BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002D04

Length=742
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_003619702.1|  Ubiquitin-like protein                             343   2e-115   
gb|ACA58351.1|  ubiquitin-like protein                                  340   2e-115   Sandersonia aurantiaca [Chinese-lantern lily]
gb|ABI84246.1|  polyubiquitin 10                                        340   3e-115   Arachis hypogaea [goober]
ref|XP_009412006.1|  PREDICTED: polyubiquitin 11-like                   341   4e-115   
gb|AFC36452.1|  ubiquitin                                               340   6e-115   Anoectochilus roxburghii
gb|AFW66442.1|  putative ubiquitin family protein                       340   8e-115   
ref|XP_010235843.1|  PREDICTED: polyubiquitin 11 isoform X1             341   1e-114   Brachypodium distachyon [annual false brome]
ref|XP_007154494.1|  hypothetical protein PHAVU_003G1236001g            338   1e-114   Phaseolus vulgaris [French bean]
ref|XP_010062974.1|  PREDICTED: polyubiquitin                           347   1e-114   Eucalyptus grandis [rose gum]
gb|AET06143.1|  ubiquitin                                               340   2e-114   Papaver somniferum
gb|AEZ49160.1|  polyubiquitin                                           342   2e-114   Wolffia australiana
ref|XP_002872805.1|  hypothetical protein ARALYDRAFT_490270             343   2e-114   
ref|XP_010490793.1|  PREDICTED: polyubiquitin 11-like                   340   2e-114   Camelina sativa [gold-of-pleasure]
ref|XP_002872746.1|  hypothetical protein ARALYDRAFT_911794             340   2e-114   
ref|XP_004968120.1|  PREDICTED: polyubiquitin-like                      340   2e-114   Setaria italica
gb|AEW46688.1|  polyubiquitin                                           339   2e-114   Ulva linza
ref|XP_003626479.1|  Ubiquitin-like protein                             341   2e-114   
dbj|BAC57955.1|  polyubiquitin                                          340   2e-114   Tripolium pannonicum [sea starwort]
ref|XP_010931017.1|  PREDICTED: polyubiquitin 11 isoform X1             340   2e-114   Elaeis guineensis
gb|EYU33610.1|  hypothetical protein MIMGU_mgv1a004315mg                339   2e-114   Erythranthe guttata [common monkey flower]
gb|KJB36627.1|  hypothetical protein B456_006G167800                    339   2e-114   Gossypium raimondii
ref|XP_002317213.1|  polyubiquitin family protein                       339   2e-114   Populus trichocarpa [western balsam poplar]
ref|XP_006288299.1|  hypothetical protein CARUB_v10001544mg             339   2e-114   
ref|XP_002438839.1|  hypothetical protein SORBIDRAFT_10g027030          339   2e-114   Sorghum bicolor [broomcorn]
ref|XP_008358804.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    340   2e-114   
gb|KDO51109.1|  hypothetical protein CISIN_1g026973mg                   339   2e-114   Citrus sinensis [apfelsine]
gb|AAP31578.1|  ubiquitin                                               339   2e-114   Hevea brasiliensis [jebe]
gb|AFP44113.1|  ubiquitin                                               338   2e-114   Lycoris longituba
ref|XP_003570150.1|  PREDICTED: polyubiquitin 11 isoform X2             340   3e-114   Brachypodium distachyon [annual false brome]
emb|CBI22349.3|  unnamed protein product                                342   3e-114   Vitis vinifera
ref|XP_006428822.1|  hypothetical protein CICLE_v10012652mg             339   3e-114   Citrus clementina [clementine]
ref|XP_007205619.1|  hypothetical protein PRUPE_ppa009116mg             339   3e-114   
ref|XP_006428779.1|  hypothetical protein CICLE_v10012654mg             339   3e-114   Citrus clementina [clementine]
ref|XP_006287868.1|  hypothetical protein CARUB_v10001095mg             345   3e-114   
emb|CDP08567.1|  unnamed protein product                                344   3e-114   Coffea canephora [robusta coffee]
gb|ACJ85618.1|  unknown                                                 339   4e-114   Medicago truncatula
emb|CAH59739.1|  polyubiquitin                                          339   4e-114   Plantago major [cart-track plant]
ref|NP_567286.1|  ubiquitin 11                                          339   4e-114   Arabidopsis thaliana [mouse-ear cress]
gb|AFW66439.1|  putative ubiquitin family protein                       341   4e-114   
gb|AFK41706.1|  unknown                                                 339   4e-114   Medicago truncatula
ref|XP_006370634.1|  hypothetical protein POPTR_0001s44440g             340   5e-114   
emb|CAD27944.1|  polyubiquitin-like                                     338   5e-114   Oryza sativa [red rice]
gb|AGV54749.1|  ubiquitin 11                                            340   5e-114   Phaseolus vulgaris [French bean]
gb|KDO51955.1|  hypothetical protein CISIN_1g026932mg                   338   5e-114   Citrus sinensis [apfelsine]
gb|AAO43307.1|  putative polyubiquitin                                  339   5e-114   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001147027.1|  polyubiquitin containing 7 ubiquitin monomers      342   5e-114   
gb|KJB62484.1|  hypothetical protein B456_009G418900                    338   6e-114   Gossypium raimondii
gb|AIZ74335.1|  polyubiquitin 3                                         338   7e-114   Pinus massoniana [Chinese red pine]
ref|XP_003574865.1|  PREDICTED: polyubiquitin-like                      342   1e-113   Brachypodium distachyon [annual false brome]
gb|AAO42469.1|  putative polyubiquitin                                  340   1e-113   Arabidopsis lyrata [lyrate rockcress]
ref|XP_003627152.1|  Ubiquitin                                          339   1e-113   
gb|AAC35858.1|  polyubiquitin                                           339   1e-113   Capsicum chinense [bonnet pepper]
gb|ABY60454.1|  putative polyubiquitin                                  339   1e-113   Adonis aestivalis var. palaestina
gb|AFK43392.1|  unknown                                                 337   1e-113   Medicago truncatula
gb|ACJ85643.1|  unknown                                                 337   1e-113   Medicago truncatula
gb|KIY97324.1|  ubiquitin C                                             336   1e-113   Monoraphidium neglectum
ref|XP_008784557.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    337   2e-113   
ref|XP_006377830.1|  hypothetical protein POPTR_0011s13770g             340   2e-113   
gb|KIM78989.1|  hypothetical protein PILCRDRAFT_573034                  337   2e-113   Piloderma croceum F 1598
ref|XP_003590494.1|  Ubiquitin                                          340   2e-113   
ref|XP_007154495.1|  hypothetical protein PHAVU_003G1236001g            338   2e-113   Phaseolus vulgaris [French bean]
emb|CAC94926.1|  putative ubiquitin                                     338   2e-113   Pleurotus sp. 'Florida' [Florida oyster mushroom]
gb|KIM78981.1|  hypothetical protein PILCRDRAFT_10644                   337   2e-113   Piloderma croceum F 1598
gb|KJA26171.1|  hypothetical protein HYPSUDRAFT_354705                  337   2e-113   Hypholoma sublateritium FD-334 SS-4
gb|EJU04700.1|  polyubiquitin UbiD/Ubi4                                 337   2e-113   Dacryopinax primogenitus
ref|XP_006685644.1|  ubiquitin                                          337   2e-113   Yamadazyma tenuis ATCC 10573
prf||1604470A  poly-ubiquitin                                           338   2e-113
ref|XP_011110054.1|  hypothetical protein H072_4094                     337   2e-113   
gb|AES89865.2|  polyubiquitin 3                                         338   2e-113   Medicago truncatula
ref|XP_006288300.1|  hypothetical protein CARUB_v10001544mg             340   2e-113   Capsella rubella
gb|AIS71924.1|  polyubiquitin                                           337   2e-113   Mangifera indica
gb|ABD96088.1|  polyubiquitin                                           338   2e-113   Malus domestica [apple tree]
gb|AAQ84316.1|  fiber polyubiquitin                                     337   2e-113   Gossypium barbadense [Egyptian cotton]
ref|XP_007014924.1|  Polyubiquitin 3                                    340   3e-113   Theobroma cacao [chocolate]
ref|XP_007211606.1|  hypothetical protein PRUPE_ppa005503mg             340   3e-113   
ref|XP_011468094.1|  PREDICTED: polyubiquitin                           340   3e-113   Fragaria vesca subsp. vesca
ref|XP_002873083.1|  hypothetical protein ARALYDRAFT_487095             339   3e-113   
dbj|BAJ85978.1|  predicted protein                                      339   3e-113   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_851029.1|  polyubiquitin 3                                       339   3e-113   Arabidopsis thaliana [mouse-ear cress]
sp|P69315.2|UBIQP_LINUS  RecName: Full=Polyubiquitin; Contains: R...    339   3e-113   Linum usitatissimum
ref|XP_006396611.1|  hypothetical protein EUTSA_v10028730mg             339   3e-113   
gb|KDP39203.1|  hypothetical protein JCGZ_00960                         340   3e-113   Jatropha curcas
gb|AHC00631.1|  polyubiquitin                                           340   3e-113   Ganoderma lucidum
ref|XP_009114489.1|  PREDICTED: polyubiquitin-like                      339   3e-113   Brassica rapa
ref|XP_006302387.1|  hypothetical protein CARUB_v10020456mg             339   3e-113   
ref|XP_009112898.1|  PREDICTED: polyubiquitin                           339   3e-113   Brassica rapa
gb|EYU33609.1|  hypothetical protein MIMGU_mgv1a004315mg                339   3e-113   Erythranthe guttata [common monkey flower]
ref|XP_002456845.1|  hypothetical protein SORBIDRAFT_03g043940          339   3e-113   Sorghum bicolor [broomcorn]
emb|CAA48140.1|  ubiquitin                                              339   3e-113   Antirrhinum majus [garden snapdragon]
gb|EPS72031.1|  polyubiquitin                                           338   4e-113   Genlisea aurea
ref|XP_007512209.1|  polyubiquitin                                      341   4e-113   Bathycoccus prasinos
ref|XP_006654612.1|  PREDICTED: polyubiquitin-like                      339   4e-113   Oryza brachyantha
emb|CDP08569.1|  unnamed protein product                                339   4e-113   Coffea canephora [robusta coffee]
gb|KIK28767.1|  hypothetical protein PISMIDRAFT_672939                  337   4e-113   Pisolithus microcarpus 441
emb|CAA40323.1|  polyubiquitin protein                                  340   4e-113   Helianthus annuus
ref|XP_007205620.1|  hypothetical protein PRUPE_ppa009116mg             339   4e-113   
gb|AAO43308.1|  putative polyubiquitin                                  337   4e-113   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006480631.1|  PREDICTED: polyubiquitin-like                      339   4e-113   Citrus sinensis [apfelsine]
gb|AES89866.2|  polyubiquitin 3                                         339   4e-113   Medicago truncatula
gb|ABK94002.1|  unknown                                                 339   4e-113   Populus trichocarpa [western balsam poplar]
gb|AAM64530.1|  ubiquitin homolog                                       336   4e-113   Arabidopsis thaliana [mouse-ear cress]
emb|CDR41572.1|  RHTO0S06e03070g1_1                                     336   4e-113   Rhodotorula toruloides
gb|KJB81823.1|  hypothetical protein B456_013G163500                    339   4e-113   Gossypium raimondii
ref|NP_849292.1|  polyubiquitin 14                                      339   5e-113   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006428820.1|  hypothetical protein CICLE_v10012290mg             339   5e-113   Citrus clementina [clementine]
ref|XP_007154493.1|  hypothetical protein PHAVU_003G123500g             343   5e-113   Phaseolus vulgaris [French bean]
emb|CAH59740.1|  polyubiquitin                                          339   5e-113   Plantago major [cart-track plant]
ref|XP_010258950.1|  PREDICTED: polyubiquitin                           339   5e-113   Nelumbo nucifera [Indian lotus]
ref|XP_003082269.1|  polyubiquitin (ISS)                                338   5e-113   
ref|XP_003537278.1|  PREDICTED: polyubiquitin-like                      339   5e-113   Glycine max [soybeans]
emb|CBY46745.1|  polyubiquitin 10 protein                               339   5e-113   Lepidium appelianum [hairy whitetop]
ref|XP_006428925.1|  hypothetical protein CICLE_v10012291mg             338   6e-113   Citrus clementina [clementine]
ref|XP_006428821.1|  hypothetical protein CICLE_v10012292mg             338   6e-113   Citrus clementina [clementine]
gb|KDP38838.1|  hypothetical protein JCGZ_04995                         339   6e-113   Jatropha curcas
ref|XP_010493589.1|  PREDICTED: polyubiquitin-like                      343   6e-113   Camelina sativa [gold-of-pleasure]
gb|AFW66438.1|  putative ubiquitin family protein                       340   6e-113   
gb|ACD31680.1|  ubiquitin                                               338   6e-113   Gossypium hirsutum [American cotton]
emb|CAA54603.1|  pentameric polyubiquitin                               340   7e-113   Nicotiana tabacum [American tobacco]
ref|XP_011077812.1|  PREDICTED: polyubiquitin 3                         339   7e-113   
dbj|BAF00213.1|  polyubiquitin 4 UBQ4                                   340   7e-113   Arabidopsis thaliana [mouse-ear cress]
gb|AFY06654.1|  polyubiquitin                                           337   7e-113   Carica papaya [mamon]
gb|EWZ40370.1|  ubiquitin C                                             335   8e-113   Fusarium oxysporum Fo47
gb|AAB95250.1|  ubiquitin                                               338   8e-113   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010938693.1|  PREDICTED: polyubiquitin                           338   8e-113   Elaeis guineensis
gb|KJB14874.1|  hypothetical protein B456_002G147600                    340   9e-113   Gossypium raimondii
gb|KDB11907.1|  ubiquitin                                               338   9e-113   Ustilaginoidea virens
emb|CEF99839.1|  Ubiquitin conserved site                               339   9e-113   Ostreococcus tauri
gb|KJB62487.1|  hypothetical protein B456_009G418900                    338   9e-113   Gossypium raimondii
gb|AGZ15412.1|  fiber polyubiquitin                                     335   1e-112   Phaseolus vulgaris [French bean]
ref|XP_010240636.1|  PREDICTED: polyubiquitin isoform X1                341   1e-112   
ref|XP_007154496.1|  hypothetical protein PHAVU_003G1236001g            338   1e-112   Phaseolus vulgaris [French bean]
ref|XP_010227188.1|  PREDICTED: polyubiquitin isoform X1                339   1e-112   
gb|AIY27743.1|  polyubiquitin Ubi10                                     339   1e-112   Betula luminifera [liang ye hua]
ref|XP_002992988.1|  hypothetical protein SELMODRAFT_187148             335   1e-112   Selaginella moellendorffii
ref|XP_001755431.1|  predicted protein                                  335   1e-112   
gb|ACJ85658.1|  unknown                                                 335   1e-112   Medicago truncatula
gb|KIL68862.1|  hypothetical protein M378DRAFT_157997                   338   1e-112   Amanita muscaria Koide BX008
ref|XP_001783045.1|  predicted protein                                  335   1e-112   
ref|XP_008796945.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    338   1e-112   Phoenix dactylifera
gb|EGO00904.1|  hypothetical protein SERLA73DRAFT_178893                338   1e-112   Serpula lacrymans var. lacrymans S7.3
ref|XP_010453358.1|  PREDICTED: polyubiquitin-like                      338   1e-112   Camelina sativa [gold-of-pleasure]
gb|AAO43309.1|  putative polyubiquitin                                  335   1e-112   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003607659.1|  Ubiquitin                                          336   1e-112   
gb|EMS24129.1|  ubiquitin C                                             335   1e-112   Rhodotorula toruloides NP11
gb|KIK92093.1|  hypothetical protein PAXRUDRAFT_830299                  335   1e-112   Paxillus rubicundulus Ve08.2h10
gb|AIS40894.1|  polyubiquitin                                           343   1e-112   Kalanchoe fedtschenkoi [lavender-scallops]
gb|ADO60140.1|  ubiquitin                                               334   2e-112   Beauveria bassiana
ref|XP_009108753.1|  PREDICTED: polyubiquitin 11-like                   335   2e-112   Brassica rapa
gb|AAK68824.1|  Unknown protein                                         335   2e-112   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003670049.1|  hypothetical protein NDAI_0D04930                  334   2e-112   Naumovozyma dairenensis CBS 421
ref|XP_011048569.1|  PREDICTED: polyubiquitin 3-like                    337   2e-112   Populus euphratica
emb|CCL99875.1|  predicted protein                                      337   2e-112   Fibroporia radiculosa
dbj|BAL61087.1|  polyubiquitin                                          334   2e-112   Dianthus caryophyllus [carnation]
ref|XP_001764949.1|  predicted protein                                  338   2e-112   
ref|XP_007924320.1|  hypothetical protein MYCFIDRAFT_60610              334   2e-112   Pseudocercospora fijiensis CIRAD86
emb|CBY16339.1|  unnamed protein product                                333   2e-112   Oikopleura dioica
emb|CEP60563.1|  LALA0S01e13784g1_1                                     334   2e-112   Lachancea lanzarotensis
ref|XP_006381473.1|  polyubiquitin family protein                       337   2e-112   
emb|CCT70325.1|  UBI4-Ubiquitin                                         336   2e-112   Fusarium fujikuroi IMI 58289
sp|P0CG84.1|UBI4P_NICSY  RecName: Full=Polyubiquitin; Contains: R...    340   2e-112   Nicotiana sylvestris
gb|KII93501.1|  hypothetical protein PLICRDRAFT_694663                  338   3e-112   Plicaturopsis crispa FD-325 SS-3
ref|XP_001931824.1|  ubiquitin                                          334   3e-112   Pyrenophora tritici-repentis Pt-1C-BFP
gb|ADD52202.1|  ubiquitin                                               340   3e-112   Catharanthus roseus [chatas]
gb|KIY45417.1|  ubiquitin                                               337   3e-112   Fistulina hepatica ATCC 64428
ref|XP_001828882.1|  ubiquitin C                                        337   3e-112   Coprinopsis cinerea okayama7#130
gb|KJB62485.1|  hypothetical protein B456_009G418900                    337   3e-112   Gossypium raimondii
ref|XP_010492041.1|  PREDICTED: polyubiquitin-like                      337   3e-112   Camelina sativa [gold-of-pleasure]
gb|KDQ20365.1|  hypothetical protein BOTBODRAFT_123907                  337   3e-112   Botryobasidium botryosum FD-172 SS1
ref|XP_001555417.1|  polyubiquitin                                      337   3e-112   Botrytis cinerea B05.10
ref|XP_008020911.1|  hypothetical protein SETTUDRAFT_162442             337   3e-112   Exserohilum turcica Et28A
ref|XP_010911599.1|  PREDICTED: polyubiquitin 4                         340   3e-112   Elaeis guineensis
gb|KIR63773.1|  polyubiquitin                                           337   3e-112   Cryptococcus gattii CA1873
ref|XP_002872109.1|  predicted protein                                  340   3e-112   
ref|XP_719867.1|  hypothetical protein CaO19.6771                       334   3e-112   Candida albicans SC5314
dbj|GAK65396.1|  ubiquitin                                              338   3e-112   Moesziomyces antarcticus
gb|AAQ07453.1|  ubiquitin                                               339   3e-112   Musa acuminata AAA Group [Cavendish banana]
ref|XP_002508175.1|  ubiquitin                                          339   3e-112   Micromonas commoda
gb|KIY53974.1|  polyubiquitin                                           337   3e-112   Fistulina hepatica ATCC 64428
ref|XP_009358096.1|  PREDICTED: polyubiquitin isoform X1                340   3e-112   Pyrus x bretschneideri [bai li]
gb|EPX74297.1|  ubiquitin                                               334   3e-112   Schizosaccharomyces octosporus yFS286
gb|KIM67150.1|  hypothetical protein SCLCIDRAFT_1210637                 337   3e-112   Scleroderma citrinum Foug A
gb|AGV54228.1|  polyubiquitin-like protein                              339   3e-112   Phaseolus vulgaris [French bean]
ref|NP_001174480.1|  Os05g0504766                                       339   4e-112   
ref|XP_007339454.1|  ubiquitin                                          337   4e-112   
ref|XP_010454368.1|  PREDICTED: polyubiquitin 4-like                    339   4e-112   Camelina sativa [gold-of-pleasure]
ref|XP_002874006.1|  hypothetical protein ARALYDRAFT_488966             339   4e-112   
gb|AAL09741.1|  AT4g05320/C17L7_240                                     339   4e-112   Arabidopsis thaliana [mouse-ear cress]
gb|ABU40645.1|  polyubiquitin                                           339   4e-112   Triticum aestivum [Canadian hard winter wheat]
gb|KIR29996.1|  polyubiquitin                                           337   4e-112   Cryptococcus gattii VGII LA55
ref|XP_006396612.1|  hypothetical protein EUTSA_v10028730mg             339   4e-112   Eutrema salsugineum [saltwater cress]
ref|NP_568397.1|  ubiquitin 4                                           339   4e-112   Arabidopsis thaliana [mouse-ear cress]
gb|AAY86773.1|  polyubiquitin                                           339   4e-112   Noccaea caerulescens
ref|NP_001105376.1|  polyubiquitin                                      339   4e-112   
ref|XP_010240921.1|  PREDICTED: polyubiquitin-like                      339   4e-112   Nelumbo nucifera [Indian lotus]
ref|XP_006593989.1|  PREDICTED: polyubiquitin 10-like isoform X1        339   4e-112   
emb|CBY46746.1|  polyubiquitin 10 protein                               339   4e-112   Lepidium campestre [bastard cress]
gb|AAB95252.1|  ubiquitin                                               339   4e-112   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003030030.1|  polyubiquitin                                      337   4e-112   Schizophyllum commune H4-8
ref|XP_007366816.1|  polyubiquitin                                      337   4e-112   Dichomitus squalens LYAD-421 SS1
gb|KJB81825.1|  hypothetical protein B456_013G163500                    339   4e-112   Gossypium raimondii
ref|XP_009763135.1|  PREDICTED: polyubiquitin-like                      339   4e-112   Nicotiana sylvestris
ref|XP_001598085.1|  polyubiquitin                                      337   4e-112   Sclerotinia sclerotiorum 1980 UF-70
ref|XP_006428816.1|  hypothetical protein CICLE_v10011684mg             339   4e-112   
gb|AAB68045.1|  polyubiquitin                                           339   4e-112   Fragaria x ananassa
ref|XP_010324327.1|  PREDICTED: polyubiquitin isoform X2                339   4e-112   
ref|XP_009596689.1|  PREDICTED: polyubiquitin-like                      339   4e-112   Nicotiana tomentosiformis
gb|EYU33608.1|  hypothetical protein MIMGU_mgv1a004315mg                339   4e-112   Erythranthe guttata [common monkey flower]
gb|ACS68205.1|  ubiquitin 10.2                                          339   4e-112   Brassica napus [oilseed rape]
ref|XP_010558157.1|  PREDICTED: polyubiquitin-like                      339   4e-112   Tarenaya hassleriana [spider flower]
emb|CDP05795.1|  unnamed protein product                                339   4e-112   Coffea canephora [robusta coffee]
gb|KIJ45725.1|  hypothetical protein M422DRAFT_106821                   337   4e-112   Sphaerobolus stellatus SS14
ref|XP_002953480.1|  polyubiquitin                                      337   4e-112   Volvox carteri f. nagariensis
ref|NP_849300.4|  polyubiquitin 10                                      339   4e-112   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001148453.1|  LOC100282068                                       339   4e-112   Zea mays [maize]
gb|AAB36545.1|  ubiquitin-like protein                                  340   4e-112   Phaseolus vulgaris [French bean]
gb|KEH31155.1|  polyubiquitin 3                                         339   4e-112   Medicago truncatula
gb|KJB81824.1|  hypothetical protein B456_013G163500                    340   4e-112   Gossypium raimondii
gb|KJB13592.1|  hypothetical protein B456_002G083000                    339   4e-112   Gossypium raimondii
ref|XP_010270791.1|  PREDICTED: polyubiquitin-like                      339   5e-112   Nelumbo nucifera [Indian lotus]
ref|XP_004956019.1|  PREDICTED: polyubiquitin 4-like                    339   5e-112   Setaria italica
ref|XP_007763327.1|  polyubiquitin                                      336   5e-112   Coniophora puteana RWD-64-598 SS2
sp|Q58G87.2|UBQ3_ORYSJ  RecName: Full=Polyubiquitin 3; Contains: ...    339   5e-112   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002266370.1|  PREDICTED: polyubiquitin 4-like                    339   5e-112   Vitis vinifera
ref|XP_006302388.1|  hypothetical protein CARUB_v10020456mg             339   5e-112   Capsella rubella
ref|XP_010696408.1|  PREDICTED: polyubiquitin 4                         339   5e-112   Beta vulgaris subsp. vulgaris [field beet]
gb|AAX40652.1|  polyubiquitin                                           339   5e-112   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001420612.1|  predicted protein                                  339   5e-112   Ostreococcus lucimarinus CCE9901
