSAE  426
            L+  + +GFYLPG+Y H Y+  D++ VKVNS+TSI+TE+PFSYY LP+C+P GG+K  AE
Sbjct  16   LVFQSGYGFYLPGSYPHNYAIGDELSVKVNSITSIDTEMPFSYYSLPFCKPQGGVKDRAE  75

Query  427  NVGELLMGDQIDNSPYRFRMNVNET-LYLCTTGPLNEHHVKLLKQR  561
            N+GELLMGD+I+NSPYRF+M  NE+ ++LC    L++   K+LK+R
Sbjct  76   NLGELLMGDRIENSPYRFKMFTNESEVFLCQVDKLSDDQFKILKKR  121



>ref|XP_002264906.1| PREDICTED: transmembrane 9 superfamily member 11 [Vitis vinifera]
Length=656

 Score =   142 bits (357),  Expect = 9e-36, Method: Composition-based stats.
 Identities = 62/99 (63%), Positives = 80/99 (81%), Gaps = 1/99 (1%)
 Frame = +1

Query  268  GFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKSAENVGELLM  447
            GFYLPG+Y H Y   + + VKVNSLTSI+TE+PFSYY LP+C+PP G+K SAEN+GELLM
Sbjct  23   GFYLPGSYPHKYDIGNTLSVKVNSLTSIDTEMPFSYYSLPFCKPPEGVKDSAENLGELLM  82

Query  448  GDQIDNSPYRFRMNVNET-LYLCTTGPLNEHHVKLLKQR  561
            GD+I+NSPYRF+M  NET ++LC + PL+    K+LK+R
Sbjct  83   GDRIENSPYRFKMYTNETQIFLCKSDPLSADDFKILKKR  121



>emb|CAN62778.1| hypothetical protein VITISV_031212 [Vitis vinifera]
Length=656

 Score =   142 bits (357),  Expect = 9e-36, Method: Composition-based stats.
 Identities = 62/99 (63%), Positives = 80/99 (81%), Gaps = 1/99 (1%)
 Frame = +1

Query  268  GFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKSAENVGELLM  447
            GFYLPG+Y H Y   + + VKVNSLTSI+TE+PFSYY LP+C+PP G+K SAEN+GELLM
Sbjct  23   GFYLPGSYPHKYDIGNTLSVKVNSLTSIDTEMPFSYYSLPFCKPPEGVKDSAENLGELLM  82

Query  448  GDQIDNSPYRFRMNVNET-LYLCTTGPLNEHHVKLLKQR  561
            GD+I+NSPYRF+M  NET ++LC + PL+    K+LK+R
Sbjct  83   GDRIENSPYRFKMYTNETQIFLCKSDPLSADDFKILKKR  121



>gb|AES91726.2| hexose transporter, putative [Medicago truncatula]
Length=701

 Score =   142 bits (358),  Expect = 1e-35, Method: Composition-based stats.
 Identities = 61/106 (58%), Positives = 85/106 (80%), Gaps = 1/106 (1%)
 Frame = +1

Query  247  LISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKSAE  426
            L+  + +GFYLPG+Y H Y+  D++ VKVNS+TSI+TE+PFSYY LP+C+P GG+K SAE
Sbjct  16   LVFQSGYGFYLPGSYPHNYAIGDELSVKVNSITSIDTEMPFSYYSLPFCKPQGGVKDSAE  75

Query  427  NVGELLMGDQIDNSPYRFRMNVNET-LYLCTTGPLNEHHVKLLKQR  561
            N+GELLMGD+I+NSPYRF+M  NE+ ++LC    L++   K+LK+R
Sbjct  76   NLGELLMGDRIENSPYRFKMFTNESEVFLCQVDKLSDDQFKILKKR  121



>ref|XP_003570309.1| PREDICTED: transmembrane 9 superfamily member 4-like [Brachypodium 
distachyon]
Length=658

 Score =   141 bits (356),  Expect = 1e-35, Method: Composition-based stats.
 Identities = 68/119 (57%), Positives = 86/119 (72%), Gaps = 2/119 (2%)
 Frame = +1

Query  211  RRRYLAAFSYFILISH-ACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLP  387
            R  +L A +  +L+S    H FYLPG+Y H Y+P D + VKVNSLTSI+TE+PFSYY LP
Sbjct  3    RLFFLVAAAVAVLMSAPVAHAFYLPGSYPHKYNPGDSLNVKVNSLTSIDTEIPFSYYSLP  62

Query  388  YCRPPGGIKKSAENVGELLMGDQIDNSPYRFRMNVNET-LYLCTTGPLNEHHVKLLKQR  561
            +C P  G+K SAEN+GELLMGD+I+NSPYRF+M  NET + LC + PL      LLK+R
Sbjct  63   FCTPSEGVKDSAENLGELLMGDRIENSPYRFKMYTNETDVLLCRSAPLAPDAFSLLKKR  121



>gb|EPS67195.1| hypothetical protein M569_07580, partial [Genlisea aurea]
Length=291

 Score =   137 bits (345),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 85/112 (76%), Gaps = 3/112 (3%)
 Frame = +1

Query  235  SYFIL--ISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGG  408
            + F+L  +S   +GFYLPG+Y H Y   D + VKVNSLTSI+TELP+ YY LP+C+P GG
Sbjct  12   ALFVLFGLSQIVNGFYLPGSYPHNYGVGDYLNVKVNSLTSIDTELPYGYYTLPFCQPEGG  71

Query  409  IKKSAENVGELLMGDQIDNSPYRFRMNVNET-LYLCTTGPLNEHHVKLLKQR  561
            IK SAEN+GELLMGD+I+NSPYRF+M  NET ++LC T  L+    KLLK+R
Sbjct  72   IKDSAENLGELLMGDRIENSPYRFKMLTNETDIFLCQTKALSSKEFKLLKKR  123



>ref|XP_006350070.1| PREDICTED: transmembrane 9 superfamily member 4-like [Solanum 
tuberosum]
Length=657

 Score =   141 bits (356),  Expect = 1e-35, Method: Composition-based stats.
 Identities = 66/106 (62%), Positives = 81/106 (76%), Gaps = 1/106 (1%)
 Frame = +1

Query  247  LISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKSAE  426
            L+S    GFYLPG+Y H Y   D + VKVNSLTSI+TELP+SYY LP+C P  G+K SAE
Sbjct  16   LVSELGCGFYLPGSYPHKYGVGDYLNVKVNSLTSIDTELPYSYYSLPFCNPEEGVKDSAE  75

Query  427  NVGELLMGDQIDNSPYRFRMNVNET-LYLCTTGPLNEHHVKLLKQR  561
            N+GELLMGD+I+NSPYRF+M  NET ++LC T PL+    KLLK+R
Sbjct  76   NLGELLMGDRIENSPYRFKMYTNETEVFLCQTKPLSADEFKLLKER  121



>ref|XP_003609518.1| Transmembrane 9 superfamily protein member, partial [Medicago 
truncatula]
Length=362

 Score =   138 bits (348),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 85/106 (80%), Gaps = 1/106 (1%)
 Frame = +1

Query  247  LISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKSAE  426
            L+  + +GFYLPG+Y H Y+  D++ VKVNS+TSI+TE+PFSYY LP+C+P GG+K SAE
Sbjct  16   LVFQSGYGFYLPGSYPHNYAIGDELSVKVNSITSIDTEMPFSYYSLPFCKPQGGVKDSAE  75

Query  427  NVGELLMGDQIDNSPYRFRMNVNET-LYLCTTGPLNEHHVKLLKQR  561
            N+GELLMGD+I+NSPYRF+M  NE+ ++LC    L++   K+LK+R
Sbjct  76   NLGELLMGDRIENSPYRFKMFTNESEVFLCQVDKLSDDQFKILKKR  121



>ref|XP_004508395.1| PREDICTED: transmembrane 9 superfamily member 4-like [Cicer arietinum]
Length=656

 Score =   141 bits (355),  Expect = 1e-35, Method: Composition-based stats.
 Identities = 63/108 (58%), Positives = 83/108 (77%), Gaps = 1/108 (1%)
 Frame = +1

Query  241  FILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKS  420
            F L+     GFYLPG+Y H Y   D++ VKVNS+TSI+TE+PFSYY LP+C+P GG+K S
Sbjct  14   FCLLFQLGFGFYLPGSYPHNYQIGDELSVKVNSITSIDTEMPFSYYSLPFCKPQGGVKDS  73

Query  421  AENVGELLMGDQIDNSPYRFRMNVNET-LYLCTTGPLNEHHVKLLKQR  561
            AEN+GELLMGD+I+NSPYRF+M  NET ++LC    L++   K+LK+R
Sbjct  74   AENLGELLMGDRIENSPYRFKMFTNETEVFLCQVDKLSQDQFKILKKR  121



>ref|XP_010913386.1| PREDICTED: transmembrane 9 superfamily member 11-like [Elaeis 
guineensis]
Length=657

 Score =   141 bits (355),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 67/111 (60%), Positives = 82/111 (74%), Gaps = 3/111 (3%)
 Frame = +1

Query  232  FSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGI  411
            FS  +L S   HGFYLPG+Y H Y   D + VK NSLTSIETELP+ YY LP+CRP  GI
Sbjct  14   FSLLLLPSG--HGFYLPGSYPHKYGVGDPLSVKANSLTSIETELPYGYYSLPFCRPQEGI  71

Query  412  KKSAENVGELLMGDQIDNSPYRFRMNVNET-LYLCTTGPLNEHHVKLLKQR  561
            K  AEN+GELLMGD+I+NSPYRF+M  NE+ ++LC +GPL+     LLK+R
Sbjct  72   KDMAENLGELLMGDRIENSPYRFKMRTNESDVFLCRSGPLSADDFNLLKKR  122



>ref|XP_010929109.1| PREDICTED: transmembrane 9 superfamily member 11-like [Elaeis 
guineensis]
 ref|XP_010929110.1| PREDICTED: transmembrane 9 superfamily member 11-like [Elaeis 
guineensis]
Length=668

 Score =   140 bits (354),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 64/99 (65%), Positives = 78/99 (79%), Gaps = 1/99 (1%)
 Frame = +1

Query  268  GFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKSAENVGELLM  447
            GFYLPG+Y H Y   D + VKVNSLTSI+TE+PFSYY LP+C+P  GIK SAEN+GELLM
Sbjct  34   GFYLPGSYPHKYMVGDTLSVKVNSLTSIDTEIPFSYYSLPFCKPQEGIKDSAENLGELLM  93

Query  448  GDQIDNSPYRFRMNVNET-LYLCTTGPLNEHHVKLLKQR  561
            GD+I+NSPYRF+M  NE+ + LC TGPL+     LLK+R
Sbjct  94   GDRIENSPYRFKMFTNESDILLCRTGPLSTQDFNLLKKR  132



>gb|KDO59354.1| hypothetical protein CISIN_1g035744mg [Citrus sinensis]
Length=653

 Score =   140 bits (354),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 65/111 (59%), Positives = 87/111 (78%), Gaps = 2/111 (2%)
 Frame = +1

Query  232  FSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGI  411
            F +F L S +  GFYLPG+Y H +   D + VKVNS+TSI+TE+PFSYY LP+C+P  G+
Sbjct  10   FVFFFLQSSS-FGFYLPGSYPHKHVVGDPLSVKVNSITSIDTEMPFSYYSLPFCKPQEGV  68

Query  412  KKSAENVGELLMGDQIDNSPYRFRMNVNET-LYLCTTGPLNEHHVKLLKQR  561
            K SAEN+GELLMGD+I+NSPYRF+M  NET ++LC T PL++ + +LLK+R
Sbjct  69   KDSAENLGELLMGDRIENSPYRFKMFTNETDIFLCKTDPLSKDNFELLKRR  119



>ref|XP_006453695.1| hypothetical protein CICLE_v10007695mg [Citrus clementina]
 gb|ESR66935.1| hypothetical protein CICLE_v10007695mg [Citrus clementina]
Length=653

 Score =   140 bits (354),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 65/111 (59%), Positives = 87/111 (78%), Gaps = 2/111 (2%)
 Frame = +1

Query  232  FSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGI  411
            F +F L S +  GFYLPG+Y H +   D + VKVNS+TSI+TE+PFSYY LP+C+P  G+
Sbjct  10   FVFFFLQSSS-FGFYLPGSYPHKHVVGDPLSVKVNSITSIDTEMPFSYYSLPFCKPQEGV  68

Query  412  KKSAENVGELLMGDQIDNSPYRFRMNVNET-LYLCTTGPLNEHHVKLLKQR  561
            K SAEN+GELLMGD+I+NSPYRF+M  NET ++LC T PL++ + +LLK+R
Sbjct  69   KDSAENLGELLMGDRIENSPYRFKMFTNETDIFLCKTDPLSKDNFELLKRR  119



>dbj|BAJ87923.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92724.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=670

 Score =   140 bits (354),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 63/102 (62%), Positives = 81/102 (79%), Gaps = 1/102 (1%)
 Frame = +1

Query  259  ACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKSAENVGE  438
            A H FYLPG+Y H YSP + + VKVNSLTSI+TE+P+SYY LP+C PP G+K SAEN+GE
Sbjct  29   AAHAFYLPGSYPHKYSPGEPLSVKVNSLTSIDTEIPYSYYSLPFCAPPEGVKDSAENLGE  88

Query  439  LLMGDQIDNSPYRFRMNVNET-LYLCTTGPLNEHHVKLLKQR  561
            LLMGD+I++SPYRFRM+ NE+ + LC + PL+     LLK+R
Sbjct  89   LLMGDRIESSPYRFRMHANESDVLLCRSPPLDPKTFALLKRR  130



>ref|XP_006359540.1| PREDICTED: transmembrane 9 superfamily member 4-like [Solanum 
tuberosum]
Length=657

 Score =   140 bits (353),  Expect = 3e-35, Method: Composition-based stats.
 Identities = 63/100 (63%), Positives = 81/100 (81%), Gaps = 1/100 (1%)
 Frame = +1

Query  265  HGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKSAENVGELL  444
            +GFYLPG+Y H Y   D + VKVNSLTSI+TELP+SYY LP+C+P  G+K SAEN+GELL
Sbjct  22   YGFYLPGSYPHKYEVGDLLNVKVNSLTSIDTELPYSYYSLPFCQPQEGVKDSAENLGELL  81

Query  445  MGDQIDNSPYRFRMNVNET-LYLCTTGPLNEHHVKLLKQR  561
            MGD+I+NSPYRF+M+ NET +++C T PL+    KLLK+R
Sbjct  82   MGDRIENSPYRFKMHSNETEIFMCQTKPLSGEEFKLLKKR  121