ref|XP_010421267.1|  PREDICTED: polyubiquitin 4-like                    339   5e-112   Camelina sativa [gold-of-pleasure]
ref|XP_009591312.1|  PREDICTED: polyubiquitin 4                         339   5e-112   Nicotiana tomentosiformis
ref|XP_010537590.1|  PREDICTED: polyubiquitin 11                        333   5e-112   Tarenaya hassleriana [spider flower]
ref|XP_010275241.1|  PREDICTED: polyubiquitin-like                      339   5e-112   Nelumbo nucifera [Indian lotus]
ref|XP_001797032.1|  hypothetical protein SNOG_06667                    333   5e-112   Parastagonospora nodorum SN15
gb|EYU18102.1|  hypothetical protein MIMGU_mgv1a008166mg                339   6e-112   Erythranthe guttata [common monkey flower]
dbj|BAK61738.1|  ubiquitin                                              332   6e-112   Larcopyle butschlii
gb|EMS65864.1|  Polyubiquitin                                           340   6e-112   Triticum urartu
ref|XP_010452435.1|  PREDICTED: polyubiquitin-like                      336   6e-112   Camelina sativa [gold-of-pleasure]
ref|XP_002891806.1|  predicted protein                                  339   7e-112   
gb|AES89856.2|  polyubiquitin 3                                         333   7e-112   Medicago truncatula
ref|NP_001053957.1|  Os04g0628100                                       339   7e-112   
ref|XP_009605659.1|  PREDICTED: polyubiquitin                           336   7e-112   Nicotiana tomentosiformis
ref|XP_003607669.1|  Multidrug resistance protein ABC transporter...    341   8e-112   
emb|CAB81074.1|  polyubiquitin (ubq10)                                  341   8e-112   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009631616.1|  PREDICTED: polyubiquitin-like                      338   9e-112   Nicotiana tomentosiformis
ref|XP_003052575.1|  predicted protein                                  335   9e-112   [Nectria] haematococca mpVI 77-13-4
ref|XP_003010029.1|  polyubiquitin UbiD/Ubi4, putative                  333   1e-111   Trichophyton benhamiae CBS 112371
gb|AAZ32851.1|  pentameric polyubiquitin                                331   1e-111   Medicago sativa [alfalfa]
gb|AAN31845.1|  putative polyubiquitin (UBQ10)                          341   1e-111   Arabidopsis thaliana [mouse-ear cress]
gb|KJB62483.1|  hypothetical protein B456_009G418900                    338   1e-111   Gossypium raimondii
gb|AAP80689.1|  polyubiquitin                                           333   1e-111   Griffithsia japonica
gb|AFK47245.1|  unknown                                                 333   1e-111   Medicago truncatula
gb|KIM22018.1|  hypothetical protein M408DRAFT_333137                   332   1e-111   Serendipita vermifera MAFF 305830
ref|XP_002980153.1|  hypothetical protein SELMODRAFT_271419             335   1e-111   
emb|CAA60629.1|  unnamed protein product                                330   1e-111   Acanthamoeba sp. 4b3
ref|XP_001755307.1|  predicted protein                                  335   1e-111   
gb|ACB87916.1|  polyubiquitin 1                                         332   1e-111   Malus domestica [apple tree]
ref|XP_002551324.1|  ubiquitin                                          335   1e-111   Candida tropicalis MYA-3404
gb|EXX74853.1|  ubiquitin                                               330   2e-111   Rhizophagus irregularis DAOM 197198w
gb|EGA57707.1|  Ubi4p                                                   333   2e-111   Saccharomyces cerevisiae FostersB
gb|AAC67552.1|  polyubiquitin                                           337   2e-111   Saccharum hybrid cultivar H32-8560
gb|EMS60894.1|  Polyubiquitin                                           340   2e-111   Triticum urartu
gb|ACX46987.1|  ubiquitin                                               339   2e-111   Guzmania wittmackii x Guzmania lingulata
ref|XP_003350608.1|  hypothetical protein SMAC_07925                    332   2e-111   Sordaria macrospora k-hell
ref|XP_006372519.1|  polyubiquitin family protein                       335   2e-111   Populus trichocarpa [western balsam poplar]
ref|XP_002839703.1|  hypothetical protein                               335   2e-111   Tuber melanosporum Mel28
gb|EPS29015.1|  hypothetical protein PDE_03961                          334   2e-111   Penicillium oxalicum 114-2
ref|XP_009784908.1|  PREDICTED: polyubiquitin-like isoform X2           340   2e-111   Nicotiana sylvestris
ref|XP_001830230.1|  ubiquitin                                          335   2e-111   Coprinopsis cinerea okayama7#130
ref|XP_004341200.1|  polyubiquitin, putative                            332   2e-111   Acanthamoeba castellanii str. Neff
gb|EGO00841.1|  hypothetical protein SERLA73DRAFT_121253                337   2e-111   Serpula lacrymans var. lacrymans S7.3
dbj|BAH71115.1|  ACYPI006410                                            332   3e-111   Acyrthosiphon pisum
ref|XP_010436682.1|  PREDICTED: polyubiquitin 4-like                    340   3e-111   
ref|XP_001210780.1|  ubiquitin                                          334   3e-111   Aspergillus terreus NIH2624
gb|KHJ83418.1|  ubiquitin family protein                                331   3e-111   Oesophagostomum dentatum [nodule worm]
gb|EZF98642.1|  polyubiquitin                                           332   3e-111   Trichophyton rubrum MR1459
ref|XP_007154492.1|  hypothetical protein PHAVU_003G123400g             336   3e-111   Phaseolus vulgaris [French bean]
gb|AAV65292.1|  polyubiquitin                                           334   3e-111   Aspergillus fumigatus
ref|XP_001227036.1|  polyubiquitin                                      334   3e-111   Chaetomium globosum CBS 148.51
dbj|BAP70433.1|  Ubiquitin                                              334   3e-111   Kluyveromyces marxianus
gb|KII92029.1|  hypothetical protein PLICRDRAFT_172184                  337   3e-111   Plicaturopsis crispa FD-325 SS-3
gb|KEZ40313.1|  Polyubiquitin                                           334   3e-111   
ref|XP_003607668.1|  Multidrug resistance protein ABC transporter...    341   3e-111   
sp|P0CG73.1|UBI1P_CANAX  RecName: Full=Polyubiquitin; Contains: R...    332   3e-111   
ref|XP_007316637.1|  hypothetical protein SERLADRAFT_368035             337   3e-111   
emb|CCG34086.1|  Polyubiquitin                                          334   3e-111   
gb|KDQ30621.1|  hypothetical protein PLEOSDRAFT_1088454                 337   3e-111   
gb|EEH07231.1|  ubiquitin                                               334   3e-111   
gb|EKV13151.1|  hypothetical protein PDIG_39650                         334   3e-111   
gb|EEH20847.2|  polyubiquitin                                           335   3e-111   
gb|KDR85168.1|  hypothetical protein GALMADRAFT_131895                  337   3e-111   
gb|EUC59758.1|  polyubiquitin                                           337   3e-111   
gb|AAO43310.1|  putative polyubiquitin                                  332   3e-111   
gb|EJU00136.1|  ubiquitin                                               337   3e-111   
gb|KIK17147.1|  hypothetical protein PISMIDRAFT_685607                  337   3e-111   
emb|CAA40324.1|  hexaubiquitin protein                                  339   3e-111   
gb|AEH41483.1|  ubiquitin                                               334   3e-111   
dbj|BAK03691.1|  predicted protein                                      339   3e-111   
dbj|BAJ91912.1|  predicted protein                                      339   3e-111   
ref|XP_003196661.1|  ATP-dependent protein binding protein              337   3e-111   
gb|KIW56414.1|  polyubiquitin                                           334   3e-111   
gb|KIH55346.1|  ubiquitin family protein                                337   3e-111   
dbj|BAK02501.1|  predicted protein                                      339   4e-111   
ref|XP_010262389.1|  PREDICTED: polyubiquitin                           340   4e-111   
gb|EEQ88150.1|  ubiquitin                                               334   4e-111   
ref|XP_002494205.1|  Ubiquitin                                          334   4e-111   
ref|XP_008796191.1|  PREDICTED: polyubiquitin-like                      334   4e-111   
ref|NP_001045980.1|  Os02g0161900                                       339   4e-111   
ref|XP_010423744.1|  PREDICTED: polyubiquitin                           339   4e-111   
ref|XP_010431529.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    339   4e-111   
gb|AFD53810.1|  ubiquitin                                               332   4e-111   
gb|KIM48035.1|  hypothetical protein M413DRAFT_16078                    337   4e-111   
dbj|GAA27344.2|  polyubiquitin-A                                        333   4e-111   
gb|AAB95251.1|  ubiquitin                                               339   4e-111   
ref|XP_007864655.1|  ubiquitin                                          337   4e-111   
ref|XP_010046742.1|  PREDICTED: polyubiquitin-like                      339   4e-111   
ref|XP_007211609.1|  hypothetical protein PRUPE_ppa005507mg             339   4e-111   
gb|AAD03343.1|  ubiquitin                                               339   4e-111   
ref|XP_006694532.1|  hypothetical protein CTHT_0041260                  334   4e-111   
gb|KIM40192.1|  hypothetical protein M413DRAFT_73842                    337   4e-111   
ref|XP_001266981.1|  polyubiquitin (UbiD), putative                     334   4e-111   
ref|XP_010324326.1|  PREDICTED: polyubiquitin isoform X1                339   4e-111   
ref|XP_004953565.1|  PREDICTED: polyubiquitin-like                      339   4e-111   
ref|XP_001880135.1|  ubiquitin                                          337   4e-111   
ref|XP_008244357.1|  PREDICTED: polyubiquitin isoform X1                340   4e-111   
gb|KIJ68260.1|  hypothetical protein HYDPIDRAFT_173033                  337   4e-111   
ref|XP_010756991.1|  polyubiquitin                                      334   4e-111   
gb|KJB81827.1|  hypothetical protein B456_013G163500                    339   4e-111   
ref|XP_009784905.1|  PREDICTED: polyubiquitin-like isoform X1           339   4e-111   
gb|AFR98116.1|  polyubiquitin                                           337   4e-111   
emb|CAA52290.1|  polyubiquitin                                          337   4e-111   
gb|AGM32540.1|  polyubiquitin-B-like isoform                            332   4e-111   
ref|XP_002452705.1|  hypothetical protein SORBIDRAFT_04g031060          339   4e-111   
gb|AAA82978.1|  polyubiquitin                                           337   4e-111   
ref|XP_002419618.1|  ubiquitin, putative                                334   4e-111   
gb|KDP42860.1|  hypothetical protein JCGZ_23802                         339   4e-111   
gb|EYU33607.1|  hypothetical protein MIMGU_mgv1a004315mg                339   4e-111   
ref|XP_008350368.1|  PREDICTED: polyubiquitin                           339   4e-111   
ref|NP_849299.4|  polyubiquitin 10                                      339   5e-111   
gb|ETN78467.1|  ubiquitin family protein                                331   5e-111   
ref|XP_007049060.1|  Polyubiquitin 10                                   339   5e-111   
ref|XP_003542730.1|  PREDICTED: polyubiquitin 10-like                   339   5e-111   
ref|XP_008345409.1|  PREDICTED: polyubiquitin-like                      339   5e-111   
gb|KJB62482.1|  hypothetical protein B456_009G418900                    337   5e-111   
ref|XP_005644220.1|  polyubiquitin                                      334   5e-111   
gb|KDR10312.1|  Ubiquitin                                               331   5e-111   
gb|AGM32487.1|  polyubiquitin-B-like isoform 1                          331   5e-111   
ref|XP_011094250.1|  PREDICTED: polyubiquitin-like                      339   5e-111   
ref|XP_002888365.1|  polyubiquitin                                      339   5e-111   
gb|ACN40936.1|  unknown                                                 339   5e-111   
ref|XP_006428817.1|  hypothetical protein CICLE_v10011684mg             339   5e-111   
dbj|GAA55031.1|  ubiquitin C                                            331   5e-111   
ref|XP_002791169.1|  ubiquitin                                          333   5e-111   
gb|AAC16012.1|  polyubiquitin                                           339   5e-111   
gb|AAO43306.1|  putative polyubiquitin                                  334   5e-111   
gb|AGT38457.1|  polyubiquitin                                           340   5e-111   
ref|XP_011094650.1|  PREDICTED: polyubiquitin                           339   5e-111   
ref|XP_008441422.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    339   5e-111   
emb|CDH08450.1|  ubiquitin and ubiquitin-like proteins                  333   5e-111   
gb|KIY97628.1|  ubiquitin C                                             333   5e-111   
emb|CCO30833.1|  Polyubiquitin                                          337   5e-111   
ref|XP_659604.1|  hypothetical protein AN2000.2                         334   5e-111   
emb|CAX71218.1|  polyubiquitin                                          329   6e-111   
ref|XP_003402310.1|  PREDICTED: polyubiquitin-B-like isoform 1          331   6e-111   
gb|KIK81924.1|  hypothetical protein PAXRUDRAFT_736824                  331   6e-111   
dbj|BAK61744.1|  ubiquitin                                              331   6e-111   
gb|AEG78435.1|  ubiquitin C variant 3                                   332   6e-111   
gb|EYC42800.1|  hypothetical protein Y032_0517g2809                     331   6e-111   
tpe|CBF85986.1|  TPA: Polyubiquitin Fragment [Source:UniProtKB/Tr...    333   7e-111   
gb|KJB13590.1|  hypothetical protein B456_002G083000                    339   7e-111   
dbj|BAN21697.1|  ubiquitin                                              329   7e-111   
ref|XP_003843815.1|  hypothetical protein LEMA_P014660.1                337   7e-111   
tpg|DAA34466.1|  TPA: ubiquitin                                         329   7e-111   
gb|AFW70219.1|  polyubiquitin-like protein                              340   7e-111   
tpd|FAA00317.1|  TPA: polyubiquitin                                     333   7e-111   
gb|KIM30634.1|  hypothetical protein M408DRAFT_328170                   330   8e-111   
ref|XP_002888394.1|  hexaubiquitin protein                              339   8e-111   
ref|XP_003619701.1|  Ubiquitin-like protein                             332   9e-111   
ref|XP_001538486.1|  polyubiquitin                                      333   1e-110   
ref|XP_007808982.1|  ubiquitin                                          334   1e-110   
gb|AAL91103.1|  ubiquitin                                               331   1e-110   
ref|XP_011038259.1|  PREDICTED: polyubiquitin-like                      333   1e-110   
ref|XP_011037020.1|  PREDICTED: polyubiquitin-like                      336   1e-110   
ref|XP_001246797.1|  polyubiquitin                                      333   1e-110   
gb|AAY33920.2|  polyubiquitin                                           335   1e-110   
ref|XP_002842034.1|  hypothetical protein                               333   1e-110   
gb|EXX74854.1|  ubiquitin                                               329   1e-110   
gb|ADD24466.1|  Ubiquitin                                               330   1e-110   
dbj|GAA87419.1|  polyubiquitin                                          333   1e-110   
ref|XP_011278194.1|  PREDICTED: polyubiquitin-B-like                    328   1e-110   
ref|XP_011203306.1|  PREDICTED: polyubiquitin-B                         328   1e-110   
gb|AFW66445.1|  ubiquitin2                                              340   1e-110   
ref|XP_002992907.1|  hypothetical protein SELMODRAFT_162680             335   1e-110   
ref|XP_002976481.1|  hypothetical protein SELMODRAFT_271198             335   1e-110   
ref|XP_005831810.1|  ubiquitin                                          330   1e-110   
ref|XP_626192.1|  polyubiquitin with 3 Ub domains                       330   2e-110   
gb|AAF04147.1|  ubiquitin precursor                                     335   2e-110   
ref|XP_007545871.1|  PREDICTED: polyubiquitin-B isoform X2              331   2e-110   
gb|AGH70140.1|  ubiquitin family protein                                328   2e-110   
ref|XP_010451655.1|  PREDICTED: polyubiquitin 4-like                    340   2e-110   
ref|XP_002083532.1|  GD13313                                            328   2e-110   
ref|XP_010480024.1|  PREDICTED: polyubiquitin-like                      332   2e-110   
gb|ESA16475.1|  hypothetical protein GLOINDRAFT_345541                  329   2e-110   
gb|ACT82769.1|  polyubiquitin                                           328   2e-110   
ref|XP_958803.1|  ubiquitin                                             332   2e-110   
ref|XP_009618235.1|  PREDICTED: polyubiquitin-like isoform X1           340   2e-110   
ref|XP_005620146.1|  PREDICTED: polyubiquitin-B isoform X1              330   2e-110   
ref|XP_001777816.1|  predicted protein                                  335   2e-110   
tpg|DAA34473.1|  TPA: ubiquitin                                         330   2e-110   
gb|KFY10578.1|  hypothetical protein V492_04946                         336   2e-110   
dbj|BAK61751.1|  ubiquitin                                              329   2e-110   
dbj|BAL61084.1|  polyubiqutin                                           335   2e-110   
ref|XP_008632241.1|  PREDICTED: polyubiquitin-C isoform X10             328   2e-110   
ref|XP_011275993.1|  ubiquitin C                                        335   3e-110   
ref|XP_006495477.1|  PREDICTED: polyubiquitin 3-like                    327   3e-110   
emb|CCA16073.1|  polyubiquitin putative                                 340   3e-110   
ref|XP_011388891.1|  putative ubiquitin                                 337   3e-110   
ref|NP_983342.1|  ACL062Cp                                              334   3e-110   
gb|ELR08709.1|  polyubiquitin                                           334   3e-110   
dbj|BAO38900.1|  ubiquitin                                              334   3e-110   
tpd|FAA00316.1|  TPA: polyubiquitin                                     334   3e-110   
ref|XP_007861169.1|  polyubiquitin                                      337   3e-110   
ref|XP_003675939.1|  hypothetical protein NCAS_0C05850                  335   3e-110   
ref|XP_008034069.1|  ubiquitin 10.1                                     337   3e-110   
ref|XP_453980.1|  hypothetical protein                                  334   3e-110   
gb|ACH45547.1|  putative ubiquitin C variant 1                          328   3e-110   
ref|XP_567862.1|  ATP-dependent protein binding protein                 337   3e-110   
tpd|FAA00319.1|  TPA: polyubiquitin                                     337   3e-110   
ref|XP_004365491.1|  polyubiquitin 5                                    328   3e-110   
ref|XP_003608276.1|  Ubiquitin                                          339   3e-110   
ref|XP_008645269.1|  PREDICTED: polyubiquitin                           339   3e-110   
ref|NP_013061.1|  ubiquitin                                             334   3e-110   
ref|XP_010553005.1|  PREDICTED: polyubiquitin-like                      339   4e-110   
emb|CAA51679.1|  ubiquitin                                              339   4e-110   
ref|XP_004505453.1|  PREDICTED: polyubiquitin-A-like                    339   4e-110   
ref|XP_009150698.1|  PREDICTED: polyubiquitin                           339   4e-110   
gb|ACB87918.1|  polyubiquitin 3                                         327   4e-110   
gb|AAC49013.1|  polyubiquitin containing 7 ubiquitin monomers           339   4e-110   
gb|KFY77115.1|  hypothetical protein V499_03430                         334   4e-110   
gb|ABD32351.2|  Ubiquitin                                               339   4e-110   
ref|XP_003607670.1|  Ubiquitin                                          339   4e-110   
ref|XP_003627151.1|  Ubiquitin                                          339   4e-110   
ref|XP_003542728.1|  PREDICTED: polyubiquitin-A-like isoform 1          339   4e-110   
ref|XP_002171731.1|  ubiquitin                                          334   4e-110   
gb|AEZ66647.1|  putative beta-1,6-glucanase                             334   4e-110   
gb|EYU33611.1|  hypothetical protein MIMGU_mgv1a004315mg                339   4e-110   
ref|XP_007410937.1|  hypothetical protein MELLADRAFT_87680              339   4e-110   
sp|P0CH27.1|RL402_TRYCR  RecName: Full=Ubiquitin-60S ribosomal pr...    333   4e-110   
ref|XP_007307433.1|  polyubiquitin                                      337   4e-110   
ref|NP_595409.1|  ubiquitin                                             334   4e-110   
emb|CAA30815.1|  unnamed protein product                                328   4e-110   
gb|EJD76734.1|  polyubiquitin, variant 2                                332   4e-110   
gb|ABO84843.1|  ubiquitin B                                             328   4e-110   
ref|XP_006350990.1|  PREDICTED: polyubiquitin-A-like                    339   4e-110   
emb|CCA40372.1|  Ubiquitin cross-reactive protein                       334   4e-110   
gb|EYU18101.1|  hypothetical protein MIMGU_mgv1a004289mg                339   4e-110   
ref|XP_002627625.1|  ubiquitin                                          334   4e-110   
ref|XP_004249885.1|  PREDICTED: polyubiquitin-like                      339   4e-110   
ref|XP_002267017.1|  PREDICTED: polyubiquitin-like                      339   4e-110   
gb|AAO43304.1|  putative polyubiquitin                                  332   4e-110   
gb|EYU38681.1|  hypothetical protein MIMGU_mgv1a004304mg                339   4e-110   
gb|ACH45557.1|  putative ubiquitin C variant 4                          327   5e-110   
ref|XP_006480550.1|  PREDICTED: polyubiquitin-A-like                    339   5e-110   
ref|XP_008003373.1|  PREDICTED: polyubiquitin-C                         328   5e-110   
ref|XP_008426285.1|  PREDICTED: polyubiquitin-B isoform X1              330   5e-110   
gb|AAO43303.1|  putative polyubiquitin                                  332   5e-110   
gb|AAO43305.1|  putative polyubiquitin                                  332   5e-110   
emb|CAN71997.1|  hypothetical protein VITISV_004025                     339   5e-110   
gb|KIZ01427.1|  ubiquitin C                                             334   5e-110   
emb|CDP91931.1|  Protein Bm3564, isoform e                              333   5e-110   
ref|XP_008161896.1|  PREDICTED: polyubiquitin-C                         328   6e-110   
ref|XP_001766873.1|  predicted protein                                  332   6e-110   
ref|XP_005023176.1|  PREDICTED: polyubiquitin-C isoform X2              328   6e-110   
ref|XP_011302492.1|  PREDICTED: polyubiquitin-B                         331   6e-110   
gb|KDQ63803.1|  hypothetical protein JAAARDRAFT_29850                   337   6e-110   
ref|XP_009901570.1|  PREDICTED: polyubiquitin-B isoform X1              328   6e-110   
ref|XP_002553736.1|  KLTH0E05852p                                       335   6e-110   
ref|XP_008300055.1|  PREDICTED: polyubiquitin-B                         328   6e-110   
gb|KJB62486.1|  hypothetical protein B456_009G418900                    333   6e-110   
gb|AAA28997.1|  ubiquitin                                               328   6e-110   
emb|CAX72428.1|  ubiquitin C                                            328   6e-110   
gb|AAL91109.1|  ubiquitin                                               331   6e-110   
ref|XP_007057723.1|  PREDICTED: polyubiquitin-C isoform X1              328   6e-110   
ref|XP_008243902.1|  PREDICTED: polyubiquitin-like isoform X1           338   7e-110   
gb|EFN76024.1|  Ubiquitin                                               328   7e-110   
emb|CAX79692.1|  ubiquitin C                                            328   7e-110   
ref|XP_001610925.1|  polyubiquitin                                      328   7e-110   
ref|XP_005525793.1|  PREDICTED: polyubiquitin-C-like isoform X2         328   7e-110   
ref|XP_667472.1|  ubiquitin B                                           328   7e-110   
ref|NP_001133175.1|  polyubiquitin                                      328   8e-110   
ref|XP_010720481.1|  PREDICTED: polyubiquitin-B                         331   8e-110   
pir||T02358  ubiquitin homolog T8F5.13 - Arabidopsis thaliana           331   8e-110
emb|CAX72421.1|  ubiquitin C                                            328   8e-110   
gb|AEP96154.1|  ubiquitin C-like protein                                328   8e-110   
ref|XP_008330590.1|  PREDICTED: polyubiquitin-B isoform X2              328   8e-110   
ref|XP_002099886.1|  GE16472                                            328   8e-110   
ref|XP_002723083.2|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    328   9e-110   
gb|ABF13286.1|  polyubiquitin                                           329   9e-110   
ref|XP_010177726.1|  PREDICTED: polyubiquitin-B isoform X5              328   9e-110   
ref|NP_176714.4|  ubiquitin 13                                          331   9e-110   
ref|XP_008924879.1|  PREDICTED: polyubiquitin isoform X6                328   9e-110   
ref|XP_004395987.1|  PREDICTED: polyubiquitin-B-like isoform 1          328   9e-110   



>ref|XP_003619702.1| Ubiquitin-like protein [Medicago truncatula]
Length=245

 Score =   343 bits (879),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 173/175 (99%), Positives = 173/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  70   LKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  249
             KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  50   FKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  109

Query  250  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  429
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  110  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  169

Query  430  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  170  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  224


 Score =   225 bits (573),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 113/113 (100%), Positives = 113/113 (100%), Gaps = 0/113 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  128  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  187

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  414
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP
Sbjct  188  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  240


 Score = 60.8 bits (146),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  73   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  122


 Score = 60.8 bits (146),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  149  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  198



>gb|ACA58351.1| ubiquitin-like protein [Sandersonia aurantiaca]
Length=189

 Score =   340 bits (873),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   224 bits (572),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 113/113 (100%), Positives = 113/113 (100%), Gaps = 0/113 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  414
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score = 60.8 bits (146),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.8 bits (146),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147



>gb|ABI84246.1| polyubiquitin 10 [Arachis hypogaea]
Length=192

 Score =   340 bits (872),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   231 bits (590),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 116/116 (100%), Positives = 116/116 (100%), Gaps = 0/116 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  423
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  192


 Score = 60.8 bits (146),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.8 bits (146),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147



>ref|XP_009412006.1| PREDICTED: polyubiquitin 11-like [Musa acuminata subsp. malaccensis]
Length=231

 Score =   341 bits (875),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 172/175 (98%), Positives = 174/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  70   LKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  249
            ++MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  1    MQMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  60

Query  250  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  429
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  61   YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  120

Query  430  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  175


 Score =   271 bits (693),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 139/152 (91%), Positives = 139/152 (91%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  79   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  138

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV             QQRLI
Sbjct  139  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVXXXXXXXXXXXXXQQRLI  198

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  199  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  230


 Score = 60.8 bits (146),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  24   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  73


 Score = 60.8 bits (146),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  100  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  149



>gb|AFC36452.1| ubiquitin, partial [Anoectochilus roxburghii]
Length=214

 Score =   340 bits (873),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  32   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  91

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  92   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  151

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  152  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  204


 Score =   252 bits (644),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 127/128 (99%), Positives = 127/128 (99%), Gaps = 0/128 (0%)
 Frame = +1

Query  211  AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAK  390
            AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAK
Sbjct  1    AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAK  60

Query  391  IQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTI  570
            IQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTI
Sbjct  61   IQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTI  120

Query  571  TLEGESSD  594
            TLE ESSD
Sbjct  121  TLEVESSD  128


 Score =   210 bits (534),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 107/107 (100%), Gaps = 0/107 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  108  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQ  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI+
Sbjct  168  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIR  214


 Score = 60.8 bits (146),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  53   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  102


 Score = 60.8 bits (146),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  129  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  178



>gb|AFW66442.1| putative ubiquitin family protein, partial [Zea mays]
Length=216

 Score =   340 bits (872),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   280 bits (717),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 140/140 (100%), Positives = 140/140 (100%), Gaps = 0/140 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKE  495
            FAGKQLEDGRTLADYNIQKE
Sbjct  197  FAGKQLEDGRTLADYNIQKE  216


 Score = 60.8 bits (146),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.8 bits (146),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXK  718
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215



>ref|XP_010235843.1| PREDICTED: polyubiquitin 11 isoform X1 [Brachypodium distachyon]
Length=265

 Score =   341 bits (875),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 175/185 (95%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = +1

Query  40   CDYFRFSILFLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  219
            CD   F      MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  13   CDLEDFLECRKMMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  72

Query  220  QLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQD  399
            QLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQD
Sbjct  73   QLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQD  132

Query  400  KEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE  579
            KEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE
Sbjct  133  KEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE  192

Query  580  GESSD  594
             ESSD
Sbjct  193  VESSD  197


 Score =   304 bits (779),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  101  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  160

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  161  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  220

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  221  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  252


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSL  736
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L
Sbjct  46   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  93


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSL  736
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L
Sbjct  122  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  169


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSL  736
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L
Sbjct  198  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  245



>ref|XP_007154494.1| hypothetical protein PHAVU_003G1236001g, partial [Phaseolus vulgaris]
 gb|ESW26488.1| hypothetical protein PHAVU_003G1236001g, partial [Phaseolus vulgaris]
Length=193

 Score =   338 bits (868),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 171/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE E+SD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVENSD  173


 Score =   232 bits (592),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 116/117 (99%), Positives = 117/117 (100%), Gaps = 0/117 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ  426
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTIDNVKAKIQDKEGIPPDQQ
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVENSDTIDNVKAKIQDKEGIPPDQQ  193


 Score = 60.8 bits (146),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.8 bits (146),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147



>ref|XP_010062974.1| PREDICTED: polyubiquitin [Eucalyptus grandis]
Length=425

 Score =   347 bits (890),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 176/184 (96%), Positives = 179/184 (97%), Gaps = 0/184 (0%)
 Frame = +1

Query  43   DYFRFSILFLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQ  222
            D  +FS L +KMQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLIFAGKQ
Sbjct  34   DLSKFSSLRVKMQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLIFAGKQ  93

Query  223  LEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  402
            LEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK
Sbjct  94   LEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  153

Query  403  EGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEG  582
            EGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE 
Sbjct  154  EGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEV  213

Query  583  ESSD  594
            ESSD
Sbjct  214  ESSD  217


 Score =   340 bits (871),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  121  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  180

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  181  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  240

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  241  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  293


 Score =   339 bits (869),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 171/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  197  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  256

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLI
Sbjct  257  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLI  316

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  317  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  369


 Score =   303 bits (777),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  273  MQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  332

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  333  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  392

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  534
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  393  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  425


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  142  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  191


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  218  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  267


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  370  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  419


 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            T+DNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  66   TVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  115


 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            T+DNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  294  TVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  343



>gb|AET06143.1| ubiquitin [Papaver somniferum]
Length=229

 Score =   340 bits (871),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   304 bits (779),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score = 60.8 bits (146),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.8 bits (146),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.8 bits (146),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223



>gb|AEZ49160.1| polyubiquitin, partial [Wolffia australiana]
Length=281

 Score =   342 bits (876),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 173/174 (99%), Positives = 173/174 (99%), Gaps = 0/174 (0%)
 Frame = +1

Query  73   KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  252
            KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  20   KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  79

Query  253  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  432
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  80   NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  139

Query  433  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  140  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  193


 Score =   338 bits (866),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 171/173 (99%), Positives = 171/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  97   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  156

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  157  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  216

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE  SSD
Sbjct  217  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVASSD  269


 Score =   213 bits (542),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 108/109 (99%), Positives = 108/109 (99%), Gaps = 0/109 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  173  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  232

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  402
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEV SSDTIDNVKAKIQDK
Sbjct  233  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVASSDTIDNVKAKIQDK  281


 Score =   193 bits (491),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 98/102 (96%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = +1

Query  289  RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT  468
            RL+  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT
Sbjct  16   RLQSKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT  75

Query  469  LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  76   LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  117


 Score = 60.8 bits (146),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  118  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  167


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  42   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  91


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  194  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  243



>ref|XP_002872805.1| hypothetical protein ARALYDRAFT_490270 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49064.1| hypothetical protein ARALYDRAFT_490270 [Arabidopsis lyrata subsp. 
lyrata]
Length=309

 Score =   343 bits (879),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   343 bits (879),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   217 bits (552),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 109/110 (99%), Positives = 110/110 (100%), Gaps = 0/110 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE  405
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK+
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKK  262


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223



>ref|XP_010490793.1| PREDICTED: polyubiquitin 11-like [Camelina sativa]
Length=230

 Score =   340 bits (871),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   304 bits (779),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score = 60.8 bits (146),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.8 bits (146),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.8 bits (146),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223



>ref|XP_002872746.1| hypothetical protein ARALYDRAFT_911794 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_002872769.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49005.1| hypothetical protein ARALYDRAFT_911794 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49028.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=229

 Score =   340 bits (871),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   300 bits (767),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP DQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPLDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  534
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  229


 Score = 60.8 bits (146),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.8 bits (146),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G   D QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPLDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223



>ref|XP_004968120.1| PREDICTED: polyubiquitin-like [Setaria italica]
 ref|XP_009404996.1| PREDICTED: polyubiquitin 11 [Musa acuminata subsp. malaccensis]
 gb|ABS18744.1| ubiqutin ligase-like protein [Oryza sativa Japonica Group]
 dbj|BAJ88219.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=229

 Score =   340 bits (871),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   304 bits (779),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score = 60.8 bits (146),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.8 bits (146),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.8 bits (146),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223



>gb|AEW46688.1| polyubiquitin, partial [Ulva linza]
Length=226

 Score =   339 bits (870),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   299 bits (766),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 150/150 (100%), Positives = 150/150 (100%), Gaps = 0/150 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLR  525
            FAGKQLEDGRTLADYNIQKESTLHLVLRLR
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLR  226


 Score = 60.8 bits (146),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.8 bits (146),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.8 bits (146),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223



>ref|XP_003626479.1| Ubiquitin-like protein [Medicago truncatula]
 gb|AES82697.1| polyubiquitin 3 [Medicago truncatula]
Length=277

 Score =   341 bits (875),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 173/175 (99%), Positives = 174/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  70   LKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  249
            +KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  47   IKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  106

Query  250  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  429
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  107  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  166

Query  430  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  167  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  221


 Score =   304 bits (778),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  125  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  185  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  244

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  534
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  245  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  277


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  70   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  119


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  146  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  195


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  222  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  271



>dbj|BAC57955.1| polyubiquitin [Aster tripolium]
Length=229

 Score =   340 bits (871),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   305 bits (781),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  534
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  229


 Score = 60.8 bits (146),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.8 bits (146),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.8 bits (146),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223



>ref|XP_010931017.1| PREDICTED: polyubiquitin 11 isoform X1 [Elaeis guineensis]
 ref|XP_010931026.1| PREDICTED: polyubiquitin 11 isoform X2 [Elaeis guineensis]
 ref|XP_010923942.1| PREDICTED: polyubiquitin 11 [Elaeis guineensis]
Length=229

 Score =   340 bits (871),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   306 bits (785),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 153/153 (100%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  534
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score = 60.8 bits (146),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.8 bits (146),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.8 bits (146),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223



>gb|EYU33610.1| hypothetical protein MIMGU_mgv1a004315mg [Erythranthe guttata]
Length=229

 Score =   339 bits (870),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   304 bits (779),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  534
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGV  229


 Score = 60.8 bits (146),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.8 bits (146),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.8 bits (146),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223



>gb|KJB36627.1| hypothetical protein B456_006G167800 [Gossypium raimondii]
Length=229

 Score =   339 bits (870),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   304 bits (778),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score = 60.5 bits (145),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.5 bits (145),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.5 bits (145),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223



>ref|XP_002317213.1| polyubiquitin family protein [Populus trichocarpa]
 gb|ABK95814.1| unknown [Populus trichocarpa]
 gb|EEE97825.1| polyubiquitin family protein [Populus trichocarpa]
Length=229

 Score =   339 bits (870),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   304 bits (779),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  534
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGI  229


 Score = 60.8 bits (146),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.8 bits (146),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.8 bits (146),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223



>ref|XP_006288299.1| hypothetical protein CARUB_v10001544mg [Capsella rubella]
 gb|EOA21197.1| hypothetical protein CARUB_v10001544mg [Capsella rubella]
Length=230

 Score =   339 bits (870),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   304 bits (778),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score = 60.5 bits (145),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.5 bits (145),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.5 bits (145),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223



>ref|XP_002438839.1| hypothetical protein SORBIDRAFT_10g027030 [Sorghum bicolor]
 gb|EER90206.1| hypothetical protein SORBIDRAFT_10g027030 [Sorghum bicolor]
Length=229

 Score =   339 bits (870),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   302 bits (774),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 151/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTLADYNIQK+STLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLADYNIQKDSTLHLVLRLRGG  228


 Score = 60.8 bits (146),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKDSTLHLVL  223


 Score = 60.5 bits (145),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.5 bits (145),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147



>ref|XP_008358804.1| PREDICTED: LOW QUALITY PROTEIN: polyubiquitin 11-like, partial 
[Malus domestica]
Length=260

 Score =   340 bits (873),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   339 bits (869),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 171/173 (99%), Positives = 171/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKT TGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTXTGKTITLEXESSD  249


 Score =   204 bits (519),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 103/105 (98%), Positives = 103/105 (98%), Gaps = 0/105 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAK  390
            IQKESTLHLVLRLRGGMQIFVKT TGKTITLE ESSDTIDNVKAK
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTXTGKTITLEXESSDTIDNVKAK  257


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223



>gb|KDO51109.1| hypothetical protein CISIN_1g026973mg [Citrus sinensis]
Length=230

 Score =   339 bits (870),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   304 bits (778),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score = 60.5 bits (145),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.5 bits (145),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.5 bits (145),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223



>gb|AAP31578.1| ubiquitin [Hevea brasiliensis]
Length=230

 Score =   339 bits (870),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   304 bits (778),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score = 60.5 bits (145),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.5 bits (145),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.5 bits (145),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223



>gb|AFP44113.1| ubiquitin, partial [Lycoris longituba]
Length=187

 Score =   338 bits (866),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 171/173 (99%), Positives = 171/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  4    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  63

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  64   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  123

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE E SD
Sbjct  124  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEGSD  176


 Score =   211 bits (538),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 107/108 (99%), Positives = 107/108 (99%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  80   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  139

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQD  399
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE SDTIDNVKAKIQD
Sbjct  140  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEGSDTIDNVKAKIQD  187


 Score =   196 bits (499),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 99/100 (99%), Positives = 99/100 (99%), Gaps = 0/100 (0%)
 Frame = +1

Query  295  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  474
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  1    RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  60

Query  475  DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  61   DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  100


 Score = 60.5 bits (145),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  101  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  150


 Score = 60.5 bits (145),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  25   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  74



>ref|XP_003570150.1| PREDICTED: polyubiquitin 11 isoform X2 [Brachypodium distachyon]
Length=241

 Score =   340 bits (871),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   304 bits (779),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223



>emb|CBI22349.3| unnamed protein product [Vitis vinifera]
Length=298

 Score =   342 bits (876),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 176/195 (90%), Positives = 179/195 (92%), Gaps = 10/195 (5%)
 Frame = +1

Query  40   CDYFRFSILFL----------KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  189
            C  ++   LF+          KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP
Sbjct  6    CYQYKILALFVSVLVHQPFPFKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  65

Query  190  DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT  369
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT
Sbjct  66   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT  125

Query  370  IDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK  549
            IDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK
Sbjct  126  IDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK  185

Query  550  TLTGKTITLEGESSD  594
            TLTGKTITLE ESSD
Sbjct  186  TLTGKTITLEVESSD  200


 Score =   340 bits (871),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  104  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  163

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  164  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  223

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  224  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  276


 Score =   219 bits (559),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  180  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  239

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  411
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG+
Sbjct  240  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGM  291


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  49   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  98


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  125  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  174


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  201  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  250



>ref|XP_006428822.1| hypothetical protein CICLE_v10012652mg [Citrus clementina]
 ref|XP_006480632.1| PREDICTED: polyubiquitin 4-like [Citrus sinensis]
 ref|XP_006480634.1| PREDICTED: polyubiquitin 4-like [Citrus sinensis]
 gb|ESR42062.1| hypothetical protein CICLE_v10012652mg [Citrus clementina]
Length=230

 Score =   339 bits (870),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   302 bits (773),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 151/152 (99%), Positives = 151/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGR LADYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRNLADYNIQKESTLHLVLRLRGG  228


 Score = 60.8 bits (146),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.8 bits (146),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED R L D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRNLADYNIQKESTLHLVL  223



>ref|XP_007205619.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
 gb|EMJ06818.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
Length=232

 Score =   339 bits (869),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 171/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQ+FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQVFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   296 bits (757),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 148/149 (99%), Positives = 148/149 (99%), Gaps = 0/149 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRL  522
            FAGKQLEDGRTLADYNIQKESTLHLVLR 
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRF  225


 Score = 60.8 bits (146),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.8 bits (146),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.8 bits (146),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223



>ref|XP_006428779.1| hypothetical protein CICLE_v10012654mg [Citrus clementina]
 ref|XP_006594132.1| PREDICTED: polyubiquitin-like [Glycine max]
 gb|ESR42019.1| hypothetical protein CICLE_v10012654mg [Citrus clementina]
 gb|KDO45140.1| hypothetical protein CISIN_1g0269401mg [Citrus sinensis]
 gb|KDO45141.1| hypothetical protein CISIN_1g0269401mg [Citrus sinensis]
 gb|KHN48309.1| Polyubiquitin [Glycine soja]
Length=230

 Score =   339 bits (869),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   303 bits (777),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score = 60.5 bits (145),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.5 bits (145),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.5 bits (145),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223



>ref|XP_006287868.1| hypothetical protein CARUB_v10001095mg, partial [Capsella rubella]
 gb|EOA20766.1| hypothetical protein CARUB_v10001095mg, partial [Capsella rubella]
Length=407

 Score =   345 bits (886),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 177/185 (96%), Positives = 179/185 (97%), Gaps = 1/185 (1%)
 Frame = +1

Query  40   CDYFRFSILFLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  219
             + FR +IL  KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  15   SNLFR-TILSFKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  73

Query  220  QLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQD  399
            QLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQD
Sbjct  74   QLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQD  133

Query  400  KEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE  579
            KEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE
Sbjct  134  KEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE  193

Query  580  GESSD  594
             ESSD
Sbjct  194  VESSD  198


 Score =   340 bits (871),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  102  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  161

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  162  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  221

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  222  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  274


 Score =   340 bits (871),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  178  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  297

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  298  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  350


 Score =   304 bits (779),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  254  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  313

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  314  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  373

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  374  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  405


 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  47   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  96


 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  123  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  172


 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  199  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  248


 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  275  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  324


 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  351  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  400



>emb|CDP08567.1| unnamed protein product [Coffea canephora]
Length=364

 Score =   344 bits (882),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 175/183 (96%), Positives = 175/183 (96%), Gaps = 0/183 (0%)
 Frame = +1

Query  46   YFRFSILFLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQL  225
            Y  F     KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQL
Sbjct  44   YLVFCFSSHKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQL  103

Query  226  EDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE  405
            EDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE
Sbjct  104  EDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE  163

Query  406  GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGE  585
            GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE E
Sbjct  164  GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE  223

Query  586  SSD  594
            SSD
Sbjct  224  SSD  226


 Score =   340 bits (872),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  130  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  189

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  190  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  249

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  250  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  302


 Score =   275 bits (703),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 137/137 (100%), Positives = 137/137 (100%), Gaps = 0/137 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  206  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  265

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  266  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  325

Query  436  FAGKQLEDGRTLADYNI  486
            FAGKQLEDGRTLADYNI
Sbjct  326  FAGKQLEDGRTLADYNI  342


 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSL  736
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L
Sbjct  75   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  122


 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSL  736
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L
Sbjct  151  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  198


 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSL  736
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L
Sbjct  227  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  274


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNI  712
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI
Sbjct  303  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNI  342



>gb|ACJ85618.1| unknown [Medicago truncatula]
Length=229

 Score =   339 bits (869),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   303 bits (777),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score = 60.8 bits (146),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.8 bits (146),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.8 bits (146),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223



>emb|CAH59739.1| polyubiquitin [Plantago major]
Length=232

 Score =   339 bits (869),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   305 bits (781),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 153/156 (98%), Positives = 154/156 (99%), Gaps = 0/156 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  543
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+  F
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGLTGF  232


 Score = 60.5 bits (145),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.5 bits (145),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.5 bits (145),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223



>ref|NP_567286.1| ubiquitin 11 [Arabidopsis thaliana]
 ref|NP_849291.1| polyubiquitin 14 [Arabidopsis thaliana]
 ref|NP_001031585.1| ubiquitin 11 [Arabidopsis thaliana]
 ref|NP_567247.2| polyubiquitin 14 [Arabidopsis thaliana]
 ref|NP_001118936.1| ubiquitin 11 [Arabidopsis thaliana]
 ref|XP_002305607.1| hypothetical protein POPTR_0004s02080g [Populus trichocarpa]
 ref|XP_006370636.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 ref|XP_007157173.1| hypothetical protein PHAVU_002G048800g [Phaseolus vulgaris]
 ref|XP_007211604.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_007211605.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_007211608.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_008349294.1| PREDICTED: polyubiquitin 11 [Malus domestica]
 ref|XP_010437606.1| PREDICTED: polyubiquitin 11 isoform X1 [Camelina sativa]
 ref|XP_010437607.1| PREDICTED: polyubiquitin 11 isoform X2 [Camelina sativa]
 ref|XP_010491428.1| PREDICTED: polyubiquitin 11 [Camelina sativa]
 sp|P0CH33.1|UBQ11_ARATH RecName: Full=Polyubiquitin 11; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAD48980.1|AF162444_12 contains similarity to Pfam family PF00240 - Ubiquitin family; 
score=526.5, E=1.9e-154, N=3 [Arabidopsis thaliana]
 emb|CAA10056.1| polyubiquitin [Vicia faba]
 emb|CAB81047.1| AT4g05050 [Arabidopsis thaliana]
 emb|CAC27335.1| putative polyubiquitin [Picea abies]
 gb|AAK96565.1| AT4g05050/T32N4_13 [Arabidopsis thaliana]
 gb|AAL06940.1| AT4g05050/T32N4_13 [Arabidopsis thaliana]
 gb|AAL09770.1| AT4g05050/T32N4_13 [Arabidopsis thaliana]
 gb|AAM19968.1| AT4g05050/T32N4_13 [Arabidopsis thaliana]
 gb|AAN65052.1| Unknown protein [Arabidopsis thaliana]
 gb|AAV92464.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92465.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92466.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92467.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92468.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92469.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92470.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92471.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92472.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92473.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92474.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92475.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92476.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92477.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92478.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92479.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92480.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92481.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92482.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92483.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92484.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92485.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92486.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92487.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92488.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92489.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92490.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 dbj|BAE98552.1| hypothetical protein [Arabidopsis thaliana]
 gb|EEE86118.1| hypothetical protein POPTR_0004s02080g [Populus trichocarpa]
 gb|AEE82244.1| polyubiquitin 14 [Arabidopsis thaliana]
 gb|AEE82245.1| polyubiquitin 14 [Arabidopsis thaliana]
 gb|AEE82468.1| ubiquitin 11 [Arabidopsis thaliana]
 gb|AEE82469.1| ubiquitin 11 [Arabidopsis thaliana]
 gb|AEE82470.1| ubiquitin 11 [Arabidopsis thaliana]
 gb|AFP43343.1| polyubiquitin [Arabidopsis thaliana]
 gb|EMJ12803.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|EMJ12804.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|EMJ12807.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|AGV54265.1| ubiquitin 11 [Phaseolus vulgaris]
 gb|ERP67205.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 gb|ESW29167.1| hypothetical protein PHAVU_002G048800g [Phaseolus vulgaris]
 gb|AES82698.2| polyubiquitin 3 [Medicago truncatula]
 gb|AJA29686.1| polyubiquitin Ubi4 [Betula luminifera]
 gb|KJB67136.1| hypothetical protein B456_010G177000 [Gossypium raimondii]
 gb|KJB69250.1| hypothetical protein B456_011G016600 [Gossypium raimondii]
 gb|KJB69251.1| hypothetical protein B456_011G016600 [Gossypium raimondii]
 gb|KJB69252.1| hypothetical protein B456_011G016600 [Gossypium raimondii]
Length=229