>ref|XP_009399549.1| PREDICTED: transmembrane 9 superfamily member 4-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009399550.1| PREDICTED: transmembrane 9 superfamily member 4-like [Musa acuminata 
subsp. malaccensis]
Length=669

 Score =   140 bits (353),  Expect = 3e-35, Method: Composition-based stats.
 Identities = 63/99 (64%), Positives = 77/99 (78%), Gaps = 1/99 (1%)
 Frame = +1

Query  268  GFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKSAENVGELLM  447
            GFYLPG+Y H Y   D + VKVNSLTSIETE+PF YY LP+CRP  GIK SAEN+GELLM
Sbjct  34   GFYLPGSYPHEYQVGDALSVKVNSLTSIETEMPFGYYSLPFCRPQEGIKDSAENLGELLM  93

Query  448  GDQIDNSPYRFRMNVNET-LYLCTTGPLNEHHVKLLKQR  561
            GD+I+NSPYRF+M  NE+ ++LC + PL+     LLK+R
Sbjct  94   GDRIENSPYRFKMFTNESDVFLCGSNPLSSQDFDLLKKR  132



>ref|NP_001048399.1| Os02g0797700 [Oryza sativa Japonica Group]
 dbj|BAD36050.1| putative endomembrane protein emp70 precursor [Oryza sativa Japonica 
Group]
 dbj|BAF10313.1| Os02g0797700 [Oryza sativa Japonica Group]
 dbj|BAG91235.1| unnamed protein product [Oryza sativa Japonica Group]
Length=665

 Score =   140 bits (353),  Expect = 4e-35, Method: Composition-based stats.
 Identities = 62/99 (63%), Positives = 80/99 (81%), Gaps = 1/99 (1%)
 Frame = +1

Query  268  GFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKSAENVGELLM  447
            GFYLPG+Y H Y+P + + VKVNSLTSI+TE+P+SYY LP+C PP G+K SAEN+GELLM
Sbjct  27   GFYLPGSYPHKYNPGEPLSVKVNSLTSIDTEIPYSYYSLPFCTPPDGVKDSAENLGELLM  86

Query  448  GDQIDNSPYRFRMNVNET-LYLCTTGPLNEHHVKLLKQR  561
            GD+I+NSPYRFRM+ N++ L+LC + PL      LLK+R
Sbjct  87   GDRIENSPYRFRMHANDSDLFLCRSPPLAADAFNLLKKR  125



>ref|XP_011084037.1| PREDICTED: transmembrane 9 superfamily member 11 [Sesamum indicum]
Length=657

 Score =   140 bits (352),  Expect = 5e-35, Method: Composition-based stats.
 Identities = 65/112 (58%), Positives = 82/112 (73%), Gaps = 1/112 (1%)
 Frame = +1

Query  229  AFSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGG  408
            A   F+       GFYLPG+Y H Y   D + +KVNSLTSI+TE+PFSYY LP+C+P  G
Sbjct  11   AMLIFMAFVQLGQGFYLPGSYPHKYGIGDYLNMKVNSLTSIDTEIPFSYYSLPFCQPKEG  70

Query  409  IKKSAENVGELLMGDQIDNSPYRFRMNVNET-LYLCTTGPLNEHHVKLLKQR  561
            IK SAEN+GELLMGD+I+NSPYRF+M  NE+ ++LC T PL+    KLLK+R
Sbjct  71   IKDSAENLGELLMGDRIENSPYRFKMYTNESDIFLCQTKPLSADEFKLLKKR  122



>ref|XP_001763301.1| predicted protein [Physcomitrella patens]
 gb|EDQ71831.1| predicted protein [Physcomitrella patens]
Length=645

 Score =   139 bits (351),  Expect = 5e-35, Method: Composition-based stats.
 Identities = 62/100 (62%), Positives = 77/100 (77%), Gaps = 1/100 (1%)
 Frame = +1

Query  265  HGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKSAENVGELL  444
              FYLPGTY+H Y   D++ VKVNSLTSIETELP+SYY LP+C+PP GI+K AEN+GE+L
Sbjct  7    QAFYLPGTYLHPYKKGDKLEVKVNSLTSIETELPYSYYSLPFCKPPEGIQKMAENIGEML  66

Query  445  MGDQIDNSPYRFRMNVNET-LYLCTTGPLNEHHVKLLKQR  561
            MGDQI+NSPY+F+M V++  L  C   PL E+ VK   QR
Sbjct  67   MGDQIENSPYKFQMKVDQKDLLACVAPPLTENDVKHFNQR  106



>ref|XP_007155122.1| hypothetical protein PHAVU_003G175400g [Phaseolus vulgaris]
 gb|ESW27116.1| hypothetical protein PHAVU_003G175400g [Phaseolus vulgaris]
Length=673

 Score =   140 bits (352),  Expect = 5e-35, Method: Composition-based stats.
 Identities = 61/111 (55%), Positives = 86/111 (77%), Gaps = 1/111 (1%)
 Frame = +1

Query  232  FSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGI  411
            F +  L+  + +GFYLPG+Y H Y   D++ VKVNSLTSI+TE+PFSYY LP+C+P GG+
Sbjct  27   FFFMCLLFQSGNGFYLPGSYPHKYGIGDELWVKVNSLTSIDTEMPFSYYSLPFCKPEGGV  86

Query  412  KKSAENVGELLMGDQIDNSPYRFRMNVNET-LYLCTTGPLNEHHVKLLKQR  561
            K SAEN+GELL+GD+I+NSPYRF+M+ NE+ ++LC    L+    K+L++R
Sbjct  87   KDSAENLGELLVGDRIENSPYRFKMHTNESEMFLCQLDKLSGDQFKILQKR  137



>ref|XP_004954235.1| PREDICTED: transmembrane 9 superfamily member 4-like [Setaria 
italica]
Length=661

 Score =   139 bits (351),  Expect = 7e-35, Method: Composition-based stats.
 Identities = 62/99 (63%), Positives = 79/99 (80%), Gaps = 1/99 (1%)
 Frame = +1

Query  268  GFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKSAENVGELLM  447
            GFYLPG+Y H Y+P + + VKVNSLTSI+TE+PFSYY LP+C PP G+K SAEN+GELLM
Sbjct  27   GFYLPGSYPHKYNPGEPLSVKVNSLTSIDTEMPFSYYSLPFCVPPEGVKDSAENLGELLM  86

Query  448  GDQIDNSPYRFRMNVNET-LYLCTTGPLNEHHVKLLKQR  561
            GD+I+NSPYRF+M  NE+ ++LC + PL      LLK+R
Sbjct  87   GDRIENSPYRFKMYTNESDVFLCRSAPLAPDAFALLKKR  125



>emb|CBI25602.3| unnamed protein product [Vitis vinifera]
Length=545

 Score =   138 bits (348),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 82/106 (77%), Gaps = 1/106 (1%)
 Frame = +1

Query  247  LISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKSAE  426
            L+     GFYLPG+Y H Y   + + VKVNSLTSI+TE+PFSYY LP+C+PP G+K SAE
Sbjct  16   LVFQCGCGFYLPGSYPHKYDIGNTLSVKVNSLTSIDTEMPFSYYSLPFCKPPEGVKDSAE  75

Query  427  NVGELLMGDQIDNSPYRFRMNVNET-LYLCTTGPLNEHHVKLLKQR  561
            N+GELLMGD+I+NSPYRF+M  NET ++LC + PL+    K+LK+R
Sbjct  76   NLGELLMGDRIENSPYRFKMYTNETQIFLCKSDPLSADDFKILKKR  121



>ref|XP_002977007.1| hypothetical protein SELMODRAFT_175941 [Selaginella moellendorffii]
 gb|EFJ22117.1| hypothetical protein SELMODRAFT_175941 [Selaginella moellendorffii]
Length=654

 Score =   139 bits (350),  Expect = 9e-35, Method: Composition-based stats.
 Identities = 68/114 (60%), Positives = 87/114 (76%), Gaps = 3/114 (3%)
 Frame = +1

Query  223  LAAFSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPP  402
            LAA +    I H    FYLPG+Y+H Y     +  KVNSLTSIETELP+SYY LP+C+P 
Sbjct  8    LAALAILCWI-HNAAAFYLPGSYLHAYPDGKDLYAKVNSLTSIETELPYSYYSLPFCQPQ  66

Query  403  GGIKKSAENVGELLMGDQIDNSPYRFRMNVNE-TLYLCTTGPLNEHHVKLLKQR  561
            GG+KKSAEN+GELLMGD+I++SPYRFRMN NE +++LCT   L+++ VK LK+R
Sbjct  67   GGVKKSAENLGELLMGDEIESSPYRFRMNTNESSIFLCTH-TLSDNDVKHLKRR  119



>ref|XP_011017952.1| PREDICTED: transmembrane 9 superfamily member 11 [Populus euphratica]
Length=657

 Score =   139 bits (349),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 60/106 (57%), Positives = 84/106 (79%), Gaps = 1/106 (1%)
 Frame = +1

Query  247  LISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKSAE  426
            ++  + HGFYLPG+Y H +   D + VKVNS+TSIETE+PFSYY LP+C+P  G+K SAE
Sbjct  16   MVLQSGHGFYLPGSYPHKHGIGDTLSVKVNSITSIETEIPFSYYSLPFCKPLEGVKDSAE  75

Query  427  NVGELLMGDQIDNSPYRFRMNVNET-LYLCTTGPLNEHHVKLLKQR  561
            N+GE+LMGD+I+NSPY+F+M +NE+ ++ C T PL+  + KLLK+R
Sbjct  76   NLGEVLMGDRIENSPYKFKMYINESDIFQCQTNPLSGENFKLLKKR  121



>ref|XP_007204607.1| hypothetical protein PRUPE_ppa002569mg [Prunus persica]
 gb|EMJ05806.1| hypothetical protein PRUPE_ppa002569mg [Prunus persica]
Length=657

 Score =   138 bits (348),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 63/106 (59%), Positives = 83/106 (78%), Gaps = 1/106 (1%)
 Frame = +1

Query  247  LISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKSAE  426
            LI  + +G+YLPG+Y H Y   D + VKVNSLTSI+TE+PFSYY LP+C+P  G+K SAE
Sbjct  16   LIFQSGYGWYLPGSYPHKYVVGDTLGVKVNSLTSIDTEIPFSYYSLPFCQPQDGVKDSAE  75

Query  427  NVGELLMGDQIDNSPYRFRMNVNET-LYLCTTGPLNEHHVKLLKQR  561
            N+GELLMGD+I+NSPY+F+M  NE+ ++LC TGPL+     LLK+R
Sbjct  76   NLGELLMGDRIENSPYQFKMYTNESEIFLCHTGPLSGDQFNLLKKR  121



>emb|CDY48716.1| BnaA09g09910D [Brassica napus]
Length=657

 Score =   138 bits (348),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 69/115 (60%), Positives = 85/115 (74%), Gaps = 4/115 (3%)
 Frame = +1

Query  220  YLAAFSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRP  399
            +LAA    I +  A   FYLPG+Y H Y   D + VKVNSLTSIETE+PFSYY LP+C+P
Sbjct  8    FLAAIFSLIQLGFA---FYLPGSYPHKYEVGDYLNVKVNSLTSIETEMPFSYYSLPFCQP  64

Query  400  PGGIKKSAENVGELLMGDQIDNSPYRFRMNVNET-LYLCTTGPLNEHHVKLLKQR  561
            P GIK SAEN+GELLMGD+I+NSPYRF+M  NE+ ++LC T  L+    KLLK+R
Sbjct  65   PEGIKDSAENLGELLMGDRIENSPYRFKMFKNESEIFLCQTEKLSGDGFKLLKKR  119



>ref|XP_002980747.1| hypothetical protein SELMODRAFT_444612 [Selaginella moellendorffii]
 gb|EFJ18398.1| hypothetical protein SELMODRAFT_444612 [Selaginella moellendorffii]
Length=654

 Score =   138 bits (347),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 64/103 (62%), Positives = 82/103 (80%), Gaps = 2/103 (2%)
 Frame = +1

Query  256  HACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKSAENVG  435
            H    FYLPG+Y+H Y     +  KVNSLTSIETELP+SYY LP+C+P GG+KKSAEN+G
Sbjct  18   HNAAAFYLPGSYLHAYPDGKDLYAKVNSLTSIETELPYSYYSLPFCQPQGGVKKSAENLG  77

Query  436  ELLMGDQIDNSPYRFRMNVNE-TLYLCTTGPLNEHHVKLLKQR  561
            ELLMGD+I++SPYRFRMN NE +++LCT   L+++ VK LK+R
Sbjct  78   ELLMGDEIESSPYRFRMNTNESSIFLCTH-TLSDNDVKHLKRR  119



>ref|XP_007013708.1| Endomembrane protein 70 protein family [Theobroma cacao]
 gb|EOY31327.1| Endomembrane protein 70 protein family [Theobroma cacao]
Length=654

 Score =   138 bits (347),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 63/106 (59%), Positives = 82/106 (77%), Gaps = 1/106 (1%)
 Frame = +1

Query  247  LISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKSAE  426
            L+  + +GFYLPG+Y H Y   D + VKVNSLTSI+TE+PFSYY LP+C+P  G+K SAE
Sbjct  13   LLFQSGYGFYLPGSYPHKYVVGDYLSVKVNSLTSIDTEMPFSYYSLPFCKPTEGVKDSAE  72

Query  427  NVGELLMGDQIDNSPYRFRMNVNET-LYLCTTGPLNEHHVKLLKQR  561
            N+GELLMGD+I+NSPYRF+M  NET ++LC +  L+    KLLK+R
Sbjct  73   NLGELLMGDRIENSPYRFKMYTNETEIFLCQSNKLSADDFKLLKKR  118



>ref|XP_004159402.1| PREDICTED: transmembrane 9 superfamily member 4-like [Cucumis 
sativus]
 gb|KGN60743.1| hypothetical protein Csa_2G009320 [Cucumis sativus]
Length=662

 Score =   138 bits (347),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 64/122 (52%), Positives = 88/122 (72%), Gaps = 5/122 (4%)
 Frame = +1

Query  211  RRRYLAAFSYFIL----ISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYY  378
            R + L+ F  ++L    I    +GFYLPG+Y H Y   D + VKVNSLTSIETELPF YY
Sbjct  5    RMKLLSRFRIWVLTCSLIFQLGYGFYLPGSYPHKYVVGDLLSVKVNSLTSIETELPFGYY  64