 Score =   339 bits (869),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   303 bits (777),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  534
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  229


 Score = 60.5 bits (145),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.5 bits (145),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.5 bits (145),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223



>gb|AFW66439.1| putative ubiquitin family protein [Zea mays]
Length=297

 Score =   341 bits (875),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 176/186 (95%), Positives = 178/186 (96%), Gaps = 0/186 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDX**REG*  615
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD   +EG 
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDIQDKEGI  256

Query  616  DPGTRR  633
             P  +R
Sbjct  257  PPDQQR  262


 Score =   338 bits (866),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   280 bits (716),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 144/152 (95%), Positives = 144/152 (95%), Gaps = 8/152 (5%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD        IQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD--------IQDKEGIPPDQQRLI  264

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  265  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  296


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223



>gb|AFK41706.1| unknown [Medicago truncatula]
 gb|AES60745.2| pentameric polyubiquitin [Medicago truncatula]
Length=233

 Score =   339 bits (869),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   303 bits (777),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223



>ref|XP_006370634.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 gb|ERP67203.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
Length=261

 Score =   340 bits (871),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   340 bits (871),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   201 bits (510),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 101/101 (100%), Positives = 101/101 (100%), Gaps = 0/101 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDN  378
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDN
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDN  253


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223



>emb|CAD27944.1| polyubiquitin-like [Oryza sativa]
Length=219

 Score =   338 bits (867),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 171/172 (99%), Positives = 171/172 (99%), Gaps = 0/172 (0%)
 Frame = +1

Query  79   QIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNI  258
            QIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNI
Sbjct  2    QIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNI  61

Query  259  QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF  438
            QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF
Sbjct  62   QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF  121

Query  439  AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  122  AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   271 bits (693),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI    +RLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIHQTSKRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTL  504
            FAGKQLEDGRTLADYNIQKESTL
Sbjct  197  FAGKQLEDGRTLADYNIQKESTL  219


 Score = 60.8 bits (146),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.8 bits (146),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 52.4 bits (124),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGS  724
            TIDNVKAKI  + G     +RLIF GKQLED RTL D NI K S
Sbjct  174  TIDNVKAKIQDKEGIHQTSKRLIFAGKQLEDGRTLADYNIQKES  217



>gb|AGV54749.1| ubiquitin 11 [Phaseolus vulgaris]
Length=269

 Score =   340 bits (872),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 173/175 (99%), Positives = 173/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  70   LKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  249
             KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  39   FKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  98

Query  250  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  429
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  99   YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  158

Query  430  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  159  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  213


 Score =   303 bits (775),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  117  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  176

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  177  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  236

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  534
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  237  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  269


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  62   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  111


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  138  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  187


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  214  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  263



>gb|KDO51955.1| hypothetical protein CISIN_1g026932mg [Citrus sinensis]
 gb|KDO51956.1| hypothetical protein CISIN_1g026932mg [Citrus sinensis]
Length=230

 Score =   338 bits (868),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   303 bits (776),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223



>gb|AAO43307.1| putative polyubiquitin [Arabidopsis thaliana]
Length=250

 Score =   339 bits (870),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  21   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  80

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  81   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  140

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  141  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  193


 Score =   304 bits (778),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  97   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  156

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  157  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  216

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  217  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  248


 Score =   230 bits (587),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 116/117 (99%), Positives = 116/117 (99%), Gaps = 0/117 (0%)
 Frame = +1

Query  244  ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  423
            ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ
Sbjct  1    ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  60

Query  424  QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  61   QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  117


 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  42   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  91


 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  118  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  167


 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  194  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  243



>ref|NP_001147027.1| polyubiquitin containing 7 ubiquitin monomers [Zea mays]
 gb|ACG25128.1| polyubiquitin containing 7 ubiquitin monomers [Zea mays]
Length=311

 Score =   342 bits (876),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 173/174 (99%), Positives = 173/174 (99%), Gaps = 0/174 (0%)
 Frame = +1

Query  73   KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  252
            KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  82   KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  141

Query  253  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  432
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  142  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  201

Query  433  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  202  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  255


 Score =   304 bits (779),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  159  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  218

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  219  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  278

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  279  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  310


 Score =   286 bits (731),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 155/179 (87%), Gaps = 6/179 (3%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL----  243
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR L    
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRNLIFSP  60

Query  244  --ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  417
               + +  +          R  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP
Sbjct  61   FARNAHTARSPISDPRSPRRSKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  120

Query  418  DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  179


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  104  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  153


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  180  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  229


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  256  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  305


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTL  697
            TIDNVKAKI  + G  PD QRLIF GKQLED R L
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRNL  56



>gb|KJB62484.1| hypothetical protein B456_009G418900 [Gossypium raimondii]
Length=229

 Score =   338 bits (867),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 171/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   304 bits (779),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score = 60.8 bits (146),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.8 bits (146),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223


 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVK+KI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71



>gb|AIZ74335.1| polyubiquitin 3, partial [Pinus massoniana]
Length=244

 Score =   338 bits (868),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 171/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  66   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  125

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  126  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  185

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE E+SD
Sbjct  186  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVENSD  238


 Score =   318 bits (814),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 160/162 (99%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = +1

Query  109  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  288
            TITLE+ESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL
Sbjct  1    TITLELESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  60

Query  289  RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT  468
            RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT
Sbjct  61   RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT  120

Query  469  LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  162


 Score =   203 bits (516),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 102/103 (99%), Positives = 103/103 (100%), Gaps = 0/103 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  142  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  201

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  384
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTIDNVK
Sbjct  202  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVENSDTIDNVK  244


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  11   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  60


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  87   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  136


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  163  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  212



>ref|XP_003574865.1| PREDICTED: polyubiquitin-like [Brachypodium distachyon]
Length=341

 Score =   342 bits (877),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 173/174 (99%), Positives = 173/174 (99%), Gaps = 0/174 (0%)
 Frame = +1

Query  73   KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  252
            KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  36   KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  95

Query  253  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  432
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  96   NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  155

Query  433  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  156  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  209


 Score =   340 bits (873),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  113  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  172

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  173  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  232

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  233  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  285


 Score =   305 bits (780),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  189  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  248

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  249  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  308

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  309  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  340


 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  58   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  107


 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  134  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  183


 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  210  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  259


 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  286  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  335



>gb|AAO42469.1| putative polyubiquitin [Arabidopsis lyrata]
Length=289

 Score =   340 bits (872),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 175/186 (94%), Positives = 178/186 (96%), Gaps = 0/186 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  68   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  127

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  128  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  187

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDX**REG*  615
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESS+   +EG 
Sbjct  188  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSEIQDKEGI  247

Query  616  DPGTRR  633
             P  +R
Sbjct  248  PPDQQR  253


 Score =   322 bits (824),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 163/164 (99%), Positives = 163/164 (99%), Gaps = 0/164 (0%)
 Frame = +1

Query  103  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  282
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  1    GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  60

Query  283  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  462
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  61   VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  120

Query  463  RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  164


 Score =   279 bits (713),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 143/152 (94%), Positives = 144/152 (95%), Gaps = 8/152 (5%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  144  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  203

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESS+        IQDKEGIPPDQQRLI
Sbjct  204  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSE--------IQDKEGIPPDQQRLI  255

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  287


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  13   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  62


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  89   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  138


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  165  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  214


 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 32/53 (60%), Gaps = 0/53 (0%)
 Frame = +2

Query  584  KALTIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            K +T++   ++I  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  230  KTITLEVESSEIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  282



>ref|XP_003627152.1| Ubiquitin [Medicago truncatula]
 gb|KEH18411.1| polyubiquitin 3 [Medicago truncatula]
Length=270

 Score =   339 bits (870),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   333 bits (853),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 168/168 (100%), Positives = 168/168 (100%), Gaps = 0/168 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE  579
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE  244


 Score =   134 bits (337),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 76/118 (64%), Gaps = 41/118 (35%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  256  IQK-----------------------------------------ESTLHLVLRLRGGM  306
            IQK                                         ESTLHLVLRLRGG 
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEDGRTLADYNIQKESTLHLVLRLRGGF  270


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223



>gb|AAC35858.1| polyubiquitin [Capsicum chinense]
Length=265

 Score =   339 bits (869),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  37   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  96

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  97   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  156

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  157  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  209


 Score =   301 bits (772),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  113  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  172

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  173  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  232

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  534
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  233  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  265


 Score =   261 bits (667),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 132/133 (99%), Positives = 132/133 (99%), Gaps = 0/133 (0%)
 Frame = +1

Query  196  QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID  375
            QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID
Sbjct  1    QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID  60

Query  376  NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTL  555
            NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTL
Sbjct  61   NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTL  120

Query  556  TGKTITLEGESSD  594
            TGKTITLE ESSD
Sbjct  121  TGKTITLEVESSD  133


 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  58   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  107


 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  134  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  183


 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVK KI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  210  TIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  259



>gb|ABY60454.1| putative polyubiquitin [Adonis aestivalis var. palaestina]
Length=281

 Score =   339 bits (870),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  12   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  71

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  72   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  131

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  132  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  184


 Score =   339 bits (870),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  88   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  147

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  148  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  207

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  208  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  260


 Score =   236 bits (601),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 118/118 (100%), Positives = 118/118 (100%), Gaps = 0/118 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  164  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  223

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  224  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  281


 Score =   212 bits (539),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 107/108 (99%), Positives = 107/108 (99%), Gaps = 0/108 (0%)
 Frame = +1

Query  271  TLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQ  450
            TLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQ
Sbjct  1    TLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQ  60

Query  451  LEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            LEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  61   LEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  108


 Score = 60.8 bits (146),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  109  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  158


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  33   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  82


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  185  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  234



>gb|AFK43392.1| unknown [Medicago truncatula]
Length=233

 Score =   337 bits (865),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 171/173 (99%), Positives = 171/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDN KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNAKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   303 bits (777),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223


 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDN KAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNAKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71



>gb|ACJ85643.1| unknown [Medicago truncatula]
Length=229

 Score =   337 bits (865),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 171/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQ+KEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQNKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   304 bits (778),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  534
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  229


 Score = 60.8 bits (146),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQNKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.5 bits (145),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.5 bits (145),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223



>gb|KIY97324.1| ubiquitin C, partial [Monoraphidium neglectum]
Length=186

 Score =   336 bits (861),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 168/173 (97%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTI+NVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIENVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTI+NVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIENVKSKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   212 bits (539),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 106/110 (96%), Positives = 110/110 (100%), Gaps = 0/110 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTI+NVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIENVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE  405
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTI+NVK+KIQDKE
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIENVKSKIQDKE  186


 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TI+NVK+KI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIENVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TI+NVK+KI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIENVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147



>ref|XP_008784557.1| PREDICTED: LOW QUALITY PROTEIN: polyubiquitin 11-like [Phoenix 
dactylifera]
Length=229

 Score =   337 bits (864),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 171/173 (99%), Positives = 171/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLV RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVXRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   304 bits (778),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score = 60.8 bits (146),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.8 bits (146),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223


 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSL  736
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  69



>ref|XP_006377830.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|ERP55627.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
Length=297

 Score =   340 bits (871),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   340 bits (871),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   280 bits (717),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 140/142 (99%), Positives = 141/142 (99%), Gaps = 0/142 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKEST  501
            FAGKQLEDGRTLADYNIQKE+ 
Sbjct  273  FAGKQLEDGRTLADYNIQKENA  294


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223


 Score = 58.9 bits (141),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXK  718
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K
Sbjct  250  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  291



>gb|KIM78989.1| hypothetical protein PILCRDRAFT_573034 [Piloderma croceum F 1598]
Length=229

 Score =   337 bits (864),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 170/173 (98%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   301 bits (772),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228


 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  71


 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  147


 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  223



>ref|XP_003590494.1| Ubiquitin [Medicago truncatula]
Length=312

 Score =   340 bits (872),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   305 bits (780),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSL  736
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221



>ref|XP_007154495.1| hypothetical protein PHAVU_003G1236001g, partial [Phaseolus vulgaris]
 gb|ESW26489.1| hypothetical protein PHAVU_003G1236001g, partial [Phaseolus vulgaris]
Length=269

 Score =   338 bits (868),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 171/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE E+SD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVENSD  173


 Score =   338 bits (868),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 171/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVENSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   232 bits (592),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 116/117 (99%), Positives = 117/117 (100%), Gaps = 0/117 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVE+SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVENSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ  426
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ  269


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223



>emb|CAC94926.1| putative ubiquitin [Pleurotus sp. 'Florida']
Length=243

 Score =   338 bits (866),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 170/173 (98%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  117

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  118  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  177

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  178  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  230


 Score =   303 bits (776),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 151/154 (98%), Positives = 153/154 (99%), Gaps = 0/154 (0%)
 Frame = +1

Query  133  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  312
            SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQI
Sbjct  1    SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQI  60

Query  313  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  492
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQK
Sbjct  61   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK  120

Query  493  ESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            ESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  154


 Score =   206 bits (523),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 103/105 (98%), Positives = 105/105 (100%), Gaps = 0/105 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  134  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  193

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAK  390
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA+
Sbjct  194  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAR  238


 Score = 61.2 bits (147),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  3    TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  52


 Score = 61.2 bits (147),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  79   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  128


 Score = 61.2 bits (147),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  155  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  204



>gb|KIM78981.1| hypothetical protein PILCRDRAFT_10644 [Piloderma croceum F 1598]
Length=229

 Score =   337 bits (864),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 170/173 (98%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   302 bits (773),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  534
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG+
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGV  229


 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  71


 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  147


 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  223



>gb|KJA26171.1| hypothetical protein HYPSUDRAFT_354705 [Hypholoma sublateritium 
FD-334 SS-4]
Length=229

 Score =   337 bits (864),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 170/173 (98%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   301 bits (772),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228


 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  71


 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  147


 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  223



>gb|EJU04700.1| polyubiquitin UbiD/Ubi4 [Dacryopinax sp. DJM-731 SS1]
Length=229

 Score =   337 bits (864),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 170/173 (98%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   301 bits (772),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228


 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  71


 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  147


 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  223



>ref|XP_006685644.1| ubiquitin [Candida tenuis ATCC 10573]
 gb|EGV64838.1| ubiquitin [Candida tenuis ATCC 10573]
Length=229

 Score =   337 bits (864),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 170/173 (98%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   301 bits (772),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVK+KI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVK+KI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVK+KI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223



>prf||1604470A poly-ubiquitin
Length=272

 Score =   338 bits (868),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  44   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  103

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  104  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  163

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  164  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  216


 Score =   303 bits (776),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  120  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  179

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  180  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  239

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  240  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  271


 Score =   276 bits (705),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 138/139 (99%), Positives = 138/139 (99%), Gaps = 0/139 (0%)
 Frame = +1

Query  178  GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE  357
            GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE
Sbjct  2    GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE  61

Query  358  SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQ  537
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQ
Sbjct  62   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQ  121

Query  538  IFVKTLTGKTITLEGESSD  594
            IFVKTLTGKTITLE ESSD
Sbjct  122  IFVKTLTGKTITLEVESSD  140


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  65   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  114


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  141  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  190


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  217  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  266



>ref|XP_011110054.1| hypothetical protein H072_4094 [Dactylellina haptotyla CBS 200.50]
 gb|EPS41950.1| hypothetical protein H072_4094 [Dactylellina haptotyla CBS 200.50]
Length=229

 Score =   337 bits (864),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 170/173 (98%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   301 bits (772),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228


 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  71


 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  147


 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  223



>gb|AES89865.2| polyubiquitin 3 [Medicago truncatula]
Length=278

 Score =   338 bits (868),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   335 bits (859),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 169/171 (99%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGES  588
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEG +
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGNN  247


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223



>ref|XP_006288300.1| hypothetical protein CARUB_v10001544mg [Capsella rubella]
 gb|EOA21198.1| hypothetical protein CARUB_v10001544mg [Capsella rubella]
Length=306

 Score =   340 bits (871),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   338 bits (866),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 171/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQ+KEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQEKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   302 bits (774),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 151/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQ+KEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQEKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  250  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQEKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223



>gb|AIS71924.1| polyubiquitin [Mangifera indica]
Length=229

 Score =   337 bits (864),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 171/173 (99%), Positives = 171/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLH VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHRVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   261 bits (667),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 131/131 (100%), Positives = 131/131 (100%), Gaps = 0/131 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRT  468
            FAGKQLEDGRT
Sbjct  197  FAGKQLEDGRT  207


 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGS  724
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65


 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRT  694
            TIDNVKAKI  + G  PD QRLIF GKQLED RT
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT  207



>gb|ABD96088.1| polyubiquitin [Malus domestica]
Length=270

 Score =   338 bits (867),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  42   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  101

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  102  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  161

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  162  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  214


 Score =   303 bits (776),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  118  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  177

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  178  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  237

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  534
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  238  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  270


 Score =   273 bits (699),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 137/138 (99%), Positives = 137/138 (99%), Gaps = 0/138 (0%)
 Frame = +1

Query  181  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  360
            IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES
Sbjct  1    IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  60

Query  361  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  540
            SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI
Sbjct  61   SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  120

Query  541  FVKTLTGKTITLEGESSD  594
            FVKTLTGKTITLE ESSD
Sbjct  121  FVKTLTGKTITLEVESSD  138


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  63   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  112


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  139  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  188


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  215  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  264



>gb|AAQ84316.1| fiber polyubiquitin [Gossypium barbadense]
Length=229

 Score =   337 bits (863),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 171/173 (99%), Positives = 171/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   299 bits (766),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  534
            FAGKQLEDGRTLADYNIQKESTL LVLRLRGG 
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLPLVLRLRGGF  229


 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLPLVL  223


 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVK KI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71



>ref|XP_007014924.1| Polyubiquitin 3 [Theobroma cacao]
 gb|EOY32543.1| Polyubiquitin 3 [Theobroma cacao]
Length=305

 Score =   340 bits (871),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   340 bits (871),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   304 bits (779),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  250  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299



>ref|XP_007211606.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|EMJ12805.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
Length=309

 Score =   340 bits (871),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   340 bits (871),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   302 bits (773),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 151/151 (100%), Positives = 151/151 (100%), Gaps = 0/151 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRG  303


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  250  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299



>ref|XP_011468094.1| PREDICTED: polyubiquitin [Fragaria vesca subsp. vesca]
Length=306

 Score =   340 bits (871),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   339 bits (869),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 171/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   304 bits (779),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  250  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            T+DNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71



>ref|XP_002873083.1| hypothetical protein ARALYDRAFT_487095 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49342.1| hypothetical protein ARALYDRAFT_487095 [Arabidopsis lyrata subsp. 
lyrata]
Length=306

 Score =   339 bits (870),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   337 bits (865),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 171/173 (99%), Positives = 171/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLTDYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   304 bits (779),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTLTD NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLTDYNIQKESTLHLVL  71


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  250  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299



>dbj|BAJ85978.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91581.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=305

 Score =   339 bits (870),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   338 bits (867),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 171/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   304 bits (778),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  250  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299


 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVK+KI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71



>ref|NP_851029.1| polyubiquitin 3 [Arabidopsis thaliana]
 ref|NP_568112.2| polyubiquitin 3 [Arabidopsis thaliana]
 ref|NP_001031824.1| polyubiquitin 3 [Arabidopsis thaliana]
 ref|XP_006288303.1| hypothetical protein CARUB_v10001548mg [Capsella rubella]
 ref|XP_009122723.1| PREDICTED: polyubiquitin 3 [Brassica rapa]
 sp|Q1EC66.1|UBQ3_ARATH RecName: Full=Polyubiquitin 3; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Arabidopsis thaliana]
 emb|CAB86091.1| polyubiquitin (ubq3) [Arabidopsis thaliana]
 dbj|BAB08384.1| polyubiquitin [Arabidopsis thaliana]
 gb|AAO00780.1| polyubiquitin (UBQ3) [Arabidopsis thaliana]
 gb|ABF85770.1| At5g03240 [Arabidopsis thaliana]
 dbj|BAH19791.1| AT5G03240 [Arabidopsis thaliana]
 gb|AED90574.1| polyubiquitin 3 [Arabidopsis thaliana]
 gb|AED90575.1| polyubiquitin 3 [Arabidopsis thaliana]
 gb|AED90576.1| polyubiquitin 3 [Arabidopsis thaliana]
 gb|EOA21201.1| hypothetical protein CARUB_v10001548mg [Capsella rubella]
Length=306

 Score =   339 bits (870),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   339 bits (870),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   304 bits (778),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  250  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299



>sp|P69315.2|UBIQP_LINUS RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Contains: RecName: Full=Ubiquitin-related; Flags: Precursor, 
partial [Linum usitatissimum]
 gb|AAA33401.1| ubiquitin, partial [Linum usitatissimum]
Length=305

 Score =   339 bits (870),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  118  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  177

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  178  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  237

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  238  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  290


 Score =   338 bits (867),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 171/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIF+KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  42   MQIFLKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  101

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  102  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  161

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  162  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  214


 Score =   273 bits (698),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 136/138 (99%), Positives = 137/138 (99%), Gaps = 0/138 (0%)
 Frame = +1

Query  181  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  360
            IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF+KTLTGKTITLEVES
Sbjct  1    IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFLKTLTGKTITLEVES  60

Query  361  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  540
            SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI
Sbjct  61   SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  120

Query  541  FVKTLTGKTITLEGESSD  594
            FVKTLTGKTITLE ESSD
Sbjct  121  FVKTLTGKTITLEVESSD  138


 Score =   221 bits (562),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 112/112 (100%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  194  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  253

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  411
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  254  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  305


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  63   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  112


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  139  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  188


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  215  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  264



>ref|XP_006396611.1| hypothetical protein EUTSA_v10028730mg [Eutrema salsugineum]
 gb|AAL27563.1|AF429429_1 polyubiquitin OUB1 [Olea europaea]
 gb|ESQ38064.1| hypothetical protein EUTSA_v10028730mg [Eutrema salsugineum]
Length=305

 Score =   339 bits (870),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   339 bits (870),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   305 bits (780),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  534
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  305


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  250  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299



>gb|KDP39203.1| hypothetical protein JCGZ_00960 [Jatropha curcas]
Length=317

 Score =   340 bits (871),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   340 bits (871),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   310 bits (795),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 155/156 (99%), Positives = 155/156 (99%), Gaps = 0/156 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  543
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI 
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIL  308


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  250  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299



>gb|AHC00631.1| polyubiquitin [Ganoderma lucidum]
Length=319

 Score =   340 bits (872),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 172/179 (96%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = +1

Query  58   SILFLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  237
            S+L   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  9    SLLAYSMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  68

Query  238  TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  417
            TL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP
Sbjct  69   TLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  128

Query  418  DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  129  DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  187


 Score =   337 bits (864),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 170/173 (98%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  91   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  150

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  151  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  210

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  211  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  263


 Score =   303 bits (775),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  167  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  226

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  227  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  286

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  534
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG+
Sbjct  287  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGL  319


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  36   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  85


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  112  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  161


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  188  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  237


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  264  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  313



>ref|XP_009114489.1| PREDICTED: polyubiquitin-like [Brassica rapa]
Length=305

 Score =   339 bits (870),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   335 bits (860),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 171/173 (99%), Positives = 171/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP DQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPQDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   304 bits (778),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  534
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  250  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G   D QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPQDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71



>ref|XP_006302387.1| hypothetical protein CARUB_v10020456mg [Capsella rubella]
 gb|EOA35285.1| hypothetical protein CARUB_v10020456mg [Capsella rubella]
Length=307

 Score =   339 bits (870),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   339 bits (870),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   304 bits (778),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  250  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299



>ref|XP_009112898.1| PREDICTED: polyubiquitin [Brassica rapa]
Length=305

 Score =   339 bits (870),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   339 bits (870),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   304 bits (779),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  534
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGI  305


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  250  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299



>gb|EYU33609.1| hypothetical protein MIMGU_mgv1a004315mg [Erythranthe guttata]
 gb|EYU33612.1| hypothetical protein MIMGU_mgv1a004315mg [Erythranthe guttata]
Length=305

 Score =   339 bits (870),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   339 bits (870),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   304 bits (779),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  534
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGV  305


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  250  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299



>ref|XP_002456845.1| hypothetical protein SORBIDRAFT_03g043940 [Sorghum bicolor]
 ref|XP_002453347.1| hypothetical protein SORBIDRAFT_04g004280 [Sorghum bicolor]
 ref|XP_003574869.1| PREDICTED: polyubiquitin [Brachypodium distachyon]
 ref|XP_007695807.1| hypothetical protein COCSADRAFT_108224 [Bipolaris sorokiniana 
ND90Pr]
 ref|XP_009412665.1| PREDICTED: polyubiquitin isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009412666.1| PREDICTED: polyubiquitin isoform X2 [Musa acuminata subsp. malaccensis]
 ref|XP_010227192.1| PREDICTED: polyubiquitin isoform X2 [Brachypodium distachyon]
 sp|P69309.2|UBIQP_AVEFA RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Avena fatua]
 pir||S28426 polyubiquitin 4 - wild oat
 emb|CAA49200.1| tetraubiquitin [Avena fatua]
 gb|AAC37466.1| polyubiquitin [Saccharum hybrid cultivar H65-7052]
 gb|AAM28291.1| tetrameric ubiquitin [Ananas comosus]
 gb|EES01965.1| hypothetical protein SORBIDRAFT_03g043940 [Sorghum bicolor]
 gb|EES06323.1| hypothetical protein SORBIDRAFT_04g004280 [Sorghum bicolor]
 gb|AEE65379.1| ubiquitin 1 [Panicum virgatum]
 gb|EMD68114.1| hypothetical protein COCSADRAFT_108224 [Bipolaris sorokiniana 
ND90Pr]
 gb|EMD93446.1| hypothetical protein COCHEDRAFT_1202381 [Bipolaris maydis C5]
 gb|EMS58836.1| Polyubiquitin [Triticum urartu]
 gb|ENI07106.1| hypothetical protein COCC4DRAFT_70576 [Bipolaris maydis ATCC 
48331]
 gb|AGT16802.1| polyubiquitin-like protein [Saccharum hybrid cultivar R570]
 gb|EUN28034.1| hypothetical protein COCVIDRAFT_96666 [Bipolaris victoriae FI3]
Length=305

 Score =   339 bits (870),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   339 bits (870),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   304 bits (778),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  250  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299



>emb|CAA48140.1| ubiquitin [Antirrhinum majus]
Length=296

 Score =   339 bits (869),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  68   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  127

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  128  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  187

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  188  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  240


 Score =   322 bits (825),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 163/164 (99%), Positives = 163/164 (99%), Gaps = 0/164 (0%)
 Frame = +1

Query  103  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  282
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  1    GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  60

Query  283  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  462
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  61   VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  120

Query  463  RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  164


 Score =   303 bits (777),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  144  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  203

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  204  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  263

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  534
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  264  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  296


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  13   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  62


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  89   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  138


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  165  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  214


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  241  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  290



>gb|EPS72031.1| polyubiquitin, partial [Genlisea aurea]
Length=274

 Score =   338 bits (867),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  46   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  105

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  106  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  165

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  166  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  218


 Score =   303 bits (775),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  122  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  181

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  182  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  241

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  534
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  242  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  274


 Score =   281 bits (719),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 141/142 (99%), Positives = 141/142 (99%), Gaps = 0/142 (0%)
 Frame = +1

Query  169  DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL  348
            DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL
Sbjct  1    DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL  60

Query  349  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  528
            EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG
Sbjct  61   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  120

Query  529  GMQIFVKTLTGKTITLEGESSD  594
            GMQIFVKTLTGKTITLE ESSD
Sbjct  121  GMQIFVKTLTGKTITLEVESSD  142


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  67   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  116


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  143  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  192


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  219  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  268



>ref|XP_007512209.1| polyubiquitin [Bathycoccus prasinos]
 emb|CCO66297.1| polyubiquitin [Bathycoccus prasinos]
Length=359

 Score =   341 bits (875),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  128  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  187

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  188  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  247

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  248  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  300


 Score =   317 bits (813),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 172/224 (77%), Positives = 172/224 (77%), Gaps = 51/224 (23%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG-------------------------  180
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG                         
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGTFRVKSRRLKFCLLALLDSATTIES  60

Query  181  --------------------------IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  282
                                      IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  61   SLALRSKKSSERREREKESALSRARGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  120

Query  283  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  462
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  121  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  180

Query  463  RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  181  RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  224


 Score =   305 bits (782),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  204  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  263

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  264  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  323

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  324  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  355


 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  149  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  198


 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  225  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  274


 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  301  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  350



>ref|XP_006654612.1| PREDICTED: polyubiquitin-like [Oryza brachyantha]
Length=305

 Score =   339 bits (870),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   339 bits (870),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   302 bits (774),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 151/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQL+DGRTLADYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLDDGRTLADYNIQKESTLHLVLRLRGG  304


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223


 Score = 58.9 bits (141),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQL+D RTL D NI K S   L  
Sbjct  250  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLDDGRTLADYNIQKESTLHLVL  299



>emb|CDP08569.1| unnamed protein product [Coffea canephora]
Length=306

 Score =   339 bits (870),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   338 bits (866),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 171/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   304 bits (779),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  534
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGI  305


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  250  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299


 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVK+KI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71



>gb|KIK28767.1| hypothetical protein PISMIDRAFT_672939, partial [Pisolithus microcarpus 
441]
Length=247

 Score =   337 bits (864),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 170/173 (98%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  19   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  78

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  79   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  138

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  139  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  191


 Score =   302 bits (774),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  95   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  154

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  155  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  534
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG+
Sbjct  215  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGL  247


 Score =   225 bits (573),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 113/115 (98%), Positives = 114/115 (99%), Gaps = 0/115 (0%)
 Frame = +1

Query  250  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  429
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  1    YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  60

Query  430  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            LIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  61   LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  115


 Score = 61.2 bits (147),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  40   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  89


 Score = 61.2 bits (147),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  116  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  165


 Score = 61.2 bits (147),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  192  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  241



>emb|CAA40323.1| polyubiquitin protein [Helianthus annuus]
Length=334

 Score =   340 bits (872),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   340 bits (872),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   340 bits (872),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  325


 Score =   209 bits (533),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 106/106 (100%), Positives = 106/106 (100%), Gaps = 0/106 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI  393
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI  334


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  250  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299



>ref|XP_007205620.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
 ref|XP_007205621.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
 gb|EMJ06819.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
 gb|EMJ06820.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
Length=306

 Score =   339 bits (870),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   338 bits (868),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 171/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQ+FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQVFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   304 bits (778),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  250  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299



>gb|AAO43308.1| putative polyubiquitin [Arabidopsis thaliana]
Length=250

 Score =   337 bits (864),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 171/173 (99%), Positives = 171/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  21   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  80

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLI
Sbjct  81   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEWIPPDQQRLI  140

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  141  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  193


 Score =   298 bits (762),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  97   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEWIPPDQQRLIFAGKQLEDGRTLADYN  156

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  157  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  216

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTLA YNIQKESTLHLVLRLRGG
Sbjct  217  FAGKQLEDGRTLAVYNIQKESTLHLVLRLRGG  248


 Score =   231 bits (588),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 116/117 (99%), Positives = 116/117 (99%), Gaps = 0/117 (0%)
 Frame = +1

Query  244  ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  423
            ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ
Sbjct  1    ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  60

Query  424  QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  61   QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  117


 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  42   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  91


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL   NI K S   L  
Sbjct  194  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAVYNIQKESTLHLVL  243


 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  +    PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  118  TIDNVKAKIQDKEWIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  167



>ref|XP_006480631.1| PREDICTED: polyubiquitin-like [Citrus sinensis]
Length=306

 Score =   339 bits (869),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   339 bits (869),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   304 bits (778),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  250  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299



>gb|AES89866.2| polyubiquitin 3 [Medicago truncatula]
Length=305

 Score =   339 bits (869),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   339 bits (869),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   303 bits (777),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  250  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299



>gb|ABK94002.1| unknown [Populus trichocarpa]
Length=305

 Score =   339 bits (869),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   335 bits (860),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 171/173 (99%), Positives = 171/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD N
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADNN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   304 bits (778),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  534
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  250  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADNNIQKESTLHLVL  71



>gb|AAM64530.1| ubiquitin homolog [Arabidopsis thaliana]
Length=229

 Score =   336 bits (862),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 171/173 (99%), Positives = 171/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVL LRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLXLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   303 bits (777),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  534
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  229


 Score = 60.5 bits (145),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.5 bits (145),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.5 bits (145),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223



>emb|CDR41572.1| RHTO0S06e03070g1_1 [Rhodosporidium toruloides]
Length=230

 Score =   336 bits (862),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 169/173 (98%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTL+DYN+QKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLSDYNVQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   300 bits (768),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 149/152 (98%), Positives = 151/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            +QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  VQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTL DYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLQDYNIQKESTLHLVLRLRGG  228


 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  71


 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D N+ K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNVQKESTLHLVL  147


 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLQDYNIQKESTLHLVL  223



>gb|KJB81823.1| hypothetical protein B456_013G163500 [Gossypium raimondii]
Length=305

 Score =   339 bits (869),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   337 bits (864),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 171/173 (99%), Positives = 171/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   303 bits (777),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  534
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  250  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299


 Score = 58.9 bits (141),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVK KI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71



>ref|NP_849292.1| polyubiquitin 14 [Arabidopsis thaliana]
 ref|NP_001118922.1| polyubiquitin 14 [Arabidopsis thaliana]
 ref|NP_974516.4| polyubiquitin 10 [Arabidopsis thaliana]
 ref|XP_002316978.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 ref|XP_002874829.1| hypothetical protein ARALYDRAFT_490155 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_004146845.1| PREDICTED: polyubiquitin-like [Cucumis sativus]
 ref|XP_004165599.1| PREDICTED: polyubiquitin-like [Cucumis sativus]
 ref|XP_004293260.1| PREDICTED: polyubiquitin [Fragaria vesca subsp. vesca]
 ref|XP_006383941.1| hypothetical protein POPTR_0004s02080g [Populus trichocarpa]
 ref|XP_006377831.1| polyubiquitin family protein [Populus trichocarpa]
 ref|XP_006377832.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 ref|XP_006377833.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 ref|XP_006372945.1| hypothetical protein POPTR_0017s06450g [Populus trichocarpa]
 ref|XP_006396614.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 ref|XP_006396615.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 ref|XP_006589609.1| PREDICTED: polyubiquitin [Glycine max]
 ref|XP_006593990.1| PREDICTED: polyubiquitin 10-like isoform X2 [Glycine max]
 ref|XP_006606032.1| PREDICTED: polyubiquitin [Glycine max]
 ref|XP_007211603.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_008454542.1| PREDICTED: polyubiquitin [Cucumis melo]
 ref|XP_009134330.1| PREDICTED: polyubiquitin [Brassica rapa]
 ref|XP_010422419.1| PREDICTED: polyubiquitin [Camelina sativa]
 ref|XP_011007895.1| PREDICTED: polyubiquitin [Populus euphratica]
 ref|XP_011010177.1| PREDICTED: polyubiquitin [Populus euphratica]
 sp|P69325.2|UBIQP_SOYBN RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Glycine max]
 sp|Q3E7T8.2|UBQ14_ARATH RecName: Full=Polyubiquitin 14; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Arabidopsis thaliana]
 pir||S49332 polyubiquitin 4 - common sunflower
 pir||G85036 polyubiquitin [imported] - Arabidopsis thaliana
 dbj|BAA03764.1| ubiquitin [Glycine max]
 dbj|BAA05670.1| ubiquitin [Glycine max]
 emb|CAA84440.1| seed tetraubiquitin [Helianthus annuus]
 dbj|BAA05085.1| Ubiquitin [Glycine max]
 gb|AAD15340.1| putative polyubiquitin [Arabidopsis thaliana]
 emb|CAB77774.1| polyubiquitin [Arabidopsis thaliana]
 gb|AAM65295.1| polyubiquitin (UBQ14) [Arabidopsis thaliana]
 emb|CAH59738.1| polyubiquitin [Plantago major]
 dbj|BAH19554.1| AT4G02890 [Arabidopsis thaliana]
 gb|EEE97590.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|EFH51088.1| hypothetical protein ARALYDRAFT_490155 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AEE82246.1| polyubiquitin 14 [Arabidopsis thaliana]
 gb|AEE82247.1| polyubiquitin 14 [Arabidopsis thaliana]
 gb|AEE82503.1| polyubiquitin 10 [Arabidopsis thaliana]
 gb|AFP43341.1| polyubiquitin [Arabidopsis thaliana]
 gb|EMJ12802.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|ERP50742.1| hypothetical protein POPTR_0017s06450g [Populus trichocarpa]
 gb|ERP55628.1| polyubiquitin family protein [Populus trichocarpa]
 gb|ERP55629.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|ERP55630.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|ERP61738.1| hypothetical protein POPTR_0004s02080g [Populus trichocarpa]
 gb|ESQ38067.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 gb|ESQ38068.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 dbj|BAO57270.1| ubiquitin 10 [Ipomoea nil]
 gb|KHN02680.1| Polyubiquitin [Glycine soja]
 gb|KHN15806.1| Polyubiquitin [Glycine soja]
 gb|KJB13594.1| hypothetical protein B456_002G083100 [Gossypium raimondii]
 gb|KJB69249.1| hypothetical protein B456_011G016600 [Gossypium raimondii]
 prf||2111434A tetraubiquitin
Length=305

 Score =   339 bits (869),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   339 bits (869),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   303 bits (777),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  534
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  250  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299



>ref|XP_006428820.1| hypothetical protein CICLE_v10012290mg [Citrus clementina]
 gb|ESR42060.1| hypothetical protein CICLE_v10012290mg [Citrus clementina]
Length=306

 Score =   339 bits (869),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   336 bits (862),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 171/173 (99%), Positives = 171/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQ KEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQHKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   303 bits (777),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  250  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQHKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71



>ref|XP_007154493.1| hypothetical protein PHAVU_003G123500g [Phaseolus vulgaris]
 gb|ESW26487.1| hypothetical protein PHAVU_003G123500g [Phaseolus vulgaris]
Length=429

 Score =   343 bits (880),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 177/183 (97%), Positives = 178/183 (97%), Gaps = 1/183 (1%)
 Frame = +1

Query  46   YFRFSILFLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQL  225
            + RF I  LKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQL
Sbjct  40   FHRF-ISPLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQL  98

Query  226  EDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE  405
            EDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE
Sbjct  99   EDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE  158

Query  406  GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGE  585
            GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE E
Sbjct  159  GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE  218

Query  586  SSD  594
            SSD
Sbjct  219  SSD  221


 Score =   339 bits (869),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  125  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  185  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  244

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  245  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  297


 Score =   339 bits (869),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  201  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  260

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  261  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  320

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  321  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  373


 Score =   304 bits (778),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  277  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  336

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  337  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  396

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  534
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  397  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  429


 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  70   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  119


 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  146  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  195


 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  222  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  271


 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  298  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  347


 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  374  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  423



>emb|CAH59740.1| polyubiquitin [Plantago major]
Length=305

 Score =   339 bits (869),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   339 bits (869),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   303 bits (777),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  250  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299



>ref|XP_010258950.1| PREDICTED: polyubiquitin [Nelumbo nucifera]
Length=306

 Score =   339 bits (869),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   339 bits (869),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   304 bits (778),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  534
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGI  305


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  250  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299



>ref|XP_003082269.1| polyubiquitin (ISS) [Ostreococcus tauri]
Length=288

 Score =   338 bits (867),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  53   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  112

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  113  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  173  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  225


 Score =   276 bits (705),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 138/140 (99%), Positives = 139/140 (99%), Gaps = 0/140 (0%)
 Frame = +1

Query  175  EGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEV  354
            +GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEV
Sbjct  10   DGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEV  69

Query  355  ESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  534
            ESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM
Sbjct  70   ESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  129

Query  535  QIFVKTLTGKTITLEGESSD  594
            QIFVKTLTGKTITLE ESSD
Sbjct  130  QIFVKTLTGKTITLEVESSD  149


 Score =   256 bits (655),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 129/129 (100%), Positives = 129/129 (100%), Gaps = 0/129 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  129  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  188

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  189  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  248

Query  436  FAGKQLEDG  462
            FAGKQLEDG
Sbjct  249  FAGKQLEDG  257


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  74   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  123


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  150  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  199



>ref|XP_003537278.1| PREDICTED: polyubiquitin-like [Glycine max]
 ref|XP_010454744.1| PREDICTED: polyubiquitin 3 [Camelina sativa]
 gb|KHN39094.1| Polyubiquitin [Glycine soja]
Length=306

 Score =   339 bits (869),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   339 bits (869),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   303 bits (777),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  250  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299



>emb|CBY46745.1| polyubiquitin 10 protein, partial [Lepidium appelianum]
Length=308

 Score =   339 bits (869),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  4    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  63

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  64   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  123

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  124  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  176


 Score =   339 bits (869),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  80   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  139

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  140  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  200  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  252


 Score =   303 bits (777),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  156  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  215

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  216  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  275

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  534
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  276  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  308


 Score =   196 bits (498),  Expect(2) = 3e-59, Method: Compositional matrix adjust.
 Identities = 99/100 (99%), Positives = 99/100 (99%), Gaps = 0/100 (0%)
 Frame = +1

Query  295  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  474
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  1    RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  60

Query  475  DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  61   DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  100


 Score = 60.5 bits (145),  Expect(2) = 3e-59, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  101  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  150


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  25   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  74


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  177  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  226


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  253  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  302



>ref|XP_006428925.1| hypothetical protein CICLE_v10012291mg [Citrus clementina]
 gb|ESR42165.1| hypothetical protein CICLE_v10012291mg [Citrus clementina]
Length=306

 Score =   338 bits (868),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   338 bits (868),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   303 bits (777),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  250  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299



>ref|XP_006428821.1| hypothetical protein CICLE_v10012292mg [Citrus clementina]
 ref|XP_006480633.1| PREDICTED: polyubiquitin-like [Citrus sinensis]
 gb|ESR42061.1| hypothetical protein CICLE_v10012292mg [Citrus clementina]
Length=306

 Score =   338 bits (868),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   338 bits (868),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   303 bits (777),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  250  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299



>gb|KDP38838.1| hypothetical protein JCGZ_04995 [Jatropha curcas]
Length=308

 Score =   339 bits (869),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   339 bits (869),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   303 bits (777),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  250  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299



>ref|XP_010493589.1| PREDICTED: polyubiquitin-like [Camelina sativa]
Length=430

 Score =   343 bits (880),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 174/180 (97%), Positives = 175/180 (97%), Gaps = 0/180 (0%)
 Frame = +1

Query  55   FSILFLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  234
             +IL  KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  41   LAILSFKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  100

Query  235  RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  414
            RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP
Sbjct  101  RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  160

Query  415  PDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            PDQQRLIFAGKQLEDG TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  161  PDQQRLIFAGKQLEDGHTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  220


 Score =   340 bits (872),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  200  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  259

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  260  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  319

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  320  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  372


 Score =   338 bits (866),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 171/173 (99%), Positives = 171/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG TLADYN
Sbjct  124  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGHTLADYN  183

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  184  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  243

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  244  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  296


 Score =   305 bits (780),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  276  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  335

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  336  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  395

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  396  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  427


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  69   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  118


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  221  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  270


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  297  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  346


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  373  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  422


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED  TL D NI K S   L  
Sbjct  145  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGHTLADYNIQKESTLHLVL  194



>gb|AFW66438.1| putative ubiquitin family protein, partial [Zea mays]
 gb|AFW66447.1| ubiquitin2, partial [Zea mays]
Length=349

 Score =   340 bits (872),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   318 bits (816),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 172/218 (79%), Positives = 172/218 (79%), Gaps = 45/218 (21%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQ-------------  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQ             
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQKESTLHLVLRLRG  196

Query  397  --------------------------------DKEGIPPDQQRLIFAGKQLEDGRTLADY  480
                                            DKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  197  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  256

Query  481  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  257  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  294


 Score =   305 bits (780),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  198  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  257

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  258  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  317

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  318  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  349


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  219  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  268


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  295  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  344



>gb|ACD31680.1| ubiquitin [Gossypium hirsutum]
Length=305

 Score =   338 bits (868),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   337 bits (863),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 171/173 (99%), Positives = 171/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   301 bits (771),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  534
            FAGKQLEDGRTL DYNIQKESTLHLVLRLRGG 
Sbjct  273  FAGKQLEDGRTLPDYNIQKESTLHLVLRLRGGF  305


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  250  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLPDYNIQKESTLHLVL  299


 Score = 58.9 bits (141),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVK KI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71



>emb|CAA54603.1| pentameric polyubiquitin [Nicotiana tabacum]
Length=346

 Score =   340 bits (872),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   340 bits (872),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   340 bits (872),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  325


 Score =   224 bits (572),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 113/113 (100%), Positives = 113/113 (100%), Gaps = 0/113 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  414
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  341


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  250  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299



>ref|XP_011077812.1| PREDICTED: polyubiquitin 3 [Sesamum indicum]
 ref|XP_011077813.1| PREDICTED: polyubiquitin 3 [Sesamum indicum]
Length=334

 Score =   339 bits (870),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  29   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  88

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  89   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  148

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  149  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  201


 Score =   339 bits (870),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  105  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  164

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  165  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  224

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  225  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  277


 Score =   304 bits (778),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  181  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  240

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  241  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  300

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  301  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  332


 Score =   219 bits (557),  Expect(2) = 3e-66, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 111/112 (99%), Gaps = 0/112 (0%)
 Frame = +1

Query  259  QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF  438
            QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF
Sbjct  14   QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF  73

Query  439  AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  74   AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  125