Query  379  DLPYCRPPGGIKKSAENVGELLMGDQIDNSPYRFRMNVNET-LYLCTTGPLNEHHVKLLK  555
             LP+C+P  G+K SAEN+GELLMGD+I+NSPY+F+M  N+T +++C++ PL     K++K
Sbjct  65   SLPFCKPSEGVKDSAENLGELLMGDRIENSPYQFKMFTNQTDIFMCSSDPLTSDQFKIMK  124

Query  556  QR  561
            +R
Sbjct  125  ER  126



>ref|XP_004139399.1| PREDICTED: transmembrane 9 superfamily member 4-like [Cucumis 
sativus]
Length=471

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/122 (52%), Positives = 88/122 (72%), Gaps = 5/122 (4%)
 Frame = +1

Query  211  RRRYLAAFSYFIL----ISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYY  378
            R + L+ F  ++L    I    +GFYLPG+Y H Y   D + VKVNSLTSIETELPF YY
Sbjct  5    RMKLLSRFRIWVLTCSLIFQLGYGFYLPGSYPHKYVVGDLLSVKVNSLTSIETELPFGYY  64

Query  379  DLPYCRPPGGIKKSAENVGELLMGDQIDNSPYRFRMNVNET-LYLCTTGPLNEHHVKLLK  555
             LP+C+P  G+K SAEN+GELLMGD+I+NSPY+F+M  N+T +++C++ PL     K++K
Sbjct  65   SLPFCKPSEGVKDSAENLGELLMGDRIENSPYQFKMFTNQTDIFMCSSDPLTSDQFKIMK  124

Query  556  QR  561
            +R
Sbjct  125  ER  126



>ref|XP_006353713.1| PREDICTED: transmembrane 9 superfamily member 4-like [Solanum 
tuberosum]
Length=655

 Score =   138 bits (347),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 62/99 (63%), Positives = 80/99 (81%), Gaps = 1/99 (1%)
 Frame = +1

Query  268  GFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKSAENVGELLM  447
            GFYLPG++ H Y   DQ+ VKVNSLTSI+TELP+ YY LP+C+P  G+K SAEN+GELLM
Sbjct  20   GFYLPGSFPHKYYVGDQLSVKVNSLTSIDTELPYGYYSLPFCKPLEGVKDSAENLGELLM  79

Query  448  GDQIDNSPYRFRMNVNET-LYLCTTGPLNEHHVKLLKQR  561
            GD+I+NSPYRF+M+VNE+ L+LC T  L+    K+LK+R
Sbjct  80   GDRIENSPYRFKMHVNESELFLCQTNALSADESKVLKER  118



>ref|XP_008242892.1| PREDICTED: transmembrane 9 superfamily member 4 [Prunus mume]
Length=657

 Score =   138 bits (347),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 62/106 (58%), Positives = 84/106 (79%), Gaps = 1/106 (1%)
 Frame = +1

Query  247  LISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKSAE  426
            LI  + +G+YLPG+Y H +   D + VKVNSLTSI+TE+PFSYY LP+C+P  G+K SAE
Sbjct  16   LIFQSGYGWYLPGSYPHKHVVGDTLGVKVNSLTSIDTEIPFSYYSLPFCQPQDGVKDSAE  75

Query  427  NVGELLMGDQIDNSPYRFRMNVNET-LYLCTTGPLNEHHVKLLKQR  561
            N+GELLMGD+I+NSPY+F+M+ NE+ ++LC TGPL+     LLK+R
Sbjct  76   NLGELLMGDRIENSPYQFKMHTNESEIFLCHTGPLSGDQFNLLKKR  121



>ref|XP_006283250.1| hypothetical protein CARUB_v10004286mg, partial [Capsella rubella]
 gb|EOA16148.1| hypothetical protein CARUB_v10004286mg, partial [Capsella rubella]
Length=681

 Score =   138 bits (347),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 64/99 (65%), Positives = 78/99 (79%), Gaps = 1/99 (1%)
 Frame = +1

Query  268  GFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKSAENVGELLM  447
            GFYLPG+Y H Y   D + VKVNSLTSIETE+PFSYY LP+C+P  GIK SAEN+GELLM
Sbjct  46   GFYLPGSYPHKYEVGDYLNVKVNSLTSIETEMPFSYYSLPFCKPSEGIKDSAENLGELLM  105

Query  448  GDQIDNSPYRFRMNVNET-LYLCTTGPLNEHHVKLLKQR  561
            GD+I+NSPYRF+M  NE+ ++LC T  L+    KLLK+R
Sbjct  106  GDRIENSPYRFKMFKNESEIFLCQTDKLSADSFKLLKKR  144



>ref|XP_002325161.2| hypothetical protein POPTR_0018s12150g [Populus trichocarpa]
 gb|EEF03726.2| hypothetical protein POPTR_0018s12150g [Populus trichocarpa]
Length=657

 Score =   137 bits (346),  Expect = 3e-34, Method: Composition-based stats.
 Identities = 60/106 (57%), Positives = 83/106 (78%), Gaps = 1/106 (1%)
 Frame = +1

Query  247  LISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKSAE  426
            ++  + HGFYLPG+Y H +   D + VKVNS+TSIETE+PFSYY LP+C+P  G+K SAE
Sbjct  16   MVFQSGHGFYLPGSYPHKHGIGDTLSVKVNSITSIETEMPFSYYSLPFCKPLEGVKDSAE  75

Query  427  NVGELLMGDQIDNSPYRFRMNVNET-LYLCTTGPLNEHHVKLLKQR  561
            N+GE+LMGD+I+NSPY+F+M  NE+ ++ C T PL+  + KLLK+R
Sbjct  76   NLGEVLMGDRIENSPYKFKMYTNESDIFQCQTDPLSGENFKLLKKR  121



>ref|XP_001752772.1| predicted protein [Physcomitrella patens]
 gb|EDQ82276.1| predicted protein [Physcomitrella patens]
Length=646

 Score =   137 bits (345),  Expect = 3e-34, Method: Composition-based stats.
 Identities = 61/107 (57%), Positives = 80/107 (75%), Gaps = 1/107 (1%)
 Frame = +1

Query  244  ILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKSA  423
            +L+    H FYLPGTY+H Y   D++ VKVNS+TSIETELP+SYY LP+CRPP GI K A
Sbjct  2    LLLFSPAHAFYLPGTYLHPYHKGDKLEVKVNSITSIETELPYSYYSLPFCRPPEGIHKVA  61

Query  424  ENVGELLMGDQIDNSPYRFRMNVNET-LYLCTTGPLNEHHVKLLKQR  561
            EN+GE+LMGDQI+NSPY+F+M +++  L  C    + E+ VK + QR
Sbjct  62   ENIGEMLMGDQIENSPYKFQMKIDQNDLLACVAPAMTENDVKHITQR  108



>ref|XP_007138440.1| hypothetical protein PHAVU_009G209100g [Phaseolus vulgaris]
 gb|ESW10434.1| hypothetical protein PHAVU_009G209100g [Phaseolus vulgaris]
Length=658

 Score =   137 bits (345),  Expect = 4e-34, Method: Composition-based stats.
 Identities = 64/121 (53%), Positives = 88/121 (73%), Gaps = 7/121 (6%)
 Frame = +1

Query  220  YLAAFSYFILIS------HACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYD  381
            Y A F  ++++          +GFYLPG+Y   +  +D++ VKVNSLTSI+TE+PFSYY 
Sbjct  3    YFAQFGLWVILILCSFQIQPNYGFYLPGSYPQKHGVTDELWVKVNSLTSIDTEMPFSYYS  62

Query  382  LPYCRPPGGIKKSAENVGELLMGDQIDNSPYRFRMNVNET-LYLCTTGPLNEHHVKLLKQ  558
            LP+C+P GGIK SAEN+GELLMGD+I+NSPYRF+M  NE+ +YLC    L+   +K+LK+
Sbjct  63   LPFCKPEGGIKDSAENLGELLMGDKIENSPYRFKMRNNESEIYLCQVEALSGDQLKILKE  122

Query  559  R  561
            R
Sbjct  123  R  123



>ref|XP_008456741.1| PREDICTED: transmembrane 9 superfamily member 4 [Cucumis melo]
Length=662

 Score =   137 bits (345),  Expect = 4e-34, Method: Composition-based stats.
 Identities = 61/106 (58%), Positives = 81/106 (76%), Gaps = 1/106 (1%)
 Frame = +1

Query  247  LISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKSAE  426
            LI    +GFYLPG+Y H Y   D + VKVNSLTSIETELPF YY LP+C+P  G+K SAE
Sbjct  21   LIFQLGYGFYLPGSYPHKYVVGDLLSVKVNSLTSIETELPFGYYSLPFCKPSEGVKDSAE  80

Query  427  NVGELLMGDQIDNSPYRFRMNVNET-LYLCTTGPLNEHHVKLLKQR  561
            N+GELLMGD+I+NSPY+F+M  N+T +++C++ PL     K++K+R
Sbjct  81   NLGELLMGDRIENSPYQFKMFTNQTDIFMCSSDPLTSDQFKIMKER  126



>gb|KFK30763.1| hypothetical protein AALP_AA6G023200 [Arabis alpina]
Length=658

 Score =   137 bits (344),  Expect = 6e-34, Method: Composition-based stats.
 Identities = 64/108 (59%), Positives = 82/108 (76%), Gaps = 1/108 (1%)
 Frame = +1

Query  241  FILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKS  420
            F+ +  +  GFYLPG+Y H Y   D + +KVNSLTSIETELPF+YY LP+C+P  GIK S
Sbjct  15   FLSVIQSGFGFYLPGSYPHKYEVGDYLNMKVNSLTSIETELPFTYYSLPFCKPSEGIKDS  74

Query  421  AENVGELLMGDQIDNSPYRFRMNVNET-LYLCTTGPLNEHHVKLLKQR  561
            AEN+GELLMGD+I+NSPYRF+M  NE+ ++LC T  L+    KLLK+R
Sbjct  75   AENLGELLMGDRIENSPYRFKMFKNESEIFLCQTEKLSADSFKLLKKR  122



>ref|NP_001147598.1| LOC100281207 precursor [Zea mays]
 gb|ACG28044.1| transmembrane 9 superfamily protein member 2 precursor [Zea mays]
Length=661

 Score =   136 bits (343),  Expect = 8e-34, Method: Composition-based stats.
 Identities = 62/99 (63%), Positives = 77/99 (78%), Gaps = 1/99 (1%)
 Frame = +1

Query  268  GFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKSAENVGELLM  447
            GFYLPG+Y H Y+  D + VKVNSLTSI+TE+PFSYY LP+C P  G+K SAEN+GELLM
Sbjct  26   GFYLPGSYPHKYNVGDDLNVKVNSLTSIDTEMPFSYYSLPFCEPQDGVKDSAENLGELLM  85

Query  448  GDQIDNSPYRFRMNVNET-LYLCTTGPLNEHHVKLLKQR  561
            GD+I+NSPYRFRM  NE+ ++LC + PL      LLK+R
Sbjct  86   GDRIENSPYRFRMYTNESDVFLCRSPPLGADAFSLLKKR  124



>gb|AFW73877.1| transmembrane 9 family protein member 2 [Zea mays]
Length=661

 Score =   136 bits (343),  Expect = 8e-34, Method: Composition-based stats.
 Identities = 62/99 (63%), Positives = 77/99 (78%), Gaps = 1/99 (1%)
 Frame = +1

Query  268  GFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKSAENVGELLM  447
            GFYLPG+Y H Y+  D + VKVNSLTSI+TE+PFSYY LP+C P  G+K SAEN+GELLM
Sbjct  26   GFYLPGSYPHKYNVGDDLNVKVNSLTSIDTEMPFSYYSLPFCEPQDGVKDSAENLGELLM  85

Query  448  GDQIDNSPYRFRMNVNET-LYLCTTGPLNEHHVKLLKQR  561
            GD+I+NSPYRFRM  NE+ ++LC + PL      LLK+R
Sbjct  86   GDRIENSPYRFRMYTNESDVFLCRSPPLGADAFSLLKKR  124



>gb|KJB07803.1| hypothetical protein B456_001G045300 [Gossypium raimondii]
Length=654

 Score =   135 bits (341),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 60/100 (60%), Positives = 80/100 (80%), Gaps = 1/100 (1%)
 Frame = +1

Query  265  HGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKSAENVGELL  444
            +GFYLPG+Y H Y   D + VKVNSLTSI+TE+PFSYY LP+C+P  G+K SAEN+GELL
Sbjct  19   YGFYLPGSYPHKYVVGDPLSVKVNSLTSIDTEMPFSYYSLPFCKPKEGVKDSAENLGELL  78

Query  445  MGDQIDNSPYRFRMNVNET-LYLCTTGPLNEHHVKLLKQR  561
            MGD+I+NSPY+F+M VNE+ ++LC +  ++    KLLK+R
Sbjct  79   MGDRIENSPYKFKMYVNESEIFLCQSNKVSADDFKLLKKR  118



>ref|XP_004146702.1| PREDICTED: transmembrane 9 superfamily member 4-like [Cucumis 
sativus]
 ref|XP_004162451.1| PREDICTED: transmembrane 9 superfamily member 4-like [Cucumis 
sativus]
 gb|KGN65219.1| hypothetical protein Csa_1G266160 [Cucumis sativus]
Length=657

 Score =   135 bits (341),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 62/106 (58%), Positives = 82/106 (77%), Gaps = 1/106 (1%)
 Frame = +1

Query  247  LISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKSAE  426
            LI  + +GFYLPG+Y   +   D + VKVNS+TSI+TE+PFSYY LP+C PPGG+K SAE
Sbjct  16   LIFQSGYGFYLPGSYPLKHVVGDDLSVKVNSITSIDTEMPFSYYSLPFCTPPGGVKDSAE  75

Query  427  NVGELLMGDQIDNSPYRFRMNVNET-LYLCTTGPLNEHHVKLLKQR  561
            N+GELLMGD+I+NSPY F+M  N+T ++LC T PL +  +K LK+R
Sbjct  76   NLGELLMGDRIENSPYLFKMYKNQTDVFLCQTDPLTDDQLKNLKER  121



>emb|CDY03353.1| BnaC09g09950D [Brassica napus]
Length=657

 Score =   135 bits (340),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 68/115 (59%), Positives = 84/115 (73%), Gaps = 4/115 (3%)
 Frame = +1

Query  220  YLAAFSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRP  399
            +LAA    I +  A   FYLPG+Y H Y   D + VKVNSLTSIETE+PFSYY LP+C+P
Sbjct  8    FLAAIFSLIQLGFA---FYLPGSYPHKYEVGDYLNVKVNSLTSIETEMPFSYYSLPFCQP  64