 Score = 60.8 bits (146),  Expect(2) = 3e-66, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  126  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  175


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  50   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  99


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  202  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  251


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  278  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  327



>dbj|BAF00213.1| polyubiquitin 4 UBQ4 [Arabidopsis thaliana]
Length=351

 Score =   340 bits (872),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   318 bits (816),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 172/218 (79%), Positives = 172/218 (79%), Gaps = 45/218 (21%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQ-------------  396
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQ             
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQKESTLHLVLRLRG  196

Query  397  --------------------------------DKEGIPPDQQRLIFAGKQLEDGRTLADY  480
                                            DKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  197  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  256

Query  481  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  257  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  294


 Score =   305 bits (780),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  198  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  257

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  258  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  317

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  318  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  349


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  219  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  268


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  295  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  344



>gb|AFY06654.1| polyubiquitin, partial [Carica papaya]
Length=264

 Score =   337 bits (864),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 171/173 (99%), Positives = 171/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  36   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  95

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  96   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  155

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  156  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  208


 Score =   301 bits (772),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  112  MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  171

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  172  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  231

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  534
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  232  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  264


 Score =   230 bits (586),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 118/121 (98%), Positives = 118/121 (98%), Gaps = 0/121 (0%)
 Frame = +1

Query  232  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  411
            G TLADYNIQKESTL LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  12   GGTLADYNIQKESTLLLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  71

Query  412  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESS  591
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESS
Sbjct  72   PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESS  131

Query  592  D  594
            D
Sbjct  132  D  132


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  57   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  106


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  209  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  258


 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVK KI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  133  TIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  182



>gb|EWZ40370.1| ubiquitin C [Fusarium oxysporum Fo47]
Length=229

 Score =   335 bits (860),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 169/173 (98%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   300 bits (768),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 149/152 (98%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228


 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVK+KI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  22   TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  71


 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVK+KI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  174  TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  223


 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVK+KI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147



>gb|AAB95250.1| ubiquitin [Arabidopsis thaliana]
Length=304

 Score =   338 bits (867),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 171/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQ+ESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQRESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   338 bits (867),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 171/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQ+ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQRESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   304 bits (778),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  250  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI + S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQRESTLHLVL  147



>ref|XP_010938693.1| PREDICTED: polyubiquitin [Elaeis guineensis]
Length=307

 Score =   338 bits (867),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 171/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIF+KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFIKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   338 bits (867),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 171/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIF+KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFIKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   301 bits (772),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 151/152 (99%), Positives = 151/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223


 Score = 58.9 bits (141),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVK KI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  250  TIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299



>gb|KJB14874.1| hypothetical protein B456_002G147600, partial [Gossypium raimondii]
Length=344

 Score =   340 bits (871),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  42   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  101

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  102  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  161

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  162  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  214


 Score =   340 bits (871),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  118  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  177

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  178  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  237

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  238  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  290


 Score =   302 bits (773),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 151/151 (100%), Positives = 151/151 (100%), Gaps = 0/151 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  194  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  253

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  254  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  313

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRG
Sbjct  314  FAGKQLEDGRTLADYNIQKESTLHLVLRLRG  344


 Score =   252 bits (643),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 137/173 (79%), Positives = 137/173 (79%), Gaps = 35/173 (20%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLE                                   DGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLE-----------------------------------DGRTLADYN  25

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  26   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  85

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  86   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  138


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  63   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  112


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  139  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  188


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  215  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  264


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  291  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  340



>gb|KDB11907.1| ubiquitin [Ustilaginoidea virens]
Length=305

 Score =   338 bits (867),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 171/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   338 bits (867),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 171/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   301 bits (772),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVK+KI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVK+KI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223


 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVK+KI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  250  TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299



>emb|CEF99839.1| Ubiquitin conserved site [Ostreococcus tauri]
Length=339

 Score =   339 bits (870),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  35   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  94

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  95   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  154

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  155  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  207


 Score =   339 bits (870),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  111  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  170

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  171  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  230

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  231  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  283


 Score =   304 bits (778),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  187  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  246

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  247  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  306

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  307  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  338


 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  56   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  105


 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  132  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  181


 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  208  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  257


 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  284  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  333



>gb|KJB62487.1| hypothetical protein B456_009G418900 [Gossypium raimondii]
Length=305

 Score =   338 bits (867),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 171/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   337 bits (863),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 170/173 (98%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   304 bits (778),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  250  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299


 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVK+KI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVK+KI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147



>gb|AGZ15412.1| fiber polyubiquitin [Phaseolus vulgaris]
Length=229

 Score =   335 bits (859),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 171/173 (99%), Positives = 171/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ES D
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESFD  173


 Score =   286 bits (731),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 146/153 (95%), Positives = 146/153 (95%), Gaps = 0/153 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES DTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESFDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  534
            FAGKQLEDG TLADYNIQKE TL LVL  RGG 
Sbjct  197  FAGKQLEDGCTLADYNIQKEFTLPLVLCFRGGF  229


 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 33/52 (63%), Gaps = 2/52 (4%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXK--GSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED  TL D NI K    P  L F
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGCTLADYNIQKEFTLPLVLCF  225



>ref|XP_010240636.1| PREDICTED: polyubiquitin isoform X1 [Brachypodium distachyon]
 ref|XP_010240784.1| PREDICTED: polyubiquitin isoform X1 [Brachypodium distachyon]
Length=383

 Score =   341 bits (874),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 172/175 (98%), Positives = 174/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  70   LKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  249
            ++MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  1    MQMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  60

Query  250  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  429
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  61   YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  120

Query  430  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  175


 Score =   340 bits (871),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  79   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  138

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  139  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  198

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  199  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  251


 Score =   340 bits (871),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  155  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  214

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  215  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  274

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  275  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  327


 Score =   304 bits (779),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  231  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  290

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  291  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  350

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  351  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  382


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  24   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  73


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  100  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  149


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  176  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  225


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  252  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  301


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  328  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  377



>ref|XP_007154496.1| hypothetical protein PHAVU_003G1236001g [Phaseolus vulgaris]
 gb|ESW26490.1| hypothetical protein PHAVU_003G1236001g [Phaseolus vulgaris]
Length=305

 Score =   338 bits (867),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 171/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE E+SD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVENSD  173


 Score =   338 bits (867),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 171/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVENSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   303 bits (777),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVE+SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVENSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  534
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  305


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  250  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299



>ref|XP_010227188.1| PREDICTED: polyubiquitin isoform X1 [Brachypodium distachyon]
Length=339

 Score =   339 bits (870),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  35   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  94

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  95   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  154

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  155  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  207


 Score =   339 bits (870),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  111  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  170

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  171  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  230

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  231  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  283


 Score =   304 bits (778),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  187  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  246

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  247  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  306

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  307  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  338


 Score =   196 bits (498),  Expect(2) = 3e-59, Method: Compositional matrix adjust.
 Identities = 99/100 (99%), Positives = 99/100 (99%), Gaps = 0/100 (0%)
 Frame = +1

Query  295  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  474
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  32   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  91

Query  475  DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  92   DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  131


 Score = 60.5 bits (145),  Expect(2) = 3e-59, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  132  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  181


 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  56   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  105


 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  208  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  257


 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  284  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  333



>gb|AIY27743.1| polyubiquitin Ubi10, partial [Betula luminifera]
Length=330

 Score =   339 bits (869),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 170/173 (98%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  75   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  134

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFV+TLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLI
Sbjct  135  IQKESTLHLVLRLRGGMQIFVRTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLI  194

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  195  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  247


 Score =   339 bits (869),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 170/173 (98%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFV+TLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  151  MQIFVRTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  210

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  211  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  270

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  271  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  323


 Score =   311 bits (798),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 162/173 (94%), Positives = 164/173 (95%), Gaps = 2/173 (1%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVK L  KTITLEV+    IDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVK-LYSKTITLEVKLRH-IDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  58

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLV RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  59   IQKESTLHLVFRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  118

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFV+TLTGKTITLE ESSD
Sbjct  119  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVRTLTGKTITLEVESSD  171


 Score =   206 bits (525),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 104/104 (100%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  227  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  286

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  387
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  287  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  330


 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 38/61 (62%), Gaps = 0/61 (0%)
 Frame = +2

Query  560  ARLLPWRVKALTIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLW  739
            ++ +   VK   IDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L 
Sbjct  9    SKTITLEVKLRHIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  68

Query  740  F  742
            F
Sbjct  69   F  69


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  96   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  145


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  248  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  297


 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            T+DNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  172  TVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  221



>ref|XP_002992988.1| hypothetical protein SELMODRAFT_187148 [Selaginella moellendorffii]
 ref|XP_002994514.1| hypothetical protein SELMODRAFT_138728 [Selaginella moellendorffii]
 gb|EFJ04422.1| hypothetical protein SELMODRAFT_138728 [Selaginella moellendorffii]
 gb|EFJ05934.1| hypothetical protein SELMODRAFT_187148 [Selaginella moellendorffii]
Length=229

 Score =   335 bits (859),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 170/173 (98%), Positives = 170/173 (98%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   302 bits (773),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  534
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVK KI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVK KI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVK KI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223



>ref|XP_001755431.1| predicted protein [Physcomitrella patens]
 gb|EDQ79911.1| predicted protein [Physcomitrella patens]
Length=231

 Score =   335 bits (859),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 170/173 (98%), Positives = 170/173 (98%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   297 bits (761),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 149/151 (99%), Positives = 149/151 (99%), Gaps = 0/151 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRG
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRG  227


 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVK KI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVK KI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVK KI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223



>gb|ACJ85658.1| unknown [Medicago truncatula]
Length=228

 Score =   335 bits (859),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 168/173 (97%), Positives = 169/173 (98%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTI LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTIILEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRL+
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLV  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK LTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKALTGKTITLEVESSD  173


 Score =   258 bits (658),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 133/146 (91%), Positives = 135/146 (92%), Gaps = 1/146 (1%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRL+FAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLVFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVK LTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKALTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLV  513
            FAG  L  G  L+   IQKESTLHLV
Sbjct  197  FAGNNLRMG-GLSLIYIQKESTLHLV  221


 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSL  736
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  69


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSL  736
            TIDNVK KI  + G  PD QRL+F GKQLED RTL D NI K S   L
Sbjct  98   TIDNVKTKIQDKEGIPPDQQRLVFAGKQLEDGRTLADYNIQKESTLHL  145



>gb|KIL68862.1| hypothetical protein M378DRAFT_157997 [Amanita muscaria Koide 
BX008]
Length=305

 Score =   338 bits (866),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 171/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   338 bits (866),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 171/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   302 bits (773),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  534
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG+
Sbjct  273  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGL  305


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  71


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  223


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  250  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  299


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147



>ref|XP_001783045.1| predicted protein [Physcomitrella patens]
 gb|EDQ52114.1| predicted protein [Physcomitrella patens]
Length=229

 Score =   335 bits (859),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 170/173 (98%), Positives = 170/173 (98%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   300 bits (767),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVK KI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVK KI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVK KI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223



>ref|XP_008796945.1| PREDICTED: LOW QUALITY PROTEIN: polyubiquitin-like [Phoenix dactylifera]
Length=309

 Score =   338 bits (866),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 171/173 (99%), Positives = 171/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES DTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESXDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   338 bits (866),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 171/173 (99%), Positives = 171/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVES DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESXDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   304 bits (779),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  250  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299



>gb|EGO00904.1| hypothetical protein SERLA73DRAFT_178893 [Serpula lacrymans var. 
lacrymans S7.3]
Length=312

 Score =   338 bits (866),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 170/173 (98%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   338 bits (866),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 170/173 (98%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   290 bits (742),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 144/147 (98%), Positives = 146/147 (99%), Gaps = 0/147 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVL  516
            FAGKQLEDGRTL+DYNIQKESTLHLV 
Sbjct  273  FAGKQLEDGRTLSDYNIQKESTLHLVF  299


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L F
Sbjct  250  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVF  299


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  71


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  147


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  223



>ref|XP_010453358.1| PREDICTED: polyubiquitin-like [Camelina sativa]
Length=305

 Score =   338 bits (866),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 171/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES+DTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESTDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   338 bits (866),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 171/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVES+DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESTDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   303 bits (777),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  534
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  250  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299



>gb|AAO43309.1| putative polyubiquitin [Arabidopsis thaliana]
Length=250

 Score =   335 bits (860),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 170/173 (98%), Positives = 171/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEV+SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  21   MQIFVKTLTGKTITLEVQSSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  80

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLI
Sbjct  81   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEWIPPDQQRLI  140

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  141  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  193


 Score =   296 bits (759),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 149/153 (97%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  97   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEWIPPDQQRLIFAGKQLEDGRTLADYN  156

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ+RLI
Sbjct  157  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQKRLI  216

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  534
            FAGKQLEDGRTLA YNIQKESTLHLVLRLRGG+
Sbjct  217  FAGKQLEDGRTLAVYNIQKESTLHLVLRLRGGI  249


 Score =   229 bits (584),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 115/117 (98%), Positives = 116/117 (99%), Gaps = 0/117 (0%)
 Frame = +1

Query  244  ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  423
            ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEV+SSDTIDNVKAKIQDKEGIPPDQ
Sbjct  1    ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVQSSDTIDNVKAKIQDKEGIPPDQ  60

Query  424  QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  61   QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  117


 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  42   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  91


 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  +    PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  118  TIDNVKAKIQDKEWIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  167


 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD +RLIF GKQLED RTL   NI K S   L  
Sbjct  194  TIDNVKAKIQDKEGIPPDQKRLIFAGKQLEDGRTLAVYNIQKESTLHLVL  243



>ref|XP_003607659.1| Ubiquitin [Medicago truncatula]
Length=259

 Score =   336 bits (861),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 171/185 (92%), Positives = 173/185 (94%), Gaps = 0/185 (0%)
 Frame = +1

Query  40   CDYFRFSILFLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  219
             DY  F     +MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  17   SDYDVFVFQCEQMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  76

Query  220  QLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQD  399
            QLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQD
Sbjct  77   QLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQD  136

Query  400  KEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE  579
            KEGIPPDQQRLIFAGKQLEDGRTL DYNIQKESTLHLVLRLRGGMQIFV TLTGKTITL+
Sbjct  137  KEGIPPDQQRLIFAGKQLEDGRTLGDYNIQKESTLHLVLRLRGGMQIFVNTLTGKTITLD  196

Query  580  GESSD  594
             ESSD
Sbjct  197  VESSD  201


 Score =   255 bits (651),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 128/152 (84%), Positives = 139/152 (91%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL DYN
Sbjct  105  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLGDYN  164

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFV TLTGKTITL+VESSDTI +VK  +++K GIP DQ R++
Sbjct  165  IQKESTLHLVLRLRGGMQIFVNTLTGKTITLDVESSDTIADVKLTLEEKVGIPLDQVRVV  224

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
             AGKQL+D  TLA YNIQKESTLH+VL++ GG
Sbjct  225  IAGKQLKDSYTLAHYNIQKESTLHMVLQVFGG  256


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  126  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLGDYNIQKESTLHLVL  175


 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED R L D NI K S   L  
Sbjct  50   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYNIQKESTLHLVL  99



>gb|EMS24129.1| ubiquitin C [Rhodosporidium toruloides NP11]
Length=238

 Score =   335 bits (859),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 168/172 (98%), Positives = 171/172 (99%), Gaps = 0/172 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESS  591
            FAGKQLEDGRTL+DYN+QKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESS
Sbjct  121  FAGKQLEDGRTLSDYNVQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESS  172


 Score =   293 bits (751),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 149/160 (93%), Positives = 151/160 (94%), Gaps = 8/160 (5%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKT--------ITLEVESSDTIDNVKAKIQDKEGI  411
            +QKESTLHLVLRLRGGMQIFVKTLTGKT        ITLEVESSDTIDNVKAKIQDKEGI
Sbjct  137  VQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSITLEVESSDTIDNVKAKIQDKEGI  196

Query  412  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            PPDQQRLIFAGKQLEDGRTL DYNIQKESTLHLVLRLRGG
Sbjct  197  PPDQQRLIFAGKQLEDGRTLQDYNIQKESTLHLVLRLRGG  236


 Score =   189 bits (479),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 95/97 (98%), Positives = 96/97 (99%), Gaps = 0/97 (0%)
 Frame = +1

Query  304  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  483
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  484  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  97


 Score = 60.8 bits (146),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D N+ K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNVQKESTLHLVL  147


 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  71


 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  182  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLQDYNIQKESTLHLVL  231



>gb|KIK92093.1| hypothetical protein PAXRUDRAFT_830299, partial [Paxillus rubicundulus 
Ve08.2h10]
Length=229

 Score =   335 bits (858),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 170/173 (98%), Positives = 171/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLLDYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   301 bits (770),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228


 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  147


 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  223


 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLLDYNIQKESTLHLVL  71



>gb|AIS40894.1| polyubiquitin [Kalanchoe fedtschenkoi]
Length=470

 Score =   343 bits (881),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 177/184 (96%), Positives = 178/184 (97%), Gaps = 2/184 (1%)
 Frame = +1

Query  49   FRFSI--LFLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQ  222
            FR +I  L  KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQ
Sbjct  3    FRKAINSLLPKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQ  62

Query  223  LEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  402
            LEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK
Sbjct  63   LEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  122

Query  403  EGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEG  582
            EGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE 
Sbjct  123  EGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEV  182

Query  583  ESSD  594
            ESSD
Sbjct  183  ESSD  186


 Score =   340 bits (871),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  90   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  149

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  150  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  209

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  210  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  262


 Score =   340 bits (871),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  166  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  225

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  226  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  285

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  286  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  338


 Score =   340 bits (871),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  242  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  301

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  302  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  361

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  362  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  414


 Score =   304 bits (779),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  318  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  377

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  437

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  438  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  469


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  35   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  84


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  111  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  160


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  187  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  236


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  263  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  312


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  339  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  388


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  415  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  464



>gb|ADO60140.1| ubiquitin [Beauveria bassiana]
Length=215

 Score =   334 bits (857),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 168/173 (97%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   273 bits (697),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 135/139 (97%), Positives = 139/139 (100%), Gaps = 0/139 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQK  492
            FAGKQLEDGRTL+DYNIQK
Sbjct  197  FAGKQLEDGRTLSDYNIQK  215


 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVK+KI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  22   TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  71


 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVK+KI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  98   TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  147


 Score = 58.2 bits (139),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXK  718
            TIDNVK+KI  + G  PD QRLIF GKQLED RTL+D NI K
Sbjct  174  TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK  215



>ref|XP_009108753.1| PREDICTED: polyubiquitin 11-like [Brassica rapa]
Length=229

 Score =   335 bits (858),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 169/173 (98%), Positives = 170/173 (98%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKE+ LHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKETNLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK LTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKNLTGKTITLEVESSD  173


 Score =   299 bits (765),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVK LTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKNLTGKTITLEVESSDTIDNVKAKIQDKEDIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  534
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  229


 Score = 60.5 bits (145),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K +   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKETNLHLVL  71


 Score = 57.8 bits (138),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  +    PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEDIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223



>gb|AAK68824.1| Unknown protein [Arabidopsis thaliana]
Length=229

 Score =   335 bits (858),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 170/173 (98%), Positives = 170/173 (98%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK L GKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKPLPGKTITLEVESSD  173


 Score =   299 bits (766),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVK L GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKPLPGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  534
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  229


 Score = 63.5 bits (153),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 41/66 (62%), Gaps = 1/66 (2%)
 Frame = +2

Query  548  KP*PARLLPWRVKAL-TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGS  724
            KP P + +   V++  TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S
Sbjct  158  KPLPGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  217

Query  725  PPSLWF  742
               L  
Sbjct  218  TLHLVL  223


 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147



>ref|XP_003670049.1| hypothetical protein NDAI_0D04930 [Naumovozyma dairenensis CBS 
421]
 ref|XP_003959063.1| hypothetical protein KAFR_0I01470 [Kazachstania africana CBS 
2517]
 ref|XP_004181533.1| hypothetical protein TBLA_0G00670 [Tetrapisispora blattae CBS 
6284]
 emb|CCD24806.1| hypothetical protein NDAI_0D04930 [Naumovozyma dairenensis CBS 
421]
 emb|CCF59928.1| hypothetical protein KAFR_0I01470 [Kazachstania africana CBS 
2517]
 emb|CCH62014.1| hypothetical protein TBLA_0G00670 [Tetrapisispora blattae CBS 
6284]
Length=229

 Score =   334 bits (857),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 168/173 (97%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   301 bits (772),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 149/153 (97%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  534
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGM
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  229


 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVK+KI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  22   TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  71


 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVK+KI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  98   TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  147


 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVK+KI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  174  TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  223



>ref|XP_011048569.1| PREDICTED: polyubiquitin 3-like [Populus euphratica]
Length=306

 Score =   337 bits (865),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 171/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQK+STLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKDSTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   335 bits (860),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 170/173 (98%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQK+STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKDSTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLE+GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEEGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   301 bits (772),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 151/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLE+GRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEEGRTLADYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKDSTLHLVL  147


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  250  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299


 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLE+ RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEEGRTLADYNIQKESTLHLVL  223



>emb|CCL99875.1| predicted protein [Fibroporia radiculosa]
Length=312

 Score =   337 bits (865),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 170/173 (98%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  8    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  67

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  68   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  127

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  128  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  180


 Score =   337 bits (865),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 170/173 (98%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  84   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  143

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  144  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  203

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  204  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  256


 Score =   303 bits (776),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  160  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  219

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  220  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  279

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  534
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG+
Sbjct  280  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGL  312


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  29   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  78


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  105  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  154


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  181  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  230


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  257  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  306



>dbj|BAL61087.1| polyubiquitin [Dianthus caryophyllus]
Length=229

 Score =   334 bits (857),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 170/173 (98%), Positives = 170/173 (98%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   299 bits (766),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVK KI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVK KI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVK KI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223



>ref|XP_001764949.1| predicted protein [Physcomitrella patens]
 gb|EDQ70165.1| predicted protein [Physcomitrella patens]
Length=318

 Score =   338 bits (866),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 171/173 (99%), Positives = 171/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   336 bits (861),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 170/173 (98%), Positives = 170/173 (98%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   311 bits (796),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 157/166 (95%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTIT  573
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM+I   TL  K IT
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMEIIEDTLASKIIT  318


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 58.9 bits (141),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVK KI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 58.9 bits (141),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVK KI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223


 Score = 58.9 bits (141),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVK KI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  250  TIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299



>ref|XP_007924320.1| hypothetical protein MYCFIDRAFT_60610 [Pseudocercospora fijiensis 
CIRAD86]
 gb|EHN05782.1| Ubi4p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii 
VIN7]
 gb|EME83800.1| hypothetical protein MYCFIDRAFT_60610 [Pseudocercospora fijiensis 
CIRAD86]
 gb|EWH17145.1| Ubi4p [Saccharomyces cerevisiae P283]
Length=229

 Score =   334 bits (857),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 168/173 (97%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   299 bits (766),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 148/152 (97%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228


 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVK+KI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  22   TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  71


 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVK+KI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  98   TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  147


 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVK+KI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  174  TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  223



>emb|CBY16339.1| unnamed protein product [Oikopleura dioica]
Length=188

 Score =   333 bits (853),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 165/173 (95%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVE+SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTI+NVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE E+SD
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASD  173


 Score =   211 bits (538),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 105/111 (95%), Positives = 110/111 (99%), Gaps = 0/111 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVE+SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG  408
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTI+NVKAKIQDKE 
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEA  187


 Score = 60.1 bits (144),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TI+NVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  22   TIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  71


 Score = 60.1 bits (144),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TI+NVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  98   TIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  147



>emb|CEP60563.1| LALA0S01e13784g1_1 [Lachancea lanzarotensis]
Length=229

 Score =   334 bits (857),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 168/173 (97%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   299 bits (766),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 148/153 (97%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  534
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG+
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGI  229


 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVK+KI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  22   TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  71


 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVK+KI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  98   TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  147


 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVK+KI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  174  TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  223



>ref|XP_006381473.1| polyubiquitin family protein [Populus trichocarpa]
 gb|ERP59270.1| polyubiquitin family protein [Populus trichocarpa]
Length=306

 Score =   337 bits (864),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 171/173 (99%), Positives = 171/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGNTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   334 bits (856),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 169/173 (98%), Positives = 170/173 (98%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVE+SDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVENSDTIDNVKVKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGNTITLEVESSD  173


 Score =   301 bits (772),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 151/152 (99%), Positives = 151/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTG TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGNTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  250  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299


 Score = 58.9 bits (141),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVK KI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKVKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71



>emb|CCT70325.1| UBI4-Ubiquitin [Fusarium fujikuroi IMI 58289]
Length=281

 Score =   336 bits (862),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 169/173 (98%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  53   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  112

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  113  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  172

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  173  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  225


 Score =   300 bits (767),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 148/152 (97%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  129  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  188

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  189  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  248

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  249  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  280


 Score =   275 bits (702),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 146/173 (84%), Positives = 148/173 (86%), Gaps = 24/173 (14%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDN                        LEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDN------------------------LEDGRTLSDYN  36

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  37   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  96

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  97   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  149


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVK+KI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  150  TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  199


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVK+KI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  226  TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  275


 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVK+KI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  74   TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  123



>sp|P0CG84.1|UBI4P_NICSY RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor, partial [Nicotiana sylvestris]
 gb|AAA34124.1| pentameric polyubiquitin, partial [Nicotiana sylvestris]
Length=377

 Score =   340 bits (871),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  132

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  133  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  192

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  193  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  245


 Score =   340 bits (871),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  149  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  208

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  209  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  268

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  269  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  321


 Score =   331 bits (848),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 168/169 (99%), Positives = 168/169 (99%), Gaps = 0/169 (0%)
 Frame = +1

Query  88   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  267
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  1    VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  60

Query  268  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  447
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  61   STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  120

Query  448  QLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            QLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  QLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  169


 Score =   304 bits (779),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  225  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  284

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  285  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  344

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  534
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  345  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  377


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  18   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  67


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  94   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  143


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  170  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  219


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  246  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  295


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  322  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  371



>gb|KII93501.1| hypothetical protein PLICRDRAFT_694663 [Plicaturopsis crispa 
FD-325 SS-3]
Length=348

 Score =   338 bits (868),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 171/185 (92%), Positives = 177/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  40   CDYFRFSILFLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  219
             + F+ ++    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  32   TNPFKPTLHTPSMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  91

Query  220  QLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQD  399
            QLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQD
Sbjct  92   QLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQD  151

Query  400  KEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE  579
            KEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE
Sbjct  152  KEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE  211

Query  580  GESSD  594
             ESSD
Sbjct  212  VESSD  216


 Score =   338 bits (866),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 170/173 (98%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  120  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  179

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  180  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  239

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  240  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  292


 Score =   302 bits (774),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  196  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  255

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  315

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  316  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  347


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  65   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  114


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  141  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  190


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  217  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  266


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  293  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  342



>ref|XP_001931824.1| ubiquitin [Pyrenophora tritici-repentis Pt-1C-BFP]
 ref|XP_003305664.1| hypothetical protein PTT_18575 [Pyrenophora teres f. teres 0-1]
 ref|XP_003854274.1| hypothetical protein MYCGRDRAFT_57170 [Zymoseptoria tritici IPO323]
 ref|XP_007275950.1| ubiquitin [Colletotrichum gloeosporioides Nara gc5]
 ref|XP_007376605.1| polyubiquitin [Spathaspora passalidarum NRRL Y-27907]
 ref|XP_007674454.1| hypothetical protein BAUCODRAFT_32336 [Baudoinia compniacensis 
UAMH 10762]
 ref|XP_007741026.1| ubiquitin C [Cladophialophora psammophila CBS 110553]
 ref|XP_009261437.1| hypothetical protein FPSE_10045 [Fusarium pseudograminearum CS3096]
 ref|XP_009650785.1| ubiquitin [Verticillium dahliae VdLs.17]
 ref|XP_011319955.1| ubiquitin [Fusarium graminearum PH-1]
 gb|EDU40929.1| ubiquitin [Pyrenophora tritici-repentis Pt-1C-BFP]
 gb|EFQ86204.1| hypothetical protein PTT_18575 [Pyrenophora teres f. teres 0-1]
 gb|EGP89250.1| hypothetical protein MYCGRDRAFT_57170 [Zymoseptoria tritici IPO323]
 gb|EGW31827.1| polyubiquitin [Spathaspora passalidarum NRRL Y-27907]
 gb|EGY14431.1| ubiquitin [Verticillium dahliae VdLs.17]
 gb|EHK44351.1| hypothetical protein TRIATDRAFT_300588 [Trichoderma atroviride 
IMI 206040]
 gb|EJT46666.1| hypothetical protein A1Q1_04737 [Trichosporon asahii var. asahii 
CBS 2479]
 gb|EKJ69797.1| hypothetical protein FPSE_10045 [Fusarium pseudograminearum CS3096]
 gb|ELA35078.1| ubiquitin [Colletotrichum gloeosporioides Nara gc5]
 gb|EMC98317.1| hypothetical protein BAUCODRAFT_32336 [Baudoinia compniacensis 
UAMH 10762]
 gb|EME45125.1| hypothetical protein DOTSEDRAFT_70987 [Dothistroma septosporum 
NZE10]
 gb|ENH81500.1| ubiquitin [Colletotrichum orbiculare MAFF 240422]
 gb|ESU14530.1| ubiquitin [Fusarium graminearum PH-1]
 emb|CDK27817.1| unnamed protein product [Kuraishia capsulata CBS 1993]
 gb|EXJ73926.1| ubiquitin C [Cladophialophora psammophila CBS 110553]
 gb|EYB28525.1| hypothetical protein FG05_08768 [Fusarium graminearum]
 gb|KEQ58801.1| ubiquitin [Aureobasidium melanogenum CBS 110374]
 gb|KEQ70291.1| ubiquitin [Aureobasidium pullulans var. namibiae CBS 147.97]
 gb|KEQ87814.1| ubiquitin [Aureobasidium pullulans EXF-150]
 gb|KER00813.1| hypothetical protein AUEXF2481DRAFT_25097 [Aureobasidium subglaciale 
EXF-2481]
 emb|CEF77191.1| unnamed protein product [Fusarium graminearum]
 gb|KIV95571.1| polyubiquitin [Exophiala mesophila]
 gb|KIW22916.1| polyubiquitin [Cladophialophora immunda]
 gb|KIW83318.1| polyubiquitin [Fonsecaea pedrosoi CBS 271.37]
 gb|KIW87781.1| polyubiquitin [Cladophialophora bantiana CBS 173.52]
 gb|KIX98997.1| polyubiquitin [Fonsecaea multimorphosa CBS 102226]
Length=229

 Score =   334 bits (857),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 168/173 (97%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   299 bits (765),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 148/152 (97%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228


 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVK+KI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  22   TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  71


 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVK+KI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  98   TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  147


 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVK+KI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  174  TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  223



>gb|ADD52202.1| ubiquitin [Catharanthus roseus]
 gb|AEK98798.1| ubiquitin [Carthamus tinctorius]
Length=381

 Score =   340 bits (871),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 176/191 (92%), Positives = 178/191 (93%), Gaps = 6/191 (3%)
 Frame = +1

Query  40   CDYFRFSILFL------KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  201
            C+  + S L L       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  CNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  202  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  381
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  254

Query  382  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  561
            KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  255  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  314

Query  562  KTITLEGESSD  594
            KTITLE ESSD
Sbjct  315  KTITLEVESSD  325


 Score =   333 bits (855),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 170/173 (98%), Positives = 170/173 (98%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDT DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD N
Sbjct  77   MQIFVKTLTGKTITLEVESSDTTDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADCN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   332 bits (850),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 169/173 (98%), Positives = 169/173 (98%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAK QDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKTQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT DNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTTDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLAD NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADCNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   301 bits (772),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  534
             AGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  349  LAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  250  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAK   + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKTQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            T DNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TTDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADCNIQKESTLHLVL  147


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLI  GKQLED RTL D NI K S   L  
Sbjct  326  TIDNVKAKIQDKEGIPPDQQRLILAGKQLEDGRTLADYNIQKESTLHLVL  375



>gb|KIY45417.1| ubiquitin [Fistulina hepatica ATCC 64428]
Length=305

 Score =   337 bits (864),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 170/173 (98%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   337 bits (864),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 170/173 (98%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   301 bits (772),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  304


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  71


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  147


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  223


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  250  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  299



>ref|XP_001828882.1| ubiquitin C [Coprinopsis cinerea okayama7#130]
 ref|XP_001873268.1| ubiquitin [Laccaria bicolor S238N-H82]
 ref|XP_003037536.1| hypothetical protein SCHCODRAFT_64979 [Schizophyllum commune 
H4-8]
 ref|XP_006454479.1| ubiquitin [Agaricus bisporus var. bisporus H97]
 ref|XP_007316692.1| hypothetical protein SERLADRAFT_385284 [Serpula lacrymans var. 
lacrymans S7.9]
 ref|XP_007325267.1| hypothetical protein AGABI1DRAFT_81473 [Agaricus bisporus var. 
burnettii JB137-S8]
 ref|XP_007378433.1| ubiquitin [Punctularia strigosozonata HHB-11173 SS5]
 ref|XP_007842308.1| polyubiquitin [Moniliophthora roreri MCA 2997]
 ref|XP_007879465.1| hypothetical protein PFL1_06871 [Pseudozyma flocculosa PF-1]
 gb|EAU92889.1| ubiquitin C [Coprinopsis cinerea okayama7#130]
 gb|EDR15060.1| ubiquitin [Laccaria bicolor S238N-H82]
 gb|EFJ02634.1| hypothetical protein SCHCODRAFT_64979 [Schizophyllum commune 
H4-8]
 gb|EGO26519.1| hypothetical protein SERLADRAFT_385284 [Serpula lacrymans var. 
lacrymans S7.9]
 gb|EIN13516.1| ubiquitin [Punctularia strigosozonata HHB-11173 SS5]
 gb|EKM83733.1| hypothetical protein AGABI1DRAFT_81473 [Agaricus bisporus var. 
burnettii JB137-S8]
 gb|EKV51498.1| ubiquitin [Agaricus bisporus var. bisporus H97]
 dbj|GAC72194.1| ubiquitin and ubiquitin-like proteins [Pseudozyma antarctica 
T-34]
 dbj|GAC93128.1| ubiquitin [Pseudozyma hubeiensis SY62]
 gb|EPQ28867.1| hypothetical protein PFL1_06871 [Pseudozyma flocculosa PF-1]
 gb|ESK98373.1| polyubiquitin [Moniliophthora roreri MCA 2997]
 gb|AHA61591.1| ubiquitin [Volvariella volvacea]
 gb|KIK04252.1| hypothetical protein K443DRAFT_4723 [Laccaria amethystina LaAM-08-1]
 gb|KIO31281.1| hypothetical protein M407DRAFT_241831 [Tulasnella calospora MUT 
4182]
Length=305

 Score =   337 bits (864),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 170/173 (98%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   337 bits (864),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 170/173 (98%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   301 bits (772),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  304


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  71


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  147


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  223


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  250  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  299



>gb|KJB62485.1| hypothetical protein B456_009G418900 [Gossypium raimondii]
Length=305

 Score =   337 bits (864),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 170/173 (98%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   337 bits (864),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 170/173 (98%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   303 bits (775),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 151/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  250  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299


 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVK+KI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVK+KI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVK+KI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223



>ref|XP_010492041.1| PREDICTED: polyubiquitin-like [Camelina sativa]
Length=305

 Score =   337 bits (864),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 171/173 (99%), Positives = 171/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAG QLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGTQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   337 bits (864),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 171/173 (99%), Positives = 171/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG QLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGTQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   304 bits (778),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  534
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  250  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF G QLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGTQLEDGRTLADYNIQKESTLHLVL  147



>gb|KDQ20365.1| hypothetical protein BOTBODRAFT_123907 [Botryobasidium botryosum 
FD-172 SS1]
Length=305

 Score =   337 bits (864),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 170/173 (98%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   337 bits (864),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 170/173 (98%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   301 bits (772),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  304


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  71


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  147


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  223


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  250  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  299



>ref|XP_001555417.1| polyubiquitin [Botrytis cinerea B05.10]
 ref|XP_001906054.1| hypothetical protein [Podospora anserina S mat+]
 ref|XP_007336907.1| ubiquitin [Auricularia delicata TFB-10046 SS5]
 ref|XP_007390409.1| hypothetical protein PHACADRAFT_247222 [Phanerochaete carnosa 
HHB-10118-sp]
 ref|XP_011121602.1| hypothetical protein AOL_s00078g37 [Arthrobotrys oligospora ATCC 
24927]
 gb|AAC15225.1| polyubiquitin [Botrytis cinerea]
 emb|CAP66720.1| unnamed protein product [Podospora anserina S mat+]
 gb|EGX49548.1| hypothetical protein AOL_s00078g37 [Arthrobotrys oligospora ATCC 
24927]
 emb|CCD51422.1| similar to polyubiquitin protein [Botrytis cinerea T4]
 gb|EJD55630.1| ubiquitin [Auricularia delicata TFB-10046 SS5]
 gb|EKM60970.1| hypothetical protein PHACADRAFT_247222 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EMR84820.1| putative polyubiquitin protein [Botrytis cinerea BcDW1]
 emb|CDP28455.1| Putative Ubiquitin [Podospora anserina S mat+]
 gb|KIP12035.1| hypothetical protein PHLGIDRAFT_17814 [Phlebiopsis gigantea 11061_1 
CR5-6]
Length=305

 Score =   337 bits (864),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 170/173 (98%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   337 bits (864),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 170/173 (98%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   301 bits (772),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  304


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  71


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  147


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  223


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  250  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  299



>ref|XP_008020911.1| hypothetical protein SETTUDRAFT_162442 [Setosphaeria turcica 
Et28A]
 gb|EOA91885.1| hypothetical protein SETTUDRAFT_162442 [Setosphaeria turcica 
Et28A]
Length=305

 Score =   337 bits (864),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 170/173 (98%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   337 bits (864),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 170/173 (98%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   301 bits (772),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVK+KI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVK+KI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVK+KI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223


 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVK+KI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  250  TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299



>ref|XP_010911599.1| PREDICTED: polyubiquitin 4 [Elaeis guineensis]
Length=384

 Score =   340 bits (871),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   340 bits (871),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   340 bits (871),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  325


 Score =   304 bits (779),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  250  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  326  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375



>gb|KIR63773.1| polyubiquitin [Cryptococcus gattii CA1873]
 gb|KIR98208.1| polyubiquitin [Cryptococcus gattii 2001/935-1]
Length=305

 Score =   337 bits (863),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 170/173 (98%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   335 bits (860),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 169/173 (98%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   301 bits (772),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  304


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  147


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  223


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  250  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  299


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVK+KI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  22   TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  71



>ref|XP_002872109.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48368.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=383

 Score =   340 bits (871),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  78   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  137

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  138  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  197

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  250


 Score =   340 bits (871),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  154  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  213

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  214  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  273

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  274  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  326


 Score =   335 bits (859),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 171/173 (99%), Positives = 171/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP DQQRLIFAGKQLEDGRTLADYN
Sbjct  2    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPLDQQRLIFAGKQLEDGRTLADYN  61

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  62   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  121

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  122  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  174


 Score =   303 bits (777),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 151/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  230  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  289

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG+PPDQQRLI
Sbjct  290  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGVPPDQQRLI  349

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  350  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  381


 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  327  TIDNVKAKIQDKEGVPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  376


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  99   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  148


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  175  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  224


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  251  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  300


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G   D QRLIF GKQLED RTL D NI K S   L  
Sbjct  23   TIDNVKAKIQDKEGIPLDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  72



>ref|XP_719867.1| hypothetical protein CaO19.6771 [Candida albicans SC5314]
 ref|XP_719750.1| hypothetical protein CaO19.14063 [Candida albicans SC5314]
 emb|CAA76783.1| polyubiquitin [Candida albicans]
 gb|EAL00878.1| hypothetical protein CaO19.14063 [Candida albicans SC5314]
 gb|EAL01003.1| hypothetical protein CaO19.6771 [Candida albicans SC5314]
 gb|EEQ44747.1| hypothetical protein CAWG_03035 [Candida albicans WO-1]
 emb|CCE42351.1| hypothetical protein CPAR2_809000 [Candida parapsilosis]
 gb|EMG49099.1| hypothetical protein G210_0209 [Candida maltosa Xu316]
 gb|KHC79264.1| polyubiquitin [Candida albicans SC5314]
Length=229

 Score =   334 bits (856),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 168/173 (97%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   299 bits (765),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 148/153 (97%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  534
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGF  229


 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVK+KI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  22   TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  71


 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVK+KI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  98   TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  147


 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVK+KI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  174  TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  223



>dbj|GAK65396.1| ubiquitin [Pseudozyma antarctica]
Length=334

 Score =   338 bits (866),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 173/185 (94%), Positives = 176/185 (95%), Gaps = 1/185 (1%)
 Frame = +1

Query  40   CDYFRFSILFLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  219
            C    F +L   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  19   CSSALFPLL-QAMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  77

Query  220  QLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQD  399
            QLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQD
Sbjct  78   QLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQD  137

Query  400  KEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE  579
            KEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE
Sbjct  138  KEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE  197

Query  580  GESSD  594
             ESSD
Sbjct  198  VESSD  202


 Score =   337 bits (863),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 170/173 (98%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  106  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  165

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  166  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  225

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  226  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  278


 Score =   301 bits (771),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  182  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  241

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  242  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  301

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  302  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  333


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  51   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  100


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  127  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  176


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  203  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  252


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  279  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  328



>gb|AAQ07453.1| ubiquitin [Musa acuminata AAA Group]
Length=381

 Score =   339 bits (870),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   338 bits (866),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 171/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL+ ESSD
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLKVESSD  249


 Score =   338 bits (866),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 171/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITL+VESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLKVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  325


 Score =   302 bits (774),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 151/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITL+VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLKVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  250  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  326  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375



>ref|XP_002508175.1| ubiquitin [Micromonas sp. RCC299]
 ref|XP_003061956.1| ubiquitin [Micromonas pusilla CCMP1545]
 gb|EEH53668.1| ubiquitin [Micromonas pusilla CCMP1545]
 gb|ACO69433.1| ubiquitin [Micromonas sp. RCC299]
 gb|KEH20642.1| polyubiquitin 3 [Medicago truncatula]
Length=381

 Score =   339 bits (870),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   339 bits (870),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   339 bits (870),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  325


 Score =   304 bits (778),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  250  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  326  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375



>gb|KIY53974.1| polyubiquitin [Fistulina hepatica ATCC 64428]
Length=305

 Score =   337 bits (863),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 170/173 (98%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   337 bits (863),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 170/173 (98%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   300 bits (768),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 149/153 (97%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  534
            FAGKQLEDGRTL+DY+IQKESTLHLVLRLRGG+
Sbjct  273  FAGKQLEDGRTLSDYSIQKESTLHLVLRLRGGL  305


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  71


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  147


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  223


 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D +I K S   L  
Sbjct  250  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYSIQKESTLHLVL  299



>ref|XP_009358096.1| PREDICTED: polyubiquitin isoform X1 [Pyrus x bretschneideri]
 ref|XP_009343084.1| PREDICTED: polyubiquitin isoform X1 [Pyrus x bretschneideri]
Length=401

 Score =   340 bits (872),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  21   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  80

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  81   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  140

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  141  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  193


 Score =   340 bits (872),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  97   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  156

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  157  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  216

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  217  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  269


 Score =   340 bits (872),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  173  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  232

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  233  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  292

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  293  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  345


 Score =   305 bits (780),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  249  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  308

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  309  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  368

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  534
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  369  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  401


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  42   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  91


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  118  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  167


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  194  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  243


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  270  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  319


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  346  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  395



>gb|EPX74297.1| ubiquitin [Schizosaccharomyces octosporus yFS286]
Length=230

 Score =   334 bits (856),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 168/173 (97%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   298 bits (764),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 148/152 (97%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228


 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVK+KI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  22   TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  71


 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVK+KI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  98   TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  147


 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVK+KI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  174  TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  223



>gb|KIM67150.1| hypothetical protein SCLCIDRAFT_1210637 [Scleroderma citrinum 
Foug A]
Length=305

 Score =   337 bits (863),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 170/173 (98%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   333 bits (854),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 169/173 (98%), Positives = 171/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQ KEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQVKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   301 bits (771),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  304


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  147


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  223


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  250  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  299


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  22   TIDNVKAKIQVKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  71



>gb|AGV54228.1| polyubiquitin-like protein [Phaseolus vulgaris]
Length=381

 Score =   339 bits (870),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  325


 Score =   334 bits (856),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 170/173 (98%), Positives = 170/173 (98%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLV  LRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVSWLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   334 bits (856),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 170/173 (98%), Positives = 170/173 (98%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLV  LRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVSWLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   305 bits (781),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  534
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  381


 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223


 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  250  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299


 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  326  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSL  736
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145



>ref|NP_001174480.1| Os05g0504766 [Oryza sativa Japonica Group]
 ref|XP_002438904.1| hypothetical protein SORBIDRAFT_10g028020 [Sorghum bicolor]
 ref|XP_006656385.1| PREDICTED: polyubiquitin-like [Oryza brachyantha]
 ref|XP_007027294.1| Ubiquitin 4 [Theobroma cacao]
 ref|XP_010240640.1| PREDICTED: polyubiquitin isoform X2 [Brachypodium distachyon]
 ref|XP_010240789.1| PREDICTED: polyubiquitin isoform X2 [Brachypodium distachyon]
 gb|AAD30173.1|AF148448_1 polyubiquitin [Sporobolus stapfianus]
 gb|AAW56906.1| polyubiquitin [Oryza sativa Japonica Group]
 gb|EAY98614.1| hypothetical protein OsI_20535 [Oryza sativa Indica Group]
 gb|EEE64284.1| hypothetical protein OsJ_19121 [Oryza sativa Japonica Group]
 gb|EER90271.1| hypothetical protein SORBIDRAFT_10g028020 [Sorghum bicolor]
 dbj|BAH93208.1| Os05g0504766 [Oryza sativa Japonica Group]
 dbj|BAJ91806.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK04112.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|AFH53939.1| polyubiquitin 4 [Brachypodium distachyon]
 gb|AFH53940.1| polyubiquitin 10 [Brachypodium distachyon]
 gb|EOY07796.1| Ubiquitin 4 [Theobroma cacao]
 gb|AGT16803.1| polyubiquitin [Saccharum hybrid cultivar R570]
Length=381

 Score =   339 bits (870),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   339 bits (870),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   339 bits (870),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  325


 Score =   304 bits (778),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  250  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  326  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375



>ref|XP_007339454.1| ubiquitin [Auricularia delicata TFB-10046 SS5]
 gb|EJD52725.1| ubiquitin [Auricularia delicata TFB-10046 SS5]
 gb|KIM81538.1| hypothetical protein PILCRDRAFT_821319 [Piloderma croceum F 1598]
Length=305

 Score =   337 bits (863),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 170/173 (98%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   337 bits (863),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 170/173 (98%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   301 bits (771),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  534
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  273  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGF  305


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  71


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  147


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  223


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  250  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  299



>ref|XP_010454368.1| PREDICTED: polyubiquitin 4-like [Camelina sativa]
Length=382

 Score =   339 bits (870),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  325


 Score =   339 bits (869),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 171/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   339 bits (869),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 171/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   304 bits (778),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  250  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  326  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            T+DNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147