Query  400  PGGIKKSAENVGELLMGDQIDNSPYRFRMNVNET-LYLCTTGPLNEHHVKLLKQR  561
              GIK SAEN+GELLMGD+I+NSPYRF+M  NE+ ++LC T  L+    KLLK+R
Sbjct  65   SEGIKDSAENLGELLMGDRIENSPYRFKMFKNESEIFLCQTEKLSGDGFKLLKKR  119



>ref|XP_009112619.1| PREDICTED: transmembrane 9 superfamily member 4 [Brassica rapa]
Length=657

 Score =   135 bits (339),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 68/115 (59%), Positives = 84/115 (73%), Gaps = 4/115 (3%)
 Frame = +1

Query  220  YLAAFSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRP  399
            +LAA    I +  A   FYLPG+Y H Y   D + VKVNSLTSIETE+PFSYY LP+C+P
Sbjct  8    FLAAIFSLIQLGFA---FYLPGSYPHKYEVGDYLNVKVNSLTSIETEMPFSYYSLPFCQP  64

Query  400  PGGIKKSAENVGELLMGDQIDNSPYRFRMNVNET-LYLCTTGPLNEHHVKLLKQR  561
              GIK SAEN+GELLMGD+I+NSPYRF+M  NE+ ++LC T  L+    KLLK+R
Sbjct  65   SEGIKDSAENLGELLMGDRIENSPYRFKMFKNESEIFLCQTEKLSGDGFKLLKKR  119



>ref|XP_001752770.1| predicted protein [Physcomitrella patens]
 gb|EDQ82274.1| predicted protein [Physcomitrella patens]
Length=654

 Score =   135 bits (339),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 61/101 (60%), Positives = 77/101 (76%), Gaps = 1/101 (1%)
 Frame = +1

Query  262  CHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKSAENVGEL  441
              GFYLPG+Y+H Y   D++ VKVNS+TS+ETELP+SYY LP+CRP  GIKK AEN+GEL
Sbjct  18   VEGFYLPGSYLHPYKDGDELGVKVNSITSVETELPYSYYSLPFCRPKEGIKKVAENIGEL  77

Query  442  LMGDQIDNSPYRFRMNVN-ETLYLCTTGPLNEHHVKLLKQR  561
            LMGD+I+NSPY+F+M  N + + +C T PL E  VK   QR
Sbjct  78   LMGDEIENSPYKFKMRTNQQNVKVCETSPLTEKDVKHFHQR  118



>ref|XP_010088424.1| Transmembrane 9 superfamily member 4 [Morus notabilis]
 gb|EXB35914.1| Transmembrane 9 superfamily member 4 [Morus notabilis]
Length=656

 Score =   134 bits (337),  Expect = 5e-33, Method: Composition-based stats.
 Identities = 63/106 (59%), Positives = 79/106 (75%), Gaps = 1/106 (1%)
 Frame = +1

Query  247  LISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKSAE  426
            LI    +GFYLPG+Y H Y   D + VKVNSLTSI+TE+PFSYY LP+C+P  G+K SAE
Sbjct  16   LIFQLGYGFYLPGSYPHKYVVGDFLNVKVNSLTSIDTEMPFSYYSLPFCKPLEGVKDSAE  75

Query  427  NVGELLMGDQIDNSPYRFRMNVNET-LYLCTTGPLNEHHVKLLKQR  561
            N+GELLMGD+I+NSPYRF+M  NE+ +YLC    L+    KLL +R
Sbjct  76   NLGELLMGDRIENSPYRFKMYTNESEIYLCKVDALSADQFKLLTKR  121



>ref|XP_010045163.1| PREDICTED: transmembrane 9 superfamily member 4-like [Eucalyptus 
grandis]
 ref|XP_010045172.1| PREDICTED: transmembrane 9 superfamily member 4-like [Eucalyptus 
grandis]
 gb|KCW88574.1| hypothetical protein EUGRSUZ_A00954 [Eucalyptus grandis]
Length=641

 Score =   134 bits (336),  Expect = 7e-33, Method: Composition-based stats.
 Identities = 63/97 (65%), Positives = 77/97 (79%), Gaps = 0/97 (0%)
 Frame = +1

Query  271  FYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKSAENVGELLMG  450
            + L G+YMHTY+ +D I  KVNSLTSIET LPFSYY LPYC+P GGI++SA NVG  LMG
Sbjct  19   YSLGGSYMHTYTYNDYISAKVNSLTSIETLLPFSYYSLPYCKPEGGIQESAGNVGTALMG  78

Query  451  DQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQR  561
            +QI +S YRFR  VNE++YLCTT PL++H   LLKQ+
Sbjct  79   EQIVSSLYRFRGYVNESVYLCTTDPLSKHEAGLLKQQ  115



>ref|XP_006473949.1| PREDICTED: transmembrane 9 superfamily member 4-like [Citrus 
sinensis]
Length=653

 Score =   134 bits (336),  Expect = 8e-33, Method: Composition-based stats.
 Identities = 59/97 (61%), Positives = 79/97 (81%), Gaps = 1/97 (1%)
 Frame = +1

Query  274  YLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKSAENVGELLMGD  453
            YLPG+Y H +   D + VKVNS+TSI+TE+PFSYY LP+C+P  G+K SAEN+GELLMGD
Sbjct  23   YLPGSYPHKHVVGDPLSVKVNSITSIDTEMPFSYYSLPFCKPQEGVKDSAENLGELLMGD  82

Query  454  QIDNSPYRFRMNVNET-LYLCTTGPLNEHHVKLLKQR  561
            +I+NSPYRF+M  NET ++LC T PL++ + +LLK+R
Sbjct  83   RIENSPYRFKMYTNETDIFLCKTDPLSKDNFELLKRR  119



>ref|XP_010047177.1| PREDICTED: transmembrane 9 superfamily member 4 [Eucalyptus grandis]
 gb|KCW78996.1| hypothetical protein EUGRSUZ_C00422 [Eucalyptus grandis]
Length=657

 Score =   134 bits (336),  Expect = 8e-33, Method: Composition-based stats.
 Identities = 60/99 (61%), Positives = 78/99 (79%), Gaps = 1/99 (1%)
 Frame = +1

Query  268  GFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKSAENVGELLM  447
            G+YLPG+Y H YS  D + VKVNSLTSI+TE+P+SYY LP+C+P  G+K SAEN+GELLM
Sbjct  23   GYYLPGSYPHKYSVGDTLSVKVNSLTSIDTEIPYSYYSLPFCQPLEGVKDSAENLGELLM  82

Query  448  GDQIDNSPYRFRMNVNET-LYLCTTGPLNEHHVKLLKQR  561
            GD+I+NSPY+F+M  NE+ ++ C T PL     KLLK+R
Sbjct  83   GDRIENSPYQFKMYTNESEIFSCRTDPLTADSFKLLKER  121



>gb|KHG19964.1| Transmembrane 9 superfamily member 4 [Gossypium arboreum]
Length=654

 Score =   133 bits (335),  Expect = 9e-33, Method: Composition-based stats.
 Identities = 61/106 (58%), Positives = 82/106 (77%), Gaps = 1/106 (1%)
 Frame = +1

Query  247  LISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKSAE  426
            +I  + +GFYLPG+Y H     D + VKVNSLTSI+TE+PFSYY LP+C+P  G+K SAE
Sbjct  13   VIFQSGYGFYLPGSYPHKCVVGDPLSVKVNSLTSIDTEMPFSYYSLPFCKPKEGVKDSAE  72

Query  427  NVGELLMGDQIDNSPYRFRMNVNET-LYLCTTGPLNEHHVKLLKQR  561
            N+GELLMGD+I+NSPY+F+M VNE+ ++LC +  L+    KLLK+R
Sbjct  73   NLGELLMGDRIENSPYKFKMYVNESEIFLCQSKKLSADDFKLLKKR  118



>gb|ABK25111.1| unknown [Picea sitchensis]
Length=664

 Score =   133 bits (335),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 62/122 (51%), Positives = 85/122 (70%), Gaps = 8/122 (7%)
 Frame = +1

Query  220  YLAAFSYFILI-------SHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYY  378
            + + F  ++LI       +   + FYLPG+Y H+Y     + VKVNSLTS+ETELP+SYY
Sbjct  7    FCSGFGMWVLIMLGILGSTQNANAFYLPGSYPHSYPQGSDLWVKVNSLTSVETELPYSYY  66

Query  379  DLPYCRPPGGIKKSAENVGELLMGDQIDNSPYRFRMNVNET-LYLCTTGPLNEHHVKLLK  555
             LP+C+P  G+K  AEN+GELLMGD+I++SPYRFRMN NE+ ++LC T  L    +K+LK
Sbjct  67   SLPFCKPLDGVKDMAENLGELLMGDRIESSPYRFRMNDNESEIFLCNTTVLGAEQLKVLK  126

Query  556  QR  561
             R
Sbjct  127  HR  128



>gb|KCW88580.1| hypothetical protein EUGRSUZ_A00958 [Eucalyptus grandis]
Length=474

 Score =   132 bits (331),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 79/112 (71%), Gaps = 0/112 (0%)
 Frame = +1

Query  226  AAFSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPG  405
            +A   ++  + +   F L  +Y+HTY+  D I  +VNSL SI   LPFSYY +PYC+P G
Sbjct  4    SAIRNWVFFALSSIWFSLARSYVHTYAGDDLIFAEVNSLNSIANWLPFSYYSVPYCKPMG  63

Query  406  GIKKSAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQR  561
            GI++   NVG  LMGDQI NSPYRFR N+N+++YLCTT PL+EH  +LLKQR
Sbjct  64   GIRERVGNVGAALMGDQIVNSPYRFRGNINKSIYLCTTDPLSEHEARLLKQR  115



>gb|KDO47051.1| hypothetical protein CISIN_1g032114mg [Citrus sinensis]
Length=147

 Score =   124 bits (312),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 80/115 (70%), Gaps = 1/115 (1%)
 Frame = +1

Query  220  YLAAFSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRP  399
            Y+     F     +C GFYL   Y H +  SD + VKVNS+TSI+T++PFSYY L +C+P
Sbjct  17   YIWVLFVFFFFQSSCLGFYLRDNYPHKHVVSDPLSVKVNSITSIDTKMPFSYYSLSFCKP  76

Query  400  PGGIKKSAENVGELLMGDQIDNSPYRFRMNVNET-LYLCTTGPLNEHHVKLLKQR  561
              G+K SAEN GELLMGD+I+NSPYRF+   NET ++ C T PL++ + +LLK+R
Sbjct  77   QEGVKDSAENRGELLMGDRIENSPYRFKTYTNETDIFFCKTDPLSKDNFELLKRR  131



>ref|XP_010942153.1| PREDICTED: transmembrane 9 superfamily member 11-like [Elaeis 
guineensis]
Length=666

 Score =   132 bits (332),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 60/99 (61%), Positives = 75/99 (76%), Gaps = 1/99 (1%)
 Frame = +1

Query  268  GFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKSAENVGELLM  447
            GFYLPG+Y H Y   D + VKVNSLTSI+TE+P+ YY LP+C+P  GIK SAEN+GELLM
Sbjct  33   GFYLPGSYPHKYLVGDTLSVKVNSLTSIDTEIPYGYYSLPFCKPQEGIKDSAENLGELLM  92

Query  448  GDQIDNSPYRFRMNVNET-LYLCTTGPLNEHHVKLLKQR  561
            GD+I+NSPYRF+M  NE+ + LC   PL+     LLK+R
Sbjct  93   GDRIENSPYRFKMFTNESDVLLCRANPLSTQDFNLLKKR  131



>ref|XP_010067662.1| PREDICTED: transmembrane 9 superfamily member 4-like [Eucalyptus 
grandis]
Length=647

 Score =   132 bits (331),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 61/97 (63%), Positives = 75/97 (77%), Gaps = 0/97 (0%)
 Frame = +1

Query  271  FYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKSAENVGELLMG  450
            F L  +YMHTY+ +D I  +VNSLTSIET LP SYY LPYC P GGI++   NVG  L+G
Sbjct  19   FSLARSYMHTYAGNDLIFAQVNSLTSIETLLPLSYYSLPYCIPMGGIRECVGNVGASLVG  78

Query  451  DQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQR  561
            DQI NSPYRF+  VNE++YLCTTGPL+ H V++LKQ+
Sbjct  79   DQIINSPYRFQGYVNESVYLCTTGPLSAHEVRILKQQ  115



>gb|KJB64580.1| hypothetical protein B456_010G054800 [Gossypium raimondii]
Length=642

 Score =   130 bits (326),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 61/106 (58%), Positives = 80/106 (75%), Gaps = 1/106 (1%)
 Frame = +1

Query  247  LISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKSAE  426
            LI  + +GFYLPG+Y   +   + + VKVNSLTSI+TE+PFSYY LP+C P  G+K SAE
Sbjct  13   LIFQSGYGFYLPGSYPLKHVVGNYLSVKVNSLTSIDTEMPFSYYSLPFCNPVEGVKDSAE  72

Query  427  NVGELLMGDQIDNSPYRFRMNVNET-LYLCTTGPLNEHHVKLLKQR  561
            N+GELLMGD+I+NSPYRF+M+ NET ++LC T  L+    KLL +R
Sbjct  73   NLGELLMGDRIENSPYRFKMHTNETEIFLCQTNKLSSDDFKLLTKR  118



>ref|XP_010652098.1| PREDICTED: transmembrane 9 superfamily member 11-like [Vitis 
vinifera]
 emb|CBI32312.3| unnamed protein product [Vitis vinifera]
Length=664

 Score =   130 bits (327),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 56/99 (57%), Positives = 78/99 (79%), Gaps = 1/99 (1%)
 Frame = +1

Query  268  GFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKSAENVGELLM  447
             FYLPG+Y H Y   D + VKVNSLTSIETE+P+ YY LP+C+P  G++ S EN+GELLM
Sbjct  28   AFYLPGSYPHRYGDGDLLSVKVNSLTSIETEMPYGYYTLPFCKPIDGVQNSRENLGELLM  87

Query  448  GDQIDNSPYRFRMNVNET-LYLCTTGPLNEHHVKLLKQR  561
            GD+I++SPYRF+  VNET +++C+TGPL++   +++K R
Sbjct  88   GDRIESSPYRFKSYVNETDVFVCSTGPLSKEEARIMKLR  126



>ref|XP_006478582.1| PREDICTED: transmembrane 9 superfamily member 2-like isoform 
X3 [Citrus sinensis]
Length=223

 Score =   124 bits (310),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 80/115 (70%), Gaps = 1/115 (1%)
 Frame = +1

Query  220  YLAAFSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRP  399
            Y+     F     +C GFYL   Y H +  SD + VKVNS+TSI+T++PFSYY L +C+P
Sbjct  17   YIWVLFVFFFFQSSCLGFYLRDNYPHKHVVSDPLSVKVNSITSIDTKMPFSYYSLSFCKP  76

Query  400  PGGIKKSAENVGELLMGDQIDNSPYRFRMNVNET-LYLCTTGPLNEHHVKLLKQR  561
              G+K SAEN GELLMGD+I+NSPYRF+   NET ++ C T PL++ + +LLK+R
Sbjct  77   QEGVKDSAENRGELLMGDRIENSPYRFKTYTNETDIFFCKTDPLSKDNFELLKRR  131



>gb|EPS67343.1| hypothetical protein M569_07431, partial [Genlisea aurea]
Length=632

 Score =   128 bits (322),  Expect = 5e-31, Method: Composition-based stats.
 Identities = 58/98 (59%), Positives = 73/98 (74%), Gaps = 1/98 (1%)
 Frame = +1

Query  268  GFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKSAENVGELLM  447
            GFYLPG+Y H Y   D + VKVNSLTS+ETELP+ YY  P+C P  G+K SAEN+GELLM
Sbjct  1    GFYLPGSYPHRYGTGDPLYVKVNSLTSVETELPYGYYTFPFCLPEDGVKDSAENLGELLM  60

Query  448  GDQIDNSPYRFRMNVNET-LYLCTTGPLNEHHVKLLKQ  558
            GD+I+ SPYRF+M  NE+ ++LC T PL+    K LK+
Sbjct  61   GDRIETSPYRFKMMTNESDIFLCRTKPLSYREFKRLKK  98



>ref|XP_006478581.1| PREDICTED: transmembrane 9 superfamily member 2-like isoform 
X2 [Citrus sinensis]
Length=266

 Score =   124 bits (311),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 80/115 (70%), Gaps = 1/115 (1%)
 Frame = +1

Query  220  YLAAFSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRP  399
            Y+     F     +C GFYL   Y H +  SD + VKVNS+TSI+T++PFSYY L +C+P
Sbjct  17   YIWVLFVFFFFQSSCLGFYLRDNYPHKHVVSDPLSVKVNSITSIDTKMPFSYYSLSFCKP  76

Query  400  PGGIKKSAENVGELLMGDQIDNSPYRFRMNVNET-LYLCTTGPLNEHHVKLLKQR  561
              G+K SAEN GELLMGD+I+NSPYRF+   NET ++ C T PL++ + +LLK+R
Sbjct  77   QEGVKDSAENRGELLMGDRIENSPYRFKTYTNETDIFFCKTDPLSKDNFELLKRR  131



>gb|KJB64579.1| hypothetical protein B456_010G054800 [Gossypium raimondii]
Length=465

 Score =   127 bits (318),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 80/106 (75%), Gaps = 1/106 (1%)
 Frame = +1

Query  247  LISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKSAE  426
            LI  + +GFYLPG+Y   +   + + VKVNSLTSI+TE+PFSYY LP+C P  G+K SAE
Sbjct  13   LIFQSGYGFYLPGSYPLKHVVGNYLSVKVNSLTSIDTEMPFSYYSLPFCNPVEGVKDSAE  72

Query  427  NVGELLMGDQIDNSPYRFRMNVNET-LYLCTTGPLNEHHVKLLKQR  561
            N+GELLMGD+I+NSPYRF+M+ NET ++LC T  L+    KLL +R
Sbjct  73   NLGELLMGDRIENSPYRFKMHTNETEIFLCQTNKLSSDDFKLLTKR  118



>ref|XP_006478580.1| PREDICTED: transmembrane 9 superfamily member 2-like isoform 
X1 [Citrus sinensis]
Length=267

 Score =   124 bits (311),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 80/115 (70%), Gaps = 1/115 (1%)
 Frame = +1

Query  220  YLAAFSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRP  399
            Y+     F     +C GFYL   Y H +  SD + VKVNS+TSI+T++PFSYY L +C+P
Sbjct  17   YIWVLFVFFFFQSSCLGFYLRDNYPHKHVVSDPLSVKVNSITSIDTKMPFSYYSLSFCKP  76

Query  400  PGGIKKSAENVGELLMGDQIDNSPYRFRMNVNET-LYLCTTGPLNEHHVKLLKQR  561
              G+K SAEN GELLMGD+I+NSPYRF+   NET ++ C T PL++ + +LLK+R
Sbjct  77   QEGVKDSAENRGELLMGDRIENSPYRFKTYTNETDIFFCKTDPLSKDNFELLKRR  131



>gb|KCW88575.1| hypothetical protein EUGRSUZ_A00955 [Eucalyptus grandis]
Length=622

 Score =   126 bits (316),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = +1

Query  292  MHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKSAENVGELLMGDQIDNSP  471
            MHTY+ +D I  +VNSLTSIET LP SYY LPYC P GGI++   NVG  L+GDQI NSP
Sbjct  1    MHTYAGNDLIFAQVNSLTSIETLLPLSYYSLPYCIPMGGIRECVGNVGASLVGDQIINSP  60

Query  472  YRFRMNVNETLYLCTTGPLNEHHVKLLKQR  561
            YRF+  VNE++YLCTTGPL+ H V++LKQ+
Sbjct  61   YRFQGYVNESVYLCTTGPLSAHEVRILKQQ  90



>ref|XP_010928520.1| PREDICTED: transmembrane 9 superfamily member 11-like [Elaeis 
guineensis]
Length=655

 Score =   122 bits (305),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 55/101 (54%), Positives = 74/101 (73%), Gaps = 1/101 (1%)
 Frame = +1

Query  262  CHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKSAENVGEL  441
            CH FY+  +Y H YS  + + VKVNSLTSI+TEL + YY LP+C+P GGIK  A+N+GEL
Sbjct  22   CHVFYVARSYPHKYSVGEPLSVKVNSLTSIDTELSYGYYSLPFCQPRGGIKDMAQNLGEL  81

Query  442  LMGDQIDNSPYRFRMNVNET-LYLCTTGPLNEHHVKLLKQR  561
             MGD+I+ SPY F+M  NE+ L+LC +GPL+     LL++R
Sbjct  82   FMGDRIEKSPYHFKMLTNESDLFLCRSGPLSADDFNLLRKR  122



>gb|EEE68403.1| hypothetical protein OsJ_26757 [Oryza sativa Japonica Group]
Length=580

 Score =   119 bits (299),  Expect = 6e-28, Method: Composition-based stats.
 Identities = 55/112 (49%), Positives = 73/112 (65%), Gaps = 4/112 (4%)
 Frame = +1

Query  238  YFILISHACH----GFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPG  405
            + IL+  + H     FYLPG+Y H Y P + +  KVNSLTS  ++LPF YY LP+C P G
Sbjct  16   FLILLLRSGHSPAAAFYLPGSYPHRYRPGEALAAKVNSLTSPSSKLPFPYYSLPFCAPQG  75

Query  406  GIKKSAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQR  561
            G+ ++AE++GELL+GD+I+ SPYRF M  N T +LC T PL      LL  R
Sbjct  76   GVNRAAESLGELLLGDRIETSPYRFSMLKNATAFLCRTDPLPPATADLLMFR  127



>dbj|BAD01346.1| endosomal protein-like [Oryza sativa Japonica Group]
 dbj|BAD01360.1| endosomal protein-like [Oryza sativa Japonica Group]
Length=671

 Score =   119 bits (299),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 55/112 (49%), Positives = 73/112 (65%), Gaps = 4/112 (4%)
 Frame = +1

Query  238  YFILISHACH----GFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPG  405
            + IL+  + H     FYLPG+Y H Y P + +  KVNSLTS  ++LPF YY LP+C P G
Sbjct  16   FLILLLRSGHSPAAAFYLPGSYPHRYRPGEALAAKVNSLTSPSSKLPFPYYSLPFCAPQG  75

Query  406  GIKKSAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQR  561
            G+ ++AE++GELL+GD+I+ SPYRF M  N T +LC T PL      LL  R
Sbjct  76   GVNRAAESLGELLLGDRIETSPYRFSMLKNATAFLCRTDPLPPATADLLMFR  127



>ref|NP_001061455.1| Os08g0288400 [Oryza sativa Japonica Group]
 dbj|BAD01345.1| endosomal protein-like [Oryza sativa Japonica Group]
 dbj|BAD01359.1| endosomal protein-like [Oryza sativa Japonica Group]
 dbj|BAF23369.1| Os08g0288400 [Oryza sativa Japonica Group]
Length=667

 Score =   118 bits (296),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 55/112 (49%), Positives = 73/112 (65%), Gaps = 4/112 (4%)
 Frame = +1

Query  238  YFILISHACH----GFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPG  405
            + IL+  + H     FYLPG+Y H Y P + +  KVNSLTS  ++LPF YY LP+C P G
Sbjct  16   FLILLLRSGHSPAAAFYLPGSYPHRYRPGEALAAKVNSLTSPSSKLPFPYYSLPFCAPQG  75

Query  406  GIKKSAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQR  561
            G+ ++AE++GELL+GD+I+ SPYRF M  N T +LC T PL      LL  R
Sbjct  76   GVNRAAESLGELLLGDRIETSPYRFSMLKNATAFLCRTDPLPPATADLLMFR  127



>gb|EAZ06398.1| hypothetical protein OsI_28628 [Oryza sativa Indica Group]
Length=671

 Score =   117 bits (292),  Expect = 8e-27, Method: Composition-based stats.
 Identities = 54/112 (48%), Positives = 72/112 (64%), Gaps = 4/112 (4%)
 Frame = +1

Query  238  YFILISHACH----GFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPG  405
            + IL+  + H     FYLPG+Y   Y P + +  KVNSLTS  ++LPF YY LP+C P G
Sbjct  16   FLILLLRSGHSPAAAFYLPGSYPQRYRPGEALAAKVNSLTSPSSKLPFPYYSLPFCAPQG  75

Query  406  GIKKSAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQR  561
            G+ ++AE++GELL+GD+I+ SPYRF M  N T +LC T PL      LL  R
Sbjct  76   GVNRAAESLGELLLGDRIETSPYRFSMLKNATDFLCRTDPLPPATADLLMSR  127



>ref|XP_004973181.1| PREDICTED: transmembrane 9 superfamily member 4-like [Setaria 
italica]
Length=668

 Score =   117 bits (292),  Expect = 9e-27, Method: Composition-based stats.
 Identities = 56/118 (47%), Positives = 77/118 (65%), Gaps = 6/118 (5%)
 Frame = +1

Query  223  LAAFSYFILISHACH----GFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPY  390
            ++AF   IL++H+ H     FYLPG+Y   Y P D +  KVNSLTS  ++LP+ YY LP+
Sbjct  9    ISAF-LLILLTHSGHCPAAAFYLPGSYPQRYRPGDTLAAKVNSLTSPSSKLPYPYYSLPF  67

Query  391  CRPPGGIKKSAENVGELLMGDQIDNSPYRFRM-NVNETLYLCTTGPLNEHHVKLLKQR  561
            C P  G+  +AE++GELL+GD+I+ SPYRF M N    L+LC T PL     +L+K R
Sbjct  68   CAPQDGVHHAAESLGELLLGDRIETSPYRFSMLNNTAPLFLCRTDPLTPGATELIKSR  125



>gb|EMT03801.1| Transmembrane 9 superfamily member 2 [Aegilops tauschii]
Length=317

 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/100 (51%), Positives = 69/100 (69%), Gaps = 2/100 (2%)
 Frame = +1

Query  268  GFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKSAENVGELLM  447
             FYLPG+Y H Y P + +  KVNSLTS  ++LPF YY LP C P GG+ ++AE++GELL+
Sbjct  27   AFYLPGSYPHRYLPGEALAAKVNSLTSPSSKLPFPYYSLPLCAPQGGVNRAAESLGELLL  86

Query  448  GDQIDNSPYRFRMNVNET--LYLCTTGPLNEHHVKLLKQR  561
            GD+I+ SPYRF M  N T  L+LC T P++     L++ R
Sbjct  87   GDRIETSPYRFSMLTNSTAALFLCRTDPVSPAAADLIRSR  126



>ref|XP_008650370.1| PREDICTED: transmembrane 9 superfamily member 4-like [Zea mays]
 tpg|DAA43023.1| TPA: hypothetical protein ZEAMMB73_762936 [Zea mays]
Length=669

 Score =   114 bits (286),  Expect = 7e-26, Method: Composition-based stats.
 Identities = 54/112 (48%), Positives = 72/112 (64%), Gaps = 6/112 (5%)
 Frame = +1

Query  244  ILISHACH----GFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGI  411
            IL  H+ H     FYLPG+Y   Y P D    KVNSLTS  ++LP+ YY LP+C P  G+
Sbjct  17   ILFIHSGHSPTAAFYLPGSYPQRYRPGDTFAAKVNSLTSPSSKLPYPYYSLPFCAPQHGV  76

Query  412  KKSAENVGELLMGDQIDNSPYRFRM--NVNETLYLCTTGPLNEHHVKLLKQR  561
            + +AE++GELL+GD+I+ SPYRF M  N    L+LC T PL+    +L+K R
Sbjct  77   RHAAESLGELLLGDRIETSPYRFSMLNNTASPLFLCRTDPLSPGTAELIKSR  128



>ref|XP_002465960.1| hypothetical protein SORBIDRAFT_01g049000 [Sorghum bicolor]
 gb|EER92958.1| hypothetical protein SORBIDRAFT_01g049000 [Sorghum bicolor]
Length=670

 Score =   114 bits (285),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 56/119 (47%), Positives = 76/119 (64%), Gaps = 7/119 (6%)
 Frame = +1

Query  223  LAAFSYFILISHACH----GFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPY  390
            ++AF   IL  H+ H     FYLPG+Y   Y P D +  KVNSLTS  ++LP+ YY LP+
Sbjct  12   ISAF-LLILFIHSGHSPAAAFYLPGSYPQRYRPGDTLAAKVNSLTSPSSKLPYPYYSLPF  70

Query  391  CRPPGGIKKSAENVGELLMGDQIDNSPYRFRM--NVNETLYLCTTGPLNEHHVKLLKQR  561
            C P  G + +AE++GELL+GD+I+ SPYRF M  N    L+LC T PL+    +L+K R
Sbjct  71   CAPQHGARHAAESLGELLLGDRIETSPYRFSMLNNTTTPLFLCRTDPLSPGTTELIKSR  129



>ref|XP_003571616.1| PREDICTED: transmembrane 9 superfamily member 4 [Brachypodium 
distachyon]
Length=688

 Score =   113 bits (282),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 54/115 (47%), Positives = 71/115 (62%), Gaps = 8/115 (7%)
 Frame = +1