>ref|XP_002874006.1| hypothetical protein ARALYDRAFT_488966 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50265.1| hypothetical protein ARALYDRAFT_488966 [Arabidopsis lyrata subsp. 
lyrata]
Length=382

 Score =   339 bits (870),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   339 bits (870),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  325


 Score =   339 bits (869),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 171/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQ+FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQVFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   304 bits (778),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  250  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  326  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375



>gb|AAL09741.1| AT4g05320/C17L7_240 [Arabidopsis thaliana]
Length=381

 Score =   339 bits (870),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  325


 Score =   337 bits (863),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 171/173 (99%), Positives = 171/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVL LRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLSLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   337 bits (863),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 171/173 (99%), Positives = 171/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVL LRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLSLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   304 bits (778),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  534
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  250  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  326  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375



>gb|ABU40645.1| polyubiquitin [Triticum aestivum]
Length=380

 Score =   339 bits (870),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   339 bits (870),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   339 bits (870),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  325


 Score =   304 bits (778),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  250  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  326  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375



>gb|KIR29996.1| polyubiquitin [Cryptococcus gattii LA55]
 gb|KIR37417.1| polyubiquitin [Cryptococcus gattii MMRL2647]
 gb|KIR43885.1| polyubiquitin [Cryptococcus gattii Ram5]
 gb|KIR92886.1| polyubiquitin [Cryptococcus gattii CBS 10090]
 gb|KIY60273.1| polyubiquitin [Cryptococcus gattii 99/473]
Length=315

 Score =   337 bits (864),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 170/173 (98%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   335 bits (860),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 169/173 (98%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   315 bits (807),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 157/159 (99%), Positives = 159/159 (100%), Gaps = 0/159 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKT  552
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKT
Sbjct  273  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKT  311


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  147


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  223


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  250  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  299


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVK+KI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  22   TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  71



>ref|XP_006396612.1| hypothetical protein EUTSA_v10028730mg [Eutrema salsugineum]
 ref|XP_010537979.1| PREDICTED: polyubiquitin [Tarenaya hassleriana]
 emb|CAJ86369.1| OSIGBa0117N13.13 [Oryza sativa Indica Group]
 emb|CAJ86419.1| H0303G06.8 [Oryza sativa Indica Group]
 gb|EAY95663.1| hypothetical protein OsI_17529 [Oryza sativa Indica Group]
 gb|ESQ38065.1| hypothetical protein EUTSA_v10028730mg [Eutrema salsugineum]
Length=381

 Score =   339 bits (870),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   339 bits (870),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   339 bits (870),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  325


 Score =   305 bits (780),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  534
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  381


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  250  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  326  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375



>ref|NP_568397.1| ubiquitin 4 [Arabidopsis thaliana]
 ref|XP_002881273.1| hypothetical protein ARALYDRAFT_482268 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_010420904.1| PREDICTED: polyubiquitin 4 [Camelina sativa]
 ref|XP_010493166.1| PREDICTED: polyubiquitin 4 [Camelina sativa]
 sp|P0CH32.1|UBQ4_ARATH RecName: Full=Polyubiquitin 4; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Arabidopsis thaliana]
 emb|CAA31331.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAB53929.1| polyubiquitin [Arabidopsis thaliana]
 gb|EFH57532.1| hypothetical protein ARALYDRAFT_482268 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AED92867.1| ubiquitin 4 [Arabidopsis thaliana]
 prf||1515347A poly-ubiquitin
Length=382

 Score =   339 bits (870),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   339 bits (870),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   339 bits (870),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  325


 Score =   304 bits (778),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  250  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  326  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375



>gb|AAY86773.1| polyubiquitin [Noccaea caerulescens]
Length=382

 Score =   339 bits (870),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   339 bits (870),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   339 bits (870),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  325


 Score =   304 bits (778),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  250  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  326  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375



>ref|NP_001105376.1| polyubiquitin [Zea mays]
 gb|AAC49025.1| polyubiquitin [Zea mays]
Length=381

 Score =   339 bits (870),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   339 bits (870),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   338 bits (867),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 171/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLV+RLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVVRLRGGMQIFVKTLTGKTITLEVESSD  325


 Score =   303 bits (775),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 151/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLV+RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVVRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  326  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375


 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSL  736
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L
Sbjct  250  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  297



>ref|XP_010240921.1| PREDICTED: polyubiquitin-like [Nelumbo nucifera]
Length=381

 Score =   339 bits (870),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   339 bits (870),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  325


 Score =   338 bits (868),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 171/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            +QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   VQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   304 bits (778),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  534
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  250  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  326  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D N+ K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNVQKESTLHLVL  71



>ref|XP_006593989.1| PREDICTED: polyubiquitin 10-like isoform X1 [Glycine max]
Length=381

 Score =   339 bits (870),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   339 bits (870),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   338 bits (868),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 171/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT+TLE ESSD
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTVTLEVESSD  325


 Score =   303 bits (777),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKT+TLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  534
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  250  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  326  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375



>emb|CBY46746.1| polyubiquitin 10 protein, partial [Lepidium campestre]
Length=381

 Score =   339 bits (870),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   339 bits (870),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  325


 Score =   338 bits (868),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 171/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   304 bits (778),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  534
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  250  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  326  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            T+DNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71



>gb|AAB95252.1| ubiquitin [Arabidopsis thaliana]
Length=380

 Score =   339 bits (870),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  325


 Score =   337 bits (863),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 171/173 (99%), Positives = 171/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ LI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQWLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   337 bits (863),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 171/173 (99%), Positives = 171/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQWLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   302 bits (773),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 151/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTLADY+IQKESTLHLVLRLRGG
Sbjct  349  FAGKQLEDGRTLADYDIQKESTLHLVLRLRGG  380


 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223


 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  250  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299


 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D +I K S   L  
Sbjct  326  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYDIQKESTLHLVL  375


 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD Q LIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQWLIFAGKQLEDGRTLADYNIQKESTLHLVL  147



>ref|XP_003030030.1| polyubiquitin [Schizophyllum commune H4-8]
 ref|XP_006678580.1| polyubiquitin [Batrachochytrium dendrobatidis JAM81]
 ref|XP_007396817.1| hypothetical protein PHACADRAFT_257732 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|AAB94630.1| polyubiquitin [Schizophyllum commune]
 gb|EFI95127.1| polyubiquitin [Schizophyllum commune H4-8]
 gb|EGF80702.1| polyubiquitin [Batrachochytrium dendrobatidis JAM81]
 gb|EKM54116.1| hypothetical protein PHACADRAFT_257732 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EPT04446.1| hypothetical protein FOMPIDRAFT_1021745 [Fomitopsis pinicola 
FP-58527 SS1]
 gb|KDQ24213.1| hypothetical protein PLEOSDRAFT_1058300 [Pleurotus ostreatus 
PC15]
 gb|KDQ28506.1| hypothetical protein PLEOSDRAFT_1089714 [Pleurotus ostreatus 
PC15]
 gb|KDQ53556.1| hypothetical protein JAAARDRAFT_72512 [Jaapia argillacea MUCL 
33604]
 gb|KIK09182.1| hypothetical protein K443DRAFT_671672 [Laccaria amethystina LaAM-08-1]
 gb|KIK44225.1| hypothetical protein CY34DRAFT_648259 [Suillus luteus UH-Slu-Lm8-n1]
 gb|KIM51102.1| hypothetical protein SCLCIDRAFT_144015 [Scleroderma citrinum 
Foug A]
 gb|KIN98337.1| hypothetical protein M404DRAFT_856969 [Pisolithus tinctorius 
Marx 270]
 gb|KIN98894.1| hypothetical protein M404DRAFT_966612 [Pisolithus tinctorius 
Marx 270]
Length=305

 Score =   337 bits (863),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 170/173 (98%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   337 bits (863),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 170/173 (98%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   302 bits (773),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  534
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG+
Sbjct  273  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGL  305


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  71


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  147


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  223


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  250  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  299



>ref|XP_007366816.1| polyubiquitin [Dichomitus squalens LYAD-421 SS1]
 gb|EJF60398.1| polyubiquitin [Dichomitus squalens LYAD-421 SS1]
Length=305

 Score =   337 bits (863),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 170/173 (98%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   335 bits (858),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 169/173 (98%), Positives = 171/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR L+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRPLSDYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   302 bits (773),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  534
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG+
Sbjct  273  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGL  305


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  147


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  223


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  250  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  299


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED R L+D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRPLSDYNIQKESTLHLVL  71



>gb|KJB81825.1| hypothetical protein B456_013G163500 [Gossypium raimondii]
 gb|KJB81826.1| hypothetical protein B456_013G163500 [Gossypium raimondii]
Length=381

 Score =   339 bits (870),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   339 bits (870),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  325


 Score =   337 bits (865),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 171/173 (99%), Positives = 171/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   304 bits (778),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  534
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  250  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  326  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375


 Score = 58.9 bits (141),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVK KI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71



>ref|XP_009763135.1| PREDICTED: polyubiquitin-like [Nicotiana sylvestris]
Length=381

 Score =   339 bits (870),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  325


 Score =   338 bits (867),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 171/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVES+DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESTDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   337 bits (863),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 170/173 (98%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES+DTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESTDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   304 bits (778),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  534
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  250  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  326  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375


 Score = 59.3 bits (142),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVK+KI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71



>ref|XP_001598085.1| polyubiquitin [Sclerotinia sclerotiorum 1980]
 gb|EDN90771.1| polyubiquitin [Sclerotinia sclerotiorum 1980 UF-70]
Length=305

 Score =   337 bits (863),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 170/173 (98%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   337 bits (863),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 170/173 (98%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   300 bits (768),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 151/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTL DYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLLDYNIQKESTLHLVLRLRGG  304


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  71


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  147


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  223


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  250  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLLDYNIQKESTLHLVL  299



>ref|XP_006428816.1| hypothetical protein CICLE_v10011684mg [Citrus clementina]
 gb|ESR42056.1| hypothetical protein CICLE_v10011684mg [Citrus clementina]
Length=382

 Score =   339 bits (870),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   339 bits (870),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   339 bits (870),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  325


 Score =   304 bits (778),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  250  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  326  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375



>gb|AAB68045.1| polyubiquitin [Fragaria x ananassa]
Length=381

 Score =   339 bits (870),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  325


 Score =   337 bits (864),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 171/173 (99%), Positives = 171/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   337 bits (864),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 171/173 (99%), Positives = 171/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   304 bits (778),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  534
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  250  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  326  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKIX + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIXDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147



>ref|XP_010324327.1| PREDICTED: polyubiquitin isoform X2 [Solanum lycopersicum]
Length=381

 Score =   339 bits (870),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   335 bits (860),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 171/173 (99%), Positives = 171/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP DQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPSDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   335 bits (860),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 171/173 (99%), Positives = 171/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP DQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPSDQQRLIFAGKQLEDGRTLADYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  325


 Score =   304 bits (778),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  534
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  250  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  326  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G   D QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPSDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223



>ref|XP_009596689.1| PREDICTED: polyubiquitin-like [Nicotiana tomentosiformis]
Length=382

 Score =   339 bits (870),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   339 bits (870),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   339 bits (870),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  325


 Score =   304 bits (778),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  250  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  326  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375



>gb|EYU33608.1| hypothetical protein MIMGU_mgv1a004315mg [Erythranthe guttata]
Length=381

 Score =   339 bits (870),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   339 bits (870),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   339 bits (870),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  325


 Score =   304 bits (779),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  534
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGV  381


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  250  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  326  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375



>gb|ACS68205.1| ubiquitin 10.2 [Brassica napus]
Length=381

 Score =   339 bits (870),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   339 bits (870),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   339 bits (870),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  325


 Score =   304 bits (779),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  534
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGI  381


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  250  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  326  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375



>ref|XP_010558157.1| PREDICTED: polyubiquitin-like [Tarenaya hassleriana]
Length=382

 Score =   339 bits (870),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   339 bits (870),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   339 bits (870),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  325


 Score =   304 bits (778),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  250  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  326  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375



>emb|CDP05795.1| unnamed protein product [Coffea canephora]
Length=381

 Score =   339 bits (870),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  325


 Score =   337 bits (865),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 171/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQ+KEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQEKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   337 bits (865),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 171/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQ+KEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQEKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   304 bits (778),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  534
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  250  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  326  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQEKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147



>gb|KIJ45725.1| hypothetical protein M422DRAFT_106821, partial [Sphaerobolus 
stellatus SS14]
Length=305

 Score =   337 bits (863),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 170/173 (98%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   337 bits (863),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 170/173 (98%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   303 bits (777),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  534
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGM
Sbjct  273  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  305


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  71


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  147


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  223


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  250  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  299



>ref|XP_002953480.1| polyubiquitin [Volvox carteri f. nagariensis]
 gb|EFJ45453.1| polyubiquitin [Volvox carteri f. nagariensis]
Length=305

 Score =   337 bits (863),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 170/173 (98%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   337 bits (863),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 170/173 (98%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   302 bits (773),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  534
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  305


 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TI+NVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TI+NVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TI+NVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223


 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TI+NVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  250  TIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299



>ref|NP_849300.4| polyubiquitin 10 [Arabidopsis thaliana]
 ref|NP_567291.4| polyubiquitin 10 [Arabidopsis thaliana]
 ref|NP_001078353.4| polyubiquitin 10 [Arabidopsis thaliana]
 ref|XP_004134747.1| PREDICTED: polyubiquitin-like isoform 1 [Cucumis sativus]
 ref|XP_004134748.1| PREDICTED: polyubiquitin-like isoform 2 [Cucumis sativus]
 ref|XP_004496773.1| PREDICTED: polyubiquitin-like [Cicer arietinum]
 ref|XP_006360087.1| PREDICTED: polyubiquitin-like isoform X2 [Solanum tuberosum]
 ref|XP_006287939.1| hypothetical protein CARUB_v10001174mg [Capsella rubella]
 ref|XP_006370633.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 ref|XP_006370635.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 ref|XP_006370637.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 ref|XP_006380307.1| hypothetical protein POPTR_0007s02460g [Populus trichocarpa]
 ref|XP_006377834.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 ref|XP_006377835.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 ref|XP_006372946.1| UBIQUITIN 11 family protein [Populus trichocarpa]
 ref|XP_006396616.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 ref|XP_006396617.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 ref|XP_006452184.1| hypothetical protein CICLE_v10008642mg [Citrus clementina]
 ref|XP_007021032.1| Polyubiquitin 10 isoform 1 [Theobroma cacao]
 ref|XP_007021033.1| Polyubiquitin 10 isoform 1 [Theobroma cacao]
 ref|XP_007021035.1| Polyubiquitin 10 [Theobroma cacao]
 ref|XP_007025987.1| Polyubiquitin 10 [Theobroma cacao]
 ref|XP_007143204.1| hypothetical protein PHAVU_007G052600g [Phaseolus vulgaris]
 ref|XP_007211430.1| hypothetical protein PRUPE_ppa007117mg [Prunus persica]
 ref|XP_007211607.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_008244360.1| PREDICTED: polyubiquitin isoform X2 [Prunus mume]
 ref|XP_009365167.1| PREDICTED: polyubiquitin [Pyrus x bretschneideri]
 ref|XP_009358097.1| PREDICTED: polyubiquitin isoform X2 [Pyrus x bretschneideri]
 ref|XP_009358098.1| PREDICTED: polyubiquitin isoform X2 [Pyrus x bretschneideri]
 ref|XP_009343085.1| PREDICTED: polyubiquitin isoform X2 [Pyrus x bretschneideri]
 ref|XP_009343086.1| PREDICTED: polyubiquitin isoform X2 [Pyrus x bretschneideri]
 ref|XP_009611794.1| PREDICTED: polyubiquitin [Nicotiana tomentosiformis]
 ref|XP_009792849.1| PREDICTED: polyubiquitin [Nicotiana sylvestris]
 ref|XP_009793738.1| PREDICTED: polyubiquitin [Nicotiana sylvestris]
 ref|XP_010267760.1| PREDICTED: polyubiquitin [Nelumbo nucifera]
 ref|XP_010423137.1| PREDICTED: polyubiquitin [Camelina sativa]
 ref|XP_010447068.1| PREDICTED: polyubiquitin [Camelina sativa]
 ref|XP_010455857.1| PREDICTED: polyubiquitin [Camelina sativa]
 ref|XP_010644407.1| PREDICTED: polyubiquitin [Vitis vinifera]
 ref|XP_011026350.1| PREDICTED: polyubiquitin [Populus euphratica]
 ref|XP_011030849.1| PREDICTED: polyubiquitin [Populus euphratica]
 ref|XP_011048300.1| PREDICTED: polyubiquitin [Populus euphratica]
 ref|XP_011460984.1| PREDICTED: polyubiquitin [Fragaria vesca subsp. vesca]
 ref|XP_011460993.1| PREDICTED: polyubiquitin [Fragaria vesca subsp. vesca]
 sp|P69322.2|UBIQP_PEA RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Pisum sativum]
 emb|CAA34886.1| unnamed protein product [Pisum sativum]
 gb|AAD03344.1| ubiquitin [Pisum sativum]
 gb|AAK96602.1| AT4g05320/C17L7_240 [Arabidopsis thaliana]
 dbj|BAD26592.1| polyubiquitin [Populus nigra]
 gb|ABB73307.1| ubiquitin [Lotus japonicus]
 gb|ABK92512.1| unknown [Populus trichocarpa]
 gb|ABK93264.1| unknown [Populus trichocarpa]
 gb|ABK95903.1| unknown [Populus trichocarpa]
 gb|ABK96012.1| unknown [Populus trichocarpa]
 gb|ABK96127.1| unknown [Populus trichocarpa]
 gb|ACK56276.1| ubiquitin [Populus trichocarpa]
 gb|AEE82501.1| polyubiquitin 10 [Arabidopsis thaliana]
 gb|AEE82504.1| polyubiquitin 10 [Arabidopsis thaliana]
 gb|AEE82505.1| polyubiquitin 10 [Arabidopsis thaliana]
 gb|EMJ12629.1| hypothetical protein PRUPE_ppa007117mg [Prunus persica]
 gb|EMJ12806.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|EOA20837.1| hypothetical protein CARUB_v10001174mg [Capsella rubella]
 gb|EOY12557.1| Polyubiquitin 10 isoform 1 [Theobroma cacao]
 gb|EOY12558.1| Polyubiquitin 10 isoform 1 [Theobroma cacao]
 gb|EOY12560.1| Polyubiquitin 10 [Theobroma cacao]
 gb|EOY28609.1| Polyubiquitin 10 [Theobroma cacao]
 gb|ERP50743.1| UBIQUITIN 11 family protein [Populus trichocarpa]
 gb|ERP55631.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|ERP55632.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|ERP58104.1| hypothetical protein POPTR_0007s02460g [Populus trichocarpa]
 gb|ERP67202.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 gb|ERP67204.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 gb|ERP67206.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 gb|ESQ38069.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 gb|ESQ38070.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 gb|ESR65424.1| hypothetical protein CICLE_v10008642mg [Citrus clementina]
 gb|ESW15198.1| hypothetical protein PHAVU_007G052600g [Phaseolus vulgaris]
 gb|KDO52961.1| hypothetical protein CISIN_1g009518mg [Citrus sinensis]
 gb|KDP20793.1| hypothetical protein JCGZ_21264 [Jatropha curcas]
 gb|AET01628.2| polyubiquitin 3 [Medicago truncatula]
 gb|KEH30745.1| polyubiquitin 3 [Medicago truncatula]
 gb|KJB13593.1| hypothetical protein B456_002G083100 [Gossypium raimondii]
 gb|KJB62633.1| hypothetical protein B456_009G427000 [Gossypium raimondii]
 prf||1603402A poly-ubiquitin
Length=381

 Score =   339 bits (870),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   339 bits (870),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   339 bits (870),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  325


 Score =   304 bits (778),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  534
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  250  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  326  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375



>ref|NP_001148453.1| LOC100282068 [Zea mays]
 ref|XP_002299930.1| UBIQUITIN 11 family protein [Populus trichocarpa]
 ref|XP_003607671.1| Ubiquitin [Medicago truncatula]
 gb|AAC49014.1| ubiquitin [Zea mays]
 gb|ACG31521.1| polyubiquitin containing 7 ubiquitin monomers [Zea mays]
 gb|EEE84735.1| UBIQUITIN 11 family protein [Populus trichocarpa]
 gb|ACR37911.1| unknown [Zea mays]
 gb|AES89868.1| polyubiquitin 3 [Medicago truncatula]
 gb|AFW66440.1| putative ubiquitin family protein isoform 1 [Zea mays]
 gb|AFW66441.1| putative ubiquitin family protein isoform 2 [Zea mays]
Length=381

 Score =   339 bits (870),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   339 bits (870),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   339 bits (870),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  325


 Score =   304 bits (778),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  250  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  326  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375



>gb|AAB36545.1| ubiquitin-like protein [Phaseolus vulgaris]
Length=407

 Score =   340 bits (872),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  103  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  162

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  163  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  222

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  223  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  275


 Score =   340 bits (872),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  179  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  238

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  239  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  298

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  299  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  351


 Score =   304 bits (779),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  255  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  314

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  315  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  374

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  375  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  406


 Score =   248 bits (633),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +1

Query  214  GKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI  393
             KQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI
Sbjct  73   AKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI  132

Query  394  QDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTIT  573
            QDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTIT
Sbjct  133  QDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTIT  192

Query  574  LEGESSD  594
            LE ESSD
Sbjct  193  LEVESSD  199


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  124  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  173


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  200  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  249


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  276  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  325


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  352  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  401



>gb|KEH31155.1| polyubiquitin 3 [Medicago truncatula]
Length=381

 Score =   339 bits (870),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   339 bits (870),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   338 bits (866),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 171/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  273  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  325


 Score =   302 bits (774),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  288

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  534
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL+D NI K S   L  
Sbjct  250  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  299


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  326  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375



>gb|KJB81824.1| hypothetical protein B456_013G163500 [Gossypium raimondii]
Length=393

 Score =   340 bits (871),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   340 bits (871),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  325


 Score =   338 bits (866),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 171/173 (99%), Positives = 171/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   281 bits (720),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 141/143 (99%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  436  FAGKQLEDGRTLADYNIQKESTL  504
            FAGKQLEDGRTLADYNIQKE+ L
Sbjct  349  FAGKQLEDGRTLADYNIQKENPL  371


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLW  739
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K +P   W
Sbjct  326  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKENPLCTW  374


 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223


 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  250  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299


 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVK KI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71



>gb|KJB13592.1| hypothetical protein B456_002G083000 [Gossypium raimondii]
Length=385

 Score =   339 bits (870),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   339 bits (870),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  249


 Score =   339 bits (870),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  325


 Score =   305 bits (780),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 152/155 (98%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  540
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG ++
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGFRM  383


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  250  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  326  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375



>ref|XP_010270791.1| PREDICTED: polyubiquitin-like [Nelumbo nucifera]
Length=382

 Score =   339 bits (869),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   338 bits (868),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 171/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT+TLE ESSD
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTVTLEVESSD  249


 Score =   338 bits (868),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 171/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKT+TLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  325


 Score =   303 bits (777),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKT+TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  534
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGI  381


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  22   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  71


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  98   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  147


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  174  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  223


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  250  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  299


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  593  TIDNVKAKIXGQGGNSPDHQRLIFXGKQLEDXRTLTDXNIXKGSPPSLWF  742
            TIDNVKAKI  + G  PD QRLIF GKQLED RTL D NI K S   L  
Sbjct  326  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  375



>ref|XP_004956019.1| PREDICTED: polyubiquitin 4-like [Setaria italica]
Length=381

 Score =   339 bits (869),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  436  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  594
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  173


 Score =   337 bits (864),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 171/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  76   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  255
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  435
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID+VKAKIQDKEGIPPDQQRLI
Sbjct  1