Query  241  FILISHA-----CHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPG  405
            FIL  H+        FYLPG+Y   Y P D +  KVNSLTS  ++LPF YY LP+C P  
Sbjct  15   FILFLHSHNTSPATAFYLPGSYPQRYRPGDALSAKVNSLTSASSKLPFPYYSLPFCAPQD  74

Query  406  GIKKSAENVGELLMGDQIDNSPYRFRMNVNET---LYLCTTGPLNEHHVKLLKQR  561
            G+ ++AE++GELL+GD+I+ SPYRF M  N T    +LC T PL+     L + R
Sbjct  75   GVNRAAESLGELLLGDRIETSPYRFSMLRNSTGGPFFLCHTDPLSPAAAALFRSR  129



>ref|XP_002308473.2| hypothetical protein POPTR_0006s22900g [Populus trichocarpa]
 gb|EEE91996.2| hypothetical protein POPTR_0006s22900g [Populus trichocarpa]
Length=127

 Score = 99.8 bits (247),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 60/77 (78%), Gaps = 0/77 (0%)
 Frame = +1

Query  265  HGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKSAENVGELL  444
            HGFYL G+Y H Y  +D + VKVNS+TSI+TE+PFSYY LP+C+   G+K S +N+GE+L
Sbjct  50   HGFYLSGSYPHKYGIADTLSVKVNSVTSIKTEIPFSYYSLPFCKLLEGVKYSVKNLGEVL  109

Query  445  MGDQIDNSPYRFRMNVN  495
            MG +I+NSPY+ +M  N
Sbjct  110  MGYRIENSPYKLKMYTN  126



>gb|KFK32680.1| hypothetical protein AALP_AA6G274800 [Arabis alpina]
Length=634

 Score =   105 bits (261),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 52/113 (46%), Positives = 72/113 (64%), Gaps = 2/113 (2%)
 Frame = +1

Query  223  LAAFSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPP  402
             A   +F LI++  HGFYLPG     +   D ++VKVN LTS +T+LP+SYY LPYCR P
Sbjct  6    FACIVFFFLITNV-HGFYLPGVAPQDFQMGDALMVKVNKLTSTKTQLPYSYYSLPYCR-P  63

Query  403  GGIKKSAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQR  561
            G I  SAEN+GE+L GD+I+NSP+ F+M  ++         L+E   K  K++
Sbjct  64   GHIVDSAENLGEVLRGDRIENSPFVFKMRESQMCAAVCRVKLDEKSAKAFKEK  116



>gb|KDP33510.1| hypothetical protein JCGZ_07081 [Jatropha curcas]
Length=645

 Score =   103 bits (257),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 54/112 (48%), Positives = 71/112 (63%), Gaps = 2/112 (2%)
 Frame = +1

Query  226  AAFSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPG  405
            AA ++ ILI H  H FYLPG     +   D++ VKVN LTS +T+LP+SYY LPYCRP  
Sbjct  17   AALAFLILI-HGGHCFYLPGVAPEDFVKGDELKVKVNKLTSTKTQLPYSYYSLPYCRPT-  74

Query  406  GIKKSAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQR  561
             I  SAEN+GE+L GD+I+NSPY F+M   +   +     L+   VK  K+R
Sbjct  75   KIVDSAENLGEVLRGDRIENSPYVFKMREQKMCNIVCRLKLDAKTVKEFKER  126



>gb|KJB68422.1| hypothetical protein B456_010G2446002, partial [Gossypium raimondii]
Length=207

 Score = 98.2 bits (243),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 67/107 (63%), Gaps = 1/107 (1%)
 Frame = +1

Query  241  FILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKS  420
            F+ ++HA H FYLPG     +   D + VKVN LTSI+T+LP+SYY LP+C PP  I  S
Sbjct  20   FLFLAHAAHCFYLPGVAPEDFQKGDLLKVKVNKLTSIKTQLPYSYYSLPFC-PPKKIVDS  78

Query  421  AENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQR  561
             EN+GE+L GD+I+NSPY F+M   +   +     L+    K  K++
Sbjct  79   TENLGEVLRGDRIENSPYVFKMRDPQMCTVLCRITLDAKTAKQFKEK  125



>gb|AAW79375.1| putative endomembrane protein [Heterocapsa triquetra]
Length=204

 Score = 97.8 bits (242),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 64/101 (63%), Gaps = 1/101 (1%)
 Frame = +1

Query  250  ISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKSAEN  429
            +S    GFYLPG     Y   +++ +KVN LTS++T+LP++YY LPYC+P  GI+ S EN
Sbjct  12   VSAPALGFYLPGVAPIEYQDGNRVDLKVNKLTSVKTQLPYAYYSLPYCKPNEGIQDSVEN  71

Query  430  VGELLMGDQIDNSPYRFRMNVNETL-YLCTTGPLNEHHVKL  549
            +GE+L GD I+NSPY   M VNET   LC      EH  K 
Sbjct  72   LGEILEGDLIENSPYEIFMRVNETCKVLCNQNLTPEHKDKF  112



>ref|XP_009117241.1| PREDICTED: transmembrane 9 superfamily member 4 [Brassica rapa]
Length=638

 Score =   101 bits (252),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 50/107 (47%), Positives = 68/107 (64%), Gaps = 1/107 (1%)
 Frame = +1

Query  241  FILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKS  420
            F L S   HGFYLPG     +   D ++VKVN LTS +T+LP+SYY LPYCRP   I  S
Sbjct  15   FFLFSVNVHGFYLPGVAPQDFQMGDALMVKVNKLTSTKTQLPYSYYSLPYCRPE-KIVDS  73

Query  421  AENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQR  561
            AEN+GE+L GD+I+NSP+ F+M  ++         L++   K LK++
Sbjct  74   AENLGEVLRGDRIENSPFVFKMRESQMCAAVCRVKLDKKSAKALKEK  120



>ref|XP_006474609.1| PREDICTED: transmembrane 9 superfamily member 4-like [Citrus 
sinensis]
Length=605

 Score =   101 bits (252),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 47/91 (52%), Positives = 63/91 (69%), Gaps = 1/91 (1%)
 Frame = +1

Query  214  RRYLAAFSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYC  393
            +R +   S F+L+ H  H FYLPG     +   D++ VKVN LTS +T+LP+SYY LPYC
Sbjct  5    KRVVLIISVFVLLVHYSHCFYLPGVAPQDFQKGDELKVKVNKLTSTKTQLPYSYYSLPYC  64

Query  394  RPPGGIKKSAENVGELLMGDQIDNSPYRFRM  486
            +P   I  SAEN+GE+L GD+I+NSPY F+M
Sbjct  65   KPE-RIVDSAENLGEVLRGDRIENSPYVFKM  94



>ref|XP_006293373.1| hypothetical protein CARUB_v10022803mg, partial [Capsella rubella]
 gb|EOA26271.1| hypothetical protein CARUB_v10022803mg, partial [Capsella rubella]
Length=652

 Score =   101 bits (252),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 48/108 (44%), Positives = 71/108 (66%), Gaps = 1/108 (1%)
 Frame = +1

Query  238  YFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKK  417
            +F++++   HGFYLPG     +   D ++VKVN LTS +T+LP+SYY LPYCR P  I  
Sbjct  28   FFVVLNVNVHGFYLPGVAPQDFQMGDALMVKVNKLTSTKTQLPYSYYSLPYCR-PDHIVD  86

Query  418  SAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQR  561
            SAEN+GE+L GD+I+NSP+ F+M  ++         L++   K LK++
Sbjct  87   SAENLGEVLRGDRIENSPFVFKMRESQMCSAVCRVKLDKKTAKALKEK  134



>gb|KJB68423.1| hypothetical protein B456_010G2446002, partial [Gossypium raimondii]
Length=258

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 67/107 (63%), Gaps = 1/107 (1%)
 Frame = +1

Query  241  FILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKS  420
            F+ ++HA H FYLPG     +   D + VKVN LTSI+T+LP+SYY LP+C PP  I  S
Sbjct  20   FLFLAHAAHCFYLPGVAPEDFQKGDLLKVKVNKLTSIKTQLPYSYYSLPFC-PPKKIVDS  78

Query  421  AENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQR  561
             EN+GE+L GD+I+NSPY F+M   +   +     L+    K  K++
Sbjct  79   TENLGEVLRGDRIENSPYVFKMRDPQMCTVLCRITLDAKTAKQFKEK  125



>ref|XP_007136939.1| hypothetical protein PHAVU_009G086800g [Phaseolus vulgaris]
 gb|ESW08933.1| hypothetical protein PHAVU_009G086800g [Phaseolus vulgaris]
Length=636

 Score =   101 bits (251),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 51/115 (44%), Positives = 70/115 (61%), Gaps = 1/115 (1%)
 Frame = +1

Query  217  RYLAAFSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCR  396
            R LA  +  +L+ H  H FYLPG     +   DQ+ VKVN LTS +T+LP+SYY LPYC 
Sbjct  5    RSLAFSAVLLLLIHGAHCFYLPGVAPQDFQKGDQLQVKVNKLTSTKTQLPYSYYSLPYCP  64

Query  397  PPGGIKKSAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQR  561
            PP  I+ SAEN+GE+L GD+I+NS Y F+M   +   +     L+    K  K++
Sbjct  65   PP-KIQDSAENLGEVLRGDRIENSLYAFKMREPQMCNIVCNIKLDAKTAKEFKEK  118



>ref|XP_009616553.1| PREDICTED: transmembrane 9 superfamily member 4-like [Nicotiana 
tomentosiformis]
Length=641

 Score =   100 bits (250),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 50/115 (43%), Positives = 69/115 (60%), Gaps = 1/115 (1%)
 Frame = +1

Query  217  RYLAAFSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCR  396
            R+++      L S+  H FYLPG     +   D ++VKVN LTS +T+LP+SYY LPYC+
Sbjct  11   RWISVLVLICLFSYEAHCFYLPGVAPQDFQKGDPLMVKVNKLTSTKTQLPYSYYSLPYCK  70

Query  397  PPGGIKKSAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQR  561
            P   I  SAEN+GE+L GD+I+NSPY F M   +   +     LN    K LK++
Sbjct  71   PE-QIVDSAENLGEVLRGDRIENSPYEFHMREPQMCNVVCRTVLNAKTAKELKEK  124



>emb|CDY34792.1| BnaA09g41590D [Brassica napus]
 emb|CDX76830.1| BnaC08g34160D [Brassica napus]
Length=638

 Score =   100 bits (249),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 49/107 (46%), Positives = 68/107 (64%), Gaps = 1/107 (1%)
 Frame = +1

Query  241  FILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKS  420
            F + S   HGFYLPG     +   D ++VKVN LTS +T+LP+SYY LPYCRP   I  S
Sbjct  15   FFVFSVNVHGFYLPGVAPQDFQMGDALMVKVNKLTSTKTQLPYSYYSLPYCRPE-KIVDS  73

Query  421  AENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQR  561
            AEN+GE+L GD+I+NSP+ F+M  ++         L++   K LK++
Sbjct  74   AENLGEVLRGDRIENSPFVFKMRESQMCAAVCRVKLDKKSAKALKEK  120



>ref|NP_196645.2| endomembrane family protein 70 [Arabidopsis thaliana]
 sp|F4KIB2.1|TMN8_ARATH RecName: Full=Transmembrane 9 superfamily member 8; AltName: 
Full=Endomembrane protein 1; AltName: Full=Transmembrane nine 
protein 8; Short=AtTMN8; Flags: Precursor [Arabidopsis thaliana]
 gb|AED91602.1| endomembrane family protein 70 [Arabidopsis thaliana]
Length=648

 Score =   100 bits (248),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 47/107 (44%), Positives = 66/107 (62%), Gaps = 1/107 (1%)
 Frame = +1

Query  241  FILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKS  420
            F+L  H  H FYLPG     +   D++ VKVN LTSI+T+LP+SYY LP+CR P  I  S
Sbjct  24   FLLFIHGAHSFYLPGVAPQDFEKGDELKVKVNKLTSIKTQLPYSYYSLPFCR-PSKIVDS  82

Query  421  AENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQR  561
             EN+GE+L GD+I+N+PY F+M   +   +     L+    K  K++
Sbjct  83   TENLGEVLRGDRIENAPYSFKMREAQMCNILGRVTLDAKTAKAFKEK  129



>ref|XP_010552093.1| PREDICTED: transmembrane 9 superfamily member 4-like [Tarenaya 
hassleriana]
Length=644

 Score =   100 bits (248),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 46/88 (52%), Positives = 62/88 (70%), Gaps = 1/88 (1%)
 Frame = +1

Query  223  LAAFSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPP  402
            + A  +F+L  H+   FYLPG     +   D++ VKVN LTSI+T+LP+SYY LP+CRP 
Sbjct  15   VVAAVFFLLFIHSARSFYLPGVAPEDFEKGDELKVKVNKLTSIKTQLPYSYYSLPFCRPK  74

Query  403  GGIKKSAENVGELLMGDQIDNSPYRFRM  486
              I  SAEN+GE+L GD+I+NSPY F+M
Sbjct  75   -KIVDSAENLGEVLRGDRIENSPYVFKM  101



>gb|KJB63264.1| hypothetical protein B456_010G2446001 [Gossypium raimondii]
Length=644

 Score = 99.8 bits (247),  Expect = 9e-21, Method: Composition-based stats.
 Identities = 46/82 (56%), Positives = 59/82 (72%), Gaps = 1/82 (1%)
 Frame = +1

Query  241  FILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKS  420
            F+ + HA H FYLPG     +   D + VKVN LTSI+T+LP+SYY LP+C PP  I  S
Sbjct  21   FLFMIHAAHCFYLPGVSPEDFQKGDPLKVKVNKLTSIKTQLPYSYYSLPFC-PPKKIVDS  79

Query  421  AENVGELLMGDQIDNSPYRFRM  486
            AEN+GE+L GD+I+NSPY F+M
Sbjct  80   AENLGEVLRGDRIENSPYVFKM  101



>ref|XP_006287242.1| hypothetical protein CARUB_v10000429mg [Capsella rubella]
 gb|EOA20140.1| hypothetical protein CARUB_v10000429mg [Capsella rubella]
Length=646

 Score = 99.8 bits (247),  Expect = 9e-21, Method: Composition-based stats.
 Identities = 49/117 (42%), Positives = 69/117 (59%), Gaps = 1/117 (1%)
 Frame = +1

Query  211  RRRYLAAFSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPY  390
            RR  +      +L  HA H FYLPG     +   D++ VKVN LTSI+T+LP+SYY LP+
Sbjct  10   RRLQILGSVILLLFIHAAHSFYLPGVAPQDFEKGDELKVKVNKLTSIKTQLPYSYYSLPF  69

Query  391  CRPPGGIKKSAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQR  561
            CRP   I  S EN+GE+L GD+I+N+PY F+M   +   +     L+    K  K++
Sbjct  70   CRPK-KIVDSTENLGEVLRGDRIENAPYSFKMREAQMCNVLCRVTLDAKTAKAFKEK  125



>gb|KJB68421.1| hypothetical protein B456_010G2446002, partial [Gossypium raimondii]
Length=97

 Score = 92.8 bits (229),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 56/78 (72%), Gaps = 1/78 (1%)
 Frame = +1

Query  241  FILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKS  420
            F+ ++HA H FYLPG     +   D + VKVN LTSI+T+LP+SYY LP+C PP  I  S
Sbjct  20   FLFLAHAAHCFYLPGVAPEDFQKGDLLKVKVNKLTSIKTQLPYSYYSLPFC-PPKKIVDS  78

Query  421  AENVGELLMGDQIDNSPY  474
             EN+GE+L GD+I+NSPY
Sbjct  79   TENLGEVLRGDRIENSPY  96



>ref|XP_007011925.1| Endomembrane protein 70 protein family [Theobroma cacao]
 gb|EOY29544.1| Endomembrane protein 70 protein family [Theobroma cacao]
Length=638

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 50/110 (45%), Positives = 67/110 (61%), Gaps = 1/110 (1%)
 Frame = +1

Query  232  FSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGI  411
            FS F L     H FYLPG     +   D ++VKVN LTS +T+LP+SYY LPYCRP   I
Sbjct  12   FSLFALFVLRAHCFYLPGVAPEDFKKGDPLLVKVNKLTSTKTQLPYSYYSLPYCRPE-NI  70

Query  412  KKSAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQR  561
              SAEN+GE+L GD+I+NSPY F+M   +   +     L++   K  K++
Sbjct  71   VDSAENLGEVLRGDRIENSPYLFKMREPQMCNIVCRKILDKKTAKAFKEK  120



>ref|XP_010493756.1| PREDICTED: transmembrane 9 superfamily member 4-like [Camelina 
sativa]
Length=646

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 46/92 (50%), Positives = 61/92 (66%), Gaps = 1/92 (1%)
 Frame = +1

Query  211  RRRYLAAFSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPY  390
            RR  +      +L  HA H FYLPG     +   D++ VKVN LTSI+T+LP+SYY LP+
Sbjct  10   RRLQILGSVILLLFIHAAHSFYLPGVAPQDFEKGDELKVKVNKLTSIKTQLPYSYYSLPF  69

Query  391  CRPPGGIKKSAENVGELLMGDQIDNSPYRFRM  486
            CRP   I  S EN+GE+L GD+I+N+PY F+M
Sbjct  70   CRPK-KIVDSTENLGEVLRGDRIENAPYSFKM  100



>ref|XP_006404919.1| hypothetical protein EUTSA_v10000079mg [Eutrema salsugineum]
 gb|ESQ46372.1| hypothetical protein EUTSA_v10000079mg [Eutrema salsugineum]
Length=643

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 51/113 (45%), Positives = 70/113 (62%), Gaps = 2/113 (2%)
 Frame = +1

Query  223  LAAFSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPP  402
             A   +F L  H  HGFYLPG     +   D ++VKVN LTS +T+LP+SYY LPYCRP 
Sbjct  15   FACVMFFSLNVH-IHGFYLPGVAPQDFQIGDALMVKVNKLTSTKTQLPYSYYSLPYCRPE  73

Query  403  GGIKKSAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQR  561
              I  SAEN+GE+L GD+I+NSP+ F+M  ++         L++   K LK++
Sbjct  74   -KIVDSAENLGEVLRGDRIENSPFVFKMRESQMCAAVCRVKLDKKSAKALKEK  125



>gb|ETO25316.1| hypothetical protein RFI_11824 [Reticulomyxa filosa]
Length=210

 Score = 95.5 bits (236),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 54/74 (73%), Gaps = 0/74 (0%)
 Frame = +1

Query  268  GFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKSAENVGELLM  447
            GFYLPG   H Y   + I +KVN L S+ T++P+ YY LP+CRP  GIK+ AEN+GELL 
Sbjct  52   GFYLPGVAPHEYQVGEAIKLKVNKLDSVFTQMPYDYYSLPFCRPSEGIKQDAENLGELLS  111

Query  448  GDQIDNSPYRFRMN  489
            GD+I+NSP++  MN
Sbjct  112  GDKIENSPFKLAMN  125



>ref|XP_010525804.1| PREDICTED: transmembrane 9 superfamily member 4 [Tarenaya hassleriana]
Length=641

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 51/116 (44%), Positives = 71/116 (61%), Gaps = 3/116 (3%)
 Frame = +1

Query  214  RRYLAAFSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYC  393
            R  +AA + F  +    HGFYLPG     +   D ++VKVN LTS +T+LP+SYY LPYC
Sbjct  11   RVSIAALALFFFVH--VHGFYLPGVAPQDFQMGDALMVKVNKLTSTKTQLPYSYYSLPYC  68

Query  394  RPPGGIKKSAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQR  561
            R P  I  SAEN+GE+L GD+I+NSPY F+M  ++         L++   K  K++
Sbjct  69   R-PDHIVDSAENLGEVLRGDRIENSPYVFKMRESQMCAAVCRIKLDKKTSKAFKEK  123



>ref|XP_010454833.1| PREDICTED: transmembrane 9 superfamily member 4-like [Camelina 
sativa]
Length=646

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 49/117 (42%), Positives = 68/117 (58%), Gaps = 1/117 (1%)
 Frame = +1

Query  211  RRRYLAAFSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPY  390
            RR         +L  HA H FYLPG     +   D++ VKVN LTSI+T+LP+SYY LP+
Sbjct  10   RRLQFLGSVILLLFIHAAHSFYLPGVAPQDFEKGDELKVKVNKLTSIKTQLPYSYYSLPF  69

Query  391  CRPPGGIKKSAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQR  561
            CRP   I  S EN+GE+L GD+I+N+PY F+M   +   +     L+    K  K++
Sbjct  70   CRPK-KIVDSTENLGEVLRGDRIENAPYSFKMREAQMCNVLGRVTLDAKSAKAFKEK  125



>ref|XP_010101024.1| Transmembrane 9 superfamily member 4 [Morus notabilis]
 gb|EXB86672.1| Transmembrane 9 superfamily member 4 [Morus notabilis]
Length=640

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 45/88 (51%), Positives = 62/88 (70%), Gaps = 1/88 (1%)
 Frame = +1

Query  223  LAAFSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPP  402
            L+ F+ F+++ H  + FYLPG     +   D + VKVN LTS +T+LP+SYY LP+CRP 
Sbjct  12   LSIFAIFLVLIHGAYSFYLPGVAPEDFKQGDDLKVKVNKLTSTKTQLPYSYYSLPFCRPK  71

Query  403  GGIKKSAENVGELLMGDQIDNSPYRFRM  486
              I  SAEN+GE+L GD+I+NSPY F+M
Sbjct  72   -KIVDSAENLGEVLRGDRIENSPYVFKM  98



>ref|XP_002880556.1| hypothetical protein ARALYDRAFT_481272 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56815.1| hypothetical protein ARALYDRAFT_481272 [Arabidopsis lyrata subsp. 
lyrata]
Length=637

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 48/107 (45%), Positives = 68/107 (64%), Gaps = 1/107 (1%)
 Frame = +1

Query  241  FILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKS  420
            F  ++   HGFYLPG     +   D ++VKVN LTS +T+LP+SYY LPYCRP   I  S
Sbjct  14   FFFLNVNIHGFYLPGVAPQDFQMGDALMVKVNKLTSTKTQLPYSYYSLPYCRPE-HIVDS  72

Query  421  AENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQR  561
            AEN+GE+L GD+I+NSP+ F+M  ++         L++   K LK++
Sbjct  73   AENLGEVLRGDRIENSPFVFKMRESQMCAAVCRVKLDKKTAKALKEK  119



>ref|XP_002285526.1| PREDICTED: transmembrane 9 superfamily member 9 [Vitis vinifera]
 emb|CBI21143.3| unnamed protein product [Vitis vinifera]
Length=638

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 49/107 (46%), Positives = 67/107 (63%), Gaps = 1/107 (1%)
 Frame = +1

Query  241  FILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKS  420
             +L+ HA H FYLPG     +   D + VKVN LTS +T+LP++YY LPYCR PG I  +
Sbjct  15   LLLLIHASHCFYLPGVSPQDFQKGDPLKVKVNKLTSTKTQLPYTYYSLPYCR-PGKIVDN  73

Query  421  AENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQR  561
            AEN+GE+L GD+I+NSPY F+M   +   +     LN    K  K++
Sbjct  74   AENLGEVLRGDRIENSPYVFKMREPQLCNVICHLKLNAKTAKDFKEK  120



>emb|CDY40124.1| BnaC02g00060D [Brassica napus]
Length=642

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 49/116 (42%), Positives = 71/116 (61%), Gaps = 2/116 (2%)
 Frame = +1

Query  214  RRYLAAFSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYC  393
            RR   AF+  + I H  H FYLPG     +   D++ VKVN LTSI+T+LP+SYY LP+C
Sbjct  6    RRSAIAFTLLLFI-HVAHSFYLPGVAPQDFEKGDELKVKVNKLTSIKTQLPYSYYSLPFC  64

Query  394  RPPGGIKKSAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQR  561
            +P   I  S EN+GE+L GD+I+N+PY F+M   +   +     L++   K  K++
Sbjct  65   QPK-KIVDSTENLGEVLRGDRIENAPYLFKMREAKMCNVLCLVTLDDKTAKAFKEK  119



>ref|XP_009125272.1| PREDICTED: transmembrane 9 superfamily member 4-like [Brassica 
rapa]
Length=638

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 46/91 (51%), Positives = 62/91 (68%), Gaps = 2/91 (2%)
 Frame = +1

Query  214  RRYLAAFSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYC  393
            RR   AF+  + I H  H FYLPG     +   D++ VKVN LTSI+T+LP+SYY LP+C
Sbjct  6    RRSAIAFTLLLFI-HVAHSFYLPGVAPQDFEKGDELKVKVNKLTSIKTQLPYSYYSLPFC  64

Query  394  RPPGGIKKSAENVGELLMGDQIDNSPYRFRM  486
            +P   I  S EN+GE+L GD+I+N+PY F+M
Sbjct  65   QPK-KIVDSTENLGEVLRGDRIENAPYSFKM  94



>emb|CDX85741.1| BnaA02g00720D [Brassica napus]
Length=634

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 46/91 (51%), Positives = 62/91 (68%), Gaps = 2/91 (2%)
 Frame = +1

Query  214  RRYLAAFSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYC  393
            RR   AF+  + I H  H FYLPG     +   D++ VKVN LTSI+T+LP+SYY LP+C
Sbjct  6    RRSAIAFTLLLFI-HVAHSFYLPGVAPQDFEKGDELKVKVNKLTSIKTQLPYSYYSLPFC  64

Query  394  RPPGGIKKSAENVGELLMGDQIDNSPYRFRM  486
            +P   I  S EN+GE+L GD+I+N+PY F+M
Sbjct  65   QPK-KIVDSTENLGEVLRGDRIENAPYSFKM  94



>emb|CDX78401.1| BnaA03g03130D [Brassica napus]
Length=609

 Score = 98.2 bits (243),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 46/107 (43%), Positives = 66/107 (62%), Gaps = 1/107 (1%)
 Frame = +1

Query  241  FILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKS  420
             +L  H  H FYLPG     +   D++ VKVN LTSI+T+LP+SYY LP+C+P   I  S
Sbjct  18   LLLCVHVAHSFYLPGVAPQDFEKGDELKVKVNKLTSIKTQLPYSYYSLPFCQPK-KIVDS  76

Query  421  AENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQR  561
             EN+GE+L GD+I+N+PY F+M   +   +     L+E   K  K++
Sbjct  77   TENLGEVLRGDRIENAPYAFKMREAQMCNVLCRVTLDEKTAKAFKEK  123



>ref|XP_009359115.1| PREDICTED: transmembrane 9 superfamily member 4-like isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009359119.1| PREDICTED: transmembrane 9 superfamily member 4-like isoform 
X1 [Pyrus x bretschneideri]
Length=640

 Score = 98.2 bits (243),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 46/88 (52%), Positives = 60/88 (68%), Gaps = 1/88 (1%)
 Frame = +1

Query  223  LAAFSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPP  402
            LA  + F+L+ H  H FYLPG     +   D + VKVN LTS +T+LP+SYY LPYC+ P
Sbjct  10   LAISAIFLLLVHGAHSFYLPGVAPEDFIKGDDLKVKVNKLTSTKTQLPYSYYSLPYCK-P  68

Query  403  GGIKKSAENVGELLMGDQIDNSPYRFRM  486
              I  S EN+GE+L GD+I+NSPY F+M
Sbjct  69   DKILDSTENLGEVLRGDRIENSPYVFKM  96



>ref|XP_009363609.1| PREDICTED: transmembrane 9 superfamily member 4 [Pyrus x bretschneideri]
Length=640

 Score = 98.2 bits (243),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 46/88 (52%), Positives = 61/88 (69%), Gaps = 1/88 (1%)
 Frame = +1

Query  223  LAAFSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPP  402
            LA  + F+L+ H  H FYLPG     +   D + VKVN LTS +T+LP+S+Y LPYC+P 
Sbjct  10   LAISAIFLLLVHGAHSFYLPGVAPEDFIKGDVLKVKVNKLTSTKTQLPYSFYSLPYCKPE  69

Query  403  GGIKKSAENVGELLMGDQIDNSPYRFRM  486
              I  SAEN+GE+L GD+I+NSPY F+M
Sbjct  70   -KIVDSAENLGEVLRGDRIENSPYVFKM  96



>ref|XP_010472420.1| PREDICTED: transmembrane 9 superfamily member 4-like [Camelina 
sativa]
Length=637

 Score = 98.2 bits (243),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 48/116 (41%), Positives = 71/116 (61%), Gaps = 1/116 (1%)
 Frame = +1

Query  214  RRYLAAFSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYC  393
            R  +    +F  ++   +GFYLPG     +   D ++VKVN LTS +T+LP+SYY LPYC
Sbjct  5    RILIVTLVFFFFLNVNVNGFYLPGVAPQDFQMGDALMVKVNKLTSTKTQLPYSYYSLPYC  64

Query  394  RPPGGIKKSAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQR  561
            RP   I  SAEN+GE+L GD+I+NSP+ F+M  ++         L++   K LK++
Sbjct  65   RPE-HIVDSAENLGEVLRGDRIENSPFVFKMRESQMCAAVCRVKLDKKTAKALKEK  119



>gb|KFK25366.1| hypothetical protein AALP_AA8G104100 [Arabis alpina]
Length=646

 Score = 98.2 bits (243),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 46/102 (45%), Positives = 64/102 (63%), Gaps = 1/102 (1%)
 Frame = +1

Query  256  HACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKSAENVG  435
            H  H FYLPG     +   D++ VKVN LTSI+T+LP+SYY LP+CRP   I  S EN+G
Sbjct  27   HGAHSFYLPGVAPQDFEKGDELKVKVNKLTSIKTQLPYSYYSLPFCRPK-KIVDSTENLG  85

Query  436  ELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQR  561
            E+L GD+I+N+PY F+M   +   +     L+E   K  K++
Sbjct  86   EVLRGDRIENAPYSFKMREAQMCNILGRVILDEKTAKAFKEK  127



>gb|EYU34345.1| hypothetical protein MIMGU_mgv1a002794mg [Erythranthe guttata]
Length=637

 Score = 97.8 bits (242),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 50/112 (45%), Positives = 67/112 (60%), Gaps = 1/112 (1%)
 Frame = +1

Query  226  AAFSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPG  405
            A F   +L  +A H FYLPG     +   D + VKVN LTS++T+LP+SYY LPYC+P  
Sbjct  10   AIFVSLLLFINAAHSFYLPGVAPQDFLKGDLLKVKVNKLTSVKTQLPYSYYSLPYCKPE-  68

Query  406  GIKKSAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQR  561
             I  SAEN+GE+L GD+I+NSPY F+M   +   +     LN    K  K +
Sbjct  69   KIVDSAENLGEVLRGDRIENSPYVFKMREPQMCTVACRIILNAKEAKEFKDK  120



>ref|XP_009131183.1| PREDICTED: transmembrane 9 superfamily member 4-like [Brassica 
rapa]
Length=643

 Score = 97.8 bits (242),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 46/107 (43%), Positives = 66/107 (62%), Gaps = 1/107 (1%)
 Frame = +1

Query  241  FILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKS  420
             +L  H  H FYLPG     +   D++ VKVN LTSI+T+LP+SYY LP+C+P   I  S
Sbjct  20   LLLCVHVAHSFYLPGVAPQDFEKGDELKVKVNKLTSIKTQLPYSYYSLPFCQPK-KIVDS  78

Query  421  AENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQR  561
             EN+GE+L GD+I+N+PY F+M   +   +     L+E   K  K++
Sbjct  79   TENLGEVLRGDRIENAPYSFKMREAQMCNVLCRVTLDEKTAKAFKEK  125



>gb|ACL53042.1| unknown [Zea mays]
Length=545

 Score = 97.4 bits (241),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 50/116 (43%), Positives = 72/116 (62%), Gaps = 3/116 (3%)
 Frame = +1

Query  220  YLAAFSYFILISHA--CHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYC  393
            +  AF+   +++ A    GFYLPG   + +   D + VKVN LTSI+T+LP+SYY LP+C
Sbjct  6    WAVAFAALCIVALAPPASGFYLPGVAPNDFEKKDPLPVKVNKLTSIKTQLPYSYYSLPFC  65

Query  394  RPPGGIKKSAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQR  561
            + P  I  SAEN+GE+L GD+I+NSPY F M   +   +     + E   KLLK++
Sbjct  66   K-PDTIVDSAENLGEVLRGDRIENSPYTFEMREPQMCQVVCKISVGEKEAKLLKEK  120



>ref|XP_010519622.1| PREDICTED: transmembrane 9 superfamily member 4-like [Tarenaya 
hassleriana]
Length=647

 Score = 97.8 bits (242),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 44/82 (54%), Positives = 58/82 (71%), Gaps = 1/82 (1%)
 Frame = +1

Query  241  FILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKS  420
             +L+ H  H FYLPG     +   D++ VKVN LTSI+T+LP+SYY LP+CR P  I  S
Sbjct  23   LLLLIHGAHSFYLPGVAPQDFEKGDELQVKVNKLTSIKTQLPYSYYSLPFCR-PAKIVDS  81

Query  421  AENVGELLMGDQIDNSPYRFRM  486
            AEN+GE+L GD+I+NS Y F+M
Sbjct  82   AENLGEVLRGDRIENSAYVFKM  103



>ref|XP_006343648.1| PREDICTED: transmembrane 9 superfamily member 4-like [Solanum 
tuberosum]
Length=641

 Score = 97.8 bits (242),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 49/115 (43%), Positives = 69/115 (60%), Gaps = 1/115 (1%)
 Frame = +1

Query  217  RYLAAFSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCR  396
            R+++ F    L+S     FYLPG     +   D ++VKVN LTS +T+LP+SYY LPYC 
Sbjct  11   RWISVFVLLCLVSFEAQCFYLPGVAPQDFMKGDPLMVKVNKLTSTKTQLPYSYYSLPYCT  70

Query  397  PPGGIKKSAENVGELLMGDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQR  561
            P   I  SAEN+GE+L GD+I+NSP+ F M   +   +     LN  + K LK++
Sbjct  71   PK-QIVDSAENLGEVLRGDRIENSPFEFHMREPQMCNVVCRIVLNAKNAKELKEK  124



>ref|XP_002963189.1| hypothetical protein SELMODRAFT_165859 [Selaginella moellendorffii]
 gb|EFJ35060.1| hypothetical protein SELMODRAFT_165859 [Selaginella moellendorffii]
Length=641

 Score = 97.8 bits (242),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 49/118 (42%), Positives = 73/118 (62%), Gaps = 2/118 (2%)
 Frame = +1

Query  211  RRRYLAAFSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPY  390
            RR    A     L+   C GFYLPG     ++  D++ VKVN LTS++T+LP+ YY L +
Sbjct  5    RRWIPTAILLVALLLEPCAGFYLPGVAPQDFNQGDELQVKVNKLTSVKTQLPYDYYSLAF  64

Query  391  CRPPGGIKKSAENVGELLMGDQIDNSPYRFRMNVNETL-YLCTTGPLNEHHVKLLKQR  561
            C+ PG +  SAEN+GE+L GD+I+NSPY FRM  +     +C T  L++ + +  K++
Sbjct  65   CK-PGKVLNSAENLGEVLRGDRIENSPYVFRMREDSYCNIVCKTDKLSKKNARKFKRK  121



>ref|XP_006483483.1| PREDICTED: transmembrane 9 superfamily member 4-like [Citrus 
sinensis]
 gb|KDO67442.1| hypothetical protein CISIN_1g006525mg [Citrus sinensis]
Length=642

 Score = 97.4 bits (241),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 44/81 (54%), Positives = 58/81 (72%), Gaps = 1/81 (1%)
 Frame = +1

Query  244  ILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKSA  423
            +L+ H  H FYLPG     +   D++ VKVN LTS +T+LP+SYY +PYCRP   I  SA
Sbjct  20   LLLIHGSHSFYLPGVAPQDFVKGDELYVKVNKLTSTKTQLPYSYYSIPYCRPK-KIVDSA  78

Query  424  ENVGELLMGDQIDNSPYRFRM  486
            EN+GE+L GD+I+NSPY F+M
Sbjct  79   ENLGEVLRGDRIENSPYVFKM  99



>ref|XP_006450278.1| hypothetical protein CICLE_v10007716mg [Citrus clementina]
 gb|ESR63518.1| hypothetical protein CICLE_v10007716mg [Citrus clementina]
Length=642

 Score = 97.4 bits (241),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 44/81 (54%), Positives = 58/81 (72%), Gaps = 1/81 (1%)
 Frame = +1

Query  244  ILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKSA  423
            +L+ H  H FYLPG     +   D++ VKVN LTS +T+LP+SYY +PYCRP   I  SA
Sbjct  20   LLLIHGSHSFYLPGVAPQDFVKGDELYVKVNKLTSTKTQLPYSYYSIPYCRPK-KIVDSA  78

Query  424  ENVGELLMGDQIDNSPYRFRM  486
            EN+GE+L GD+I+NSPY F+M
Sbjct  79   ENLGEVLRGDRIENSPYVFKM  99



>ref|XP_001766313.1| predicted protein [Physcomitrella patens]
 gb|EDQ68945.1| predicted protein [Physcomitrella patens]
Length=621

 Score = 97.4 bits (241),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 46/98 (47%), Positives = 64/98 (65%), Gaps = 1/98 (1%)
 Frame = +1

Query  268  GFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKSAENVGELLM  447
            GFYLPG      +  D++ VKVN LTS +T+LP+ YY L YC+P   ++  AEN+GE+L 
Sbjct  10   GFYLPGVAPLDLAQGDKVQVKVNKLTSTKTQLPYEYYSLDYCKPK-KVENMAENLGEVLR  68

Query  448  GDQIDNSPYRFRMNVNETLYLCTTGPLNEHHVKLLKQR  561
            GD+I+NSPY F+M VNE   +     L+E   K+ K+R
Sbjct  69   GDRIENSPYVFKMKVNEQCKIVCKTKLSEKSAKIFKER  106



>gb|KFK27770.1| hypothetical protein AALP_AA8G426700 [Arabis alpina]
Length=650

 Score = 97.4 bits (241),  Expect = 7e-20, Method: Composition-based stats.
 Identities = 43/82 (52%), Positives = 57/82 (70%), Gaps = 1/82 (1%)
 Frame = +1

Query  241  FILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYCRPPGGIKKS  420
             +L  H  H FYLPG     +   D++ VKVN LTSI+T+LP+SYY LP+CRP   I  S
Sbjct  26   LLLFIHGAHSFYLPGVAPQDFEKGDELKVKVNKLTSIKTQLPYSYYSLPFCRPK-KIVDS  84

Query  421  AENVGELLMGDQIDNSPYRFRM  486
             EN+GE+L GD+I+N+PY F+M
Sbjct  85   TENLGEVLRGDRIENAPYSFKM  106



>ref|XP_003526158.1| PREDICTED: transmembrane 9 superfamily member 4-like [Glycine 
max]
 gb|KHN07017.1| Transmembrane 9 superfamily member 4 [Glycine soja]
Length=637

 Score = 97.4 bits (241),  Expect = 7e-20, Method: Composition-based stats.
 Identities = 49/91 (54%), Positives = 62/91 (68%), Gaps = 2/91 (2%)
 Frame = +1

Query  217  RYLAAFSY-FILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPYC  393
            R L AFS   +L+ H  H FYLPG     +   DQ+ VKVN LTS +T+LP+SYY LPYC
Sbjct  5    RSLVAFSAALLLLIHGAHCFYLPGVAPQDFLKGDQLQVKVNKLTSTKTQLPYSYYSLPYC  64

Query  394  RPPGGIKKSAENVGELLMGDQIDNSPYRFRM  486
              P  I+ SAEN+GE+L GD+I+NS Y F+M
Sbjct  65   -APSKIQDSAENLGEVLRGDRIENSLYVFKM  94



>ref|XP_008220671.1| PREDICTED: transmembrane 9 superfamily member 4-like [Prunus 
mume]
Length=639

 Score = 97.4 bits (241),  Expect = 7e-20, Method: Composition-based stats.
 Identities = 45/92 (49%), Positives = 61/92 (66%), Gaps = 1/92 (1%)
 Frame = +1

Query  211  RRRYLAAFSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPY  390
            R + +   + F+L+ H    FYLPG     +   D + VKVN LTS +T+LP+S+Y LPY
Sbjct  5    RSKAVRTLTIFLLLIHGAQSFYLPGVAPEDFIKGDDLKVKVNKLTSTKTQLPYSFYSLPY  64

Query  391  CRPPGGIKKSAENVGELLMGDQIDNSPYRFRM  486
            CR P  I  SAEN+GE+L GD+I+NSPY F+M
Sbjct  65   CR-PDKILDSAENLGEVLRGDRIENSPYVFKM  95



>ref|XP_007221970.1| hypothetical protein PRUPE_ppa002736mg [Prunus persica]
 gb|EMJ23169.1| hypothetical protein PRUPE_ppa002736mg [Prunus persica]
Length=639

 Score = 97.1 bits (240),  Expect = 8e-20, Method: Composition-based stats.
 Identities = 45/92 (49%), Positives = 61/92 (66%), Gaps = 1/92 (1%)
 Frame = +1

Query  211  RRRYLAAFSYFILISHACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPY  390
            R + +   + F+L+ H    FYLPG     +   D + VKVN LTS +T+LP+S+Y LPY
Sbjct  5    RSKAVRTLTIFLLLIHGAQSFYLPGVAPEDFIKGDDLKVKVNKLTSTKTQLPYSFYSLPY  64

Query  391  CRPPGGIKKSAENVGELLMGDQIDNSPYRFRM  486
            CR P  I  SAEN+GE+L GD+I+NSPY F+M
Sbjct  65   CR-PDKILDSAENLGEVLRGDRIENSPYVFKM  95



>ref|NP_568465.1| endomembrane family protein 70 [Arabidopsis thaliana]
 sp|Q9C5N2.1|TMN9_ARATH RecName: Full=Transmembrane 9 superfamily member 9; AltName: 
Full=Endomembrane protein 2; AltName: Full=Transmembrane nine 
protein 9; Short=AtTMN9; Flags: Precursor [Arabidopsis thaliana]
 gb|AAK25845.1|AF360135_1 putative multispanning membrane protein [Arabidopsis thaliana]
 gb|AED93399.1| endomembrane family protein 70 [Arabidopsis thaliana]
Length=644

 Score = 97.1 bits (240),  Expect = 8e-20, Method: Composition-based stats.
 Identities = 47/92 (51%), Positives = 62/92 (67%), Gaps = 2/92 (2%)
 Frame = +1

Query  214  RRYLAAFSYFILIS-HACHGFYLPGTYMHTYSPSDQIIVKVNSLTSIETELPFSYYDLPY  390
            RR     S  +L+S H  H FYLPG     +   D++ VKVN LTSI+T+LP+SYY LP+
Sbjct  8    RRLQILGSVILLLSIHVAHSFYLPGVAPQDFEKGDELKVKVNKLTSIKTQLPYSYYSLPF  67

Query  391  CRPPGGIKKSAENVGELLMGDQIDNSPYRFRM  486
            CRP   I  S EN+GE+L GD+I+N+PY F+M
Sbjct  68   CRPK-KIVDSTENLGEVLRGDRIENAPYSFKM  98



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 658693633920